BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8894
         (853 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF406699_1796907 Solanum tuberosum BEL1-related homeotic prot...   155   9e-37   
gb:AY050459_1562233 Arabidopsis thaliana AT4g36870/C7A10_490 mRN...   154   3e-36   
gb:AF353092_1790538 Arabidopsis thaliana BEL1-like homeobox 4 (B...   153   5e-36   
pir|T02415|T02415 probable homeodomain transcription factor [imp...   153   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AF406701_1796909 Solanum tuberosum BEL1-related homeotic prot...   149   9e-35   
gb:AF053769_1764475 Malus x domestica homeodomain protein (Mdh1)...   149   9e-35   
pir|D85435|D85435 BEL1-like homeobox 2 protein (BLH2) [imported]...   140   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AF334758_1787475 Hordeum vulgare homeodomain protein JUBEL1 (...   139   7e-32   
gb:AF406700_1796908 Solanum tuberosum BEL1-related homeotic prot...   131   2e-29   
gb:AF375964_1792975 Lycopersicon esculentum bell-like homeodomai...   130   2e-29   
gb:AE016959_1023614 Oryza sativa (japonica cultivar-group) chrom...   129   7e-29   
gb:AP000616_1820513 Oryza sativa (japonica cultivar-group) genom...   126   6e-28   
gb:AY054513_1563167 Arabidopsis thaliana homeotic protein BEL1 h...   123   4e-27   
gb:AB006707_1510039 Arabidopsis thaliana genomic DNA, chromosome...   123   4e-27   
pir|A57632|A57632 homeotic protein BEL1 - Arabidopsis thaliana        123   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AF406703_1796911 Solanum tuberosum BEL1-related homeotic prot...   123   5e-27   
gb:AF406698_1796906 Solanum tuberosum BEL1-related homeotic prot...   122   7e-27   
gb:AF375966_1792977 Lycopersicon esculentum bell-like homeodomai...   122   7e-27   
gb:AF406697_1796905 Solanum tuberosum BEL1-related homeotic prot...   122   9e-27   
gb:GGN318871_1679988 Gnetum gnemon partial mRNA for putative BEL...   122   9e-27   
gb:AF406702_1796910 Solanum tuberosum BEL1-related homeotic prot...   122   1e-26   
gb:AF353094_1790540 Arabidopsis thaliana BEL1-like homeodomain 1...   121   2e-26   
gb:AY062545_1565201 Arabidopsis thaliana Similar to homeodomain ...   121   2e-26   
pir|H84774|H84774 probable homeodomain transcription factor [imp...   121   2e-26   Arabidopsis thaliana [mouse-ear cress]
pir|F96784|F96784 hypothetical protein F1B16.6 [imported] - Arab...   121   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AY056796_1563845 Arabidopsis thaliana At2g16400/F16F14.10 mRN...   120   3e-26   
pir|H86329|H86329 F6F9.25 protein - Arabidopsis thaliana>gb:AE00...   120   3e-26   Arabidopsis thaliana [mouse-ear cress]
pir|H84539|H84539 probable homeodomain transcription factor [imp...   120   3e-26   Arabidopsis thaliana [mouse-ear cress]
pir|T05281|T05281 probable homeobox protein T4L20.190 - Arabidop...   119   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AF334759_1787476 Hordeum vulgare homeodomain protein JUBEL2 (...   118   2e-25   
gb:AC104428_1737599 Oryza sativa (japonica cultivar-group) chrom...   118   2e-25   
gb:AC111016_1738825 Oryza sativa (japonica cultivar-group) chrom...   117   2e-25   
gb:AC079736_1732773 Oryza sativa (japonica cultivar-group) chrom...   117   2e-25   
gb:AC079736_1732772 Oryza sativa (japonica cultivar-group) chrom...   117   2e-25   
gb:AY524972_1611542 Oryza sativa (indica cultivar-group) benzoth...   117   2e-25   
pir|D84679|D84679 probable homeodomain transcription factor [imp...   117   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AB071331_1522782 Oryza sativa (japonica cultivar-group) mRNA ...   117   3e-25   
gb:AB071330_1522781 Oryza sativa (indica cultivar-group) mRNA fo...   117   3e-25   
pir|C84670|C84670 probable homeodomain transcription factor [imp...   117   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AC007290_1535768 Arabidopsis thaliana chromosome 2 clone T22O...   115   8e-25   
gb:AF375965_1792976 Lycopersicon esculentum bell-like homeodomai...   115   1e-24   
gb:BT000779_1635050 Arabidopsis thaliana clone RAFL07-07-D11 (R1...   115   1e-24   
gb:ATH519491_1552854 Arabidopsis thaliana mRNA for homeodomain p...   115   1e-24   
pir|T48224|T48224 probable homeodomain protein - Arabidopsis tha...   115   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AF375967_1792978 Lycopersicon esculentum bell-like homeodomai...   108   1e-22   
gb:AP005003_1847111 Oryza sativa (japonica cultivar-group) genom...   106   5e-22   
gb:AP003714_1832364 Oryza sativa (japonica cultivar-group) genom...   106   5e-22   
gb:AY082396_1569182 Zea mays knotted1-interacting protein (kip) ...   104   2e-21   
gb:ATHIGEN_1553244 A.thaliana AtH1 gene.                              104   2e-21   
sp|P48731|ATH1_ARATH|ATH1_ARATH Homeobox protein ATH1.>pir|T05306|T05306 ho...   104   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AC103550_1737265 Oryza sativa chromosome 3 BAC OSJNBa0079G12 ...   103   3e-21   
gb:AC079736_1732774 Oryza sativa (japonica cultivar-group) chrom...   103   3e-21   
gb:GGN318873_1679990 Gnetum gnemon partial mRNA for putative BEL...    84   3e-15   
gb:GGN318872_1679989 Gnetum gnemon partial mRNA for putative BEL...    82   1e-14   
gb:GGN318874_1679991 Gnetum gnemon partial mRNA for putative BEL...    82   1e-14   
sp|Q90655|AKR_CHICK|AKR_CHICK Homeodomain protein AKR (Avian knotted-relat...    76   9e-13   Gallus gallus [bantam]
gb:AY705698_1347637 Oikopleura dioica Meis-b gene, complete cds.       75   1e-12   
gb:BC054667_2551074 Danio rerio pbx/knotted 1 homeobox 1.1, mRNA...    75   2e-12   
gb:AF382393_2490548 Danio rerio pbx/knotted-1 homeobox Prep1.1 m...    75   2e-12   
gb:BC064716_2553885 Xenopus tropicalis hypothetical protein MGC7...    74   3e-12   
gb:BC044016_2548423 Xenopus laevis TGFB-induced factor (TALE fam...    74   3e-12   
gb:HSU68385_2025669 Human Meis1-related protein 2 (MRG2), mRNA, ...    74   5e-12   
gb:BC086156_2564738 Xenopus laevis hypothetical LOC495635, mRNA ...    73   8e-12   
gb:MMTGIFPRO_2117712 M.musculus mRNA for mTGIF protein.                73   8e-12   
gb:BC012700_2091629 Mus musculus TG interacting factor, mRNA (cD...    73   8e-12   
gb:BC031268_1980108 Homo sapiens TGFB-induced factor (TALE famil...    73   8e-12   
gb:AY665270_1958575 Pan troglodytes transforming growth factor-b...    73   8e-12   
gb:AY650366_1958313 Macaca fascicularis transforming growth fact...    73   8e-12   
gb:AF179900_1888389 Homo sapiens TALE homeobox TG-interacting fa...    73   8e-12   
gb:AY705697_1347636 Oikopleura dioica Meis-a gene, partial cds.        73   8e-12   
sp|P70284|TGIF_MOUSE|TGIF_MOUSE 5'-TG-3' interacting factor (Homeobox prote...    73   8e-12   Mus musculus [mouse]
sp|Q15583|TGIF_HUMAN|TGIF_HUMAN 5'-TG-3' interacting factor (Homeobox prote...    73   8e-12   Homo sapiens [man]
gb:AY391467_2531603 Danio rerio TGFB-induced factor (TGIF) mRNA,...    72   1e-11   
gb:AF487460_2066955 Mus musculus homeodomain containing transcri...    72   1e-11   
gb:BC045626_1983599 Homo sapiens PBX/knotted 1 homeobox 2, mRNA ...    72   1e-11   
gb:AY665227_1958532 Saimiri boliviensis transforming growth fact...    72   1e-11   
gb:HSM808766_1188023 Homo sapiens mRNA; cDNA DKFZp686G20229 (fro...    72   1e-11   
gb:AK082952_1173756 Mus musculus 12 days embryo spinal cord cDNA...    72   1e-11   
pir|JC7766|JC7766 three-amino-acid loop extension(TALE) homeodom...    72   1e-11   Homo sapiens [man]
sp|Q96KN3|PNX2_HUMAN|PNX2_HUMAN Homeobox protein PKNOX2 (PBX/knotted homeob...    72   1e-11   Homo sapiens [man]
gb:AB086818_2463973 Danio rerio prep2 gene for TALE homeodomain ...    72   1e-11   
gb:AB086816_2463972 Gallus gallus PREP2 gene for TALE homeodomai...    72   1e-11   
gb:CR860477_1184544 Pongo pygmaeus mRNA; cDNA DKFZp459B221 (from...    72   1e-11   
gb:AF170065_2478261 Danio rerio meis2 mRNA, complete cds.              71   3e-11   
gb:BC056317_2551757 Danio rerio myeloid ecotropic viral integrat...    70   4e-11   
gb:AF222995_2480857 Danio rerio homeobox transcription factor Me...    70   4e-11   
gb:AY449637_1950775 Callithrix jacchus X-linked TGIF-like protei...    70   4e-11   
gb:AF202933_2479957 Gallus gallus myeloid ecotropic viral insert...    70   5e-11   
gb:BC069251_1987888 Homo sapiens Meis1, myeloid ecotropic viral ...    70   5e-11   
gb:AY449635_1950773 Cercopithecus aethiops X-linked TGIF-like pr...    70   5e-11   
gb:TCA518941_1399639 Tribolium castaneum mRNA for homothorax (ht...    70   5e-11   
gb:AF036584_1234922 Drosophila melanogaster homothorax homeoprot...    70   5e-11   
gb:AF026788_1234331 Drosophila melanogaster homothorax (hth) mRN...    70   5e-11   
gb:AE014297_1138861 Drosophila melanogaster chromosome 3R, compl...    70   5e-11   
gb:AE014297_1138860 Drosophila melanogaster chromosome 3R, compl...    70   5e-11   
gb:AE014297_1138859 Drosophila melanogaster chromosome 3R, compl...    70   5e-11   
sp|Q99687|MEI3_HUMAN|MEI3_HUMAN Homeobox protein Meis3 (Meis1-related prote...    70   5e-11   Homo sapiens [man]
gb:XLU68388_2583499 Xenopus laevis XMeis1-3 protein mRNA, partia...    70   7e-11   
gb:BC066375_2554266 Danio rerio myeloid ecotropic viral integrat...    70   7e-11   
gb:BC065980_2554233 Danio rerio myeloid ecotropic viral integrat...    70   7e-11   
gb:BC056515_2551790 Danio rerio myeloid ecotropic viral integrat...    70   7e-11   
gb:AF375872_2490227 Danio rerio transcription factor Meis2.2 (me...    70   7e-11   
gb:AF375871_2490226 Danio rerio transcription factor Meis1.1 (me...    70   7e-11   
gb:AF202934_2479958 Gallus gallus myeloid ecotropic viral insert...    70   7e-11   
gb:AF199011_2479668 Gallus gallus homeoprotein Meis2 (Meis2) mRN...    70   7e-11   
gb:BC052701_2101222 Mus musculus Pbx/knotted 1 homeobox, mRNA (c...    70   7e-11   
gb:BC023689_2094212 Mus musculus myeloid ecotropic viral integra...    70   7e-11   
gb:BC017375_2092462 Mus musculus myeloid ecotropic viral integra...    70   7e-11   
gb:AL603984_2071254 Mouse DNA sequence from clone RP23-137B16 on...    70   7e-11   
gb:BC001516_1967651 Homo sapiens Meis1, myeloid ecotropic viral ...    70   7e-11   
gb:AY449641_1950779 Lagothrix lagotricha X-linked TGIF-like prot...    70   7e-11   
gb:AF179898_1888387 Homo sapiens TALE homeobox protein Meis2d mR...    70   7e-11   
gb:AF179896_1888385 Homo sapiens TALE homeobox protein Meis2b mR...    70   7e-11   
gb:AF178948_1888209 Homo sapiens TALE homeobox protein Meis2a mR...    70   7e-11   
gb:AF017418_1876779 Homo sapiens homeobox protein MEIS2 (MEIS2) ...    70   7e-11   
gb:CSA518945_1375707 Cupiennius salei mRNA for homothorax 1 (hth...    70   7e-11   
gb:CSA518935_1375699 Cupiennius salei mRNA for homothorax 2 (hth...    70   7e-11   
gb:CR857152_1181401 Pongo pygmaeus mRNA; cDNA DKFZp469A1832 (fro...    70   7e-11   
sp|P97367|MEI2_MOUSE|MEI2_MOUSE Homeobox protein Meis2 (Meis1-related prote...    70   7e-11   Mus musculus [mouse]
sp|O14770|MEI2_HUMAN|MEI2_HUMAN Homeobox protein Meis2 (Meis1-related prote...    70   7e-11   Homo sapiens [man]
sp|Q60954|MEI1_MOUSE|MEI1_MOUSE Homeobox protein Meis1 (Myeloid ecotropic v...    70   7e-11   Mus musculus [mouse]
sp|O00470|MEI1_HUMAN|MEI1_HUMAN Homeobox protein Meis1.>gb:BC043503_1983430...    70   7e-11   Homo sapiens [man]
