BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8931
         (938 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY123847_1580056 Nicotiana tabacum glutamate/malate transloca...   339   4e-92   
gb:AB008268_1510458 Arabidopsis thaliana genomic DNA, chromosome...   324   1e-87   
gb:AY123846_1580055 Spinacia oleracea glutamate/malate transloca...   320   3e-86   
gb:AY123845_1580054 Flaveria bidentis glutamate/malate transloca...   318   1e-85   
gb:AP005399_1851159 Oryza sativa (japonica cultivar-group) genom...   317   2e-85   
gb:AP004213_1838859 Oryza sativa (japonica cultivar-group) genom...   314   2e-84   
gb:AB112939_1527215 Zea mays ZmpDCT3 mRNA for plastidic general ...   313   3e-84   
gb:AB112938_1527214 Zea mays ZmpDCT2 mRNA for plastidic general ...   313   3e-84   
gb:AB112937_1527213 Zea mays ZmpDCT1 mRNA for plastidic general ...   311   9e-84   
gb:AY123844_1580053 Sorghum bicolor glutamate/malate translocato...   307   2e-82   
gb:AB008268_1510457 Arabidopsis thaliana genomic DNA, chromosome...   283   3e-75   
gb:AF036172_1762932 Zea mays 2-oxoglutarate/malate translocator ...   271   1e-71   
gb:AB112936_1527212 Zea mays ZmpOMT1 mRNA for plastidic 2-oxoglu...   179   9e-44   
pir|F69811|F69811 2-oxoglutarate/malate translocator homolog yfl...   178   1e-43   Bacillus subtilis
pir|T49900|T49900 2-oxoglutarate/malate translocator-like protei...   177   3e-43   Arabidopsis thaliana [mouse-ear cress]
sp|Q41364|SOT1_SPIOL|SOT1_SPIOL 2-oxoglutarate/malate translocator, chlorop...   176   8e-43   Spinacia oleracea
gb:AF370494_1792279 Arabidopsis thaliana 2-oxoglutarate/malate t...   174   2e-42   
gb:CP000002_856496 Bacillus licheniformis ATCC 14580, complete g...   174   2e-42   
gb:AE017333_446677 Bacillus licheniformis DSM 13, complete genome.    174   2e-42   
pir|B97096|B97096 2-oxoglutarate/malate translocator [imported] ...   168   2e-40   Clostridium acetobutylicum
gb:AE016808_337866 Vibrio vulnificus CMCP6 chromosome II section...   161   2e-38   
gb:BA000038_724698 Vibrio vulnificus YJ016 DNA, chromosome II, c...   159   6e-38   
gb:BA000032_709302 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   159   6e-38   
gb:AY826859_1629165 Heterocapsa triquetra clone HTOXO1 chloropla...   158   2e-37   
gb:AE016996_374664 Chlamydophila caviae GPIC section 3 of 4 of t...   156   6e-37   
pir|H72105|H72105 dicarboxylase translocator - Chlamydophila pne...   154   3e-36   Chlamydia pneumoniae
pir|G86516|G86516 dicarboxylase translocator [imported] - Chlamy...   154   3e-36   Chlamydia pneumoniae
gb:AE008845_244812 Salmonella typhimurium LT2, section 149 of 22...   152   7e-36   
gb:CP000026_77754 Salmonella enterica subsp. enterica serovar Pa...   152   7e-36   
pir|AE0887|AE0887 probable membrane transport protein STY3340 [i...   152   7e-36   Salmonella enterica subsp. enterica serovar Typhi
gb:AE002316_45063 Chlamydia muridarum Nigg section 47 of 85 of t...   152   9e-36   
gb:AE016744_321902 Staphylococcus epidermidis ATCC 12228, sectio...   151   2e-35   
gb:CP000029_82905 Staphylococcus epidermidis RP62A, complete gen...   151   2e-35   
pir|F71543|F71543 probable dicarboxylate translocator - Chlamydi...   150   3e-35   Chlamydia trachomatis
gb:BX571856_782194 Staphylococcus aureus subsp. aureus strain MR...   149   6e-35   
gb:BA000017_678380 Staphylococcus aureus subsp. aureus Mu50 DNA,...   149   6e-35   
pir|F90078|F90078 hypothetical protein SA2486 [imported] - Staph...   149   6e-35   Staphylococcus aureus subsp. aureus N315
gb:BX927154_833578 Corynebacterium glutamicum ATCC 13032, IS fin...   149   8e-35   
gb:BA000036_719772 Corynebacterium glutamicum ATCC 13032 DNA, co...   149   8e-35   
gb:BA000033_712905 Staphylococcus aureus subsp. aureus MW2 DNA, ...   149   8e-35   
gb:CP000046_92783 Staphylococcus aureus subsp. aureus COL, compl...   149   8e-35   
gb:BX950851_843133 Erwinia carotovora subsp. atroseptica SCRI104...   148   1e-34   
gb:AL935255_550965 Lactobacillus plantarum strain WCFS1 complete...   148   2e-34   
gb:AE004969_61152 Neisseria gonorrhoeae FA 1090, complete genome.     147   3e-34   
gb:BX950851_842718 Erwinia carotovora subsp. atroseptica SCRI104...   146   7e-34   
gb:AL935255_550976 Lactobacillus plantarum strain WCFS1 complete...   144   2e-33   
pir|B81831|B81831 probable integral membrane transport protein N...   144   2e-33   Neisseria meningitidis serogroup A
pir|A81194|A81194 C4-dicarboxylate transporter NMB0470 [imported...   144   2e-33   Neisseria meningitidis serogroup B
gb:AE016827_342599 Mannheimia succiniciproducens MBEL55E, comple...   140   4e-32   
gb:BX842651_824770 Bdellovibrio bacteriovorus complete genome, s...   140   5e-32   
gb:AP006840_569825 Symbiobacterium thermophilum DNA, complete ge...   136   5e-31   
gb:BX950851_841580 Erwinia carotovora subsp. atroseptica SCRI104...   124   2e-27   
gb:AL935252_550093 Lactobacillus plantarum strain WCFS1 complete...   115   9e-25   
gb:CP000033_89184 Lactobacillus acidophilus NCFM, complete genome.    111   2e-23   
gb:AE017154_392685 Haemophilus ducreyi strain 35000HP section 4 ...   102   1e-20   
sp|Q57048|YBHI_HAEIN|YBHI_HAEIN Hypothetical protein HI0020.>pir|B64043|B64...   102   1e-20   Haemophilus influenzae
gb:BA000040_732760 Bradyrhizobium japonicum USDA 110 DNA, comple...    97   3e-19   
gb:AE016757_324744 Escherichia coli CFT073 section 3 of 18 of th...    97   6e-19   
gb:AE008724_242341 Salmonella typhimurium LT2, section 32 of 220...    97   6e-19   
gb:AF417305_1797900 Castanea sativa putative oxoglutarate-malate...    96   8e-19   
pir|AI0010|AI0010 probable membrane transport protein YPO0081 [i...    95   2e-18   Yersinia pestis
gb:AE016757_324889 Escherichia coli CFT073 section 3 of 18 of th...    95   2e-18   
gb:AE005674_70473 Shigella flexneri 2a str. 301, complete genome...    95   2e-18   
sp|P75763|YBHI_ECOLI|YBHI_ECOLI Hypothetical protein ybhI.>pir|B64813|B6481...    95   2e-18   Escherichia coli [E. coli]
sp|P77405|CITT_ECOLI|CITT_ECOLI Citrate carrier (Citrate transporter) (Citr...    94   3e-18   Escherichia coli [E. coli]
pir|G85579|G85579 probable membrane pump protein ybhI [imported]...    94   4e-18   Escherichia coli O157:H7
pir|G85560|G85560 probable membrane protein ybdS [imported] - Es...    94   5e-18   Escherichia coli [E. coli]
pir|F71969|F71969 hypothetical protein jhp0131 - Helicobacter py...    93   9e-18   Helicobacter pylori J99
pir|AE0578|AE0578 citrate carrier [imported] - Salmonella enteri...    90   7e-17   Salmonella enterica subsp. enterica serovar Typhi
gb:AE016841_346307 Salmonella enterica subsp. enterica serovar T...    86   1e-15   
pir|B91122|B91122 hypothetical protein ECs3946 [imported] - Esch...    83   9e-15   Escherichia coli O157:H7
sp|P39414|TTDT_ECOLI|TTDT_ECOLI Putative tartrate carrier (Tartrate transpo...    83   9e-15   Escherichia coli [E. coli]
gb:AE005674_72688 Shigella flexneri 2a str. 301, complete genome...    82   2e-14   
gb:AE016767_327797 Escherichia coli CFT073 section 13 of 18 of t...    81   3e-14   
pir|G84065|G84065 hypothetical protein BH3327 [imported] - Bacil...    76   8e-13   Bacillus halodurans
gb:HPY418339_138579 Helicobacter pylori sodiT1 gene (partial), m...    72   2e-11   
gb:HPY418335_138567 Helicobacter pylori sodiT1 gene (partial), m...    70   5e-11   
gb:HPY418337_138573 Helicobacter pylori sodiT1 gene (partial), m...    70   6e-11   
gb:HPY418340_138582 Helicobacter pylori sodiT1 gene (partial), m...    69   1e-10   
gb:HPY418338_138576 Helicobacter pylori sodiT1 gene (partial), m...    69   2e-10   
gb:AE016770_329002 Escherichia coli CFT073 section 16 of 18 of t...    62   2e-08   
gb:CP000029_80972 Staphylococcus epidermidis RP62A, complete gen...    52   2e-05   
gb:BX571856_780197 Staphylococcus aureus subsp. aureus strain MR...    49   1e-04   
gb:BA000033_710944 Staphylococcus aureus subsp. aureus MW2 DNA, ...    49   1e-04   
gb:CP000046_90908 Staphylococcus aureus subsp. aureus COL, compl...    49   1e-04   
pir|C89840|C89840 conserved hypothetical protein SA0645 [importe...    49   1e-04   Staphylococcus aureus subsp. aureus Mu50
gb:AF496379_516269 Lactobacillus delbrueckii subsp. lactis 2-oxo...    41   0.039   
sp|Q07252|MEMP_ALCEU|MEMP_ALCEU Membrane protein.>pir|I39534|I39534 hypothe...    41   0.039   Cupriavidus necator
gb:BA000028_696927 Oceanobacillus iheyensis HTE831 DNA, complete...    40   0.086   
gb:AY596298_634712 Haloarcula marismortui ATCC 43049 chromosome ...    39   0.15    
gb:AL935260_552483 Lactobacillus plantarum strain WCFS1 complete...    37   0.73    
sp|Q57486|Y608_HAEIN|Y608_HAEIN Hypothetical protein HI0608.>pir|I64080|I64...    36   1.2     Haemophilus influenzae
pir|F64546|F64546 sodium-dependent transporter - Helicobacter py...    35   1.6     Helicobacter pylori
gb:AE016827_343544 Mannheimia succiniciproducens MBEL55E, comple...    35   2.1     
gb:BX936398_837914 Yersinia pseudotuberculosis IP32953 genome, c...    35   2.8     
gb:AE013947_301726 Yersinia pestis KIM section 347 of 415 of the...    35   2.8     
pir|AF0093|AF0093 Sodium,sulfate symporter-family protein [impor...    35   2.8     Yersinia pestis Antiqua
pir|E71961|E71961 probable transporter - Helicobacter pylori (st...    35   2.8     Helicobacter pylori J99
gb:AY363392_1322719 Callinectes sapidus mitochondrion, complete ...    34   3.6     
gb:CP000021_872892 Vibrio fischeri ES114 chromosome II, complete...    34   3.6     
gb:AE011120_269362 Methanosarcina acetivorans str. C2A, section ...    34   3.6     
gb:AP006878_576441 Thermococcus kodakaraensis strain KOD1 DNA, c...    34   4.7     
pir|G83492|G83492 hypothetical protein PA1232 [imported] - Pseud...    34   4.7     Pseudomonas aeruginosa
gb:AJ749949_532185 Francisella tularensis subsp. tularensis comp...    33   6.2     
gb:AY380558_614918 Burkholderia multivorans E243 type III secret...    33   8.0     
gb:AE010495_263724 Fusobacterium nucleatum subsp. nucleatum ATCC...    33   8.0     
gb:CR522870_99612 Desulfotalea psychrophila LSv54 chromosome.          33   8.0     


>gb:AY123847_1580056 Nicotiana tabacum glutamate/malate translocator
           (DiT2) mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 583

 Score =  339 bits (870), Expect = 4e-92
 Identities = 171/205 (83%), Positives = 177/205 (86%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW MIGTMLLAVSLW  GDALGIASVVAAM                 LSEKSAWDTLAWF
Sbjct: 379 EWVMIGTMLLAVSLWVFGDALGIASVVAAMLGLSILLLLGVLDWDDCLSEKSAWDTLAWF 438

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVLVGMA QLTNLGIV WMS+CVAKSLQ LSLSWPAAF +LQA+YF IHYLFASQTGHVG
Sbjct: 439 AVLVGMAGQLTNLGIVGWMSSCVAKSLQALSLSWPAAFGVLQAAYFFIHYLFASQTGHVG 498

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAM+LASGVPGVLAAL LAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFK G
Sbjct: 499 ALYSAFLAMHLASGVPGVLAALALAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKMG 558

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FIMA++NA IWGVVGTFWWKFLGLY
Sbjct: 559 FIMALVNATIWGVVGTFWWKFLGLY 583



>gb:AB008268_1510458 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSJ1.>gb:AY056329_1563639 Arabidopsis thaliana
           putative 2-oxoglutarate/malate translocator protein
           (At5g64290) mRNA, complete cds.>gb:BT000654_1634932
           Arabidopsis thaliana clone RAFL07-09-O18 (R10957)
           putative 2-oxoglutarate/malate translocator (At5g64290)
           mRNA, complete cds.>gb:BT015925_1642543 Arabidopsis
           thaliana At5g64290 gene, complete cds.
          Length = 563

 Score =  324 bits (831), Expect = 1e-87
 Identities = 159/205 (77%), Positives = 175/205 (85%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M+GTMLLAV+LW  G+ LGI SVVAAM                 LSEKSAWDTLAWF
Sbjct: 359 EWIMVGTMLLAVTLWICGETLGIPSVVAAMIGLSILLVLGVLNWDDCLSEKSAWDTLAWF 418

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVLVGMA QLTNLG+V+WMS+CVAK LQ LSLSWPAAF +LQA+YF IHYLFASQTGHVG
Sbjct: 419 AVLVGMAGQLTNLGVVTWMSDCVAKVLQSLSLSWPAAFGLLQAAYFFIHYLFASQTGHVG 478

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           AL+SAFLAM++A+GVPG+LAAL LAYNTNLFGALTHYSSGQAAVY+GAGYVDLPDVFK G
Sbjct: 479 ALFSAFLAMHIAAGVPGILAALALAYNTNLFGALTHYSSGQAAVYYGAGYVDLPDVFKIG 538

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+MA INA+IWGVVGTFWWKFLGLY
Sbjct: 539 FVMATINAIIWGVVGTFWWKFLGLY 563



>gb:AY123846_1580055 Spinacia oleracea glutamate/malate translocator
           (DiT1) mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 564

 Score =  320 bits (819), Expect = 3e-86
 Identities = 158/205 (77%), Positives = 173/205 (84%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M+GTMLLAVSLW  G+ +G++SVVAAM                 L+EKSAWDTLAWF
Sbjct: 360 EWVMVGTMLLAVSLWVFGEKIGVSSVVAAMLGLSVLLLLGVLDWNDCLNEKSAWDTLAWF 419

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVLVGMASQLTNLGIVSWMS CVA+SL+ ++LSWPAAF ILQA+YF +HYLFASQTGHVG
Sbjct: 420 AVLVGMASQLTNLGIVSWMSGCVARSLKTMNLSWPAAFGILQAAYFFVHYLFASQTGHVG 479

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAMN+ASGVPGVLAAL LAYNTNLFGALTHYSSGQAAVY+GAGYVDLPDVFK G
Sbjct: 480 ALYSAFLAMNIASGVPGVLAALALAYNTNLFGALTHYSSGQAAVYYGAGYVDLPDVFKMG 539

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FIMAVINA IW VVG  WWK LG+Y
Sbjct: 540 FIMAVINATIWTVVGGVWWKILGIY 564



>gb:AY123845_1580054 Flaveria bidentis glutamate/malate translocator
           (DiT2) mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 563

 Score =  318 bits (815), Expect = 1e-85
 Identities = 159/205 (77%), Positives = 169/205 (82%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW MI TM+LAVSLW  GDA+GI SVV AM                 LSEKSAWDTLAWF
Sbjct: 359 EWVMIATMVLAVSLWVFGDAIGIPSVVTAMLGLSILLLLGVLEWDDCLSEKSAWDTLAWF 418

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVLVGMA QLTNLGIV+WMSNCVAK LQ  SLSWPAAF +LQ +YF IHY+FASQTGHVG
Sbjct: 419 AVLVGMAGQLTNLGIVTWMSNCVAKFLQSFSLSWPAAFGVLQGAYFLIHYMFASQTGHVG 478

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAMNLA+GVPGVLAAL LAYNTNLFGALTHYSSGQAAVYFGAGYV+LPDVF+ G
Sbjct: 479 ALYSAFLAMNLAAGVPGVLAALALAYNTNLFGALTHYSSGQAAVYFGAGYVELPDVFRIG 538

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FIMA INA+IW VVG  WWKFLGLY
Sbjct: 539 FIMACINAVIWAVVGGAWWKFLGLY 563



>gb:AP005399_1851159 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0676H02.>gb:AP005574_1854308 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1595_D08.
          Length = 550

 Score =  317 bits (812), Expect = 2e-85
 Identities = 155/205 (75%), Positives = 173/205 (84%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW MIGTMLLAVSLW  GDA+G++SVVAAM                 L+EKSAWDTLAWF
Sbjct: 346 EWVMIGTMLLAVSLWVFGDAIGVSSVVAAMLGLSILLLLGVLDWDDCLNEKSAWDTLAWF 405