gb:BC084920_2564156 Xenopus laevis Meis3 homeoprotein, mRNA (cDN...    69   9e-11   
gb:BC081037_2561946 Xenopus laevis MGC81734 protein, mRNA (cDNA ...    69   9e-11   
gb:BC075589_2558685 Xenopus tropicalis Meis1, myeloid ecotropic ...    69   9e-11   
gb:BC044024_2548430 Xenopus laevis similar to myeloid ecotropic ...    69   9e-11   
gb:AF072895_2471716 Xenopus laevis Meis3 homeoprotein (Meis3) mR...    69   9e-11   
gb:BC003762_2089319 Mus musculus myeloid ecotropic viral integra...    69   9e-11   
gb:HSY13613_2028332 Homo sapiens mRNA for homeodomain protein Pr...    69   9e-11   
gb:HSU68727_2025680 Human homeobox-containing protein mRNA, comp...    69   9e-11   
gb:BC000735_1966988 Homo sapiens PBX/knotted 1 homeobox 1, mRNA ...    69   9e-11   
gb:AY196965_1938961 Homo sapiens homeobox-containing protein PKN...    69   9e-11   
gb:AY142115_1937003 Homo sapiens PKNOX1B (PKNOX1) mRNA, complete...    69   9e-11   
sp|O70477|PNX1_MOUSE|PNX1_MOUSE Homeobox protein PKNOX1 (PBX/knotted homeob...    69   9e-11   Mus musculus [mouse]
sp|P55347|PNX1_HUMAN|PNX1_HUMAN Homeobox protein PKNOX1 (PBX/knotted homeob...    69   9e-11   Homo sapiens [man]
sp|P97368|MEI3_MOUSE|MEI3_MOUSE Homeobox protein Meis3 (Meis1-related prote...    69   9e-11   Mus musculus [mouse]
sp|P79937|MEI1_XENLA|MEI1_XENLA Homeobox protein Meis1 (XMeis1).>gb:XLU6838...    69   9e-11   Xenopus laevis [clawed frog]
gb:BC065977_2554230 Danio rerio myeloid ecotropic viral integrat...    69   1e-10   
gb:AY449640_1950778 Saimiri sciureus X-linked TGIF-like protein ...    69   1e-10   
gb:AY204697_1309652 Venturia canescens homeodomain-containing pr...    69   1e-10   
sp|Q8MID1|TGLX_MIOTA|TGLX_MIOTA Homeobox protein TGIF2LX (TGFB-induced fact...    69   1e-10   Miopithecus talapoin
sp|Q8MID8|TGLX_MACFA|TGLX_MACFA Homeobox protein TGIF2LX (TGFB-induced fact...    69   1e-10   Macaca fascicularis [crab eating macaque]
sp|Q8MIC2|TGLX_PAPHA|TGLX_PAPHA Homeobox protein TGIF2LX (TGFB-induced fact...    68   2e-10   Papio hamadryas [baboon]
sp|Q8MIE6|TGLX_HYLLA|TGLX_HYLLA Homeobox protein TGIF2LX (TGFB-induced fact...    68   2e-10   Hylobates lar [white-handed gibbon]
gb:MMU57343_2122566 Mus musculus homeobox protein Meis2 mRNA, co...    68   3e-10   
gb:AY449639_1950777 Aotus trivirgatus X-linked TGIF-like protein...    68   3e-10   
gb:AY091593_1936207 Homo sapiens MEIS1-related protein 2 (MEIS3)...    67   3e-10   
gb:AY705696_1347635 Oikopleura dioica Prep gene, partial cds.          67   3e-10   
gb:AC006692_1203746 Caenorhabditis elegans cosmid T28F12, comple...    67   3e-10   
gb:AC006692_1203744 Caenorhabditis elegans cosmid T28F12, comple...    67   3e-10   
gb:AE013599_1131480 Drosophila melanogaster chromosome 2R, compl...    67   3e-10   
gb:AE013599_1131479 Drosophila melanogaster chromosome 2R, compl...    67   3e-10   
gb:AE013599_1131478 Drosophila melanogaster chromosome 2R, compl...    67   3e-10   
gb:AE013599_1131477 Drosophila melanogaster chromosome 2R, compl...    67   3e-10   
gb:AX400034_1467347 Sequence 205 from Patent WO0218424.                67   4e-10   
gb:AK029490_1161516 Mus musculus adult male testis cDNA, RIKEN f...    67   4e-10   
gb:AK017884_1159367 Mus musculus 8 days embryo whole body cDNA, ...    67   4e-10   
sp|Q8MID6|TGLX_MACMU|TGLX_MACMU Homeobox protein TGIF2LX (TGFB-induced fact...    67   4e-10   Macaca mulatta [rhesus macaque]
sp|Q9GZN2|TGI2_HUMAN|TGI2_HUMAN Homeobox protein TGIF2 (TGFB-induced factor...    67   4e-10   Homo sapiens [man]
gb:BC081024_2561933 Xenopus laevis MGC81646 protein, mRNA (cDNA ...    67   6e-10   
gb:AC092697_1735557 Oryza sativa chromosome 10 BAC OSJNBb0060I05...    66   7e-10   
sp|Q8MIB8|TGLX_PONPY|TGLX_PONPY Homeobox protein TGIF2LX (TGFB-induced fact...    66   1e-09   Pongo pygmaeus [orang utan]
gb:XLU68387_2583498 Xenopus laevis XMeis1-2 protein mRNA, comple...    65   1e-09   
gb:AY449636_1950774 Pygathrix nemaeus X-linked TGIF-like protein...    65   1e-09   
gb:CR382131_1664665 Yarrowia lipolytica chromosome E of strain C...    65   1e-09   
gb:AB016001_1512742 Ipomoea nil PKn2s1 (knotted-like gene) mRNA,...    65   1e-09   
gb:AB016000_1512741 Ipomoea nil PKn2 (knotted-like gene) mRNA, c...    65   1e-09   
sp|Q8MIB7|TGLX_PANTR|TGLX_PANTR Homeobox protein TGIF2LX (TGFB-induced fact...    65   2e-09   Pan troglodytes
gb:AF497480_1905258 Homo sapiens TGF beta-induced transcription ...    65   2e-09   
gb:AF100326_1768094 Dendrobium grex Madame Thong-IN homeobox pro...    65   2e-09   
gb:DOR276389_1675995 Dendrobium grex Madame Thong-IN mRNA for kn...    65   2e-09   
gb:AY532908_1612134 Emericella nidulans AhpA (ahpA) gene, comple...    65   2e-09   
sp|Q8IUE1|TGLX_HUMAN|TGLX_HUMAN Homeobox protein TGIF2LX (TGFB-induced fact...    65   2e-09   Homo sapiens [man]
sp|Q8MIE9|TGLX_GORGO|TGLX_GORGO Homeobox protein TGIF2LX (TGFB-induced fact...    65   2e-09   Gorilla gorilla gorilla [lowland gorilla]
gb:AC090683_1734401 Oryza sativa chromosome 3 BAC OSJNBa0035I24 ...    64   3e-09   
gb:CR380954_1651181 Candida glabrata strain CBS138 chromosome H ...    64   4e-09   
gb:AB043956_1520039 Ceratopteris richardii mRNA for CRKNOX2, com...    64   4e-09   
gb:AY667450_1620713 Selaginella kraussiana KNOTTED1-like protein...    64   5e-09   
gb:GMA551279_1385409 Glomeris marginata partial mRNA for homotho...    64   5e-09   
pir|T07777|T07777 probable homeobox protein H1 - potato>gb:STU65...    64   5e-09   Solanum tuberosum [potatoes]
gb:AF434662_2065691 Mus musculus testis expressed homeobox mRNA,...    63   6e-09   
gb:AY072735_1567388 Antirrhinum majus invaginata (ina) mRNA, com...    63   6e-09   
gb:AX969880_1485189 Sequence 683 from Patent EP1104808.                63   6e-09   
sp|Q8IUE0|TGLY_HUMAN|TGLY_HUMAN Homeobox protein TGIF2LY (TGFB-induced fact...    63   6e-09   Homo sapiens [man]
gb:LEU76408_1684761 Lycopersicon esculentum knotted 3 protein (T...    63   8e-09   
gb:AY680398_1622073 Pinus taeda homeobox transcription factor KN...    63   8e-09   
gb:AY667449_1620712 Selaginella kraussiana KNOTTED1-like protein...    63   8e-09   
gb:AY096803_1576297 Helianthus annuus knotted-1-like protein 2 (...    63   8e-09   
sp|O04134|HKL1_MALDO|HKL1_MALDO Homeobox protein knotted-1 like 1 (KNAP1).>...    63   8e-09   Malus domestica [apple tree]
gb:AF376049_2490256 Danio rerio transcription factor Meis4.1a (m...    62   1e-08   
gb:AE016819_1748787 Ashbya gossypii (= Eremothecium gossypii) AT...    62   1e-08   
gb:HTU519674_1682195 Helianthus tuberosus mRNA for putative knot...    62   1e-08   
gb:AY680405_1622080 Picea mariana homeobox transcription factor ...    62   1e-08   
gb:AY680400_1622075 Picea abies homeobox transcription factor KN...    62   1e-08   
gb:AY096804_1576298 Helianthus annuus knotted-1-like protein 3 (...    62   1e-08   
gb:AY096802_1576296 Helianthus annuus knotted-1-like protein 1 (...    62   1e-08   
gb:AB043955_1520038 Ceratopteris richardii mRNA for CRKNOX1s, co...    62   1e-08   
gb:AB043954_1520037 Ceratopteris richardii mRNA for CRKNOX1, com...    62   1e-08   
gb:AB025715_1516736 Nicotiana tabacum mRNA for homeobox 22, comp...    62   1e-08   
sp|P24345|HKN1_MAIZE|HKN1_MAIZE Homeotic protein knotted-1.>pir|S14283|S142...    62   1e-08   Zea mays [maize]
gb:AF457124S2_1801310 Zea mays knotted1-like homeodomain protein...    62   1e-08   
gb:AF100455_1768101 Zea mays knotted class 1 homeodomain protein...    62   1e-08   
gb:AY684938_1622269 Populus balsamifera subsp. trichocarpa x Pop...    62   1e-08   
gb:AY601274_1617427 Chelidonium majus shoot meristemless-like pr...    62   1e-08   
gb:AY423709_1605483 Populus alba x Populus tremula putative Kn1-...    62   1e-08   
gb:AC117176_1208020 Dictyostelium discoideum chromosome 2 map 50...    62   1e-08   
sp|P56669|HLG3_MAIZE|HLG3_MAIZE Homeobox protein liguleless 3 (Fragment).         62   1e-08   Zea mays [maize]
sp|P56661|HKL3_MAIZE|HKL3_MAIZE Homeobox protein knotted-1 like 3 (Fragment).     62   1e-08   Zea mays [maize]
sp|O04135|HKL2_MALDO|HKL2_MALDO Homeobox protein knotted-1 like 2 (KNAP2).>...    62   1e-08   Malus domestica [apple tree]
gb:AF544054_1810420 Nicotiana tabacum knotted 3 (kn3) mRNA, part...    62   2e-08   
gb:AF544053_1810419 Nicotiana tabacum knotted 2 (kn2) mRNA, part...    62   2e-08   
gb:AF482995_1804027 Arabidopsis thaliana RLD homeodomain protein...    62   2e-08   
gb:AF482994_1804026 Arabidopsis thaliana Landsberg erecta homeod...    62   2e-08   
gb:AB025714_1516735 Nicotiana tabacum mRNA for homeobox 20, comp...    62   2e-08   
gb:AB025713_1516734 Nicotiana tabacum mRNA for homeobox 9, compl...    62   2e-08   
gb:CNS07EGG_1374133 chromosome X of strain GB-M1 of Encephalitoz...    62   2e-08   
gb:CEH25HOME_1365042 Caenorhabditis elegans mRNA for CEH-25 home...    62   2e-08   
gb:AC006692_1203748 Caenorhabditis elegans cosmid T28F12, comple...    62   2e-08   
gb:AC006692_1203747 Caenorhabditis elegans cosmid T28F12, comple...    62   2e-08   
gb:AC006692_1203745 Caenorhabditis elegans cosmid T28F12, comple...    62   2e-08   
sp|P46639|HKL1_ARATH|HKL1_ARATH Homeobox protein knotted-1 like 1 (KNAT1).>...    62   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AF457122S2_1801308 Zea mays knotted1-like homeodomain protein...    61   2e-08   
gb:AF457119_1801304 Zea mays knotted1-like homeodomain protein l...    61   2e-08   
gb:AF308454_1784801 Medicago truncatula knotted class I homeodom...    61   2e-08   
gb:AF022390_1761991 Hordeum vulgare knotted class 1 homeodomain ...    61   2e-08   
gb:AY755413_1626930 Populus alba x Populus tremula homeodomain p...    61   2e-08   
gb:AY684937_1622268 Populus balsamifera subsp. trichocarpa x Pop...    61   2e-08   
gb:AY655754_1620249 Streptocarpus saxorum STM1 protein mRNA, com...    61   2e-08   
gb:AY655753_1620248 Streptocarpus rexii STM1 protein mRNA, compl...    61   2e-08   
gb:AY655752_1620247 Streptocarpus dunnii STM1 protein mRNA, part...    61   2e-08   
gb:AY169493_1586531 Nicotiana tabacum Knotted-1-like homeobox pr...    61   2e-08   
gb:AY112704_1578154 Petunia x hybrida shootmeristemless-like mRN...    61   2e-08   
gb:AY072736_1567389 Antirrhinum majus hirzina (hirz) mRNA, compl...    61   2e-08   
gb:AB071452_1522821 Oryza sativa gene for transcription factor O...    61   2e-08   
pir|T06382|T06382 Knox protein 1 - garden pea>gb:AF063307_176541...    61   2e-08   Pisum sativum [garden pea]
pir|T02783|T02783 probable homeotic protein - rice>gb:AB007624_1...    61   2e-08   Oryza sativa [red rice]
pir|T01735|T01735 homeobox protein NTH15 - common tobacco>gb:AB0...    61   2e-08   Nicotiana tabacum [American tobacco]
sp|P53147|YGJ6_YEAST|YGJ6_YEAST Hypothetical homeobox protein in PRP20-VPS4...    61   2e-08   Saccharomyces cerevisiae [brewer's yeast]
sp|Q43484|KNX3_HORVU|KNX3_HORVU Homeobox protein KNOX3 (Hooded protein).>pi...    61   2e-08   Hordeum vulgare [barley]
sp|P56663|HKL5_MAIZE|HKL5_MAIZE Homeobox protein knotted-1 like 5 (Fragment).     61   2e-08   Zea mays [maize]
gb:AF457120S2_1801306 Zea mays knotted1-like homeodomain protein...    61   3e-08   
gb:AF457118_1801303 Zea mays knotted1-like homeodomain protein l...    61   3e-08   
gb:AB071664_1522926 Oryza sativa (indica cultivar-group) gene fo...    61   3e-08   
gb:AB071513_1522882 Oryza meridionalis gene for transcription fa...    61   3e-08   
gb:AB071504_1522873 Oryza glaberrima gene for transcription fact...    61   3e-08   
gb:AB071498_1522867 Oryza glaberrima gene for transcription fact...    61   3e-08   
gb:AB071477_1522846 Oryza rufipogon gene for transcription facto...    61   3e-08   
gb:AB071460_1522829 Oryza sativa (japonica cultivar-group) gene ...    61   3e-08   
gb:AB071454_1522823 Oryza sativa gene for transcription factor O...    61   3e-08   
gb:AB071439_1522809 Oryza sativa (indica cultivar-group) gene fo...    61   3e-08   
sp|P46608|HMB1_SOYBN|HMB1_SOYBN Homeobox protein SBH1.>pir|S42543|S42543 hy...    61   3e-08   Glycine max [soybeans]
sp|P56668|HKLB_MAIZE|HKLB_MAIZE Homeobox protein knotted-1 like 11 (Fragment).    61   3e-08   Zea mays [maize]
gb:AF170172_1774244 Acetabularia acetabulum KNOX1 homeodomain pr...    60   4e-08   
gb:LEU76407_1684760 Lycopersicon esculentum knotted 2 protein (T...    60   4e-08   
gb:AY080857_1568547 Arabidopsis thaliana putative homeobox prote...    60   4e-08   
gb:AB182944_1529259 Triticum aestivum Wknox1b gene for KN1 homeo...    60   4e-08   
gb:AB182943_1529258 Triticum aestivum Wknox1a gene for KN1 homeo...    60   4e-08   
gb:AB015999_1512740 Ipomoea nil Pkn1 (knotted-like gene) mRNA, c...    60   4e-08   
gb:AE005173_893905 Arabidopsis thaliana chromosome 1, bottom arm...    60   4e-08   
pir|S68456|S68456 homeotic protein shootmeristemless, KNOTTED-li...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q9M6D9|STM_BRAOL|STM_BRAOL Homeobox protein Shootmeristemless.>gb:AF193...    60   4e-08   Brassica oleracea
sp|Q38874|STM_ARATH|STM_ARATH Homeobox protein SHOOT MERISTEMLESS.>pir|T01...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q41330|HKN1_LYCES|HKN1_LYCES Homeotic protein knotted-1 (TKN1).>pir|T077...    60   4e-08   Solanum lycopersicum
sp|O22299|HKL6_LYCES|HKL6_LYCES Homeobox protein knotted-1 like LET6.>pir|T...    60   4e-08   Solanum lycopersicum
gb:AP004301_1839821 Oryza sativa (japonica cultivar-group) genom...    60   5e-08   
gb:AP002881_1823595 Oryza sativa (japonica cultivar-group) genom...    60   5e-08   
gb:AF544045_1810411 Hordeum vulgare knotted 1 (kn1) mRNA, comple...    60   5e-08   
gb:LEU76409_1684762 Lycopersicon esculentum homeobox 1 protein (...    60   5e-08   
gb:BT002930_1636518 Arabidopsis thaliana clone RAFL14-89-I21 (R2...    60   5e-08   
gb:AY680399_1622074 Pinus strobus homeobox transcription factor ...    60   5e-08   
gb:AB072362_1522995 Arabidopsis thaliana KNAT6L mRNA for homeodo...    60   5e-08   
gb:AB072361_1522994 Arabidopsis thaliana KNAT6S mRNA for homeodo...    60   5e-08   
gb:AB028883_1518118 Oryza sativa mRNA for knotted1-type homeobox...    60   5e-08   
gb:AB016071_1512760 Oryza sativa (japonica cultivar-group) mRNA,...    60   5e-08   
gb:AB007626_1510117 Oryza sativa (japonica cultivar-group) HOS16...    60   5e-08   
gb:AB007623_1510114 Oryza sativa (japonica cultivar-group) Hos3 ...    60   5e-08   
gb:AE005172_891291 Arabidopsis thaliana chromosome 1, top arm co...    60   5e-08   
pir|S57818|S57818 homeotic protein ATK1 - Arabidopsis thaliana>g...    60   5e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T02785|T02785 probable homeotic protein - rice>gb:AF050181_1...    60   5e-08   Oryza sativa Japonica Group [Japonica rice]
sp|Q41853|RSH1_MAIZE|RSH1_MAIZE Homeobox protein rough sheath 1.>pir|T03946...    60   5e-08   
gb:AY781901_1628330 Saccharum hybrid cultivar isolate c53a homeo...    60   7e-08   
gb:AY312168_1598229 Zea mays homeobox transcription factor GNARL...    60   7e-08   
pir|A96729|A96729 homeotic protein (ATK1), 26548-32058 [imported...    60   7e-08   
sp|P56662|HKL4_MAIZE|HKL4_MAIZE Homeobox protein knotted-1 like 4 (Fragment).     60   7e-08   
sp|P46640|HKL2_ARATH|HKL2_ARATH Homeobox protein knotted-1 like 2 (KNAT2) (...    60   7e-08   
gb:AF063248_1765407 Picea abies homeobox protein mRNA, complete ...    59   9e-08   
gb:AC133450_1741458 Oryza sativa chromosome 3 BAC OSJNBa0072F13 ...    59   9e-08   
gb:PMU90092_1700844 Picea mariana homeobox transcription factor ...    59   9e-08   
gb:AY680403_1622078 Pinus taeda homeobox transcription factor KN...    59   9e-08   
gb:AY680394_1622069 Picea glauca homeobox transcription factor K...    59   9e-08   
gb:AY680393_1622068 Pinus strobus homeobox transcription factor ...    59   9e-08   
gb:AY680391_1622066 Pinus strobus homeobox transcription factor ...    59   9e-08   
gb:AB028884_1518119 Oryza sativa mRNA for knotted1-type homeobox...    59   9e-08   
gb:AK118296_1816283 Arabidopsis thaliana At5g11060 mRNA for puta...    59   1e-07   
gb:AF533597_1809465 Lycopersicon esculentum knotted protein TKN4...    59   1e-07   
gb:AF483277_1804041 Picea abies KNOTTED1-like homeodomain protei...    59   1e-07   
gb:AF375968_1792979 Lycopersicon esculentum knotted homeodomain ...    59   1e-07   
gb:AF011554_1761173 Oryza officinalis homeobox protein (Knotted-...    59   1e-07   
gb:AY680404_1622079 Pinus taeda homeobox transcription factor KN...    59   1e-07   
gb:AY680395_1622070 Pinus strobus homeobox transcription factor ...    59   1e-07   
gb:ATKNAT4_1553535 A.thaliana mRNA for KNAT4 homeobox protein.         59   1e-07   
pir|JQ2379|JQ2379 homeobox 1 protein OSH1 - rice>gb:AC145380_174...    59   1e-07   
sp|P46609|OSH1_ORYSA|OSH1_ORYSA Homeobox protein OSH1.>gb:RICOSH1_1703703 O...    59   1e-07   
sp|P41817|CUP9_YEAST|CUP9_YEAST Homeobox protein CUP9.>pir|A56344|A56344 co...    59   1e-07   
gb:AF544047_1810413 Hordeum vulgare knotted 4 (kn4) gene, partia...    59   2e-07   
sp|Q93348|IRXH_CAEEL|IRXH_CAEEL Putative iroquois-class homeobox protein C3...    59   2e-07   
sp|P56666|HKL8_MAIZE|HKL8_MAIZE Homeobox protein knotted-1 like 8 (Fragment).     59   2e-07   
sp|P48001|HKL4_ARATH|HKL4_ARATH Homeobox protein knotted-1 like 4 (KNAT4).>...    59   2e-07   
gb:AF398433_2491911 Danio rerio iroquois homeodomain transcripti...    58   2e-07   
gb:CNS07EGD_1373489 chromosome VI of strain GB-M1 of Encephalito...    58   2e-07   
gb:CR380949_1649474 Candida glabrata strain CBS138 chromosome C ...    58   3e-07   
sp|P56659|HKL1_MAIZE|HKL1_MAIZE Homeobox protein knotted-1 like 1 (Fragment).     58   3e-07   
gb:AF544050_1810416 Hordeum vulgare knotted 6 (kn6) mRNA, partia...    57   3e-07   
gb:AY120762_1579644 Arabidopsis thaliana KNAT3 homeodomain prote...    57   3e-07   
gb:AY086091_1571149 Arabidopsis thaliana clone 21240 mRNA, compl...    57   3e-07   
gb:AB071451_1522820 Oryza sativa (japonica cultivar-group) gene ...    57   3e-07   
gb:AY705701_1347640 Oikopleura dioica Irx-e gene, complete cds.        57   3e-07   
sp|O22300|HKLB_LYCES|HKLB_LYCES Homeobox protein knotted-1 like LET12.>pir|...    57   3e-07   
sp|O04136|HKL3_MALDO|HKL3_MALDO Homeobox protein knotted-1 like 3 (KNAP3).>...    57   3e-07   
sp|P48000|HKL3_ARATH|HKL3_ARATH Homeobox protein knotted-1 like 3 (KNAT3).>...    57   3e-07   
gb:GGA238354_2572680 Gallus gallus mRNA for iroquois homologue-1.      57   4e-07   
gb:AC149069_2467661 X. tropicalis BAC clone ISB1-177L8 containin...    57   4e-07   
gb:BC029160_1979422 Homo sapiens, clone IMAGE:5181034, mRNA, par...    57   4e-07   
gb:AK118326_1816309 Arabidopsis thaliana At1g62990 mRNA for puta...    57   4e-07   
gb:AF308451_1784799 Arabidopsis thaliana homeodomain transcripti...    57   4e-07   
gb:LEU76410_1684763 Lycopersicon esculentum homeobox 2 protein (...    57   4e-07   
gb:AY084398_1569488 Arabidopsis thaliana clone 106887 mRNA, comp...    57   4e-07   
pir|A96655|A96655 hypothetical protein F16P17.16 [imported] - Ar...    57   4e-07   
pir|T02220|T02220 homeobox protein NTH23 - common tobacco>gb:AB0...    57   4e-07   
sp|P81068|IRX1_MOUSE|IRX1_MOUSE Iroquois-class homeodomain protein IRX-1 (I...    57   4e-07   
sp|P78414|IRX1_HUMAN|IRX1_HUMAN Iroquois-class homeodomain protein IRX-1 (I...    57   4e-07   
sp|P46606|HD1_BRANA|HD1_BRANA Homeobox protein HD1.>pir|S47535|S47535 home...    57   4e-07   
gb:XLRNAIRO1_2583099 Xenopus laevis mRNA for an homeobox Iro pro...    57   6e-07   
gb:BC066730_2554567 Danio rerio iroquois homeobox protein 3b, mR...    57   6e-07   
gb:AY043241_2509452 Danio rerio iroquois homeobox protein ziro1-...    57   6e-07   
gb:AF359505_2489230 Danio rerio iroquois homeobox protein Ziro1 ...    57   6e-07   
gb:AF340184_2488549 Danio rerio iroquois 3 homeobox protein mRNA...    57   6e-07   
gb:AF319963_2487561 Gallus gallus clone 12 iroquois-related home...    57   6e-07   
gb:AF124095_2475217 Danio rerio iroquois homeobox protein Ziro3 ...    57   6e-07   
gb:AB091387_2464446 Oryzias latipes Iro3 mRNA for iroquois homeo...    57   6e-07   
gb:MMIRX1_2116156 Mus musculus mRNA for iroquois homeobox protei...    57   6e-07   
gb:AF284817_1783102 Physcomitrella patens class 1 KNOTTED1-like ...    57   6e-07   
gb:AF003527_1760656 Avena vaviloviana knotted-1 homeobox protein...    57   6e-07   
gb:AC116369_1739293 Oryza sativa chromosome 3 BAC OSJNBb0113I20 ...    57   6e-07   
gb:AC092781_1735736 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    57   6e-07   
gb:AC090683_1734403 Oryza sativa chromosome 3 BAC OSJNBa0035I24 ...    57   6e-07   
gb:PMU90091_1700843 Picea mariana homeobox transcription factor ...    57   6e-07   
gb:AY680402_1622077 Pinus taeda homeobox transcription factor KN...    57   6e-07   
gb:AY680392_1622067 Picea glauca homeobox transcription factor K...    57   6e-07   
gb:ATKNAT5_1553536 A.thaliana mRNA for KNAT5 homeobox protein.         57   6e-07   
sp|Q9BYU1|PBX4_HUMAN|PBX4_HUMAN Pre-B-cell leukemia transcription factor-4 ...    57   6e-07   
sp|P56664|HKL6_MAIZE|HKL6_MAIZE Homeobox protein knotted-1 like 6 (Fragment...    57   6e-07   
sp|P48002|HKL5_ARATH|HKL5_ARATH Homeobox protein knotted-1 like 5 (KNAT5) (...    57   6e-07   
gb:BC067972_2554956 Xenopus tropicalis hypothetical protein MGC6...    56   8e-07   
gb:AF157620_2477674 Gallus gallus iroquois-related homeobox tran...    56   8e-07   
gb:AF027175_2469230 Xenopus laevis homeobox transcription factor...    56   8e-07   
gb:BC085500_2109244 Mus musculus Iroquois related homeobox 3 (Dr...    56   8e-07   
gb:BC023667_1978182 Homo sapiens iroquois homeobox protein 3, mR...    56   8e-07   
gb:AY335943_1944099 Homo sapiens homeodomain protein IRXB1 (IRX3...    56   8e-07   
gb:AC098695_1736866 Oryza sativa (japonica cultivar-group) chrom...    56   8e-07   
gb:AB061819_1522093 Oryza sativa (japonica cultivar-group) HOS66...    56   8e-07   
gb:AB061817_1522091 Oryza sativa (japonica cultivar-group) HOS58...    56   8e-07   
gb:AB007629_1510120 Oryza sativa (japonica cultivar-group) HOS66...    56   8e-07   
gb:AB007627_1510118 Oryza sativa (japonica cultivar-group) HOS58...    56   8e-07   
gb:AY705700_1347639 Oikopleura dioica Irx-a gene, partial cds.         56   8e-07   
sp|P81067|IRX3_MOUSE|IRX3_MOUSE Iroquois-class homeodomain protein IRX-3 (I...    56   8e-07   
sp|P78415|IRX3_HUMAN|IRX3_HUMAN Iroquois-class homeodomain protein IRX-3 (I...    56   8e-07   
gb:AP003918_1835210 Oryza sativa (japonica cultivar-group) genom...    56   1e-06   
gb:D49703S2_1674627 Oryza sativa (japonica cultivar-group) OSH45...    56   1e-06   
gb:AY667451_1620714 Selaginella kraussiana KNOTTED1-like protein...    56   1e-06   