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVLVGMA QLTNLGIVSWMS+CVAK L+  SLSWPAAF +L+ASYF IHYLFASQTGHVG
Sbjct: 406 AVLVGMAGQLTNLGIVSWMSSCVAKLLESFSLSWPAAFCVLEASYFLIHYLFASQTGHVG 465

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAM++A+GVP VL+AL LA+NTNLFGALTHYSSGQAAVYFGAGY++LPDVF+ G
Sbjct: 466 ALYSAFLAMHVAAGVPRVLSALALAFNTNLFGALTHYSSGQAAVYFGAGYLELPDVFRMG 525

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+ A+IN LIWGVVGTFWWK LGLY
Sbjct: 526 FVTALINILIWGVVGTFWWKLLGLY 550



>gb:AP004213_1838859 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1111_H02.>gb:AP005391_1850951 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0092C08.
          Length = 555

 Score =  314 bits (804), Expect = 2e-84
 Identities = 153/205 (74%), Positives = 169/205 (82%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M+ TM+LAVSLW  GD +G++SVVAAM                 L+EKSAWDTLAWF
Sbjct: 351 EWIMVATMILAVSLWIFGDTIGVSSVVAAMIGLSILLLLGVLNWEDCLNEKSAWDTLAWF 410

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A+LVGMA QLTNLGIVSWMSNCVAK LQ  SLSWPAAF +LQASYF IHYLFASQT HVG
Sbjct: 411 AILVGMAGQLTNLGIVSWMSNCVAKVLQSFSLSWPAAFGVLQASYFFIHYLFASQTAHVG 470

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAM+LA+GVP +L+AL L YN+NLFGALTHYSSGQ+AVY+GAGYVDLPDVFK G
Sbjct: 471 ALYSAFLAMHLAAGVPAILSALALTYNSNLFGALTHYSSGQSAVYYGAGYVDLPDVFKLG 530

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F  A INA+IWGVVGTFWWKFLGLY
Sbjct: 531 FTTAAINAVIWGVVGTFWWKFLGLY 555



>gb:AB112939_1527215 Zea mays ZmpDCT3 mRNA for plastidic general
           dicarboxylate transporter, complete cds.
          Length = 551

 Score =  313 bits (802), Expect = 3e-84
 Identities = 152/205 (74%), Positives = 169/205 (82%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW MIGTMLLAVSLW  G+ +G++SVVAAM                 L+EKSAWDTLAWF
Sbjct: 347 EWVMIGTMLLAVSLWIFGETIGVSSVVAAMIGLSILLVLGVLNWEDCLNEKSAWDTLAWF 406

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A+LVG+A QLTNLGIVSWMSNCVAK LQ  SLSWPAAF++LQASYF IHY+FASQT HVG
Sbjct: 407 AILVGLAGQLTNLGIVSWMSNCVAKVLQSFSLSWPAAFVVLQASYFFIHYIFASQTAHVG 466

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAM+LA+GVP +++AL LAYN NLFGALTHYSSGQ+AVYFGAGYVDLPDVFK G
Sbjct: 467 ALYSAFLAMHLAAGVPALMSALALAYNANLFGALTHYSSGQSAVYFGAGYVDLPDVFKLG 526

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI A INA+IWGV G  WWKFLGLY
Sbjct: 527 FITAAINAVIWGVAGALWWKFLGLY 551



>gb:AB112938_1527214 Zea mays ZmpDCT2 mRNA for plastidic general
           dicarboxylate transporter, complete cds.
          Length = 551

 Score =  313 bits (802), Expect = 3e-84
 Identities = 152/205 (74%), Positives = 169/205 (82%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW MIGTMLLAVSLW  G+ +G++SVVAAM                 L+EKSAWDTLAWF
Sbjct: 347 EWVMIGTMLLAVSLWIFGETIGVSSVVAAMIGLSILLVLGVLNWEDCLNEKSAWDTLAWF 406

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A+LVG+A QLTNLGIVSWMSNCVAK LQ  SLSWPAAF++LQASYF IHY+FASQT HVG
Sbjct: 407 AILVGLAGQLTNLGIVSWMSNCVAKVLQSFSLSWPAAFVVLQASYFFIHYIFASQTAHVG 466

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAM+LA+GVP +++AL LAYN NLFGALTHYSSGQ+AVYFGAGYVDLPDVFK G
Sbjct: 467 ALYSAFLAMHLAAGVPALMSALALAYNANLFGALTHYSSGQSAVYFGAGYVDLPDVFKLG 526

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI A INA+IWGV G  WWKFLGLY
Sbjct: 527 FITAAINAVIWGVAGALWWKFLGLY 551



>gb:AB112937_1527213 Zea mays ZmpDCT1 mRNA for plastidic general
           dicarboxylate transporter, complete cds.
          Length = 554

 Score =  311 bits (798), Expect = 9e-84
 Identities = 153/205 (74%), Positives = 170/205 (82%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  MIGTM+LAVSLW  GDA+G++SVVAAM                 L+EKSAWDTLAWF
Sbjct: 350 ESVMIGTMILAVSLWVFGDAIGVSSVVAAMLGLSILLVLGVLDWDDCLNEKSAWDTLAWF 409

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVLVGMA QLTNLGIVSWMSNCVAK LQ  SLSWP AF +L+ASYF IHYLFASQTGHVG
Sbjct: 410 AVLVGMAGQLTNLGIVSWMSNCVAKLLQSFSLSWPVAFCVLEASYFLIHYLFASQTGHVG 469

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAM++A+GVP VL+AL LA+NTNLFGA+THYSSGQAAVYFGAGY++LPDVF+ G
Sbjct: 470 ALYSAFLAMHIAAGVPSVLSALALAFNTNLFGAITHYSSGQAAVYFGAGYMELPDVFRLG 529

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI A+ N LIWGVVGT WWKFLGLY
Sbjct: 530 FITALANTLIWGVVGTIWWKFLGLY 554



>gb:AY123844_1580053 Sorghum bicolor glutamate/malate translocator
           (DiT1) mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 563

 Score =  307 bits (786), Expect = 2e-82
 Identities = 147/205 (71%), Positives = 170/205 (82%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW MIGTM+LAV+LW  GDA+G++SVVAAM                 L+EKSAWDTLAWF
Sbjct: 359 EWAMIGTMILAVALWIFGDAIGVSSVVAAMLGLSILLLLGVLDWADILNEKSAWDTLAWF 418

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           +VLVGMA+QLT+LGIVSWMS+C+A  LQ  SLSWPAAF +LQASY  IHYLFASQTGHVG
Sbjct: 419 SVLVGMAAQLTSLGIVSWMSSCIANLLQSFSLSWPAAFCVLQASYLVIHYLFASQTGHVG 478

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALYSAFLAM++A+GVP VL+AL LA+NT+LFG +THYSSGQAAVYFGAGY+DLPDVF+ G
Sbjct: 479 ALYSAFLAMHVAAGVPSVLSALALAFNTDLFGGITHYSSGQAAVYFGAGYLDLPDVFRIG 538

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI  +IN LIWG +GTFWWKFLGLY
Sbjct: 539 FISTLINTLIWGGIGTFWWKFLGLY 563



>gb:AB008268_1510457 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSJ1.>gb:AY045893_1561400 Arabidopsis thaliana
           putative 2-oxoglutarate/malate translocator protein
           (At5g64280) mRNA, complete cds.>gb:AY133825_1581645
           Arabidopsis thaliana clone U10753 putative
           2-oxoglutarate/malate translocator protein (At5g64280)
           mRNA, complete cds.
          Length = 549

 Score =  283 bits (724), Expect = 3e-75
 Identities = 135/205 (65%), Positives = 160/205 (78%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M+G M   VSLW  G+A+GIASVV+AM                 LS+KSAWD+L WF
Sbjct: 345 EWIMLGAMAFTVSLWVFGEAIGIASVVSAMIGLSTLLLLGVINWDDCLSDKSAWDSLTWF 404

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVL+GMA QLTNLG+V+WMS+CVAK LQ LSL+WPA+F+ILQA Y  IHYLFASQTGH G
Sbjct: 405 AVLIGMAGQLTNLGVVAWMSDCVAKLLQSLSLTWPASFIILQACYLLIHYLFASQTGHAG 464

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           ALY  FLAM +A+GVPGVLAAL LA+N NL GAL HYS G AA+Y+GAGYVDL D+F+ G
Sbjct: 465 ALYPPFLAMQIAAGVPGVLAALCLAFNNNLSGALAHYSGGPAALYYGAGYVDLRDMFRVG 524

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+MA++ A+IWG VG+FWWKFLGLY
Sbjct: 525 FVMALVQAIIWGGVGSFWWKFLGLY 549



>gb:AF036172_1762932 Zea mays 2-oxoglutarate/malate translocator
           (Zmmt) gene, partial cds.
          Length = 153

 Score =  271 bits (693), Expect = 1e-71
 Identities = 127/153 (83%), Positives = 139/153 (90%)
 Frame = -2

Query: 781 AWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLF 602
           AWD LAWFAVLVGMA QLTNLGIVSWMSNCVAK LQ  SLSWP AF +L+ASYF IHYLF
Sbjct: 1   AWDNLAWFAVLVGMAGQLTNLGIVSWMSNCVAKLLQSFSLSWPVAFCVLEASYFLIHYLF 60

Query: 601 ASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVD 422
           ASQTGHVGALYSAFLAM++A+GVP VL+AL LA+NTNLFGA+THYSSGQAAVYFGAGY++
Sbjct: 61  ASQTGHVGALYSAFLAMHIAAGVPSVLSALALAFNTNLFGAITHYSSGQAAVYFGAGYME 120

Query: 421 LPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
           LPDVF+ GFI A+IN LIWGVVGT WWKFLGLY
Sbjct: 121 LPDVFRLGFITALINTLIWGVVGTIWWKFLGLY 153



>gb:AB112936_1527212 Zea mays ZmpOMT1 mRNA for plastidic
           2-oxoglutarate/malate transporter, complete cds.
          Length = 578

 Score =  179 bits (453), Expect = 9e-44
 Identities = 87/205 (42%), Positives = 121/205 (59%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M GT+LL V LW  G  L + +V AA+                 L+E  AWDTL WF
Sbjct: 374 ETIMAGTLLLTVGLWIFGGMLNVDAVSAAILGLAVLLISGVVTWKECLAESVAWDTLTWF 433

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A L+ MA  L   G++SW S  V K +  L +SW  +F +L   YF  HY FAS   H+G
Sbjct: 434 AALIAMAGYLNKFGLISWFSETVVKFVGGLGMSWQLSFGVLVLLYFYSHYFFASGAAHIG 493

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+++AFL++  A G P + AA+ L++ +NL G  THY  G A V++GAGYV L   + +G
Sbjct: 494 AMFTAFLSVASALGTPSLFAAMVLSFLSNLMGGTTHYGIGSAPVFYGAGYVPLAQWWGYG 553

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+++V+N +IW  VG FWWK +GL+
Sbjct: 554 FVISVVNIIIWLGVGGFWWKIIGLW 578



>pir|F69811|F69811 2-oxoglutarate/malate translocator homolog yflS -
           Bacillus subtilis>gb:D86417_120807 Bacillus subtilis
           35.7 kb genomic DNA, 70-73 degree region, complete
           cds.>gb:BSUB0005_752722 Bacillus subtilis complete
           genome (section 5 of 21): from 813670 to 1011078.
          Length = 478

 Score =  178 bits (452), Expect = 1e-43
 Identities = 87/205 (42%), Positives = 123/205 (60%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E +M+   LL + LW  G +  I +   A+                   E+ AWDTL WF
Sbjct: 276 ELSMVIVFLLVLVLWIFGGSFNIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWF 335

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A LV +A+ L  LG+VSW SN +  S+     SW  AF+IL   Y+  HY FAS T H+ 
Sbjct: 336 AALVMLANFLNELGMVSWFSNAMKSSVS--GFSWIVAFIILIVVYYYSHYFFASATAHIS 393

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+YSAFLA+ +A+G P +LAAL LA+ +NLFG+ THY SG A V+FGAGY+     +  G
Sbjct: 394 AMYSAFLAVVVAAGAPPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIG 453

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI+++++ ++W V+G  WWK LG++
Sbjct: 454 FILSIVHIIVWLVIGGLWWKVLGIW 478



>pir|T49900|T49900 2-oxoglutarate/malate translocator-like protein
           T24H18.30 [similarity] - Arabidopsis
           thaliana>gb:ATT24H18_1555413 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T24H18 (ESSA project).
          Length = 557

 Score =  177 bits (449), Expect = 3e-43
 Identities = 88/205 (42%), Positives = 119/205 (58%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M  T+ L V LW  G  LG+ +V AA+                 L+E  AWDTL WF
Sbjct: 353 ELIMAATLFLTVGLWIFGAKLGVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWF 412

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A L+ MA  L   G++ W S  V K +  L LSW  +F IL   YF  HY FAS   H+G
Sbjct: 413 AALIAMAGYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIG 472

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+++AFL+++ A G P   AAL LA+ +NL G LTHY  G A +++GA YV L   + +G
Sbjct: 473 AMFTAFLSVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYG 532

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+++++N LIW  VG  WWKF+GL+
Sbjct: 533 FLISIVNILIWLGVGGAWWKFIGLW 557



>sp|Q41364|SOT1_SPIOL 2-oxoglutarate/malate translocator,
           chloroplast precursor.>gb:A47930_1449453 Sequence 1 from
           Patent WO9534654.>gb:SOU13238_1715922 Spinacia oleracea
           envelope membrane 2-oxoglutarate/malate translocator
           (SODiT1) mRNA, chloroplast mRNA encoding chloroplast
           protein, complete cds.
          Length = 569

 Score =  176 bits (445), Expect = 8e-43
 Identities = 87/205 (42%), Positives = 121/205 (59%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M  T+LL V LW  G  LG+ +V AA+                 L+E  AWDTL WF
Sbjct: 365 ESIMAVTLLLTVGLWVFGGKLGVDAVTAAILGLSVLLITGVVTWKECLAESVAWDTLTWF 424

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A L+ MA  L   G+++W S  V K +  L LSW  +F +L   YF  HY FAS   H+G
Sbjct: 425 AALIAMAGYLNKYGLITWFSENVVKVVGGLGLSWQMSFGVLVLLYFYSHYFFASGAAHIG 484

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+++AFL++  A G P  LAA+ L++ +NL G LTHY  G A V++GA YV LP  + +G
Sbjct: 485 AMFTAFLSVASALGTPPFLAAIVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLPQWWGYG 544

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+++++N +IW  VG  WWK +GL+
Sbjct: 545 FLISIVNLIIWLGVGGLWWKAIGLW 569



>gb:AF370494_1792279 Arabidopsis thaliana 2-oxoglutarate/malate
           translocator precursor-like protein (T24H18.30) mRNA,
           complete cds.
          Length = 413

 Score =  174 bits (442), Expect = 2e-42
 Identities = 87/205 (42%), Positives = 118/205 (57%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M  T+ L V LW  G  LG+ +V AA+                 L+E  AWDTL WF
Sbjct: 209 ELIMAATLFLTVGLWIFGAKLGVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWF 268

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A L+ MA  L   G++ W S  V K +  L LSW  +F IL   YF  HY FAS   H+G
Sbjct: 269 AALIAMAGYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIG 328

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+++AFL+++ A G P   AAL  A+ +NL G LTHY  G A +++GA YV L   + +G
Sbjct: 329 AMFTAFLSVSTALGTPPYFAALVHAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYG 388

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+++++N LIW  VG  WWKF+GL+
Sbjct: 389 FLISIVNILIWLGVGGAWWKFIGLW 413



>gb:CP000002_856496 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 293

 Score =  174 bits (442), Expect = 2e-42
 Identities = 87/205 (42%), Positives = 121/205 (59%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E +M+   LL + LW  G  L I +   A+                   E+ AWDTL WF
Sbjct: 91  ELSMVAVFLLVLFLWIFGGNLNIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWF 150

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A LV +AS L  LG+V W S+ +   +     SW +AFLIL A Y+  HY FAS T H+ 
Sbjct: 151 AALVMLASFLNELGMVGWFSDAMKSYVS--GFSWISAFLILIAVYYYSHYFFASATAHIS 208

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+YSAFLA+ +A+G P +LAAL LA+ +NLF + THY +G A V+FGAGY+     +  G
Sbjct: 209 AMYSAFLAVIIAAGAPPLLAALSLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIG 268

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI+++++ + W VVG  WWK LG++
Sbjct: 269 FILSIVHIVTWLVVGGLWWKLLGIW 293



>gb:AE017333_446677 Bacillus licheniformis DSM 13, complete genome.
          Length = 478

 Score =  174 bits (442), Expect = 2e-42
 Identities = 87/205 (42%), Positives = 121/205 (59%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E +M+   LL + LW  G  L I +   A+                   E+ AWDTL WF
Sbjct: 276 ELSMVAVFLLVLFLWIFGGNLNIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWF 335

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A LV +AS L  LG+V W S+ +   +     SW +AFLIL A Y+  HY FAS T H+ 
Sbjct: 336 AALVMLASFLNELGMVGWFSDAMKSYVS--GFSWISAFLILIAVYYYSHYFFASATAHIS 393

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+YSAFLA+ +A+G P +LAAL LA+ +NLF + THY +G A V+FGAGY+     +  G
Sbjct: 394 AMYSAFLAVIIAAGAPPLLAALSLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIG 453

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI+++++ + W VVG  WWK LG++
Sbjct: 454 FILSIVHIVTWLVVGGLWWKLLGIW 478



>pir|B97096|B97096 2-oxoglutarate/malate translocator [imported] -
           Clostridium acetobutylicum>gb:AE007668_228918
           Clostridium acetobutylicum ATCC 824 section 156 of 356
           of the complete genome.>gb:AE001437_1091873 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 476

 Score =  168 bits (425), Expect = 2e-40
 Identities = 83/197 (42%), Positives = 113/197 (57%)
 Frame = -2

Query: 913 LLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGMAS 734
           ++ + LW  G    I + + A                    EK AWDTL WF+VLV MA+
Sbjct: 282 VIILFLWITGSLTKIDATLTAFIGLSLLLIFKVITWDDVKGEKGAWDTLIWFSVLVMMAN 341

Query: 733 QLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFLA 554
           QL  LG++ W S  V  S+     SWP   LIL   YF IHY+FAS T HV ++YSAFLA
Sbjct: 342 QLNKLGLIKWFSTLVKNSVH--GFSWPIILLILLVCYFYIHYIFASATAHVSSMYSAFLA 399

Query: 553 MNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINA 374
           + +A GVP +LAAL L +  NL  + THYSSG A + FG+GYV+    +   FI+ ++  
Sbjct: 400 IAIAGGVPPLLAALSLGFFGNLLASTTHYSSGPAPILFGSGYVNQNKWWSLNFILGIVYF 459

Query: 373 LIWGVVGTFWWKFLGLY 323
           +IW  +G+ WWK +G+Y
Sbjct: 460 IIWLGIGSIWWKVIGIY 476



>gb:AE016808_337866 Vibrio vulnificus CMCP6 chromosome II section 1
           of 6 of the complete sequence.>gb:AE016796_1047590
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 467

 Score =  161 bits (407), Expect = 2e-38
 Identities = 84/205 (40%), Positives = 118/205 (57%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  +  T +  V+LW  G  LGI + V A+                 LSEK AW T+ WF
Sbjct: 265 EIMVCATFIGMVTLWVLGPTLGIHATVTALIGLVFLLLSRTITWDAVLSEKEAWHTITWF 324

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVL+ MAS+L  LG + W SN + +SL      W    ++L   Y+  HYL AS   H+ 
Sbjct: 325 AVLIMMASELNKLGFIKWFSNGIGESLS--GFGWATTIILLLLVYYYSHYLMASAMAHIS 382

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+YSAFLA+ +++GVP +LAA+ L   +NL+ + THYSSG A + FGAG+  L + +K G
Sbjct: 383 AMYSAFLAIAISAGVPPMLAAIVLGIFSNLYMSTTHYSSGPAPILFGAGFHSLQNWWKIG 442

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+ ++I   I+  VG  WWK LGL+
Sbjct: 443 FVFSLIVIPIFIFVGGMWWKVLGLW 467



>gb:BA000038_724698 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 469

 Score =  159 bits (403), Expect = 6e-38
 Identities = 83/205 (40%), Positives = 117/205 (57%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  +  T +  V+LW  G  LGI + V A+                 LSEK AW T+ WF
Sbjct: 267 EIMVCATFIGMVTLWVLGPTLGIHATVTALIGLVFLLLSRTITWDAVLSEKEAWHTITWF 326

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVL+ MAS+L  LG + W SN + +SL      W    ++L   Y+  HYL AS   H+ 
Sbjct: 327 AVLIMMASELNKLGFIKWFSNGIGESLS--GFGWATTIILLLLVYYYSHYLMASAMAHIS 384

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+YSAFLA+ +++G P +LAA+ L   +NL+ + THYSSG A + FGAG+  L + +K G
Sbjct: 385 AMYSAFLAIAISAGAPPMLAAIVLGIFSNLYMSTTHYSSGPAPILFGAGFHSLQNWWKIG 444

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+ ++I   I+  VG  WWK LGL+
Sbjct: 445 FVFSLIVIPIFIFVGGMWWKVLGLW 469



>gb:BA000032_709302 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 467

 Score =  159 bits (403), Expect = 6e-38
 Identities = 85/199 (42%), Positives = 115/199 (57%)
 Frame = -2

Query: 919 TMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGM 740
           T +  VSLW  G  LGI + V A+                 L EK AW T+ WFAVLV M
Sbjct: 271 TFIGMVSLWVLGPTLGIHATVTALLGLVFLLLTHTITWDAVLGEKEAWHTITWFAVLVMM 330

Query: 739 ASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAF 560
           A+QL  LG +SW S  +A+SL      W    ++L   Y+  HYL AS   H+ A+YSAF
Sbjct: 331 AAQLNKLGFISWFSESMAESLS--GFGWVTTIVVLLLVYYYSHYLMASAMAHISAMYSAF 388

Query: 559 LAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVI 380
           LA+ +++G P +LAA+ L   +NL+ + THYSSG A + FGAG+  L + +K GFI ++I
Sbjct: 389 LAIAISAGAPPMLAAIVLGIFSNLYMSTTHYSSGPAPILFGAGFHTLQNWWKIGFIFSLI 448

Query: 379 NALIWGVVGTFWWKFLGLY 323
              I+  VG  WWK LGL+
Sbjct: 449 VIPIFVFVGGAWWKLLGLW 467



>gb:AY826859_1629165 Heterocapsa triquetra clone HTOXO1 chloroplast
           oxoglutarate/malate translocator mRNA, partial cds;
           nuclear gene for chloroplast product.
          Length = 347

 Score =  158 bits (399), Expect = 2e-37
 Identities = 76/192 (39%), Positives = 106/192 (55%)
 Frame = -2

Query: 898 LWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGMASQLTNL 719
           LW    A GI +V  A+                  SE+ AW T+ WFA+LV M++ L   
Sbjct: 156 LWAGSTAFGIPAVTTAVLGLSALLLTGTMTWADCASEQGAWTTMTWFAILVSMSAMLNKR 215

Query: 718 GIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFLAMNLAS 539
           G+VSW++  ++  +    LS   AF +L   Y   HY FASQ  H+ ALY  F+AM + +
Sbjct: 216 GVVSWLAATISGQITGAGLSAAPAFFLLLFIYTFSHYAFASQVAHLSALYVPFIAMMVKT 275

Query: 538 GVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGV 359
           G P  +A   LA  +N+FG+LT Y+S QA V++G GYV L D ++ G I  V N  +W  
Sbjct: 276 GTPPAVAVFALAVASNVFGSLTPYASAQAPVFYGGGYVTLKDWYRMGLIFIVFNLAVWIS 335

Query: 358 VGTFWWKFLGLY 323
           VG+ WWK +GLY
Sbjct: 336 VGSVWWKIIGLY 347



>gb:AE016996_374664 Chlamydophila caviae GPIC section 3 of 4 of the
           complete genome.>gb:AE015925_994343 Chlamydophila caviae
           GPIC complete genome.
          Length = 470

 Score =  156 bits (394), Expect = 6e-37
 Identities = 79/198 (39%), Positives = 113/198 (57%), Gaps = 1/198 (0%)
 Frame = -2

Query: 913 LLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXX-XXXXLSEKSAWDTLAWFAVLVGMA 737
           +L V LW  GD L I++  AA+                  ++  +AW+T  WF  L+ MA
Sbjct: 275 ILLVVLWTFGDLLRISATTAALIGLSLLILTNILDWHKDVMANTTAWETFIWFGALIMMA 334

Query: 736 SQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFL 557
           S L   G +  + N VA  +    LSW   F IL   YF  HYLFAS T H+GA++  FL
Sbjct: 335 SFLNQFGFIPLIGNSVAAGVA--GLSWKVGFPILFLIYFYSHYLFASNTAHIGAMFPVFL 392

Query: 556 AMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVIN 377
           A++++ G   + A L  A+++NLFG LTHY SG A +YFG+  V + D ++ GFI++++N
Sbjct: 393 AVSISLGTNPIFACLVFAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWRSGFILSIVN 452

Query: 376 ALIWGVVGTFWWKFLGLY 323
             IW  +GT WWK LGL+
Sbjct: 453 IAIWIGIGTLWWKLLGLF 470



>pir|H72105|H72105 dicarboxylase translocator - Chlamydophila
           pneumoniae  (strain CWL029)>gb:AE001607_37072 Chlamydia
           pneumoniae section 23 of 103 of the complete
           genome.>gb:AE001363_941629 Chlamydia pneumoniae,
           complete genome.
          Length = 470

 Score =  154 bits (388), Expect = 3e-36
 Identities = 80/205 (39%), Positives = 117/205 (57%), Gaps = 1/205 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXX-XXXXLSEKSAWDTLAW 761
           E T++    L V LW  GD LGI++  AA+                  ++  +AW+T  W
Sbjct: 267 EKTILMIFFLLVVLWTFGDLLGISATTAALIGLSLLILTNILDWQKDVIANTTAWETFIW 326

Query: 760 FAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHV 581
           F  L+ MAS L  LG +  + +  A  +    LSW   F +L   YF  HYLFAS T H+
Sbjct: 327 FGALIMMASFLNQLGFIPLVGDSAAALVS--GLSWKIGFPLLFLIYFYSHYLFASNTAHI 384

Query: 580 GALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKF 401
           GA+Y  FLA++++ G   + AAL LA+ +NLFG LTHY SG A +YFG+  V + + ++ 
Sbjct: 385 GAMYPIFLAVSISLGTNPIFAALTLAFASNLFGGLTHYGSGPAPLYFGSHLVTVQEWWRS 444

Query: 400 GFIMAVINALIWGVVGTFWWKFLGL 326
           GF ++++N +IW  +G+ WWK LGL
Sbjct: 445 GFALSIVNIVIWIGIGSLWWKALGL 469



>pir|G86516|G86516 dicarboxylase translocator [imported] -
           Chlamydophila pneumoniae (strain J138)>gb:AE002215_44038
           Chlamydophila pneumoniae AR39, section 43 of 94 of the
           complete genome.>gb:AE017157_393556 Chlamydophila
           pneumoniae TW-183, section 1 of 4 of the complete
           genome.>gb:BA000008_663580 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886163
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE009440_1027818 Chlamydophila pneumoniae
           TW-183, complete genome.
          Length = 470

 Score =  154 bits (388), Expect = 3e-36
 Identities = 80/205 (39%), Positives = 117/205 (57%), Gaps = 1/205 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXX-XXXXLSEKSAWDTLAW 761
           E T++    L V LW  GD LGI++  AA+                  ++  +AW+T  W
Sbjct: 267 EKTILMIFFLLVVLWTFGDLLGISATTAALIGLSLLILTNILDWQKDVIANTTAWETFIW 326

Query: 760 FAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHV 581
           F  L+ MAS L  LG +  + +  A  +    LSW   F +L   YF  HYLFAS T H+
Sbjct: 327 FGALIMMASFLNQLGFIPLVGDSAAALVS--GLSWKIGFPLLFLIYFYSHYLFASNTAHI 384

Query: 580 GALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKF 401
           GA+Y  FLA++++ G   + AAL LA+ +NLFG LTHY SG A +YFG+  V + + ++ 
Sbjct: 385 GAMYPIFLAVSISLGTNPIFAALTLAFASNLFGGLTHYGSGPAPLYFGSHLVTVQEWWRS 444

Query: 400 GFIMAVINALIWGVVGTFWWKFLGL 326
           GF ++++N +IW  +G+ WWK LGL
Sbjct: 445 GFALSIVNIVIWIGIGSLWWKALGL 469



>gb:AE008845_244812 Salmonella typhimurium LT2, section 149 of 220
           of the complete genome.>gb:AE006468_1001894 Salmonella
           typhimurium LT2, complete genome.
          Length = 494

 Score =  152 bits (385), Expect = 7e-36
 Identities = 78/207 (37%), Positives = 111/207 (53%), Gaps = 2/207 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M+ T+ + + LW  G +LG+ +  A+                   SEK AWDTL WF
Sbjct: 288 EWLMLATVGVLLVLWIFGSSLGVDATTASFVGLSILLLSGVLTWEDVKSEKGAWDTLIWF 347

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCL--SLSWPAAFLILQASYFCIHYLFASQTGH 584
           A L+ MA+QL  LG  SW  N +  S+       SW    L+L A+YF  HY FAS    
Sbjct: 348 AALLMMANQLKKLGFTSWFGNLIGDSIGSTMHGTSWIIILLLLNAAYFYTHYFFASGNAQ 407

Query: 583 VGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFK 404
           + ALY+ FL + L   +P    AL LA+ ++L+ +LT Y+  +  + FGAGYV     ++
Sbjct: 408 IAALYAVFLGVGLHLNIPAAPMALMLAFTSSLYCSLTQYTHARGPILFGAGYVPTGVWWR 467

Query: 403 FGFIMAVINALIWGVVGTFWWKFLGLY 323
            GFI+++ N  ++  VG  WWK LGLY
Sbjct: 468 TGFIISLFNQAVFLTVGLAWWKVLGLY 494



>gb:CP000026_77754 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 487

 Score =  152 bits (385), Expect = 7e-36
 Identities = 78/207 (37%), Positives = 111/207 (53%), Gaps = 2/207 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M+ T+ + + LW  G +LG+ +  A+                   SEK AWDTL WF
Sbjct: 281 EWLMLATVGVLLVLWIFGSSLGVDATTASFVGLSILLLSGVLTWEDVKSEKGAWDTLIWF 340

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCL--SLSWPAAFLILQASYFCIHYLFASQTGH 584
           A L+ MA+QL  LG  SW  N +  S+       SW    L+L A+YF  HY FAS    
Sbjct: 341 AALLMMANQLKKLGFTSWFGNLIGDSIGSTMHGTSWIIILLLLNAAYFYTHYFFASGNAQ 400

Query: 583 VGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFK 404
           + ALY+ FL + L   +P    AL LA+ ++L+ +LT Y+  +  + FGAGYV     ++
Sbjct: 401 IAALYAVFLGVGLHLNIPAAPMALMLAFTSSLYCSLTQYTHARGPILFGAGYVPTGVWWR 460

Query: 403 FGFIMAVINALIWGVVGTFWWKFLGLY 323
            GFI+++ N  ++  VG  WWK LGLY
Sbjct: 461 TGFIISLFNQAVFLTVGLAWWKVLGLY 487



>pir|AE0887|AE0887 probable membrane transport protein STY3340
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)>gb:AE016844_347086 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, section 11
           of 16 of the complete genome.>gb:AL627277_543413
           Salmonella enterica serovar Typhi (Salmonella typhi)
           strain CT18, complete chromosome; segment
           13/20.>gb:AE014613_984418 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, complete genome.
          Length = 484

 Score =  152 bits (385), Expect = 7e-36
 Identities = 78/207 (37%), Positives = 111/207 (53%), Gaps = 2/207 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M+ T+ + + LW  G +LG+ +  A+                   SEK AWDTL WF
Sbjct: 278 EWLMLATVGVLLVLWIFGSSLGVDATTASFVGLSILLLSGVLTWEDVKSEKGAWDTLIWF 337

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCL--SLSWPAAFLILQASYFCIHYLFASQTGH 584
           A L+ MA+QL  LG  SW  N +  S+       SW    L+L A+YF  HY FAS    
Sbjct: 338 AALLMMANQLKKLGFTSWFGNLIGDSIGSTMHGTSWIIILLLLNAAYFYTHYFFASGNAQ 397

Query: 583 VGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFK 404
           + ALY+ FL + L   +P    AL LA+ ++L+ +LT Y+  +  + FGAGYV     ++
Sbjct: 398 IAALYAVFLGVGLHLNIPAAPMALMLAFTSSLYCSLTQYTHARGPILFGAGYVPTGIWWR 457

Query: 403 FGFIMAVINALIWGVVGTFWWKFLGLY 323
            GFI+++ N  ++  VG  WWK LGLY
Sbjct: 458 TGFIISLFNQAVFLTVGLAWWKVLGLY 484



>gb:AE002316_45063 Chlamydia muridarum Nigg section 47 of 85 of the
           complete genome.>gb:AE002160_1149203 Chlamydia muridarum
           Nigg, complete genome.
          Length = 471

 Score =  152 bits (384), Expect = 9e-36
 Identities = 77/196 (39%), Positives = 117/196 (59%), Gaps = 1/196 (0%)
 Frame = -2

Query: 910 LAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXX-XXXXLSEKSAWDTLAWFAVLVGMAS 734
           L +SLW  GD++G+++   A+                  LS   AW+T  WF  L+ MAS
Sbjct: 276 LLISLWTFGDSIGVSATTTALIGLSLLVLTDILDWQQDVLSNTIAWETFLWFGALIMMAS 335

Query: 733 QLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFLA 554
            L++ G V+++ + V   +Q   LSW   F +L   YF  HYLFAS T H+ A+Y  FL 
Sbjct: 336 FLSSFGFVNFVGDSVIGMVQ--GLSWKIGFPVLFLIYFYSHYLFASNTAHIAAMYPIFLT 393

Query: 553 MNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINA 374
           ++++ GV  + AAL LA+ +NLFG LTHY SG A +YFG+  V + + ++ GFI++++N 
Sbjct: 394 VSISLGVNPMFAALALAFASNLFGGLTHYGSGPAPLYFGSQLVSVQEWWRSGFILSIVNL 453

Query: 373 LIWGVVGTFWWKFLGL 326
           +IW  +G++WW  LGL
Sbjct: 454 IIWLGLGSWWWYCLGL 469



>gb:AE016744_321902 Staphylococcus epidermidis ATCC 12228, section 1
           of 9 of the complete genome.>gb:AE015929_1146571
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 472

 Score =  151 bits (381), Expect = 2e-35
 Identities = 75/204 (36%), Positives = 112/204 (54%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M+G  ++A++LW  G  + + + + A                  L+E  AW+TL WF
Sbjct: 270 EKLMVGIFIIALALWVLGSFINVDATLTAFIALALLLLTGVLAWSDILNETGAWNTLVWF 329

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           +VLV MA QL  LG + W+S  +A+ L     SWP   ++L   YF  HYLFAS T HV 
Sbjct: 330 SVLVLMAEQLNKLGFIPWLSKLIAQGLN--GFSWPIVLVLLILFYFYSHYLFASATAHVS 387

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+Y+A L + +ASG P + +AL L +  NL  + THYSSG A + + AGYV     +   
Sbjct: 388 AMYAALLGVAVASGAPPLFSALMLGFFGNLLASTTHYSSGPAPILYAAGYVTQKRWWTMN 447