gb:AB043957_1520040 Ceratopteris richardii mRNA for CRKNOX3, com...    56   1e-06   
gb:AY705695_1347634 Oikopleura dioica Pbx gene, complete cds.          56   1e-06   
pir|T03874|T03874 probable homeobox protein OSH45, splice form O...    56   1e-06   
pir|T03875|T03875 probable homeobox protein OSH45, splice form O...    56   1e-06   
gb:MMU300183_2120529 Mus musculus partial mRNA for Pbx4 protein,...    55   1e-06   
gb:BC032875_2097384 Mus musculus pre-B-cell leukemia transcripti...    55   1e-06   
gb:BC025404_1978501 Homo sapiens Meis1, myeloid ecotropic viral ...    55   1e-06   
gb:AF544052_1810418 Nicotiana tabacum knotted 1 (kn1) mRNA, comp...    55   1e-06   
gb:AF544051_1810417 Hordeum vulgare knotted 7 (kn7) mRNA, comple...    55   1e-06   
gb:AB061818_1522092 Oryza sativa (japonica cultivar-group) HOS59...    55   1e-06   
gb:AB025573_1516211 Nicotiana tabacum NTH1 mRNA for KN1-type hom...    55   1e-06   
gb:AB007628_1510119 Oryza sativa (japonica cultivar-group) HOS59...    55   1e-06   
gb:AF391292_1267445 Branchiostoma floridae cosmid MPMGc117N2261,...    55   1e-06   
sp|Q99NE9|PBX4_MOUSE|PBX4_MOUSE Pre-B-cell leukemia transcription factor-4 ...    55   1e-06   
sp|P56660|HKL2_MAIZE|HKL2_MAIZE Homeobox protein knotted-1 like 2 (Fragment).     55   1e-06   
gb:GGA238355_2572681 Gallus gallus partial mRNA for iroquois hom...    55   2e-06   
gb:BC076162_2559036 Danio rerio iroquois homeobox protein 6a, mR...    55   2e-06   
gb:AF319965_2487563 Gallus gallus clone 30 iroquois-related home...    55   2e-06   
gb:AY705702_1347641 Oikopleura dioica Irx-b gene, complete cds.        55   2e-06   
gb:AY313149_1318637 Saccoglossus kowalevskii iroquois (iro) mRNA...    55   2e-06   
gb:AE014296_1136035 Drosophila melanogaster chromosome 3L, compl...    55   2e-06   
pir|T03095|T03095 homeoprotein Sail - fruit fly (Drosophila mela...    55   2e-06   
gb:AF527947_1808527 Brassica oleracea homeodomain protein BOSTM-...    55   2e-06   
gb:DMARA_1378102 D.melanogaster mRNA for araucan homeoprotein.         55   2e-06   
gb:CSA518944_1375706 Cupiennius salei mRNA for extradenticle 2 (...    55   2e-06   
gb:CSA518943_1375705 Cupiennius salei mRNA for extradenticle-1 (...    55   2e-06   
gb:BT016078_1358523 Drosophila melanogaster LP02208 full insert ...    55   2e-06   
gb:AK035140_1164001 Mus musculus 12 days embryo embryonic body b...    55   2e-06   
sp|Q9ER75|IRX6_MOUSE|IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 (I...    55   2e-06   
sp|Q24248|ARA_DROME|ARA_DROME Homeobox protein araucan.>gb:AE014296_113603...    55   2e-06   
gb:BC065966_2554220 Danio rerio iroquois homeobox protein 4a, mR...    54   3e-06   
gb:AY845128_2546912 Danio rerio Iroquois 4a protein (irx4a) mRNA...    54   3e-06   
gb:AF338158_2488346 Xenopus laevis iroquois-5 homeobox transcrip...    54   3e-06   
gb:AY705699_1347638 Oikopleura dioica Irx-c gene, complete cds.        54   3e-06   
sp|P41779|HM20_CAEEL|HM20_CAEEL Homeobox protein ceh-20.>pir|T16221|T16221 ...    54   3e-06   
gb:AY017309_2508434 Danio rerio iroquois homeobox protein Ziro5 ...    54   4e-06   
gb:BX883044_2111412 Rattus norvegicus chromosome 20, major histo...    54   4e-06   
gb:BC087615_2110097 Mus musculus cDNA clone MGC:91042 IMAGE:4978...    54   4e-06   
gb:HSPBX2_2019457 Human PBX2 mRNA.                                     54   4e-06   
gb:AL662884_1931898 Human DNA sequence from clone XXbac-300A18 o...    54   4e-06   
gb:AL662830_1931645 Human DNA sequence from clone XXbac-173E2 on...    54   4e-06   
gb:AF285147_1783115 Physcomitrella patens class 1 KNOTTED1-like ...    54   4e-06   
gb:AF011552_1761171 Hordeum marinum homeobox protein (Knotted-1)...    54   4e-06   
gb:TCA518940_1399638 Tribolium castaneum mRNA for extradenticle ...    54   4e-06   
gb:DMDPBXA_1378660 D.melanogaster for Dpbx gene.                       54   4e-06   
gb:AY600514_1340196 Tribolium castaneum iroquois-like protein (i...    54   4e-06   
sp|O35984|PBX2_MOUSE|PBX2_MOUSE Pre-B-cell leukemia transcription factor-2 ...    54   4e-06   
sp|P40425|PBX2_HUMAN|PBX2_HUMAN Pre-B-cell leukemia transcription factor-2 ...    54   4e-06   
sp|P56667|HKLA_MAIZE|HKLA_MAIZE Homeobox protein knotted-1 like 10 (Fragment).    54   4e-06   
sp|P40427|EXD_DROME|EXD_DROME Homeobox protein extradenticle.>pir|A48840|A...    54   4e-06   
gb:BC077951_2560597 Xenopus laevis homeobox Iroquois protein 2, ...    54   5e-06   
gb:AY512587_2535768 Danio rerio iroquois homeobox protein 5b (ir...    54   5e-06   
gb:AF162696_2477779 Danio rerio Pbx4 homeodomain protein (pbx4) ...    54   5e-06   
gb:MMU271054_2119971 Mus musculus partial mRNA for iroquois home...    54   5e-06   
gb:AF165985_2057551 Mus musculus iroquois-class homeobox protein...    54   5e-06   
gb:HSU90309_2027124 Human iroquois-class homeodomain protein IRX...    54   5e-06   
gb:HSU90304_2027119 Human iroquois-class homeodomain protein IRX...    54   5e-06   
gb:BC074850_1989350 Homo sapiens iroquois homeobox protein 5, mR...    54   5e-06   
gb:AF483278_1804042 Picea abies KNOTTED1-like homeodomain protei...    54   5e-06   
gb:AY705703_1347642 Oikopleura dioica Irx-d gene, partial cds.         54   5e-06   
sp|Q9JKQ4|IRX5_MOUSE|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 (I...    54   5e-06   
sp|P78411|IRX5_HUMAN|IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 (I...    54   5e-06   
gb:GGA237599_2572675 Gallus gallus mRNA for iroquois homologue-2.      53   6e-06   
gb:DRE245965_2571032 Danio rerio mRNA for pbxy homeodomain prote...    53   6e-06   
gb:AB043620_2462046 Gallus gallus PBX1B mRNA, complete cds.            53   6e-06   
gb:AB043619_2462045 Gallus gallus PBX1A mRNA, complete cds.            53   6e-06   
gb:BT008000_2150932 Synthetic construct Homo sapiens pre-B-cell ...    53   6e-06   
gb:BC002244_2088996 Mus musculus pre B-cell leukemia transcripti...    53   6e-06   
gb:HUMTRAA1_2037855 Human translocation (t1;19) fusion protein (...    53   6e-06   
gb:AB064996_1869656 Macaca fascicularis mRNA for pre-B-cell leuk...    53   6e-06   
gb:AF285148_1783116 Physcomitrella patens class 2 KNOTTED1-like ...    53   6e-06   
gb:CR382122_1655257 Kluyveromyces lactis strain NRRL Y-1140 chro...    53   6e-06   
gb:AB016002_1512743 Ipomoea nil PKn3 (knotted-like gene) mRNA, c...    53   6e-06   
gb:DMCAUP_1378507 D.melanogaster mRNA for caupolican homeoprotein.     53   6e-06   
gb:BT015986_1358431 Drosophila melanogaster RE59515 full insert ...    53   6e-06   
pir|C34734|C34734 transcription factor 3/homeotic protein prl mu...    53   6e-06   
pir|B34734|B34734 transcription factor 3/homeotic protein prl mu...    53   6e-06   
pir|A54863|A54863 homeobox protein - mouse>gb:AL357568_1925025 H...    53   6e-06   
pir|B33061|B33061 homeotic protein prl - human>gb:HUMPRLAA_20358...    53   6e-06   
sp|P40424|PBX1_HUMAN|PBX1_HUMAN Pre-B-cell leukemia transcription factor-1 ...    53   6e-06   
sp|P54269|CAUP_DROME|CAUP_DROME Homeobox protein caupolican.>gb:AE014296_11...    53   6e-06   
gb:BC081317_2562205 Xenopus tropicalis irx2-prov protein, mRNA (...    53   8e-06   
gb:BC077101_2559821 Danio rerio iroquois homeobox protein 1, b, ...    53   8e-06   
gb:BC065681_2554126 Danio rerio iroquois homeobox protein 2, a, ...    53   8e-06   
gb:AY845129_2546913 Danio rerio Iroquois 4b protein (irx4b) mRNA...    53   8e-06   
gb:AY845127_2546911 Danio rerio Iroquois 2a protein (irx2a) mRNA...    53   8e-06   
gb:AY017308_2508433 Danio rerio iroquois homeobox protein Ziro1 ...    53   8e-06   
gb:AF414134_2493247 Danio rerio iroquois 1 mRNA, complete cds.         53   8e-06   
gb:AF338157_2488345 Xenopus laevis iroquois-4 homeobox transcrip...    53   8e-06   
gb:AC149071_2467662 Xenopus tropicalis BAC clone ISB10250N9 cont...    53   8e-06   
gb:BC085291_2109168 Mus musculus Iroquois related homeobox 2 (Dr...    53   8e-06   
gb:AF165986_2057552 Mus musculus iroquois-class homeobox protein...    53   8e-06   
gb:AK125053_1915801 Homo sapiens cDNA FLJ43063 fis, clone BRTHA3...    53   8e-06   
sp|P78412|IRX6_HUMAN|IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 (I...    53   8e-06   
sp|Q9QY61|IRX4_MOUSE|IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 (I...    53   8e-06   
sp|P78413|IRX4_HUMAN|IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 (I...    53   8e-06   
sp|Q9YGS0|IRX4_CHICK|IRX4_CHICK Iroquois-class homeodomain protein IRX-4 (I...    53   8e-06   
sp|P81066|IRX2_MOUSE|IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 (I...    53   8e-06   
sp|Q9BZI1|IRX2_HUMAN|IRX2_HUMAN Iroquois-class homeodomain protein IRX-2 (I...    53   8e-06   
gb:AB071663_1522925 Oryza sativa (japonica cultivar-group) gene ...    52   1e-05   
gb:AB071437_1522807 Oryza sativa (japonica cultivar-group) gene ...    52   1e-05   
gb:AB028882_1518117 Oryza sativa mRNA for knotted1-type homeobox...    52   1e-05   
gb:AB007625_1510116 Oryza sativa (japonica cultivar-group) HOS13...    52   1e-05   
gb:AC006692_1203749 Caenorhabditis elegans cosmid T28F12, comple...    52   1e-05   
gb:BC077517_2560225 Xenopus laevis MGC82772 protein, mRNA (cDNA ...    52   1e-05   
gb:BC056322_2551762 Danio rerio iroquois homeobox protein 2, a, ...    52   1e-05   
gb:AF319964_2487562 Gallus gallus clone 18 iroquois-related home...    52   1e-05   
gb:AF319962_2487560 Gallus gallus clone 5 iroquois-related homeo...    52   1e-05   
gb:MMIRX2_2116157 Mus musculus mRNA for iroquois homeobox protei...    52   1e-05   
gb:BC036207_1981867 Homo sapiens chromosome 10 open reading fram...    52   1e-05   
gb:AF319967_1896582 Homo sapiens clone 19-3 iroquois-related hom...    52   1e-05   
gb:AF288769_1783514 Physcomitrella patens homeobox protein (MKN4...    52   1e-05   
gb:AK034675_1163838 Mus musculus 12 days embryo embryonic body b...    52   1e-05   
gb:BC071048_2555922 Xenopus laevis hypothetical protein MGC83856...    52   2e-05   
gb:AF110101_1768714 Santalum album knotted 1 homolog (SE1) mRNA,...    52   2e-05   
gb:DRE245964_2571031 Danio rerio mRNA for Pbx3b homeodomain prot...    51   2e-05   
gb:AJ719751_2501938 Gallus gallus mRNA for hypothetical protein,...    51   2e-05   
gb:AF020200_2051042 Mus musculus transcription factor PBX3b (PBX...    51   2e-05   
gb:AL445186_1927339 Human DNA sequence from clone RP11-336P12 on...    51   2e-05   
gb:AF355142_1898812 Homo sapiens pre-B-cell leukemia transcripti...    51   2e-05   
gb:AF355141_1898811 Homo sapiens pre-B-cell leukemia transcripti...    51   2e-05   
gb:CR860444_1184513 Pongo pygmaeus mRNA; cDNA DKFZp459H0923 (fro...    51   2e-05   
sp|O35317|PBX3_MOUSE|PBX3_MOUSE Pre-B-cell leukemia transcription factor-3 ...    51   2e-05   
sp|P40426|PBX3_HUMAN|PBX3_HUMAN Pre-B-cell leukemia transcription factor-3 ...    51   2e-05   
gb:DRE245963_2571030 Danio rerio mRNA for Pbx1b homeodomain prot...    51   3e-05   
gb:BC066446_2554336 Danio rerio pre-B-cell leukemia transcriptio...    51   3e-05   
gb:AF480430_2497020 Xenopus laevis pre-B-cell leukemia transcrip...    51   3e-05   
gb:CR382136_1668744 Debaryomyces hansenii chromosome D of strain...    51   3e-05   
gb:AY898810_1632045 Chlamydomonas incerta homoserine dehydrogena...    51   3e-05   
gb:AY052652_1562812 Chlamydomonas reinhardtii gamete-specific ho...    51   3e-05   