Query: 397 FIMAVINALIWGVVGTFWWKFLGL 326
            ++ ++  +IW  VG+ W K +G+
Sbjct: 448 IVLGIVYFIIWIGVGSLWMKLIGM 471



>gb:CP000029_82905 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 472

 Score =  151 bits (381), Expect = 2e-35
 Identities = 75/204 (36%), Positives = 112/204 (54%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M+G  ++A++LW  G  + + + + A                  L+E  AW+TL WF
Sbjct: 270 EKLMVGIFIIALALWVLGSFINVDATLTAFIALALLLLTGVLAWSDILNETGAWNTLVWF 329

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           +VLV MA QL  LG + W+S  +A+ L     SWP   ++L   YF  HYLFAS T HV 
Sbjct: 330 SVLVLMAEQLNKLGFIPWLSKLIAQGLN--GFSWPIVLVLLILFYFYSHYLFASATAHVS 387

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+Y+A L + +ASG P + +AL L +  NL  + THYSSG A + + AGYV     +   
Sbjct: 388 AMYAALLGVAVASGAPPLFSALMLGFFGNLLASTTHYSSGPAPILYAAGYVTQKRWWTMN 447

Query: 397 FIMAVINALIWGVVGTFWWKFLGL 326
            ++ ++  +IW  VG+ W K +G+
Sbjct: 448 IVLGIVYFIIWIGVGSLWMKLIGM 471



>pir|F71543|F71543 probable dicarboxylate translocator - Chlamydia
           trachomatis  (serotype D, strain
           UW3/Cx)>gb:AE001294_34131 Chlamydia trachomatis
           D/UW-3/CX section 21 of 87 of the complete
           genome.>gb:AE001273_1098157 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 471

 Score =  150 bits (379), Expect = 3e-35
 Identities = 78/196 (39%), Positives = 115/196 (58%), Gaps = 1/196 (0%)
 Frame = -2

Query: 910 LAVSLWGXGDALGI-ASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGMAS 734
           L +SLW  GD++GI A+    +                 LS  +AW+T  WF  L+ MAS
Sbjct: 276 LLISLWTFGDSIGISATTTTFIGLSLLILTNILDWQKDVLSNTTAWETFFWFGALIMMAS 335

Query: 733 QLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFLA 554
            L+  G + ++ + V  S+Q   LSW   F IL   YF  HYLFAS T H+ A+Y  FL 
Sbjct: 336 FLSAFGFIHFVGDSVIGSVQ--GLSWKIGFPILFLIYFYSHYLFASNTAHIAAMYPIFLT 393

Query: 553 MNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINA 374
           ++++ G   + AAL LA+ +NLFG LTHY SG A +YFG+ +V + + ++ GFI++++N 
Sbjct: 394 VSISLGANPMFAALALAFASNLFGGLTHYGSGPAPLYFGSHFVSVQEWWRSGFILSIVNL 453

Query: 373 LIWGVVGTFWWKFLGL 326
            IW  +G++WW  LGL
Sbjct: 454 TIWLGLGSWWWYCLGL 469



>gb:BX571856_782194 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 472

 Score =  149 bits (377), Expect = 6e-35
 Identities = 77/202 (38%), Positives = 112/202 (55%)
 Frame = -2

Query: 928 MIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVL 749
           MIG  ++A++LW  G  + I + + A                  L+E  AW+TL WF+VL
Sbjct: 273 MIGIFVIALTLWIVGSFIHIDATLTAFIALALLLLTGVLTWQDILNETGAWNTLVWFSVL 332

Query: 748 VGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALY 569
           V MA QL  LG + W+S  +A SL    LSWP   +IL   YF  HYLFAS T H+ A+Y
Sbjct: 333 VLMADQLNKLGFIPWLSKSIATSLG--GLSWPIVLVILILFYFYSHYLFASSTAHISAMY 390

Query: 568 SAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIM 389
           +A L + +A+G P + +AL L +  NL  + THYSSG A + F +GYV     +    I+
Sbjct: 391 AALLGVAIAAGAPPLFSALMLGFFGNLLASTTHYSSGPAPILFSSGYVTQKRWWTMNLIL 450

Query: 388 AVINALIWGVVGTFWWKFLGLY 323
             +  +IW  +G+ W K +G++
Sbjct: 451 GFVYFIIWIGLGSLWMKVIGIF 472



>gb:BA000017_678380 Staphylococcus aureus subsp. aureus Mu50 DNA,
           complete genome.
          Length = 200

 Score =  149 bits (377), Expect = 6e-35
 Identities = 77/202 (38%), Positives = 112/202 (55%)
 Frame = -2

Query: 928 MIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVL 749
           MIG  ++A++LW  G  + I + + A                  L+E  AW+TL WF+VL
Sbjct: 1   MIGIFVIALTLWIVGSFIHIDATLTAFIALALLLLTGVLTWQDILNETGAWNTLVWFSVL 60

Query: 748 VGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALY 569
           V MA QL  LG + W+S  +A SL    LSWP   +IL   YF  HYLFAS T H+ A+Y
Sbjct: 61  VLMADQLNKLGFIPWLSKSIATSLG--GLSWPIVLVILILFYFYSHYLFASSTAHISAMY 118

Query: 568 SAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIM 389
           +A L + +A+G P + +AL L +  NL  + THYSSG A + F +GYV     +    I+
Sbjct: 119 AALLGVAIAAGAPPLFSALMLGFFGNLLASTTHYSSGPAPILFSSGYVTQKRWWTMNLIL 178

Query: 388 AVINALIWGVVGTFWWKFLGLY 323
             +  +IW  +G+ W K +G++
Sbjct: 179 GFVYFIIWIGLGSLWMKVIGIF 200



>pir|F90078|F90078 hypothetical protein SA2486 [imported] -
           Staphylococcus aureus (strain N315)>gb:SAU564499_172530
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, strain
           Michigan.>gb:SAU564500_172532 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           strain New Jersey.>gb:SAU564501_172533 Staphylococcus
           aureus 2486 gene for 2-oxoglutarate/malate translocator
           homologue, strain PC3.>gb:SAU564502_172534
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, strain St
           Luke.>gb:SAU564503_172535 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           strain PC1.>gb:SAU564504_172536 Staphylococcus aureus
           2486 gene for 2-oxoglutarate/malate translocator
           homologue, isolate 6096.>gb:SAU564505_172537
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, isolate
           1018.>gb:SAU564506_172538 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           strain SMH11888.>gb:SAU564507_172539 Staphylococcus
           aureus 2486 gene for 2-oxoglutarate/malate translocator
           homologue, strain SMH18000.>gb:SAU564508_172540
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, strain
           SMH18037.>gb:SAU564509_172541 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           strain SMH18034.>gb:SAU564510_172542 Staphylococcus
           aureus 2486 gene for 2-oxoglutarate/malate translocator
           homologue, strain SMH12248.>gb:SAU564511_172543
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, strain
           SMH8997.>gb:SAU564512_172544 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           strain SMH10501.>gb:SAU564513_172545 Staphylococcus
           aureus 2486 gene for 2-oxoglutarate/malate translocator
           homologue, strain SMH17608.>gb:SAU564514_172546
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, strain
           SMH17487.>gb:SAU564515_172547 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           strain SMH14017.>gb:SAU564523_172555 Staphylococcus
           aureus 2486 gene for 2-oxoglutarate/malate translocator
           homologue, isolate 3700.>gb:SAU564524_172556
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, isolate
           3759.>gb:SAU564525_172557 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           isolate AG.>gb:SAU564526_172558 Staphylococcus aureus
           2486 gene for 2-oxoglutarate/malate translocator
           homologue, strain SMH2.>gb:SAU564527_172559
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, strain
           LLA.>gb:SAU564528_172560 Staphylococcus aureus 2486 gene
           for 2-oxoglutarate/malate translocator homologue, strain
           LLE.>gb:BA000018_680973 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete genome.
          Length = 472

 Score =  149 bits (377), Expect = 6e-35
 Identities = 77/202 (38%), Positives = 112/202 (55%)
 Frame = -2

Query: 928 MIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVL 749
           MIG  ++A++LW  G  + I + + A                  L+E  AW+TL WF+VL
Sbjct: 273 MIGIFVIALTLWIVGSFIHIDATLTAFIALALLLLTGVLTWQDILNETGAWNTLVWFSVL 332

Query: 748 VGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALY 569
           V MA QL  LG + W+S  +A SL    LSWP   +IL   YF  HYLFAS T H+ A+Y
Sbjct: 333 VLMADQLNKLGFIPWLSKSIATSLG--GLSWPIVLVILILFYFYSHYLFASSTAHISAMY 390

Query: 568 SAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIM 389
           +A L + +A+G P + +AL L +  NL  + THYSSG A + F +GYV     +    I+
Sbjct: 391 AALLGVAIAAGAPPLFSALMLGFFGNLLASTTHYSSGPAPILFSSGYVTQKRWWTMNLIL 450

Query: 388 AVINALIWGVVGTFWWKFLGLY 323
             +  +IW  +G+ W K +G++
Sbjct: 451 GFVYFIIWIGLGSLWMKVIGIF 472



>gb:BX927154_833578 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment
           7/10.>gb:AX066949_1460377 Sequence 531 from Patent
           WO0100805.
          Length = 443

 Score =  149 bits (376), Expect = 8e-35
 Identities = 76/206 (36%), Positives = 113/206 (54%), Gaps = 1/206 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGD-ALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAW 761
           E  + GT ++ + LW  GD  LGI++   A                  + EK+AWDT+ W
Sbjct: 240 EKVLAGTFVVLLLLWTGGDLVLGISATTTAFVGVIILLVAHVLTWEDIIQEKTAWDTMVW 299

Query: 760 FAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHV 581
           FAVL  MA+ L+  G ++W+S  +A SL    ++W  A ++L   YF  HY FAS T H+
Sbjct: 300 FAVLYMMATALSQYGFIAWISEVIASSLG--GMNWVVALVVLVLIYFFSHYFFASATAHI 357

Query: 580 GALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKF 401
            A+Y AFL   +A G P ++AAL LAY +NLF +LT YS G +   FG  Y+ + + ++ 
Sbjct: 358 SAMYLAFLGAAIAIGAPPLMAALVLAYTSNLFSSLTQYSGGPSPTLFGLNYITVGEWWRT 417

Query: 400 GFIMAVINALIWGVVGTFWWKFLGLY 323
             I   ++  IW V+G  W   +GL+
Sbjct: 418 SAIAGAVSITIWLVIGGLWMNVIGLW 443



>gb:BA000036_719772 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.
          Length = 476

 Score =  149 bits (376), Expect = 8e-35
 Identities = 76/206 (36%), Positives = 113/206 (54%), Gaps = 1/206 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGD-ALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAW 761
           E  + GT ++ + LW  GD  LGI++   A                  + EK+AWDT+ W
Sbjct: 273 EKVLAGTFVVLLLLWTGGDLVLGISATTTAFVGVIILLVAHVLTWEDIIQEKTAWDTMVW 332

Query: 760 FAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHV 581
           FAVL  MA+ L+  G ++W+S  +A SL    ++W  A ++L   YF  HY FAS T H+
Sbjct: 333 FAVLYMMATALSQYGFIAWISEVIASSLG--GMNWVVALVVLVLIYFFSHYFFASATAHI 390

Query: 580 GALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKF 401
            A+Y AFL   +A G P ++AAL LAY +NLF +LT YS G +   FG  Y+ + + ++ 
Sbjct: 391 SAMYLAFLGAAIAIGAPPLMAALVLAYTSNLFSSLTQYSGGPSPTLFGLNYITVGEWWRT 450

Query: 400 GFIMAVINALIWGVVGTFWWKFLGLY 323
             I   ++  IW V+G  W   +GL+
Sbjct: 451 SAIAGAVSITIWLVIGGLWMNVIGLW 476



>gb:BA000033_712905 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.>gb:BX571857_784816
           Staphylococcus aureus strain MSSA476, complete genome.
          Length = 472

 Score =  149 bits (376), Expect = 8e-35
 Identities = 77/202 (38%), Positives = 112/202 (55%)
 Frame = -2

Query: 928 MIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVL 749
           MIG  ++A++LW  G  + I + + A                  L+E  AW+TL WF+VL
Sbjct: 273 MIGIFVVALTLWIVGSFIHIDATLTAFIALALLLLTGVLTWQDILNETGAWNTLVWFSVL 332

Query: 748 VGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALY 569
           V MA QL  LG + W+S  +A SL    LSWP   +IL   YF  HYLFAS T H+ A+Y
Sbjct: 333 VLMADQLNKLGFIPWLSKSIATSLG--GLSWPIVLVILILFYFYSHYLFASSTAHISAMY 390

Query: 568 SAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIM 389
           +A L + +A+G P + +AL L +  NL  + THYSSG A + F +GYV     +    I+
Sbjct: 391 AALLGVAIAAGAPPLFSALMLGFFGNLLASTTHYSSGPAPILFSSGYVTQKRWWTMNLIL 450

Query: 388 AVINALIWGVVGTFWWKFLGLY 323
             +  +IW  +G+ W K +G++
Sbjct: 451 GFVYFIIWIGLGSLWMKVIGIF 472



>gb:CP000046_92783 Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:SAU564516_172548 Staphylococcus aureus 2486
           gene for 2-oxoglutarate/malate translocator homologue,
           strain LIM2.>gb:SAU564517_172549 Staphylococcus aureus
           2486 gene for 2-oxoglutarate/malate translocator
           homologue, strain LIM3.>gb:SAU564518_172550
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, isolate
           307.>gb:SAU564519_172551 Staphylococcus aureus 2486 gene
           for 2-oxoglutarate/malate translocator homologue,
           isolate Duf.>gb:SAU564520_172552 Staphylococcus aureus
           2486 gene for 2-oxoglutarate/malate translocator
           homologue, isolate 23.>gb:SAU564521_172553
           Staphylococcus aureus 2486 gene for
           2-oxoglutarate/malate translocator homologue, isolate
           309.>gb:SAU564522_172554 Staphylococcus aureus 2486 gene
           for 2-oxoglutarate/malate translocator homologue, strain
           LIM1.
          Length = 472

 Score =  149 bits (376), Expect = 8e-35
 Identities = 77/202 (38%), Positives = 112/202 (55%)
 Frame = -2

Query: 928 MIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVL 749
           MIG  ++A++LW  G  + I + + A                  L+E  AW+TL WF+VL
Sbjct: 273 MIGIFVVALTLWIVGSFIHIDATLTAFIALALLLLTGVLTWQDILNETGAWNTLVWFSVL 332

Query: 748 VGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALY 569
           V MA QL  LG + W+S  +A SL    LSWP   +IL   YF  HYLFAS T H+ A+Y
Sbjct: 333 VLMADQLNKLGFIPWLSKSIATSLG--GLSWPIVLVILILFYFYSHYLFASSTAHISAMY 390

Query: 568 SAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIM 389
           +A L + +A+G P + +AL L +  NL  + THYSSG A + F +GYV     +    I+
Sbjct: 391 AALLGVAIAAGAPPLFSALMLGFFGNLLASTTHYSSGPAPILFSSGYVTQKRWWTMNLIL 450

Query: 388 AVINALIWGVVGTFWWKFLGLY 323
             +  +IW  +G+ W K +G++
Sbjct: 451 GFVYFIIWIGLGSLWMKVIGIF 472



>gb:BX950851_843133 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 470

 Score =  148 bits (374), Expect = 1e-34
 Identities = 72/205 (35%), Positives = 110/205 (53%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW ++G  L  V+ W  G  L I + + A+                 +SEK AW T+ WF
Sbjct: 268 EWVVLGVFLGLVTFWVLGSTLNIDATLTALAGLSVLLLSRALTWDDVVSEKEAWHTVVWF 327

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           AVL+ +A QL  +G+++W+      ++    + W     +L   Y+  HYL AS   H+ 
Sbjct: 328 AVLMTLAGQLNKMGLIAWLGGLAGNAVS--GMHWLPMLGLLLLVYYYSHYLMASAIAHIS 385

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+Y+ F+++ LA+G P +L  L     +NLF + THYSSG A + FG GYV L   +K G
Sbjct: 386 AMYAIFVSIALAAGAPPMLTVLVFGIFSNLFMSTTHYSSGPAPILFGTGYVPLGTWWKIG 445

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           F+++++   IW  VG  WWK LG +
Sbjct: 446 FLVSLVIIPIWLGVGGMWWKLLGFW 470



>gb:AL935255_550965 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 4/11.
          Length = 473

 Score =  148 bits (373), Expect = 2e-34
 Identities = 74/205 (36%), Positives = 114/205 (55%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M G  +LA+ LW      G+ + + A                  L E  AW+TL WF
Sbjct: 271 EKLMGGIFMLALFLWISASLTGLDATLVAFIAVTLLLLTGVLSVDDLLHENGAWNTLVWF 330

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           ++L+ MA +L +LG + W+S  + ++LQ +S  W  A L+L   YF  HYLFA  T HV 
Sbjct: 331 SILIFMAGKLNSLGFIPWLSQTMGQALQGISWLWVLAALMLV--YFYSHYLFAGATAHVS 388

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+Y AFL + +++G P +LAAL L ++  +F + THY++G A++ FG+GY+   + ++  
Sbjct: 389 AMYGAFLGVAISAGAPPMLAALLLGFDGAIFSSTTHYANGPASIMFGSGYITQSEWWRLN 448

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
             +     L+WGV GT W K LG +
Sbjct: 449 LCLGGFYLLVWGVGGTLWMKLLGYW 473



>gb:AE004969_61152 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 488

 Score =  147 bits (371), Expect = 3e-34
 Identities = 69/156 (44%), Positives = 103/156 (66%)
 Frame = -2