>gb:AF406699_1796907 Solanum tuberosum BEL1-related homeotic protein
            13 (Bel13) mRNA, partial cds.
          Length = 567

 Score =  155 bits (392), Expect = 9e-37
 Identities = 111/271 (40%), Positives = 133/271 (49%), Gaps = 29/271 (10%)
 Frame = -2

Query: 849  AGSYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFE 670
            AG+ GLTKGETP            + A +QMGM+ + E WRPQRGLP+RSVN+LR+WLFE
Sbjct: 305  AGNSGLTKGETPRLKMLEQSLRQQR-AFHQMGMM-EQEAWRPQRGLPERSVNILRAWLFE 362

Query: 669  HFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVXXXXXXXXXXXEN----- 505
            HFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV           +      
Sbjct: 363  HFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYQQEAKDEDGDGDEK 422

Query: 504  -----------AQTPMPRDDDDDNSKEIXXXXXXXXXXXXXXX---------XXXXTKRC 385
                       AQTP P    + +S  +                            +KR 
Sbjct: 423  SQSQNSGNNIIAQTPTPNSLTNTSSTNMTTTTAPTTTTALAAAETGTAATPITVTSSKRS 482

Query: 384  QFNATENDSSRTXXXXXXXXXXXASGNQVTM-INGNTAAVPPPVSLSFAAAAAPVVDCGG 208
            Q NAT++D S              S NQ T   N +        +LS           G 
Sbjct: 483  QINATDSDPS-------LVAINSFSENQATFPTNIHDPDDCRRGNLSGDDGTTTHDHMGS 535