Query: 790 EKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIH 611
           EKSAWDT+ WF  L+ MA+ L  LG++ W S  +A+S+  L +S  AA +IL  +Y   H
Sbjct: 333 EKSAWDTIIWFGALIMMAAFLNKLGLIKWFSGVLAESVGGLGVSGTAAGVILVLAYMYAH 392

Query: 610 YLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAG 431
           Y+FAS T H+ A++ AFLA  ++   P +  AL +A  +N+   LTHY++G + V FG+G
Sbjct: 393 YMFASTTAHITAMFGAFLAAAVSLNAPAMPTALMMAAASNIMMTLTHYATGTSPVIFGSG 452

Query: 430 YVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
           Y  + + +K GFIM+V+N LI+ V+G+ WWK LG +
Sbjct: 453 YTTMGEWWKAGFIMSVVNFLIFSVIGSIWWKVLGYW 488



>gb:BX950851_842718 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 484

 Score =  146 bits (368), Expect = 7e-34
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 2/207 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EW M  T++L + LW  GD LG+ +  A+                   +EK AWDTL WF
Sbjct: 278 EWLMAFTVILLLVLWIFGDRLGVDATTASFVGLSFLLLTGVLSWEDVKNEKGAWDTLIWF 337

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCL--SLSWPAAFLILQASYFCIHYLFASQTGH 584
           A L+ MA+QL  LG  +W  + +  ++  L    SW    L+L A+YF  HY FAS    
Sbjct: 338 AALLMMANQLKKLGFTNWFGDLIGSNIGHLMQGTSWVLVLLLLNAAYFYTHYFFASGNAQ 397

Query: 583 VGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFK 404
           + AL++ FL + +   +P V  A  LA+ ++L+ +LT Y+  +  + FGAGYV     ++
Sbjct: 398 IAALFAVFLGVGINLNIPAVPMAFMLAFTSSLYCSLTQYTHARGPILFGAGYVPTAVWWR 457

Query: 403 FGFIMAVINALIWGVVGTFWWKFLGLY 323
            GF+++++N  I+   G  WWK + LY
Sbjct: 458 TGFVVSLVNQAIFMGAGLLWWKAIDLY 484



>gb:AL935255_550976 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 4/11.
          Length = 472

 Score =  144 bits (364), Expect = 2e-33
 Identities = 71/205 (34%), Positives = 110/205 (53%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M G  LLA+ LW     +G+ + + A                  L E  AW+TL WF
Sbjct: 270 EKIMGGVFLLALVLWMLSSFIGLEASLVAFMAVSLLLVAGVLSVDDVLHETGAWNTLVWF 329

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           ++L+ MA++L  LG + W+S  +  +L+    SW      L   YF  HYLFAS T HV 
Sbjct: 330 SILIFMANELNKLGFIPWLSGAIGGALK--GFSWGIVLAALVLFYFYSHYLFASGTAHVS 387

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+Y A L + +++G P   AAL L +  ++F + THY++G A+V FG+GYV     ++  
Sbjct: 388 AMYGALLGVAVSAGAPATFAALILGFTGSIFASTTHYANGPASVLFGSGYVTQGKWWQLN 447

Query: 397 FIMAVINALIWGVVGTFWWKFLGLY 323
           FI+ +   ++WG +G  W K +G++
Sbjct: 448 FILGLFYLVVWGGIGALWMKVIGIW 472



>pir|B81831|B81831 probable integral membrane transport protein
           NMA2015 [imported] - Neisseria meningitidis (strain
           Z2491 serogroup A)>gb:NMA6Z2491_154890 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 6/7.
          Length = 488

 Score =  144 bits (364), Expect = 2e-33
 Identities = 68/156 (43%), Positives = 102/156 (65%)
 Frame = -2

Query: 790 EKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIH 611
           EKSAWDT+ WF  L+ MA+ L  LG++ W S  +A+S+  L +S  AA +IL  +Y   H
Sbjct: 333 EKSAWDTIIWFGALIMMAAFLNKLGLIKWFSGVLAESVGGLGVSGTAAGVILVLAYMYAH 392

Query: 610 YLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAG 431
           Y+FAS T H+ A++ AF A  ++   P +  AL +A  +N+   LTHY++G + V FG+G
Sbjct: 393 YMFASTTAHITAMFGAFFAAAVSLNAPAMPTALMMAAASNIMMTLTHYATGTSPVIFGSG 452

Query: 430 YVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
           Y  + + +K GFIM+V+N LI+ V+G+ WWK LG +
Sbjct: 453 YTTMGEWWKAGFIMSVVNFLIFFVIGSIWWKVLGYW 488



>pir|A81194|A81194 C4-dicarboxylate transporter NMB0470 [imported] -
           Neisseria meningitidis (strain MC58 serogroup
           B)>gb:AE002404_45935 Neisseria meningitidis serogroup B
           strain MC58 section 46 of 206 of the complete
           genome.>gb:AE002098_896048 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 488

 Score =  144 bits (364), Expect = 2e-33
 Identities = 68/156 (43%), Positives = 102/156 (65%)
 Frame = -2

Query: 790 EKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIH 611
           EKSAWDT+ WF  L+ MA+ L  LG++ W S  +A+S+  L +S  AA +IL  +Y   H
Sbjct: 333 EKSAWDTIIWFGALIMMAAFLNKLGLIKWFSGVLAESVGGLGVSGTAAGVILVLAYMYAH 392

Query: 610 YLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAG 431
           Y+FAS T H+ A++ AF A  ++   P +  AL +A  +N+   LTHY++G + V FG+G
Sbjct: 393 YMFASTTAHITAMFGAFFAAAVSLNAPAMPTALMMAAASNIMMTLTHYATGTSPVIFGSG 452

Query: 430 YVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
           Y  + + +K GFIM+V+N LI+ V+G+ WWK LG +
Sbjct: 453 YTTMGEWWKAGFIMSVVNFLIFFVIGSIWWKVLGYW 488



>gb:AE016827_342599 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 486

 Score =  140 bits (353), Expect = 4e-32
 Identities = 76/204 (37%), Positives = 108/204 (52%), Gaps = 1/204 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDAL-GIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAW 761
           EW +    +L + LW  GD +  I + V+A                  +SE +AWDT+ W
Sbjct: 283 EWILALDFILLLLLWTVGDLVFHIPATVSAFVGLVILLLTNIMSWKNIISETAAWDTMFW 342

Query: 760 FAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHV 581
           FAVLV MA+ L   G +SW+S  +A S+   S SWP AF IL   YF   Y FAS   H+
Sbjct: 343 FAVLVMMANALNKYGTISWISTHIADSVG--SFSWPVAFTILVLVYFYTRYFFASAMAHI 400

Query: 580 GALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKF 401
            A+Y AF+A  +A G P ++AA+GL Y + L  +LT Y+ G     +G+GY      +  
Sbjct: 401 SAMYLAFVAAAIAVGTPPIIAAIGLGYTSTLSMSLTQYAGGPGPALYGSGYNSTGQWWGV 460

Query: 400 GFIMAVINALIWGVVGTFWWKFLG 329
            F +++++  IW  VG  W K LG
Sbjct: 461 SFAVSILSLAIWFSVGGVWMKLLG 484



>gb:BX842651_824770 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 6/11.
          Length = 488

 Score =  140 bits (352), Expect = 5e-32
 Identities = 74/212 (34%), Positives = 110/212 (51%), Gaps = 7/212 (3%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDAL-------GIASVVAAMXXXXXXXXXXXXXXXXXLSEKSA 779
           E  +IG   L + +W  G  L        + +   A                  L EK A
Sbjct: 277 EKILIGVFFLLLFIWAGGPELLSSDPLFKVDATAGAFVGLGVLLFSGVLTWDDLLKEKGA 336

Query: 778 WDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFA 599
           WDT+ WF+ LV +A+ L  LG+V+W S  V  S+    L W  A  IL   Y  IHY FA
Sbjct: 337 WDTVTWFSSLVMLATFLNKLGVVAWFSKTVESSIAHWGLGWMEAAAILVLLYVFIHYFFA 396

Query: 598 SQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDL 419
           S T H+ AL+++F  + +A G P ++  L L + ++L  +LTHY +G A V FG+GYV +
Sbjct: 397 SNTAHISALFASFFGVGVALGAPPLMFGLFLGFASSLCASLTHYGTGSAPVLFGSGYVTM 456

Query: 418 PDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
            + +K+GF++ ++N LI+      WWK LG +
Sbjct: 457 GEWWKWGFVVTLLNLLIFAGGCAVWWKVLGYW 488



>gb:AP006840_569825 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 472

 Score =  136 bits (343), Expect = 5e-31
 Identities = 66/202 (32%), Positives = 108/202 (53%)
 Frame = -2

Query: 928 MIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVL 749
           M+   LL + LW       + +   A+                 L+EK  WD L WF  L
Sbjct: 272 MLAVFLLTLVLWATSQWTNLNATAIALLGVAILLVIGVLDWQDVLAEKGGWDALIWFGGL 331

Query: 748 VGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALY 569
           VG+A+ L+ +GI+ W+++ +  SL  +S SW  AF+++  +Y   HY  AS T H  A +
Sbjct: 332 VGLATGLSKVGIIGWLASILETSLGGIS-SWFLAFILVVIAYTYSHYFIASMTAHATAFF 390

Query: 568 SAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIM 389
                + +++G P  +  L L +  +L   +THY +G A +YFGAGY+D    +K+GF+ 
Sbjct: 391 VPLALVAISAGAPLEITVLVLGFFNSLNAVMTHYGTGPAPIYFGAGYIDQGTWWKWGFVT 450

Query: 388 AVINALIWGVVGTFWWKFLGLY 323
           ++IN ++W   G+ WWK +GL+
Sbjct: 451 SLINLVVWLGAGSLWWKVIGLW 472



>gb:BX950851_841580 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 473

 Score =  124 bits (312), Expect = 2e-27
 Identities = 61/197 (30%), Positives = 99/197 (50%)
 Frame = -2

Query: 913 LLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGMAS 734
           +LA+  WG     G ++    +                 LS+++AWDT+ WF+ ++ +A+
Sbjct: 279 VLALLGWGTSLITGFSATSVGLALVAYLFVTQAVQWKDVLSDRAAWDTVIWFSAIISLAA 338

Query: 733 QLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFLA 554
            L++LG + WM+  +  S+Q         F+IL   Y  +HYLFA+ +GHV ALY+ F A
Sbjct: 339 GLSDLGFIKWMTVKLGNSIQGFGAM--ETFVILGILYIYVHYLFATASGHVAALYAPFAA 396

Query: 553 MNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINA 374
             +A+G P ++ A+     +NL    T Y  G   +YF  GY +    +K  F +   N 
Sbjct: 397 TAIAAGAPPMMVAICFGIFSNLMWGNTEYGGGPGPIYFAQGYFERHRFYKINFCIVTFNV 456

Query: 373 LIWGVVGTFWWKFLGLY 323
            +  +VG  WWK +G Y
Sbjct: 457 ALIFIVGLVWWKLIGYY 473



>gb:AL935252_550093 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 1/11.
          Length = 471

 Score =  115 bits (289), Expect = 9e-25
 Identities = 64/199 (32%), Positives = 104/199 (52%)
 Frame = -2

Query: 919 TMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGM 740
           T +LA+ LW  G  +GI +   +                  L+E  AW+ L W ++++ M
Sbjct: 275 TFILAIVLWLIGTKIGIDATEVSFIAVVILLITGVLTTNDLLNEHFAWNILVWLSIIMMM 334

Query: 739 ASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAF 560
           + +L  LG   W S  +   L    ++W +  +IL  +YF +HY+F S +  + ALY+ F
Sbjct: 335 SKKLMTLGFFPWFSKTLGHLLN--GMNWISVLIILFLAYFYLHYMFPSVSTQISALYAGF 392

Query: 559 LAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVI 380
           L++ + +GVP VLAAL LA+  ++  + T YS+G AA+    GYV   + ++   I+ VI
Sbjct: 393 LSIAIGAGVPHVLAALLLAFAGSINLSTTPYSAGPAALLSSTGYVTSAEWWRLSAIIGVI 452

Query: 379 NALIWGVVGTFWWKFLGLY 323
             +IW   G  W K LG +
Sbjct: 453 FNVIWLGGGLLWTKLLGFW 471



>gb:CP000033_89184 Lactobacillus acidophilus NCFM, complete genome.
          Length = 488

 Score =  111 bits (278), Expect = 2e-23
 Identities = 53/156 (33%), Positives = 89/156 (57%)
 Frame = -2

Query: 790 EKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIH 611
           E  AW+ L W ++L+ MA +L + G ++W +  +   +    ++W    ++L    F  H
Sbjct: 335 ETGAWNILIWLSILIFMAGKLISYGFIAWFAKFIQSEVH--GINWGLVLVVLILLMFYTH 392

Query: 610 YLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAG 431
           Y FAS T H+ ALY  FL +  A G P  L+A+ LA+   +  + THY++G A++    G
Sbjct: 393 YFFASGTAHMTALYLPFLTVATAMGAPLGLSAMLLAFTGVINASTTHYANGPASILATTG 452

Query: 430 YVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
           YV   + +K  FI+ +I  +I+G+VGT W K +G++
Sbjct: 453 YVKQSEWWKMNFILGLIYMVIFGIVGTIWMKIIGIW 488



>gb:AE017154_392685 Haemophilus ducreyi strain 35000HP section 4 of
           6 of the complete genome.>gb:AE017143_1026947
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 482

 Score =  102 bits (253), Expect = 1e-20
 Identities = 56/194 (28%), Positives = 94/194 (48%)
 Frame = -2

Query: 913 LLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGMAS 734
           +LA+  W   D L + + V A+                    K+ WDTL W+  ++ M++
Sbjct: 281 VLALLGWVFSDFLHVNATVVALITMVLCIMLSIVSWDDIRKNKAGWDTLIWYGGIISMST 340

Query: 733 QLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFLA 554
            L+  G   W++  ++++L        A  +IL  S   + YLFAS   +V A+   F  
Sbjct: 341 VLSKAGFFEWLATTLSENLNFGDYGNVALVVILLLSV-SVRYLFASGGAYVAAMVPVFAT 399

Query: 553 MNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINA 374
           +   +G P  L ALGL ++ +  G++THY  G   + FGAGY D+   +  G ++A  + 
Sbjct: 400 VGKVAGAPVELLALGLLFSNSYGGSVTHYGGGPGPITFGAGYNDIKSWWMAGAVIAFGSL 459

Query: 373 LIWGVVGTFWWKFL 332
           +I   +G  WW+FL
Sbjct: 460 IIHVTLGIAWWQFL 473



>sp|Q57048|YBHI_HAEIN Hypothetical protein HI0020.>pir|B64043|B64043
           conserved hypothetical protein HI0020 - Haemophilus
           influenzae>gb:U32687_203711 Haemophilus influenzae Rd
           KW20 section 2 of 163 of the complete
           genome.>gb:L42023_1096260 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 479

 Score =  102 bits (253), Expect = 1e-20
 Identities = 59/194 (30%), Positives = 93/194 (47%)
 Frame = -2

Query: 913 LLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWFAVLVGMAS 734
           ++A+  W   ++L I + + A+                 L  K AW+TL W+  ++GM+ 
Sbjct: 281 VIALFGWIFSNSLHINATIVAIIVMVLCIVLSIVTWDDILKSKGAWNTLVWYGGIIGMSG 340

Query: 733 QLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVGALYSAFLA 554
            L   G   W++N ++  LQ       A  +IL  S   + YLFAS   +V A+   F  
Sbjct: 341 LLEKSGFFKWLANTLSTILQFEGHGMMALIVILTLSV-SVRYLFASGGAYVAAMVPVFAT 399

Query: 553 MNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINA 374
           +   +G P  L ALGL +  +  G++THY  G   + FGAGY D+   +  G I+A  + 
Sbjct: 400 VGHVTGAPTELLALGLVFANSYGGSVTHYGGGPGPIAFGAGYNDIKSWWITGAIIAFGSL 459

Query: 373 LIWGVVGTFWWKFL 332
           +I   +G  WWK L
Sbjct: 460 IIHLTIGMAWWKLL 473



>gb:BA000040_732760 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 490

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 62/199 (31%), Positives = 97/199 (48%), Gaps = 13/199 (6%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDA-------LG---IASVVAAMXXXXXXXXXXXXXXXXXLSE 788
           EW M+  ++LA+ LW  G +       LG   + +                      +SE
Sbjct: 280 EWIMLALIVLAMFLWIAGSSPDINVPLLGSNFVNATTVVFIVISLMLVTGVIEFADIVSE 339

Query: 787 KSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHY 608
           KSAW+   +F  L+ +AS L  +G + W +   AK L  LS S   A ++L A +F IHY
Sbjct: 340 KSAWEVFFYFTSLLTLASGLNEIGFIKWFATEYAKPLAGLSPS--TAMILLVALFFWIHY 397

Query: 607 LFASQTGHVGALYSAFLAMNLASGVPGV---LAALGLAYNTNLFGALTHYSSGQAAVYFG 437
            F+S T H  A+    LA+   SG+PG+     A+   Y+  L G ++ Y++G A +YFG
Sbjct: 398 FFSSITSHAAAVLPVVLAVG--SGIPGLPVTTLAMLCMYSLGLMGVISPYATGPAPMYFG 455

Query: 436 AGYVDLPDVFKFGFIMAVI 380
           +GY+     + FG I  ++
Sbjct: 456 SGYIGKGQFWGFGLIFGLL 474



>gb:AE016757_324744 Escherichia coli CFT073 section 3 of 18 of the
           complete genome.>gb:AE014075_955328 Escherichia coli
           CFT073 complete genome.
          Length = 487

 Score = 96.7 bits (239), Expect = 6e-19
 Identities = 62/208 (29%), Positives = 98/208 (47%), Gaps = 3/208 (1%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EWT+IG +LL++ LW  G  + I +    +                     SAW+TL   
Sbjct: 287 EWTLIGLVLLSLGLWVFGSEV-INATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNL 345