Query: 207  ---GFGTPATGDVSLTLGLRHPENSVTITNF 124
                FGT A GDVSLTLGLRH  N    T+F
Sbjct: 536  TMIRFGTTA-GDVSLTLGLRHAGNLPENTHF 565



>gb:AY050459_1562233 Arabidopsis thaliana AT4g36870/C7A10_490 mRNA,
            complete cds.>gb:AF173816_1774456 Arabidopsis thaliana
            bel1-like homeodomain 2 (BLH2) mRNA, complete cds.
          Length = 739

 Score =  154 bits (388), Expect = 3e-36
 Identities = 106/278 (38%), Positives = 130/278 (46%), Gaps = 35/278 (12%)
 Frame = -2

Query: 843  SYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHF 664
            S GLTKGETP            + A +QMGM+ + E WRPQRGLP+RSVN+LR+WLFEHF
Sbjct: 464  SSGLTKGETPRLRLLEQSLRQQR-AFHQMGMM-EQEAWRPQRGLPERSVNILRAWLFEHF 521

Query: 663  LNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV-------XXXXXXXXXXXEN 505
            L+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV                  EN
Sbjct: 522  LHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQESKEREREEELEEN 581

Query: 504  AQTPMPRDDDDDNS----------------KEIXXXXXXXXXXXXXXXXXXXTKRCQFNA 373
             +    ++ +DD S                 +                      R   NA
Sbjct: 582  EEDQETKNSNDDKSTKSNNNESNFTAVRTTSQTPTTTAPDASDADAAVATGHRLRSNINA 641

Query: 372  TENDSSRTX--XXXXXXXXXXASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGG--- 208
             END+S               A  + +    G + A     +   +       D  G   
Sbjct: 642  YENDASSLLLPSSYSNAAAPAAVSDDLNSRYGGSDAFSAVATCQQSVGGFDDADMDGVNV 701

Query: 207  -GFGTPATGDVSLTLGLRHPEN------SVTITNFGAY 115
              FGT  TGDVSLTLGLRH  N      S  +  FG +
Sbjct: 702  IRFGTNPTGDVSLTLGLRHAGNMPDKDASFCVREFGGF 739



>gb:AF353092_1790538 Arabidopsis thaliana BEL1-like homeobox 4 (BLH4)
            mRNA, complete cds.
          Length = 627

 Score =  153 bits (386), Expect = 5e-36
 Identities = 105/261 (40%), Positives = 134/261 (51%), Gaps = 16/261 (6%)
 Frame = -2

Query: 849  AGSYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFE 670
            A S GLTKGETP            + A + MGM+ + E WRPQRGLP+RSVN+LR+WLFE
Sbjct: 388  AASSGLTKGETPRLRLLEQSLRQQR-AFHHMGMM-EQEAWRPQRGLPERSVNILRAWLFE 445

Query: 669  HFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVXXXXXXXXXXXENAQTPM 490
            HFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV           E A    
Sbjct: 446  HFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEAKEREEA---- 501

Query: 489  PRDDDDDNSKEIXXXXXXXXXXXXXXXXXXXTKRCQFNATENDSSRTXXXXXXXXXXXAS 310
              +++++N ++                        + N  EN+ +               
Sbjct: 502  --EEENENQQQ------------QRRQQQTNNNDTKPNNNENNFTVITAQTPTTMTSTHH 547

Query: 309  GNQVTMINGNTAAVPPPVSLSFAAAAAPV------VDCGG----GFGTPATGDVSLTLGL 160
             N  + ++ + AA     S +F  A          VD  G     FGT  TGDVSLTLGL
Sbjct: 548  ENDSSFLS-SVAAASHGGSDAFTVATCQQDVSDFHVDGDGVNVIRFGTKQTGDVSLTLGL 606

Query: 159  RHPEN------SVTITNFGAY 115
            RH  N      S ++ +FG +
Sbjct: 607  RHSGNIPDKNTSFSVRDFGDF 627



>pir|T02415|T02415 probable homeodomain transcription factor
            [imported] - Arabidopsis thaliana>gb:AC004482_1531757
            Arabidopsis thaliana chromosome 2 clone F27L4 map
            CIC06C07, complete sequence.>gb:AY058179_1564315
            Arabidopsis thaliana At2g23760/F27L4.6 mRNA, complete
            cds.>gb:AY142019_1582856 Arabidopsis thaliana
            At2g23760/F27L4.6 mRNA, complete cds.
          Length = 627

 Score =  153 bits (386), Expect = 5e-36
 Identities = 105/261 (40%), Positives = 134/261 (51%), Gaps = 16/261 (6%)
 Frame = -2

Query: 849  AGSYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFE 670
            A S GLTKGETP            + A + MGM+ + E WRPQRGLP+RSVN+LR+WLFE
Sbjct: 388  AASSGLTKGETPRLRLLEQSLRQQR-AFHHMGMM-EQEAWRPQRGLPERSVNILRAWLFE 445

Query: 669  HFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVXXXXXXXXXXXENAQTPM 490
            HFLNPYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV           E A    
Sbjct: 446  HFLNPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEAKEREEA---- 501

Query: 489  PRDDDDDNSKEIXXXXXXXXXXXXXXXXXXXTKRCQFNATENDSSRTXXXXXXXXXXXAS 310
              +++++N ++                        + N  EN+ +               
Sbjct: 502  --EEENENQQQ------------QRRQQQTNNNDTKPNNNENNFTVITAQTPTTMTSTHH 547

Query: 309  GNQVTMINGNTAAVPPPVSLSFAAAAAPV------VDCGG----GFGTPATGDVSLTLGL 160
             N  + ++ + AA     S +F  A          VD  G     FGT  TGDVSLTLGL
Sbjct: 548  ENDSSFLS-SVAAASHGGSDAFTVATCQQDVSDFHVDGDGVNVIRFGTKQTGDVSLTLGL 606

Query: 159  RHPEN------SVTITNFGAY 115
            RH  N      S ++ +FG +
Sbjct: 607  RHSGNIPDKNTSFSVRDFGDF 627



>gb:AF406701_1796909 Solanum tuberosum BEL1-related homeotic protein
            22 (Bel22) mRNA, partial cds.
          Length = 620

 Score =  149 bits (375), Expect = 9e-35
 Identities = 99/261 (37%), Positives = 122/261 (46%), Gaps = 19/261 (7%)
 Frame = -2

Query: 849  AGSYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFE 670
            + S GLTKGETP            + A  QMGM+ + E WRPQRGLP+RSVN+LR+WLFE
Sbjct: 370  SSSSGLTKGETPRLKVLEQSLRQQR-AFQQMGMM-EQEAWRPQRGLPERSVNILRAWLFE 427

Query: 669  HFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVXXXXXXXXXXXENAQTPM 490
            HFL+PYPS+ADK LL+RQTGLS+NQV+NWFINARVRLWKPMV              Q  +
Sbjct: 428  HFLHPYPSDADKHLLARQTGLSRNQVANWFINARVRLWKPMVEEMY----------QREV 477

Query: 489  PRDDDDDNSKE--------------IXXXXXXXXXXXXXXXXXXXTKRCQFNATENDSSR 352
              DD DD  +               I                    K+ Q N +E D S 
Sbjct: 478  NEDDVDDMQENQNSTNTQIPTPNIIITTNSNITETKSAATATIASDKKPQINVSEIDPSI 537

Query: 351  TXXXXXXXXXXXASGNQVTMINGNTAAV-----PPPVSLSFAAAAAPVVDCGGGFGTPAT 187
                                I   +  +           +  A+ + +      FGT   
Sbjct: 538  VAMNTHYSSSMPTQLTNFPTIQDESDHILYRRSGAEYGTTNMASNSEIGSNMITFGTTTA 597

Query: 186  GDVSLTLGLRHPENSVTITNF 124
             DVSLTLGLRH  N    T+F
Sbjct: 598  SDVSLTLGLRHAGNLPENTHF 618



>gb:AF053769_1764475 Malus x domestica homeodomain protein (Mdh1)
            mRNA, complete cds.
          Length = 809

 Score =  149 bits (375), Expect = 9e-35
 Identities = 104/271 (38%), Positives = 125/271 (46%), Gaps = 39/271 (14%)
 Frame = -2

Query: 849  AGSYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFE 670
            AG+ G+TKGETP            + A +QMGM+ + E WRPQRGLP+RSVN+LR+WLFE
Sbjct: 520  AGTSGITKGETPRLKLLEQSLRQQR-AFHQMGMM-EQEAWRPQRGLPERSVNILRAWLFE 577

Query: 669  HFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV-------XXXXXXXXXXX 511
            HFL+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV                  
Sbjct: 578  HFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEANEEEEVGEGG 637

Query: 510  ENAQTPMPRDDD---DDNSKEIXXXXXXXXXXXXXXXXXXXTKRCQFNATENDSSRTXXX 340
                T    D +   + N+                      +KR   NA+END S     
Sbjct: 638  VGGATSAAADQERERNSNAGLAAQTPTPTTTTTTTTKNSPASKRSDINASENDPS----L 693

Query: 339  XXXXXXXXASGNQVTMINGNTAAVPPPVSLSFAAAAAPVVDCGGG--------------- 205
                       +   M    +  V  P    F AAA+       G               
Sbjct: 694  VAINRHQQQQHHHPMMATTTSTTVASPAYQCFPAAASDDTCRSYGTTSANANIAAHHDHQ 753

Query: 204  -------------FG-TPATGDVSLTLGLRH 154
                         FG T A GDVSLTLGLRH
Sbjct: 754  NSSNIDSSTTLISFGTTTAAGDVSLTLGLRH 784



>pir|D85435|D85435 BEL1-like homeobox 2 protein (BLH2) [imported] -
           Arabidopsis thaliana>gb:ATAP21_1544010 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV86_1547642 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 638

 Score =  140 bits (354), Expect = 2e-32
 Identities = 70/100 (70%), Positives = 80/100 (80%)
 Frame = -2

Query: 843 SYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHF 664
           S GLTKGETP            + A +QMGM  + E WRPQRGLP+RSVN+LR+WLFEHF
Sbjct: 464 SSGLTKGETPRLRLLEQSLRQNR-AFHQMGM--EQEAWRPQRGLPERSVNILRAWLFEHF 520

Query: 663 LNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           L+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPMV
Sbjct: 521 LHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMV 560



>gb:AF334758_1787475 Hordeum vulgare homeodomain protein JUBEL1
           (JuBel1) gene, complete cds.
          Length = 759

 Score =  139 bits (350), Expect = 7e-32
 Identities = 68/100 (68%), Positives = 80/100 (80%)
 Frame = -2

Query: 843 SYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHF 664
           S GLTKGETP            + A + MGM+ + E WRPQRGLP+RSV++LRSWLFEHF
Sbjct: 499 SSGLTKGETPRLRAIDQSLRQQR-AFHHMGMM-EQEAWRPQRGLPERSVSILRSWLFEHF 556

Query: 663 LNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           L+PYPS+ADK LL+RQTGLS+NQVSNWFINARVRLWKPM+
Sbjct: 557 LHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMI 596



>gb:AF406700_1796908 Solanum tuberosum BEL1-related homeotic protein
           14 (Bel14) mRNA, partial cds.
          Length = 532

 Score =  131 bits (329), Expect = 2e-29
 Identities = 67/115 (58%), Positives = 81/115 (70%)
 Frame = -2

Query: 837 GLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLN 658
           G T+GETP            K A  QM M+ ++ PWRPQRGLP+RSV+VLR+WLFEHFL+
Sbjct: 264 GSTRGETPRLRLLDQTLRQQK-AFQQMNMM-ETHPWRPQRGLPERSVSVLRAWLFEHFLH 321

Query: 657 PYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVXXXXXXXXXXXENAQTP 493
           PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV           EN  +P
Sbjct: 322 PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEEENVGSP 376