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A LV MA+ LT  G + W +N ++  L+  S +  A  ++L   ++  HYLFAS + H  
Sbjct: 346 ATLVVMANGLTRSGFIDWFANTMSTHLEGFSPN--ATVIVLVLVFYFAHYLFASLSAHTA 403

Query: 577 ALYSAFLAMNLASGVPGV---LAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVF 407
            +    LA+    G+PGV      + L  +  + G LT Y++G   + +G GYV   D +
Sbjct: 404 TMLPVILAVG--KGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSKDYW 461

Query: 406 KFGFIMAVINALIWGVVGTFWWKFLGLY 323
           + G I  VI   +  +VG   W  L ++
Sbjct: 462 RLGAIFGVIYISMLLLVG---WPILAMW 486



>gb:AE008724_242341 Salmonella typhimurium LT2, section 32 of 220 of
           the complete genome.>gb:AE006468_999423 Salmonella
           typhimurium LT2, complete genome.
          Length = 487

 Score = 96.7 bits (239), Expect = 6e-19
 Identities = 62/208 (29%), Positives = 97/208 (46%), Gaps = 3/208 (1%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EWT+IG +LL++ LW  G  + I +    +                     SAW+TL   
Sbjct: 287 EWTLIGLVLLSLGLWVFGGKI-INATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNL 345

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A LV MA+ LT  G + W +N ++  L+    S  A  ++L   ++  HYLFAS + H  
Sbjct: 346 ATLVVMANGLTRSGFIDWFANTMSTHLE--GFSPDATVIVLVLVFYFAHYLFASLSAHTA 403

Query: 577 ALYSAFLAMNLASGVPGV---LAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVF 407
            +    LA+    G+PGV      + L  +  + G LT Y++G   + +G GYV   D +
Sbjct: 404 TMLPVILAVG--KGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSRDYW 461

Query: 406 KFGFIMAVINALIWGVVGTFWWKFLGLY 323
           + G I  VI   +  +VG   W  L ++
Sbjct: 462 RLGAIFGVIYIAMLLLVG---WPILAMW 486



>gb:AF417305_1797900 Castanea sativa putative
           oxoglutarate-malate-translocase mRNA, partial cds.
          Length = 48

 Score = 96.3 bits (238), Expect = 8e-19
 Identities = 43/48 (89%), Positives = 44/48 (91%)
 Frame = -2

Query: 466 SSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
           S GQAAVYFGAGYVDLPDVFK GFIMAVIN +IWGVVG FWWKFLGLY
Sbjct: 1   SFGQAAVYFGAGYVDLPDVFKVGFIMAVINTIIWGVVGAFWWKFLGLY 48



>pir|AI0010|AI0010 probable membrane transport protein YPO0081
           [imported] - Yersinia pestis (strain
           CO92)>gb:AE013606_298393 Yersinia pestis KIM section 6
           of 415 of the complete genome.>gb:AE017127_385940
           Yersinia pestis biovar Medievalis str. 91001 section 1
           of 16 of the complete genome.>gb:AJ414141_521940
           Yersinia pestis strain CO92 complete genome; segment
           1/20.>gb:BX936398_834722 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.>gb:AE009952_928576
           Yersinia pestis KIM complete genome.>gb:AE017042_1142506
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 475

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/153 (33%), Positives = 81/153 (52%)
 Frame = -2

Query: 787 KSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHY 608
           K AW+TL WF  ++G+AS L+   +  W++N +  ++      + A  +I   S   I Y
Sbjct: 321 KGAWNTLLWFGGIIGLASALSKEKVFDWLANLIQNNVDFGHNPFIALTIIGFLSII-IRY 379

Query: 607 LFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGY 428
            FAS + +  A+   FL +   +G   +  AL LA   +  GALTHY  G A + FGAGY
Sbjct: 380 FFASASSYAIAMLPVFLTVGKVAGADPMALALVLAATNSYGGALTHYGGGSAPIIFGAGY 439

Query: 427 VDLPDVFKFGFIMAVINALIWGVVGTFWWKFLG 329
            ++   +  G ++A +  ++   VG  WW+FLG
Sbjct: 440 NNVKQWWASGAVIATVCFIVTMTVGYVWWQFLG 472



>gb:AE016757_324889 Escherichia coli CFT073 section 3 of 18 of the
           complete genome.>gb:AE014075_955473 Escherichia coli
           CFT073 complete genome.
          Length = 477

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 51/202 (25%), Positives = 92/202 (45%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  ++G  +LA+  W    +LG+     A+                 +  K  W+TL W+
Sbjct: 271 EKMLLGVFVLALLGWIFSKSLGVDESTVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWY 330

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
             ++G++S L+ +    W++     +L        A F+I+  S   + Y FAS + ++ 
Sbjct: 331 GGIIGLSSLLSKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSII-VRYFFASGSAYIV 389

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+   F  +   SG P +L AL L ++ +  G +THY      V FG GY D+   +  G
Sbjct: 390 AMLPVFAMLANVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVG 449

Query: 397 FIMAVINALIWGVVGTFWWKFL 332
            ++ ++  L+   +G +WW  L
Sbjct: 450 AVLTILTFLVHITLGVWWWNML 471



>gb:AE005674_70473 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016981_370842 Shigella flexneri 2a str.
           2457T section 4 of 16 of the complete
           genome.>gb:AE014073_995592 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 456

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 51/202 (25%), Positives = 92/202 (45%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  ++G  +LA+  W    +LG+     A+                 +  K  W+TL W+
Sbjct: 250 EKMLLGVFVLALLGWIFSKSLGVDESTVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWY 309

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
             ++G++S L+ +    W++     +L        A F+I+  S   + Y FAS + ++ 
Sbjct: 310 GGIIGLSSLLSKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSII-VRYFFASGSAYIV 368

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+   F  +   SG P +L AL L ++ +  G +THY      V FG GY D+   +  G
Sbjct: 369 AMLPVFAMLANVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVG 428

Query: 397 FIMAVINALIWGVVGTFWWKFL 332
            ++ ++  L+   +G +WW  L
Sbjct: 429 AVLTILTFLVHITLGVWWWNML 450



>sp|P75763|YBHI_ECOLI Hypothetical protein ybhI.>pir|B64813|B64813
           ybhI protein - Escherichia coli (strain
           K-12)>gb:D90715_121488 Escherichia coli K12 genomic DNA.
           (17.1 - 17.4 min).>gb:U00096_199846 Escherichia coli
           K-12 MG1655 complete genome.
          Length = 477

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 51/202 (25%), Positives = 92/202 (45%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  ++G  +LA+  W    +LG+     A+                 +  K  W+TL W+
Sbjct: 271 EKMLLGVFVLALLGWIFSKSLGVDESTVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWY 330

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
             ++G++S L+ +    W++     +L        A F+I+  S   + Y FAS + ++ 
Sbjct: 331 GGIIGLSSLLSKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSII-VRYFFASGSAYIV 389

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+   F  +   SG P +L AL L ++ +  G +THY      V FG GY D+   +  G
Sbjct: 390 AMLPVFAMLANVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVG 449

Query: 397 FIMAVINALIWGVVGTFWWKFL 332
            ++ ++  L+   +G +WW  L
Sbjct: 450 AVLTILTFLVHITLGVWWWNML 471



>sp|P77405|CITT_ECOLI Citrate carrier (Citrate transporter)
           (Citrate/succinate antiporter).>pir|B64795|B64795 ybdS
           protein - Escherichia coli (strain
           K-12)>pir|C90710|C90710 probable membrane protein
           [imported] - Escherichia coli  (strain O157:H7,
           substrain RIMD 0509952)>gb:D90701_121295 Escherichia
           coli K12 genomic DNA. (13.6 - 14.0
           min).>gb:D90702_121304 Escherichia coli K12 genomic DNA.
           (13.7 - 14.1 min).>gb:ECU82598_134715 Escherichia coli
           genomic sequence of minutes 9 to 12.>gb:U00096_199706
           Escherichia coli K-12 MG1655 complete
           genome.>gb:BA000007_658663 Escherichia coli O157:H7 DNA,
           complete genome.
          Length = 487

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 61/208 (29%), Positives = 97/208 (46%), Gaps = 3/208 (1%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EWT+IG +LL++ LW  G  + I +    +                     SAW+TL   
Sbjct: 287 EWTLIGLVLLSLGLWVFGSEV-INATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNL 345

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A LV MA+ LT  G + W +  ++  L+  S +  A  ++L   ++  HYLFAS + H  
Sbjct: 346 ATLVVMANGLTRSGFIDWFAGTMSTHLEGFSPN--ATVIVLVLVFYFAHYLFASLSAHTA 403

Query: 577 ALYSAFLAMNLASGVPGV---LAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVF 407
            +    LA+    G+PGV      + L  +  + G LT Y++G   + +G GYV   D +
Sbjct: 404 TMLPVILAVG--KGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSKDYW 461

Query: 406 KFGFIMAVINALIWGVVGTFWWKFLGLY 323
           + G I  VI   +  +VG   W  L ++
Sbjct: 462 RLGAIFGVIYISMLLLVG---WPILAMW 486



>pir|G85579|G85579 probable membrane pump protein ybhI [imported] -
           Escherichia coli (strain O157:H7, substrain
           EDL933)>pir|F90728|F90728 probable membrane pump protein
           [imported] - Escherichia coli (strain O157:H7, substrain
           RIMD 0509952)>gb:AE005174_65032 Escherichia coli O157:H7
           EDL933, complete genome.>gb:BA000007_658810 Escherichia
           coli O157:H7 DNA, complete genome.
          Length = 477

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 51/202 (25%), Positives = 92/202 (45%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  ++G  +LA+  W    +LG+     A+                 +  K  W+TL W+
Sbjct: 271 EKMLLGVFVLALLGWIFSKSLGVDESSVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWY 330

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
             ++G++S L+ +    W++     +L        A F+I+  S   + Y FAS + ++ 
Sbjct: 331 GGIIGLSSLLSKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSII-VRYFFASGSAYIV 389

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
           A+   F  +   SG P +L AL L ++ +  G +THY      V FG GY D+   +  G
Sbjct: 390 AMLPVFAMLANVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVG 449

Query: 397 FIMAVINALIWGVVGTFWWKFL 332
            ++ ++  L+   +G +WW  L
Sbjct: 450 AVLTILTFLVHITLGVWWWNML 471



>pir|G85560|G85560 probable membrane protein ybdS [imported] -
           Escherichia coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_64880 Escherichia coli O157:H7
           EDL933, complete genome.
          Length = 487

 Score = 93.6 bits (231), Expect = 5e-18
 Identities = 60/206 (29%), Positives = 95/206 (46%), Gaps = 1/206 (0%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EWT+IG +LL++ LW  G  + I +    +                     SAW+TL   
Sbjct: 287 EWTLIGLVLLSLGLWVFGSEV-INATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNL 345

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
           A LV MA+ LT  G + W +  ++  L+  S +  A  ++L   ++  HYLFAS + H  
Sbjct: 346 ATLVVMANGLTRSGFIDWFAGTMSTHLEGFSPN--ATVIVLVLVFYFAHYLFASLSAHTA 403

Query: 577 ALYSAFLAMNLA-SGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKF 401
            +    LA+     GVP     + L  +  + G LT Y++G   + +G GYV   D ++ 
Sbjct: 404 TMLPVILAVGKXIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSKDYWRL 463

Query: 400 GFIMAVINALIWGVVGTFWWKFLGLY 323
           G I  VI   +  +VG   W  L ++
Sbjct: 464 GAIFGVIYISMLLLVG---WPILAMW 486



>pir|F71969|F71969 hypothetical protein jhp0131 - Helicobacter
           pylori (strain J99)>gb:AE001452_35125 Helicobacter
           pylori, strain J99 section 13 of 132 of the complete
           genome.>gb:AE001439_883895 Helicobacter pylori, strain
           J99 complete genome.
          Length = 482

 Score = 92.8 bits (229), Expect = 9e-18
 Identities = 59/205 (28%), Positives = 99/205 (48%), Gaps = 3/205 (1%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M+   LLA+  W  G +LG+ +   A+                 +  KSA++     
Sbjct: 275 EILMLSLTLLALLGWIFGKSLGLHASATALIVMVLMAFCKIVSYEDIIKNKSAFNIFLLL 334

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGHVG 578
             L+ MA  L N+G ++++ N     L+   L    A L + A ++  HY FAS T HV 
Sbjct: 335 GSLLTMAGGLKNVGFLNFIGNAAQNFLEHAHLDPLIAVLFIVALFYLSHYFFASITAHVS 394

Query: 577 ALYSAFLAMNLASGVPGV---LAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVF 407
           AL++ F  + + S + GV     +L L  +  + G LT Y +G + +Y+G+GY+   D +
Sbjct: 395 ALFALF--VGIGSHIQGVNLQELSLFLMLSLGIMGILTPYGTGPSTIYYGSGYIQSKDFW 452

Query: 406 KFGFIMAVINALIWGVVGTFWWKFL 332
           K+GFI   +  +++  V   W KF+
Sbjct: 453 KWGFIFGFLYLIVFLSVCAPWVKFI 477



>pir|AE0578|AE0578 citrate carrier [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:CP000026_76893 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AL627267_540940 Salmonella enterica serovar
           Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 3/20.
          Length = 501

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 62/220 (28%), Positives = 96/220 (43%), Gaps = 15/220 (6%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EWT+IG +LL++ LW  G  + I +    +                     SAW+TL   
Sbjct: 287 EWTLIGLVLLSLGLWVFGGKI-INATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNL 345

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQAS------------YFCI 614
           A LV MA+ LT  G + W +N ++  L+  S       L+L               ++  
Sbjct: 346 ATLVVMANGLTRSGFIDWFANTMSTHLEGFSPDATVIVLVLVLVLVLVLVLVLVLVFYFA 405

Query: 613 HYLFASQTGHVGALYSAFLAMNLASGVPGV---LAALGLAYNTNLFGALTHYSSGQAAVY 443
           HYLFAS + H   +    LA+    G+PGV      + L  +  + G LT Y++G   + 
Sbjct: 406 HYLFASLSAHTATMLPVILAVG--KGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVII 463

Query: 442 FGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
           +G GYV   D ++ G I  VI   +  +VG   W  L ++
Sbjct: 464 YGCGYVKSRDYWRLGAIFGVIYIAMLLLVG---WPILAMW 500



>gb:AE016841_346307 Salmonella enterica subsp. enterica serovar
           Typhi Ty2, section 8 of 16 of the complete
           genome.>gb:AE014613_983639 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, complete genome.
          Length = 511

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 62/230 (26%), Positives = 97/230 (42%), Gaps = 25/230 (10%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           EWT+IG +LL++ LW  G  + I +    +                     SAW+TL   
Sbjct: 287 EWTLIGLVLLSLGLWVFGGKI-INATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNL 345

Query: 757 AVLVGMASQLTNLGIVSWMSNCVAKSLQCLS----------------------LSWPAAF 644
           A LV MA+ LT  G + W +N ++  L+  S                      +      
Sbjct: 346 ATLVVMANGLTRSGFIDWFANTMSTHLEGFSPDATVIVLVLVLVLVLVLVLVLVLVLVLV 405

Query: 643 LILQASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGV---LAALGLAYNTNLFGALT 473
           L+L   ++  HYLFAS + H   +    LA  +  G+PGV      + L  +  + G LT
Sbjct: 406 LVLVLVFYFAHYLFASLSAHTATMLPVILA--VGKGIPGVPMEQLCILLVLSIGIMGCLT 463

Query: 472 HYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGLY 323
            Y++G   + +G GYV   D ++ G I  VI   +  +VG   W  L ++
Sbjct: 464 PYATGPGVIIYGCGYVKSRDYWRLGAIFGVIYIAMLLLVG---WPILAMW 510



>pir|B91122|B91122 hypothetical protein ECs3946 [imported] -
           Escherichia coli  (strain O157:H7, substrain RIMD
           0509952)>pir|A85967|A85967 hypothetical protein ygjE
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>gb:AE005174_68196 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:BA000007_661958
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 487

 Score = 82.8 bits (203), Expect = 9e-15
 Identities = 61/204 (29%), Positives = 95/204 (46%), Gaps = 6/204 (2%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXG----DALGIA-SVVAAMXXXXXXXXXXXXXXXXXLSEKSAWD 773
           E  M+G M+ A+ LW  G    DA  +  SVVA M                  S K+AW+
Sbjct: 286 EKRMLGLMVGALVLWIFGGDYIDAAMVGYSVVALMLLLRIISWDDIV------SNKAAWN 339

Query: 772 TLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQ 593
              W A L+ +A+ L N G +SW    +A SL   S +     LI+   ++ + Y FAS 
Sbjct: 340 VFFWLASLITLATGLNNTGFISWFGKLLAGSLSGYSPTMVMVALIV--VFYLLRYFFASA 397

Query: 592 TGHVGALYSAFLAMNLA-SGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLP 416
           T +  AL    +A  LA   +P  +  L +     L   LT Y++G + +Y+G+GY+   
Sbjct: 398 TAYTSALAPMMIAAALAMPEIPLPVFCLMVGAAIGLGSILTPYATGPSPIYYGSGYLPTA 457

Query: 415 DVFKFGFIMAVINALIWGVVGTFW 344
           D ++ G I  +I  ++  + G  W
Sbjct: 458 DYWRLGAIFGLIFLVLLVITGLLW 481



>sp|P39414|TTDT_ECOLI Putative tartrate carrier (Tartrate
           transporter) (Tartrate/succinate
           antiporter).>pir|E65094|QQECRS ygjE protein -
           Escherichia coli (strain K-12)>gb:ECU28379_133791
           Escherichia coli K-12 genome; approximately 68
           minutes.>gb:U00096_202079 Escherichia coli K-12 MG1655
           complete genome.
          Length = 487

 Score = 82.8 bits (203), Expect = 9e-15
 Identities = 61/204 (29%), Positives = 95/204 (46%), Gaps = 6/204 (2%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXG----DALGIA-SVVAAMXXXXXXXXXXXXXXXXXLSEKSAWD 773
           E  M+G M+ A+ LW  G    DA  +  SVVA M                  S K+AW+
Sbjct: 286 EKRMLGLMVGALVLWIFGGDYIDAAMVGYSVVALMLLLRIISWDDIV------SNKAAWN 339