>gb:AF375964_1792975 Lycopersicon esculentum bell-like homeodomain
           protein 3 (BL3) mRNA, partial cds.
          Length = 523

 Score =  130 bits (328), Expect = 2e-29
 Identities = 64/98 (65%), Positives = 77/98 (78%)
 Frame = -2

Query: 837 GLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLN 658
           G T+GETP            K A  QM M+ ++ PWRPQRGLP+RSV+VLR+WLFEHFL+
Sbjct: 242 GSTRGETPRLRLLDQTLRQQK-AFQQMNMM-ETHPWRPQRGLPERSVSVLRAWLFEHFLH 299

Query: 657 PYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           PYPS+ DK +L+RQTGLS++QVSNWFINARVRLWKPMV
Sbjct: 300 PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV 337



>gb:AE016959_1023614 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092389_1735367
           Oryza sativa chromosome 10 BAC OSJNBa0053C23 genomic
           sequence, complete sequence.>gb:AE017115_1753433 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 586

 Score =  129 bits (324), Expect = 7e-29
 Identities = 63/98 (64%), Positives = 77/98 (78%)
 Frame = -2

Query: 837 GLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLN 658
           G+TKGETP            K    Q GML +S PWRPQRGLP+R+V++LR+WLFEHFL+
Sbjct: 293 GMTKGETPRLRVLDQCLRQHKAY--QAGML-ESHPWRPQRGLPERAVSILRAWLFEHFLH 349

Query: 657 PYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           PYPS+ DK +L+RQTGLS++QV+NWFINARVRLWKPMV
Sbjct: 350 PYPSDVDKHILARQTGLSRSQVANWFINARVRLWKPMV 387



>gb:AP000616_1820513 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone:P0514G12.
          Length = 529

 Score =  126 bits (316), Expect = 6e-28
 Identities = 62/102 (60%), Positives = 77/102 (75%)
 Frame = -2

Query: 849 AGSYGLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFE 670
           A + G TKG+TP            + A  Q G + DS PWRPQRGLP+R+V VLR+WLFE
Sbjct: 257 AAAPGATKGDTPRLRVLDQCLRQQR-AFQQSGAV-DSFPWRPQRGLPERAVAVLRAWLFE 314

Query: 669 HFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           HFL+PYP++ DK +L+RQTGLS++QVSNWFINARVRLWKPM+
Sbjct: 315 HFLHPYPNDVDKHILARQTGLSRSQVSNWFINARVRLWKPMI 356



>gb:AY054513_1563167 Arabidopsis thaliana homeotic protein BEL1
           homolog (At5g41410; MYC6.12) mRNA, complete cds.
          Length = 513

 Score =  123 bits (309), Expect = 4e-27
 Identities = 52/69 (75%), Positives = 64/69 (92%)
 Frame = -2

Query: 750 LLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINA 571
           L+D+ PWRPQRGLP+R+V  LR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINA
Sbjct: 386 LVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA 445

Query: 570 RVRLWKPMV 544
           RVRLWKPM+
Sbjct: 446 RVRLWKPMI 454



>gb:AB006707_1510039 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MYC6.>gb:ATU39944_1556969 Arabidopsis thaliana
           homeobox protein (BEL1) mRNA, complete
           cds.>gb:AY049237_1561880 Arabidopsis thaliana
           AT5g41410/MYC6_12 mRNA, complete
           cds.>gb:BT002637_1636240 Arabidopsis thaliana
           At5g41410/MYC6_12 gene, complete cds.
          Length = 611

 Score =  123 bits (309), Expect = 4e-27
 Identities = 52/69 (75%), Positives = 64/69 (92%)
 Frame = -2

Query: 750 LLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINA 571
           L+D+ PWRPQRGLP+R+V  LR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINA
Sbjct: 386 LVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA 445

Query: 570 RVRLWKPMV 544
           RVRLWKPM+
Sbjct: 446 RVRLWKPMI 454



>pir|A57632|A57632 homeotic protein BEL1 - Arabidopsis thaliana
          Length = 610

 Score =  123 bits (309), Expect = 4e-27
 Identities = 52/69 (75%), Positives = 64/69 (92%)
 Frame = -2

Query: 750 LLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINA 571
           L+D+ PWRPQRGLP+R+V  LR+WLFEHFL+PYPS+ DK +L+RQTGLS++QVSNWFINA
Sbjct: 385 LVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA 444

Query: 570 RVRLWKPMV 544
           RVRLWKPM+
Sbjct: 445 RVRLWKPMI 453



>gb:AF406703_1796911 Solanum tuberosum BEL1-related homeotic protein
           30 (Bel30) mRNA, complete cds.
          Length = 645

 Score =  123 bits (308), Expect = 5e-27
 Identities = 54/76 (71%), Positives = 68/76 (89%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           AL Q+GM+     WRPQRGLP+ SV+VLR+WLFEHFL+PYP ++DK++L+RQTGL+++QV
Sbjct: 380 ALQQLGMM-QQHAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQV 438

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPMV
Sbjct: 439 SNWFINARVRLWKPMV 454



>gb:AF406698_1796906 Solanum tuberosum BEL1-related homeotic protein
           11 (Bel11) mRNA, partial cds.
          Length = 535

 Score =  122 bits (307), Expect = 7e-27
 Identities = 56/104 (53%), Positives = 77/104 (74%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           AL Q+GM+  +  W+PQRGLP+R+V+VLR+WLFEHFL+PYP ++DK++L++QTGL+++QV
Sbjct: 230 ALQQLGMM-QTNAWKPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIILAKQTGLTRSQV 288

Query: 591 SNWFINARVRLWKPMVXXXXXXXXXXXENAQTPMPRDDDDDNSK 460
           SNWFINARVRLWKPMV              Q   P +++   SK
Sbjct: 289 SNWFINARVRLWKPMVEEMYMEEVKKNNQEQNIEPNNNEIVGSK 332



>gb:AF375966_1792977 Lycopersicon esculentum bell-like homeodomain
           protein 2 (BL2) mRNA, complete cds.
          Length = 699

 Score =  122 bits (307), Expect = 7e-27
 Identities = 53/76 (69%), Positives = 69/76 (90%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           AL Q+GM+     WRPQRGLP+R+V+VLR+WLFEHFL+PYP ++DK++L++QTGL+++QV
Sbjct: 393 ALQQLGMM-QPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV 451

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPMV
Sbjct: 452 SNWFINARVRLWKPMV 467



>gb:AF406697_1796905 Solanum tuberosum BEL1-related homeotic protein
           5 (Bel5) mRNA, complete cds.
          Length = 688

 Score =  122 bits (306), Expect = 9e-27
 Identities = 53/76 (69%), Positives = 69/76 (90%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           AL Q+GM+     WRPQRGLP+R+V+VLR+WLFEHFL+PYP ++DK++L++QTGL+++QV
Sbjct: 381 ALQQIGMM-QPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV 439

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPMV
Sbjct: 440 SNWFINARVRLWKPMV 455



>gb:GGN318871_1679988 Gnetum gnemon partial mRNA for putative
           BEL1-like protein (melbel1 gene).
          Length = 900

 Score =  122 bits (306), Expect = 9e-27
 Identities = 60/123 (48%), Positives = 82/123 (66%)
 Frame = -2

Query: 837 GLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLN 658
           G++ GETP            + +++ +GML +   WRPQRGLP+R+V+VLR+WLFEHFL+
Sbjct: 554 GVSVGETPRLRLVDQGIRNQR-SVHHLGML-EQHAWRPQRGLPERAVSVLRAWLFEHFLH 611

Query: 657 PYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMVXXXXXXXXXXXENAQTPMPRDD 478
           PYP++ADK +L+RQTGLS++QVSNWFINARV LWKPMV                P  + D
Sbjct: 612 PYPTDADKHMLARQTGLSRSQVSNWFINARVGLWKPMVEEMYELETREASQVDAPPGKTD 671

Query: 477 DDD 469
            ++
Sbjct: 672 REE 674



>gb:AF406702_1796910 Solanum tuberosum BEL1-related homeotic protein
           29 (Bel29) mRNA, partial cds.
          Length = 567

 Score =  122 bits (305), Expect = 1e-26
 Identities = 53/76 (69%), Positives = 69/76 (90%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           AL Q+GM+     WRPQRGLP+R+V+VLR+WLFEHFL+PYP ++DK++L++QTGL+++QV
Sbjct: 225 ALQQLGMI-QHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKMMLAKQTGLTRSQV 283

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPMV
Sbjct: 284 SNWFINARVRLWKPMV 299



>gb:AF353094_1790540 Arabidopsis thaliana BEL1-like homeodomain 1
           (BLH1) mRNA, complete cds.
          Length = 680

 Score =  121 bits (303), Expect = 2e-26
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = -2

Query: 771 ALNQMGMLL--DSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKN 598
           AL Q+GM+    +  WRPQRGLP+R+V+VLR+WLFEHFL+PYP ++DK +L++QTGL+++
Sbjct: 371 ALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRS 430

Query: 597 QVSNWFINARVRLWKPMVXXXXXXXXXXXEN-----AQTPMPRDDDDDNSK 460
           QVSNWFINARVRLWKPMV                   +TP+ + ++D  SK
Sbjct: 431 QVSNWFINARVRLWKPMVEEMYMEEMKEQAKNMGSMEKTPLDQSNEDSASK 481



>gb:AY062545_1565201 Arabidopsis thaliana Similar to homeodomain
           proteins (At1g75410; F1B16.6) mRNA, complete
           cds.>gb:BT000133_1634411 Arabidopsis thaliana Similar to
           homeodomain proteins (At1g75410) mRNA, complete cds.
          Length = 524

 Score =  121 bits (303), Expect = 2e-26
 Identities = 52/73 (71%), Positives = 67/73 (91%)
 Frame = -2

Query: 762 QMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNW 583
           Q+GM+  +  WRPQRGLP+ SV++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NW
Sbjct: 339 QLGMVRPA--WRPQRGLPENSVSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANW 396

Query: 582 FINARVRLWKPMV 544
           FINARVRLWKPM+
Sbjct: 397 FINARVRLWKPMI 409



>pir|H84774|H84774 probable homeodomain transcription factor
           [imported] - Arabidopsis thaliana>gb:AC007017_1534959
           Arabidopsis thaliana chromosome 2 clone F11F19 map
           g6825, complete sequence.>gb:AY072175_1567066
           Arabidopsis thaliana putative homeodomain transcription
           factor (At2g35940) mRNA, complete
           cds.>gb:AY096548_1576090 Arabidopsis thaliana putative
           homeodomain transcription factor (At2g35940) mRNA,
           complete cds.>gb:AY099854_1576879 Arabidopsis thaliana
           putative homeodomain transcription factor (At2g35940)
           mRNA, complete cds.>gb:BT008422_1639639 Arabidopsis
           thaliana At2g35940 gene, complete cds.
          Length = 680

 Score =  121 bits (303), Expect = 2e-26
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 7/111 (6%)
 Frame = -2

Query: 771 ALNQMGMLL--DSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKN 598
           AL Q+GM+    +  WRPQRGLP+R+V+VLR+WLFEHFL+PYP ++DK +L++QTGL+++
Sbjct: 371 ALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRS 430

Query: 597 QVSNWFINARVRLWKPMVXXXXXXXXXXXEN-----AQTPMPRDDDDDNSK 460
           QVSNWFINARVRLWKPMV                   +TP+ + ++D  SK
Sbjct: 431 QVSNWFINARVRLWKPMVEEMYMEEMKEQAKNMGSMEKTPLDQSNEDSASK 481



>pir|F96784|F96784 hypothetical protein F1B16.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_895080 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC023754_1539234 Arabidopsis thaliana
           chromosome I BAC F1B16 genomic sequence, complete
           sequence.>gb:AY085278_1570350 Arabidopsis thaliana clone
           142443 mRNA, complete sequence.>gb:AY598452_1617127
           Arabidopsis thaliana BEL1-like homeodomain 3 protein
           mRNA, complete cds.>gb:AF353093_1790539 Arabidopsis
           thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete
           cds.
          Length = 524