Query: 772 TLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQ 593
              W A L+ +A+ L N G +SW    +A SL   S +     LI+   ++ + Y FAS 
Sbjct: 340 VFFWLASLITLATGLNNTGFISWFGKLLAGSLSGYSPTMVMVALIV--VFYLLRYFFASA 397

Query: 592 TGHVGALYSAFLAMNLA-SGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLP 416
           T +  AL    +A  LA   +P  +  L +     L   LT Y++G + +Y+G+GY+   
Sbjct: 398 TAYTSALAPMMIAAALAMPEIPLPVFCLMVGAAIGLGSILTPYATGPSPIYYGSGYLPTA 457

Query: 415 DVFKFGFIMAVINALIWGVVGTFW 344
           D ++ G I  +I  ++  + G  W
Sbjct: 458 DYWRLGAIFGLIFLVLLVITGLLW 481



>gb:AE005674_72688 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016988_372840 Shigella flexneri 2a str.
           2457T section 11 of 16 of the complete
           genome.>gb:AE014073_997590 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 487

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 61/204 (29%), Positives = 95/204 (46%), Gaps = 6/204 (2%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXG----DALGIA-SVVAAMXXXXXXXXXXXXXXXXXLSEKSAWD 773
           E  M+G M+ A+ LW  G    DA  +  SVVA M                  S K+AW+
Sbjct: 286 EKRMLGLMVGALVLWIFGGDYIDAAMVGYSVVALMLLLRIISWDDIV------SNKAAWN 339

Query: 772 TLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQ 593
              W A L+ +A+ L N G +SW    +A SL   S +     LI+   ++ + Y FAS 
Sbjct: 340 VFFWLASLITLATGLNNTGFISWFGKLLAGSLSGYSPTMVMVTLIV--VFYLLRYFFASA 397

Query: 592 TGHVGALYSAFLAMNLA-SGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLP 416
           T +  AL    +A  LA   +P  +  L +     L   LT Y++G + +Y+G+GY+   
Sbjct: 398 TAYTCALAPMMIAAALAMPEIPLPVFCLMVGAAIGLGSILTPYATGPSPIYYGSGYLPTA 457

Query: 415 DVFKFGFIMAVINALIWGVVGTFW 344
           D ++ G I  +I  ++  + G  W
Sbjct: 458 DYWRLGAIFGLIFLVLLVITGLLW 481



>gb:AE016767_327797 Escherichia coli CFT073 section 13 of 18 of the
           complete genome.>gb:AE014075_958381 Escherichia coli
           CFT073 complete genome.
          Length = 487

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 61/204 (29%), Positives = 95/204 (46%), Gaps = 6/204 (2%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXG----DALGIA-SVVAAMXXXXXXXXXXXXXXXXXLSEKSAWD 773
           E  M+G M+ A+ LW  G    DA  +  SVVA M                  S K+AW+
Sbjct: 286 EKRMLGLMVGALVLWIFGGDYIDAAMVGYSVVALMLLLRIICWDDIV------SNKAAWN 339

Query: 772 TLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQ 593
              W A L+ +A+ L N G +SW    +A SL   S +     LI+   ++ + Y FAS 
Sbjct: 340 VFFWLASLITLATGLNNTGFISWFGKLLAGSLSGYSPTIVMVALIV--VFYLLRYFFASA 397

Query: 592 TGHVGALYSAFLAMNLA-SGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLP 416
           T +  AL    +A  LA   +P  +  L +     L   LT Y++G + +Y+G+GY+   
Sbjct: 398 TAYTSALAPMMIAAALAMPEIPLPVFCLMVGAAIGLGSILTPYATGPSPIYYGSGYLPTV 457

Query: 415 DVFKFGFIMAVINALIWGVVGTFW 344
           D ++ G I  +I  ++  + G  W
Sbjct: 458 DYWRLGAIFGLIFLVLLVITGLLW 481



>pir|G84065|G84065 hypothetical protein BH3327 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_657273 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 93

 Score = 76.3 bits (186), Expect = 8e-13
 Identities = 35/82 (42%), Positives = 53/82 (64%), Gaps = 3/82 (3%)
 Frame = -2

Query: 559 LAMNL---ASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIM 389
           +A+N+   A+G P +L+AL L + +NLF    HY SG A V+FG GYVD    +  GF +
Sbjct: 12  MALNILAVAAGAPPLLSALLLGFFSNLFSCTIHYGSGPAPVFFGTGYVDQKKWWSIGFFI 71

Query: 388 AVINALIWGVVGTFWWKFLGLY 323
           ++I+ ++W  +G  WWK LGL+
Sbjct: 72  SIIHIVVWLGIGGAWWKVLGLW 93



>gb:HPY418339_138579 Helicobacter pylori sodiT1 gene (partial), mutY
           gene (partial) and lctP gene (partial), strain NQ367.
          Length = 116

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 37/109 (33%), Positives = 63/109 (57%), Gaps = 3/109 (2%)
 Frame = -2

Query: 649 AFLILQASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLA---ALGLAYNTNLFGA 479
           A L + A ++  HY FAS T HV AL++ F+   + S + GV     +L L ++  + G 
Sbjct: 5   AVLFIVALFYLSHYFFASITAHVSALFALFVG--IGSHIQGVNLQELSLFLMFSLGIMGI 62

Query: 478 LTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFL 332
           LT Y +G + +Y+G+GY+   D +K+GFI  ++  +++  V   W KF+
Sbjct: 63  LTPYGTGPSTIYYGSGYISSKDFWKWGFIFGMVYLIVFLSVCVPWVKFI 111



>gb:HPY418335_138567 Helicobacter pylori sodiT1 gene (partial), mutY
           gene (partial) and lctP gene (partial), strain
           NQ352.>gb:HPY418336_138570 Helicobacter pylori sodiT1
           gene (partial), mutY gene (partial) and lctP gene
           (partial), strain NQ1701.
          Length = 116

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 37/109 (33%), Positives = 62/109 (56%), Gaps = 3/109 (2%)
 Frame = -2

Query: 649 AFLILQASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLA---ALGLAYNTNLFGA 479
           A L + A ++  HY FAS T HV AL++ F+   + S + GV     +L L ++  + G 
Sbjct: 5   AVLFIVALFYLSHYFFASITAHVSALFALFVG--IGSHIQGVNLQELSLFLMFSLGIMGI 62

Query: 478 LTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFL 332
           LT Y +G + +Y+G+GY+   D +K+GFI   +  +++  V   W KF+
Sbjct: 63  LTPYGTGPSTIYYGSGYIQSKDFWKWGFIFGFLYLIVFLSVCVPWVKFI 111



>gb:HPY418337_138573 Helicobacter pylori sodiT1 gene (partial), mutY
           gene (partial) and lctP gene (partial), strain NQ267.
          Length = 116

 Score = 70.1 bits (170), Expect = 6e-11
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 3/109 (2%)
 Frame = -2

Query: 649 AFLILQASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLA---ALGLAYNTNLFGA 479
           A L + A ++  HY FAS T HV AL++ F+   + S + GV     +L L ++  + G 
Sbjct: 5   AVLFIVALFYLSHYFFASITAHVSALFALFVG--IGSHIQGVNLQELSLFLMFSLGIMGI 62

Query: 478 LTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFL 332
           LT Y +G + +Y+G+GY+   D +K GFI   +  +++  V   W KF+
Sbjct: 63  LTPYGTGPSTIYYGSGYIPSKDFWKLGFIFGFVYLIVFLSVCVPWVKFI 111



>gb:HPY418340_138582 Helicobacter pylori sodiT1 gene (partial), mutY
           gene (partial) and lctP gene (partial), strain
           LSU1062-1.>gb:HPY418341_138585 Helicobacter pylori
           sodiT1 gene (partial), mutY gene (partial) and lctP gene
           (partial), strain LSU1062-3.
          Length = 116

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 3/109 (2%)
 Frame = -2

Query: 649 AFLILQASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLA---ALGLAYNTNLFGA 479
           A L + A ++  HY FAS T HV AL++ F+   + S + GV     +L L  +  + G 
Sbjct: 5   AVLFIVALFYLSHYFFASITAHVSALFALFVG--IGSHIQGVNLQELSLFLMLSLGIMGI 62

Query: 478 LTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFL 332
           LT Y +G + +Y+G+GY+   D +K+GFI   +  +++  V   W KF+
Sbjct: 63  LTPYGTGPSTIYYGSGYIQSKDFWKWGFIFGFVYLIVFLSVCAPWVKFI 111



>gb:HPY418338_138576 Helicobacter pylori sodiT1 gene (partial), mutY
           gene (partial) and lctP gene (partial), strain NQ1671.
          Length = 116

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 37/109 (33%), Positives = 60/109 (55%), Gaps = 3/109 (2%)
 Frame = -2

Query: 649 AFLILQASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLA---ALGLAYNTNLFGA 479
           A L + A ++  HY FAS T HV AL++ F+   + S + GV     +L L  +  + G 
Sbjct: 5   AVLFIVALFYLSHYFFASITAHVSALFALFVG--IGSHIQGVNLQELSLFLMLSLGIMGI 62

Query: 478 LTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFL 332
           LT Y +G + +Y+G+GY+   D +K GFI   +  +++  V   W KF+
Sbjct: 63  LTPYGTGPSTIYYGSGYIPSKDFWKLGFIFGFVYLIVFLSVCVPWVKFI 111



>gb:AE016770_329002 Escherichia coli CFT073 section 16 of 18 of the
           complete genome.>gb:AE014075_959586 Escherichia coli
           CFT073 complete genome.
          Length = 501

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 59/211 (27%), Positives = 83/211 (39%), Gaps = 7/211 (3%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDAL-GIASVVAAMXXXXXXXXXXXXXXXXXLSEKSA-WDTLA 764
           E  +IG  LL +  W  G  L  I +    +                   EK   W TL 
Sbjct: 292 EKRLIGISLLLLLFWSTGGKLHSIDTTSVTLAGLAIMLLPGIGVMSWKEVEKRVQWGTLL 351

Query: 763 WFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTGH 584
            F + + + S L +    SWM+N V K      L   A F IL A    IH  FAS T  
Sbjct: 352 MFGIGISLGSTLLDTQAASWMANYVVKGFGLDGLPSLAIFAILAAFLIIIHLGFASATAL 411

Query: 583 VGALYSAFLAMNLAS-----GVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDL 419
             AL    +++ L+S     GV  V   + LA++ + FG +   ++ Q  V  G      
Sbjct: 412 TAALLPILISL-LSSLPPELGVNPVGMTILLAFSVS-FGFILPINAPQNMVCMGTDTFTP 469

Query: 418 PDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
               + G  + VI  L+  +    WWK LGL
Sbjct: 470 RQFTRVGLYLTVIGYLLLLLFAATWWKILGL 500



>gb:CP000029_80972 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016745_322112 Staphylococcus epidermidis
           ATCC 12228, section 2 of 9 of the complete
           genome.>gb:AE015929_1146781 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 518

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 39/159 (24%), Positives = 65/159 (40%), Gaps = 4/159 (2%)
 Frame = -2

Query: 790 EKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIH 611
           +K  W T+  F V + + + L   G   W+S+     +    L   A   ++      IH
Sbjct: 362 KKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGLMGLKHLPIIATIALITLFNILIH 421

Query: 610 YLFASQTGHVGALYSAFLAM----NLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVY 443
             FAS T    AL   F+++    NL     G +       +   FG L   S+ Q  + 
Sbjct: 422 LGFASATSLASALIPVFISLTSTLNLGDHAIGFVLIQQFVIS---FGFLLPVSAPQNMLA 478

Query: 442 FGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
           +G G   + D  K G  + ++  ++  V    +WK+LGL
Sbjct: 479 YGTGTFTVKDFLKTGIPLTIVGYILVIVFSLTYWKWLGL 517



>gb:BX571856_780197 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 517

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 2/156 (1%)
 Frame = -2

Query: 787 KSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHY 608
           K  W T+  F V + + + L   G   W+S+     L    L   A   ++      IH 
Sbjct: 362 KIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIHL 421

Query: 607 LFASQTGHVGALYSAFLAM--NLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGA 434
            FAS T    AL   F+++   L  G   +   L   +  + FG L   S+ Q  + +G 
Sbjct: 422 GFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVIS-FGFLLPVSAPQNMLAYGT 480

Query: 433 GYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
           G   + D  K G  + ++  ++  V    +WK+LGL
Sbjct: 481 GTFTVKDFLKTGIPLTIVGYILVIVFSMTYWKWLGL 516



>gb:BA000033_710944 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.
          Length = 517

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 2/156 (1%)
 Frame = -2

Query: 787 KSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHY 608
           K  W T+  F V + + + L   G   W+S+     L    L   A   ++      IH 
Sbjct: 362 KIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIHL 421

Query: 607 LFASQTGHVGALYSAFLAM--NLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGA 434
            FAS T    AL   F+++   L  G   +   L   +  + FG L   S+ Q  + +G 
Sbjct: 422 GFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVIS-FGFLLPVSAPQNMLAYGT 480

Query: 433 GYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
           G   + D  K G  + ++  ++  V    +WK+LGL
Sbjct: 481 GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGL 516



>gb:CP000046_90908 Staphylococcus aureus subsp. aureus COL, complete
           genome.
          Length = 517

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 2/156 (1%)
 Frame = -2

Query: 787 KSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHY 608
           K  W T+  F V + + + L   G   W+S+     L    L   A   ++      IH 
Sbjct: 362 KIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIHL 421

Query: 607 LFASQTGHVGALYSAFLAM--NLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGA 434
            FAS T    AL   F+++   L  G   +   L   +  + FG L   S+ Q  + +G 
Sbjct: 422 GFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVIS-FGFLLPVSAPQNMLAYGT 480

Query: 433 GYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
           G   + D  K G  + ++  ++  V    +WK+LGL
Sbjct: 481 GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGL 516



>pir|C89840|C89840 conserved hypothetical protein SA0645 [imported]
           - Staphylococcus aureus (strain N315)>gb:BA000017_676387
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_679060 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BX571857_782875 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 517

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 2/156 (1%)
 Frame = -2

Query: 787 KSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHY 608
           K  W T+  F V + + + L   G   W+S+     L    L   A   ++      IH 
Sbjct: 362 KIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLGLKHLPIIATIALITLFNILIHL 421

Query: 607 LFASQTGHVGALYSAFLAM--NLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGA 434
            FAS T    AL   F+++   L  G   +   L   +  + FG L   S+ Q  + +G 
Sbjct: 422 GFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQFVIS-FGFLLPVSAPQNMLAYGT 480

Query: 433 GYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
           G   + D  K G  + ++  ++  V    +WK+LGL
Sbjct: 481 GTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGL 516



>gb:AF496379_516269 Lactobacillus delbrueckii subsp. lactis
           2-oxoglutarate/malate translocator precursor, gene,
           partial cds.
          Length = 151

 Score = 40.8 bits (94), Expect = 0.039
 Identities = 20/74 (27%), Positives = 34/74 (45%)
 Frame = -2

Query: 937 EWTMIGTMLLAVSLWGXGDALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTLAWF 758
           E  M+   +LA+ LW     +G+ +   A                  LS+  AW+ + WF
Sbjct: 74  EKVMMAVFILALVLWMLSSFIGLDATWVAFLATALLLVTGVLTTKDMLSZTGAWNVVVWF 133

Query: 757 AVLVGMASQLTNLG 716
           ++L+ MA+QL+  G
Sbjct: 134 SILIFMANQLSLKG 147



>sp|Q07252|MEMP_ALCEU Membrane protein.>pir|I39534|I39534
           hypothetical protein - Alcaligenes
           eutrophus>gb:AELACDEH_466694 A.eutrophus genes for
           lactate dehydrogenase, putative membrane-bound protein
           with four times repitition of Pro-Ser-Ala at the
           N-terminus (function unknown) and transglycosidase
           (partial).
          Length = 513

 Score = 40.8 bits (94), Expect = 0.039
 Identities = 35/157 (22%), Positives = 62/157 (39%), Gaps = 3/157 (1%)
 Frame = -2

Query: 790 EKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIH 611
           +++ W TL  F V + + + L +     W+   V       +      F IL A    IH
Sbjct: 357 QRTPWGTLIVFGVGISLGTALLSTNAGQWLGQFVVTHSGLAAHGALLVFAILSAFLILIH 416

Query: 610 YLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAY---NTNLFGALTHYSSGQAAVYF 440
             FAS T    AL    +A  +   +PG +  +G+      T  FG +   ++ Q  V  
Sbjct: 417 LGFASATALTAALLPILIA--VLQTLPGDINRVGMTMLLGFTVSFGFILPINAPQNMVCL 474

Query: 439 GAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLG 329
           G    +     + G  + +I   +  +    +W++LG
Sbjct: 475 GTETFNGRQFARIGIPVTIIGYAMMLLFAATYWRWLG 511



>gb:BA000028_696927 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 552

 Score = 39.7 bits (91), Expect = 0.086
 Identities = 31/140 (22%), Positives = 59/140 (42%)
 Frame = -2

Query: 787 KSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHY 608
           K  W  L  F   + +A+  T+ G+  W    + + L  L    P   ++  A+      
Sbjct: 393 KLPWGILLLFGGGLAIAAGFTDSGLSDW----IGEQLTGLENVAPIIIILSIAALVIFLT 448

Query: 607 LFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGY 428
              S T     ++    A+ +A GV   +  +  A   +    L   ++   AV FG+GY
Sbjct: 449 EITSNTATATMMFPIMAALAVAVGVHPFILMIAAALAASCAFMLP-VATPPNAVVFGSGY 507

Query: 427 VDLPDVFKFGFIMAVINALI 368
           + +PD+ K GF + ++  ++
Sbjct: 508 LRIPDMAKAGFFLNIVGIIL 527



>gb:AY596298_634712 Haloarcula marismortui ATCC 43049 chromosome II,
           complete sequence.
          Length = 538

 Score = 38.9 bits (89), Expect = 0.15
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 18/167 (10%)
 Frame = -2

Query: 778 WDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFA 599
           W TL  F   + +A  L N G   W++N V   L  + +      LI+ A    + +L  
Sbjct: 380 WGTLLLFGGGISLADALANTGTTEWIANTVFGGLTGMPV-----VLIIAAVVLVVVFL-- 432

Query: 598 SQTGHVGALYSAFLAMNLASGVPGVLAA-LGLA-YNTNLF----GALT-------HYSSG 458
             T       +  + + +  G+  V AA LGL  + T +F    GA+          ++ 
Sbjct: 433 --TEMTSNTATTTILVPILIGLGSVFAATLGLTDFKTAIFLSVSGAIAASFAFALPVATP 490

Query: 457 QAAVYFGAGYVDLPDVFKFGFIM-----AVINALIWGVVGTFWWKFL 332
             A+ +G+GY+    + + G I+     AV+  LIW ++ TF W  L
Sbjct: 491 PNAIVYGSGYIKQSHMLRTGVILNIVMTAVLTGLIW-LLFTFVWPHL 536



>gb:AL935260_552483 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 9/11.
          Length = 459

 Score = 36.6 bits (83), Expect = 0.73
 Identities = 39/151 (25%), Positives = 65/151 (43%), Gaps = 8/151 (5%)
 Frame = -2

Query: 754 VLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFC--IHYLFASQTGHV 581
           V +  A  + N+G V+ M+N +AK+L   +L      L +  + F   IH    S    +
Sbjct: 313 VFLTSAIAIGNVGGVTGMNNWIAKTLIPSNLPTNIYLLAIVITVFAMIIHMFMGSVIAVM 372

Query: 580 GALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGA------GYVDL 419
           G    AF+A     G+  +  +L +   TNL   L  ++    AV  G+      GY   
Sbjct: 373 GITIPAFVAATAHMGISPLAVSLLVFSVTNLHYILPFHN---LAVLVGSDPDTGGGYTQ- 428

Query: 418 PDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
            DV + G  +  +   +  +V  FW+  +GL
Sbjct: 429 KDVMRLGIPLTAV-VFVVALVEMFWFHLVGL 458



>sp|Q57486|Y608_HAEIN Hypothetical protein HI0608.>pir|I64080|I64080
           probable membrane protein HI0608 - Haemophilus
           influenzae  (strain Rd KW20)>gb:U32743_204280
           Haemophilus influenzae Rd KW20 section 58 of 163 of the
           complete genome.>gb:L42023_1096829 Haemophilus
           influenzae Rd KW20 complete genome.
          Length = 461

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 22/100 (22%), Positives = 47/100 (47%)
 Frame = -2

Query: 640 ILQASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSS 461
           +L A++      F S T     L   F+++  + G+P +  AL +    +    L   ++
Sbjct: 361 LLVAAFIIFLTEFTSNTASAALLVPIFISIAQSLGMPEIGLALIIGIGASCAFMLP-VAT 419

Query: 460 GQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWW 341
              A+ FG+G V   ++ K GF++ ++  ++   +G  +W
Sbjct: 420 PPNAIVFGSGQVKQSEMVKVGFLLNLVCVVVIATMGYMFW 459



>pir|F64546|F64546 sodium-dependent transporter - Helicobacter
           pylori (strain 26695)>gb:AE000541_24391 Helicobacter
           pylori 26695 section 19 of 134 of the complete
           genome.>gb:AE000511_879830 Helicobacter pylori 26695
           complete genome.
          Length = 552

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 48/220 (21%), Positives = 91/220 (41%), Gaps = 17/220 (7%)
 Frame = -2

Query: 934 WTMIGTMLLAVSLWGXG----DALGIASVVAAMXXXXXXXXXXXXXXXXXLSEKSAWDTL 767
           W  +G ML +   WG      D++ IA  V+A+                 +++K  WD L
Sbjct: 352 WIFLGVMLKS---WGVKIDKIDSV-IAMGVSALLFILPANHQGDRLIDWGVAKKLPWDVL 407

Query: 766 AWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFASQTG 587
             F   + +++Q +  G+  W+ + V+          P  F+I+  +   I   F ++  
Sbjct: 408 LLFGGGLALSAQFSKTGLSLWIGHLVSGFSHL-----PILFIIVMVTLMVI---FLTEIT 459

Query: 586 HVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQA-------------AV 446
              A  +AFL +     + GV  A+G+ Y  +    LT   +  A             A+
Sbjct: 460 SNTATAAAFLPV-----IGGV--AMGMGYENHQSLLLTIPVALSATCAFMLPVVTPPNAI 512

Query: 445 YFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWWKFLGL 326
            +G+GYV + D+ K G  + ++  ++   + TF +  + L
Sbjct: 513 AYGSGYVKITDMIKAGLWLNLVGVVL---ISTFSYFLVSL 549



>gb:AE016827_343544 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 470

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 21/88 (23%), Positives = 40/88 (45%)
 Frame = -2

Query: 604 FASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYV 425
           F S T     L   F+++  A G+P +  AL +    +    L   ++   A+ FG G V
Sbjct: 382 FTSNTASAALLVPIFISIAQALGMPEMGLALLIGLGASCAFMLP-VATPPNAIVFGTGEV 440

Query: 424 DLPDVFKFGFIMAVINALIWGVVGTFWW 341
              D+ + G ++ ++   + G +G  +W
Sbjct: 441 KQSDMIRAGVVLNILCIFVIGTIGYLFW 468



>gb:BX936398_837914 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 459

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
 Frame = -2

Query: 646 FLILQASYFCIHYL--FASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALT 473
           F+I+ A    I +L    S T     L   F  ++ A G+P +L  + +    +    L 
Sbjct: 356 FIIILAVATFIIFLTELTSNTASAALLVPVFATVSEALGMPPLLLTMIIGIGASCAFMLP 415

Query: 472 HYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWW 341
             +   A VY G G++  P++ K GF + +I  ++  ++  + W
Sbjct: 416 VATPPNAIVY-GTGFIRQPEMVKVGFWLNIICIIVVSLLAWYLW 458



>gb:AE013947_301726 Yersinia pestis KIM section 347 of 415 of the
           complete genome.>gb:AE017140_389179 Yersinia pestis
           biovar Medievalis str. 91001 section 14 of 16 of the
           complete genome.>gb:AE009952_931909 Yersinia pestis KIM
           complete genome.>gb:AE017042_1145745 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 459

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
 Frame = -2

Query: 646 FLILQASYFCIHYL--FASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALT 473
           F+I+ A    I +L    S T     L   F  ++ A G+P +L  + +    +    L 
Sbjct: 356 FIIILAVATFIIFLTELTSNTASAALLVPVFATVSEALGMPPLLLTMIIGIGASCAFMLP 415

Query: 472 HYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWW 341
             +   A VY G G++  P++ K GF + +I  ++  ++  + W
Sbjct: 416 VATPPNAIVY-GTGFIRQPEMVKVGFWLNIICIIVVSLLAWYLW 458



>pir|AF0093|AF0093 Sodium,sulfate symporter-family protein
           [imported] - Yersinia pestis (strain
           CO92)>gb:AJ414144_522602 Yersinia pestis strain CO92
           complete genome; segment 4/20.
          Length = 456

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
 Frame = -2

Query: 646 FLILQASYFCIHYL--FASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALT 473
           F+I+ A    I +L    S T     L   F  ++ A G+P +L  + +    +    L 
Sbjct: 353 FIIILAVATFIIFLTELTSNTASAALLVPVFATVSEALGMPPLLLTMIIGIGASCAFMLP 412

Query: 472 HYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALIWGVVGTFWW 341
             +   A VY G G++  P++ K GF + +I  ++  ++  + W
Sbjct: 413 VATPPNAIVY-GTGFIRQPEMVKVGFWLNIICIIVVSLLAWYLW 455



>pir|E71961|E71961 probable transporter - Helicobacter pylori
           (strain J99)>gb:AE001458_35194 Helicobacter pylori,
           strain J99 section 19 of 132 of the complete
           genome.>gb:AE001439_883964 Helicobacter pylori, strain
           J99 complete genome.
          Length = 548

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 33/155 (21%), Positives = 68/155 (43%), Gaps = 13/155 (8%)
 Frame = -2

Query: 793 SEKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCI 614
           ++K  WD L  F   + +++Q +  G+  W+ + V+          P  F+I+  +   I
Sbjct: 395 AKKLPWDVLLLFGGGLALSAQFSKTGLSLWIGHLVSGFSHL-----PILFIIVMVTLMVI 449

Query: 613 HYLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALT------------- 473
              F ++     A  +AFL +     + GV  A+G+ Y ++    LT             
Sbjct: 450 ---FLTEITSNTATAAAFLPV-----IGGV--AMGMGYESHQSLLLTIPVALSATCAFML 499

Query: 472 HYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALI 368
             ++   A+ +G+GYV + D+ K G  + ++  ++
Sbjct: 500 PVATPPNAIAYGSGYVKITDMIKAGLWLNLVGVVL 534



>gb:AY363392_1322719 Callinectes sapidus mitochondrion, complete
           genome.
          Length = 335

 Score = 34.3 bits (77), Expect = 3.6
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 6/85 (7%)
 Frame = -2

Query: 664 LSWPAAFLILQ----ASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYN 497
           LSWP AF++L     A  F I YL  S+     AL +  L   L S V G L  L +   
Sbjct: 113 LSWPQAFILLTIQKLAPMFLISYLTFSE-----ALMNIILYFALISSVIGALGGLNVTMM 167

Query: 496 TNL--FGALTHYSSGQAAVYFGAGY 428
             L  F ++ H S    A+Y    Y
Sbjct: 168 RKLMAFSSINHMSWMLIAIYMSDIY 192



>gb:CP000021_872892 Vibrio fischeri ES114 chromosome II, complete
           sequence.
          Length = 332

 Score = 34.3 bits (77), Expect = 3.6
 Identities = 32/139 (23%), Positives = 61/139 (43%), Gaps = 2/139 (1%)
 Frame = -2

Query: 754 VLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYL-FASQTGHVG 578
           +L G    L+N+   +  S  +A SL  +       F IL  + F +    FAS T    
Sbjct: 194 LLFGGGICLSNILKATGTSTFLAHSLSDILSQAGILFTILTVAAFVVFLTEFASNTASAA 253

Query: 577 ALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFG 398
            L   F ++  A G+  V+ +  +A + +    L   ++   A+ FG+G++   ++ + G
Sbjct: 254 LLIPVFASVAEALGISPVVLSAMIAISASCAFMLP-VATPPNAIVFGSGHIKQSEMMRVG 312

Query: 397 -FIMAVINALIWGVVGTFW 344
            ++  V   ++ G    FW
Sbjct: 313 IYLNLVCVVVLTGFAAIFW 331



>gb:AE011120_269362 Methanosarcina acetivorans str. C2A, section 465
           of 534 of the complete genome.>gb:AE010299_909921
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 705

 Score = 34.3 bits (77), Expect = 3.6
 Identities = 26/78 (33%), Positives = 40/78 (51%)
 Frame = -2

Query: 547 LASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAGYVDLPDVFKFGFIMAVINALI 368
           L+ GVPGVL A+  +   NL  ALT   S    ++FG GY       ++G + A    L+
Sbjct: 141 LSVGVPGVLCAVKPSILFNLAVALTFALSFN--LFFGIGYNLTHGKIRYGLLTAGFGMLL 198

Query: 367 WGVVGTFWWKFLGLY*VK 314
             + G F  +F+ +Y +K
Sbjct: 199 GNLQGLF--EFVSMYVLK 214



>gb:AP006878_576441 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 470

 Score = 33.9 bits (76), Expect = 4.7
 Identities = 34/142 (23%), Positives = 53/142 (37%), Gaps = 12/142 (8%)
 Frame = -2

Query: 769 LAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAA--FLILQASYFCIHYLFAS 596
           LA+  ++  +   L NL    W+       L     +WP    F+ +   +    + F S
Sbjct: 25  LAYPLIINQLVQVLYNLTDTFWLGKLGRLELSAPGTAWPLVWFFMSIGMGFATAGFAFVS 84

Query: 595 Q----------TGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQAAV 446
           Q            + GALYS  L    A GV GV+ A  L     +   +  Y+     V
Sbjct: 85  QYVGAKDYDRANRYAGALYSLMLLFATAVGVSGVILAPYLLRLMGVSDTIFPYALRYTRV 144

Query: 445 YFGAGYVDLPDVFKFGFIMAVI 380
            F AG      +F F F++  +
Sbjct: 145 IF-AGIPFSFTLFAFNFLLRAV 165



>pir|G83492|G83492 hypothetical protein PA1232 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004552_55468
           Pseudomonas aeruginosa PAO1, section 113 of 529 of the
           complete genome.>gb:AE004091_969568 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 679

 Score = 33.9 bits (76), Expect = 4.7
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = -2

Query: 544 ASGVPGVLAALGLAYNTNLFGALTHYSSGQAAVYFGAG-YVDLPDVFKFGF-IMAVINAL 371
           ASG     AAL L + T+  G +   S G AA+  G G Y+ L   F     ++ +IN +
Sbjct: 5   ASGGRDWYAALPLPWRTDSLGYVLR-SIGAAALALGLGLYLQLDSPFSAASTVLLLINPV 63

Query: 370 IWGVVGTFWWKFLG 329
              VVG  WW+ +G
Sbjct: 64  QGAVVGKGWWRAVG 77



>gb:AJ749949_532185 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 475

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 7/148 (4%)
 Frame = -2

Query: 790 EKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFL-------ILQ 632
           +++ WDTL +F  ++     L  LG +   S  +   +Q ++ S  +A         IL 
Sbjct: 332 KEAEWDTLLFFYGILVSVQGLAALGYLGIASQYIYTDMQSIAPSLFSAHTQANTIIGILS 391

Query: 631 ASYFCIHYLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLFGALTHYSSGQA 452
           A    I  +FA  + +    ++ +L + L +GV G L A+G A    + G     S G+ 
Sbjct: 392 AIIDNIPVMFAVLSMNPTMEHAQWLLITLTAGVGGSLLAIGSAAGVAVMGK----SKGK- 446

Query: 451 AVYFGAGYVDLPDVFKFGFIMAVINALI 368
             Y   G++    V   G+  ++I  L+
Sbjct: 447 --YTFIGHLKWTWVIALGYFASIIVHLL 472



>gb:AY380558_614918 Burkholderia multivorans E243 type III secretion
           gene cluster, partial sequence.
          Length = 3953

 Score = 33.1 bits (74), Expect = 8.0
 Identities = 18/54 (33%), Positives = 23/54 (42%)
 Frame = +3

Query: 726 VNWLAMPTRTANHARVSQADFSLKQSSQSSTPNNKRIDNPSMAATTLAMPSASP 887
           VNW+    RT    R   A    + + QSS P  +R+D P  A T    P   P
Sbjct: 11  VNWMMFLERTLEAERAKAAS---QAAQQSSDPVKQRVDTPPPAVTVQVTPDTDP 61



>gb:AE010495_263724 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 37 of 197 of the complete
           genome.>gb:AE009951_910892 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 425

 Score = 33.1 bits (74), Expect = 8.0
 Identities = 36/148 (24%), Positives = 63/148 (42%), Gaps = 12/148 (8%)
 Frame = -2

Query: 778 WDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCIHYLFA 599
           WDTL +F  L  M   + NLGI+ ++ +      + + +S    F +   S   +  +F 
Sbjct: 276 WDTLFFFIGLFIMIKGIENLGIIKFIGD------KIIEIS-TGNFKVASISIMWLSSIFT 328

Query: 598 SQTGHVGALYSAFLAMNLASGVPGV-------LAALGLAYNTNLFGALTHYSSGQAAVYF 440
           S  G+V    +A  A  + + +P         +    L+Y + L G++T   S    V  
Sbjct: 329 SIFGNVA--NAATFAKIIKTIIPDFQNIANTKVFWWALSYGSCLGGSITMIGSATNVVAV 386

Query: 439 GAG-----YVDLPDVFKFGFIMAVINAL 371
            A       +D    FKFG  +A++N +
Sbjct: 387 SASAKAGCKIDFMKFFKFGSKIAILNLI 414



>gb:CR522870_99612 Desulfotalea psychrophila LSv54 chromosome.
          Length = 626

 Score = 33.1 bits (74), Expect = 8.0
 Identities = 37/148 (25%), Positives = 58/148 (39%), Gaps = 10/148 (6%)
 Frame = -2

Query: 793 SEKSAWDTLAWFAVLVGMASQLTNLGIVSWMSNCVAKSLQCLSLSWPAAFLILQASYFCI 614
           + K  W  L  F   + MA       + +W+   V       SL   A   +L  +  C+
Sbjct: 460 ASKMPWGVLILFGGGLSMAGGFKASRLANWIGGQV-------SLLDQAPVFVLLLACLCL 512

Query: 613 HYLFASQTGHVGALYSAFLAMNLASGVPGVLAALGLAYNTNLF---GALTH-------YS 464
                  T +     +A L M + S V     A+GL  N  L     A+T         +
Sbjct: 513 IIFLTELTSNTA---TAALVMPILSAV-----AVGLGQNPLLLLVPAAITASCAFMLPVA 564

Query: 463 SGQAAVYFGAGYVDLPDVFKFGFIMAVI 380
           +   A+ FG+GYV +P + K GF + V+
Sbjct: 565 TPPNAIVFGSGYVTIPQMVKSGFGLDVV 592


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,036,329,469
Number of Sequences: 1806583
Number of extensions: 22580612
Number of successful extensions: 59314
Number of sequences better than 10.0: 107
Number of HSP's better than 10.0 without gapping: 56449
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59111
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 67285516404
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)