 Score =  121 bits (303), Expect = 2e-26
 Identities = 52/73 (71%), Positives = 67/73 (91%)
 Frame = -2

Query: 762 QMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNW 583
           Q+GM+  +  WRPQRGLP+ SV++LR+WLFEHFL+PYP E++K++LS+QTGLSKNQV+NW
Sbjct: 339 QLGMVRPA--WRPQRGLPENSVSILRAWLFEHFLHPYPKESEKIMLSKQTGLSKNQVANW 396

Query: 582 FINARVRLWKPMV 544
           FINARVRLWKPM+
Sbjct: 397 FINARVRLWKPMI 409



>gb:AY056796_1563845 Arabidopsis thaliana At2g16400/F16F14.10 mRNA,
           complete cds.>gb:BT000609_1634887 Arabidopsis thaliana
           putative homeodomain transcription factor
           (At2g16400/F16F14.10) mRNA, complete cds.
          Length = 482

 Score =  120 bits (301), Expect = 3e-26
 Identities = 54/76 (71%), Positives = 66/76 (86%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           AL ++G++     WRPQRGLPD SV VLR+WLFEHFL+PYP ++DK++L+RQTGLS+ QV
Sbjct: 274 ALQRLGVM-QPHTWRPQRGLPDSSVLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQV 332

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPMV
Sbjct: 333 SNWFINARVRLWKPMV 348



>pir|H86329|H86329 F6F9.25 protein - Arabidopsis
           thaliana>gb:AE005172_890932 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007797_1536238 Arabidopsis thaliana
           chromosome I BAC F6F9 genomic sequence, complete
           sequence.>gb:AY570508_1615582 Arabidopsis thaliana
           BEL1-like homeodomain 5 protein mRNA, complete cds.
          Length = 538

 Score =  120 bits (301), Expect = 3e-26
 Identities = 52/73 (71%), Positives = 67/73 (91%)
 Frame = -2

Query: 762 QMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNW 583
           Q+GM+  +  WRPQRGLP+ SV+VLR+WLFEHFL+PYP E++K++L++QTGLSKNQV+NW
Sbjct: 344 QLGMVRPA--WRPQRGLPENSVSVLRAWLFEHFLHPYPKESEKIMLAKQTGLSKNQVANW 401

Query: 582 FINARVRLWKPMV 544
           FINARVRLWKPM+
Sbjct: 402 FINARVRLWKPMI 414



>pir|H84539|H84539 probable homeodomain transcription factor
           [imported] - Arabidopsis thaliana>gb:AC007047_1535072
           Arabidopsis thaliana chromosome 2 clone F16F14 map
           mi398, complete sequence.
          Length = 482

 Score =  120 bits (301), Expect = 3e-26
 Identities = 54/76 (71%), Positives = 66/76 (86%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           AL ++G++     WRPQRGLPD SV VLR+WLFEHFL+PYP ++DK++L+RQTGLS+ QV
Sbjct: 274 ALQRLGVM-QPHTWRPQRGLPDSSVLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQV 332

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPMV
Sbjct: 333 SNWFINARVRLWKPMV 348



>pir|T05281|T05281 probable homeobox protein T4L20.190 - Arabidopsis
           thaliana>gb:ATCHRIV81_1547422 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 81.>gb:ATT4L20_1556065
           Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20
           (ESSA project).>gb:BT012291_1641497 Arabidopsis thaliana
           At4g34610 gene, complete cds.
          Length = 532

 Score =  119 bits (297), Expect = 1e-25
 Identities = 51/75 (68%), Positives = 63/75 (84%)
 Frame = -2

Query: 768 LNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVS 589
           L Q    +  + WRPQRGLP+ SV +LR+WLFEHFL+PYP ++DK++L+RQTGLS+ QVS
Sbjct: 303 LRQQRGFMQPQAWRPQRGLPENSVLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVS 362

Query: 588 NWFINARVRLWKPMV 544
           NWFINARVRLWKPMV
Sbjct: 363 NWFINARVRLWKPMV 377



>gb:AF334759_1787476 Hordeum vulgare homeodomain protein JUBEL2
           (JuBel2) gene, complete cds.
          Length = 611

 Score =  118 bits (295), Expect = 2e-25
 Identities = 50/63 (79%), Positives = 60/63 (95%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRPQRGLP+RSV VLR+WLFEHFL+PYP++ DK +L++QTGL++NQVSNWFINARVRLWK
Sbjct: 345 WRPQRGLPERSVTVLRAWLFEHFLHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVRLWK 404

Query: 552 PMV 544
           PMV
Sbjct: 405 PMV 407



>gb:AC104428_1737599 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1123F12, complete sequence.
          Length = 884

 Score =  118 bits (295), Expect = 2e-25
 Identities = 51/77 (66%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -2

Query: 771 ALNQMGMLLDSE-PWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQ 595
           A+ Q GM+   +  WRPQRGLP+ +V+VLR+WLFEHFL+PYP +++K++L+RQTGLS+ Q
Sbjct: 603 AMQQFGMMQQPQHAWRPQRGLPESAVSVLRAWLFEHFLHPYPKDSEKLMLARQTGLSRGQ 662

Query: 594 VSNWFINARVRLWKPMV 544
           VSNWFINARVRLWKPM+
Sbjct: 663 VSNWFINARVRLWKPMI 679



>gb:AC111016_1738825 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1651_D06, complete sequence.
          Length = 580

 Score =  117 bits (294), Expect = 2e-25
 Identities = 49/63 (77%), Positives = 62/63 (98%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRPQRGLP+R+V+VLR+WLFEHFL+PYP+++DK +L++QTGL++NQVSNWFINARVRLWK
Sbjct: 339 WRPQRGLPERAVSVLRAWLFEHFLHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVRLWK 398

Query: 552 PMV 544
           PMV
Sbjct: 399 PMV 401



>gb:AC079736_1732773 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 642

 Score =  117 bits (294), Expect = 2e-25
 Identities = 50/76 (65%), Positives = 66/76 (86%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           A  Q G LL    WRPQRGLP+ SV++LR+WLFEHFL+PYP +++K++L+RQTGL+++Q+
Sbjct: 370 AFQQYG-LLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI 428

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPM+
Sbjct: 429 SNWFINARVRLWKPMI 444



 Score = 32.7 bits (73), Expect = 9.0
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = -2

Query: 207 GFGTPATGDVSLTLGLRHPENSVTITN 127
           G G     +VSLTLGL+HP+N +++ N
Sbjct: 563 GLGRYGNSNVSLTLGLQHPDNRLSVQN 589



>gb:AC079736_1732772 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 675

 Score =  117 bits (294), Expect = 2e-25
 Identities = 50/76 (65%), Positives = 66/76 (86%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           A  Q G LL    WRPQRGLP+ SV++LR+WLFEHFL+PYP +++K++L+RQTGL+++Q+
Sbjct: 370 AFQQYG-LLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI 428

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPM+
Sbjct: 429 SNWFINARVRLWKPMI 444



 Score = 32.7 bits (73), Expect = 9.0
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = -2

Query: 207 GFGTPATGDVSLTLGLRHPENSVTITN 127
           G G     +VSLTLGL+HP+N +++ N
Sbjct: 563 GLGRYGNSNVSLTLGLQHPDNRLSVQN 589



>gb:AY524972_1611542 Oryza sativa (indica cultivar-group)
           benzothiadiazole-induced homeodomain protein 1 (BIHD1)
           mRNA, complete cds.
          Length = 642

 Score =  117 bits (294), Expect = 2e-25
 Identities = 50/76 (65%), Positives = 66/76 (86%)
 Frame = -2

Query: 771 ALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQV 592
           A  Q G LL    WRPQRGLP+ SV++LR+WLFEHFL+PYP +++K++L+RQTGL+++Q+
Sbjct: 370 AFQQYG-LLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI 428

Query: 591 SNWFINARVRLWKPMV 544
           SNWFINARVRLWKPM+
Sbjct: 429 SNWFINARVRLWKPMI 444



 Score = 35.0 bits (79), Expect = 1.8
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = -2

Query: 207 GFGTPATGDVSLTLGLRHPENSVTITN 127
           G G    G+VSLTLGL+HP+N +++ N
Sbjct: 563 GLGRYGNGNVSLTLGLQHPDNRLSVQN 589



>pir|D84679|D84679 probable homeodomain transcription factor
           [imported] - Arabidopsis thaliana>gb:AC006929_1534797
           Arabidopsis thaliana chromosome 2 clone T1E2 map mi54,
           complete sequence.>gb:BT005921_1638843 Arabidopsis
           thaliana At2g27990 gene, complete
           cds.>gb:AK119153_1817092 Arabidopsis thaliana At2g27990
           mRNA for putative homeodomain transcription factor,
           complete cds, clone: RAFL21-50-D24.
          Length = 584

 Score =  117 bits (294), Expect = 2e-25
 Identities = 52/79 (65%), Positives = 64/79 (81%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRPQRGLP+R+V VLR+WLF+HFL+PYP+++DK +L+ QTGLS+NQVSNWFINARVRLWK
Sbjct: 425 WRPQRGLPERAVAVLRAWLFDHFLHPYPTDSDKQMLATQTGLSRNQVSNWFINARVRLWK 484

Query: 552 PMVXXXXXXXXXXXENAQT 496
           PMV           +NA T
Sbjct: 485 PMVEEIHTLETKAIKNADT 503



>gb:AB071331_1522782 Oryza sativa (japonica cultivar-group) mRNA for
           qSH-1, complete cds.>gb:AB071333_1522784 Oryza sativa
           (japonica cultivar-group) gene for qSH-1, complete
           cds.>gb:AP004127_1838032 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1,
           clone:P0005H10.
          Length = 612

 Score =  117 bits (293), Expect = 3e-25
 Identities = 49/63 (77%), Positives = 61/63 (96%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRPQRGLP+R+V+VLR+WLFEHFL+PYP++ DK +L++QTGL++NQVSNWFINARVRLWK
Sbjct: 371 WRPQRGLPERAVSVLRAWLFEHFLHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVRLWK 430

Query: 552 PMV 544
           PMV
Sbjct: 431 PMV 433



>gb:AB071330_1522781 Oryza sativa (indica cultivar-group) mRNA for
           qSH-1, complete cds.>gb:AB071332_1522783 Oryza sativa
           (indica cultivar-group) gene for qSH-1, complete cds.
          Length = 612

 Score =  117 bits (293), Expect = 3e-25
 Identities = 49/63 (77%), Positives = 61/63 (96%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRPQRGLP+R+V+VLR+WLFEHFL+PYP++ DK +L++QTGL++NQVSNWFINARVRLWK
Sbjct: 371 WRPQRGLPERAVSVLRAWLFEHFLHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVRLWK 430

Query: 552 PMV 544
           PMV
Sbjct: 431 PMV 433



>pir|C84670|C84670 probable homeodomain transcription factor
           [imported] - Arabidopsis thaliana
          Length = 431

 Score =  117 bits (292), Expect = 4e-25
 Identities = 49/66 (74%), Positives = 62/66 (93%)
 Frame = -2

Query: 741 SEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVR 562
           S  WRPQRGLP+++V+VLRSWLFEHFL+PYP + DKV+L++QTGL+K+QVSNWFINARVR
Sbjct: 226 SNAWRPQRGLPEKAVSVLRSWLFEHFLHPYPRDLDKVMLAKQTGLTKSQVSNWFINARVR 285

Query: 561 LWKPMV 544
           +WKP+V
Sbjct: 286 MWKPLV 291



>gb:AC007290_1535768 Arabidopsis thaliana chromosome 2 clone T22O13
           map B68, complete sequence.
          Length = 431

 Score =  115 bits (289), Expect = 8e-25
 Identities = 49/66 (74%), Positives = 61/66 (92%)
 Frame = -2

Query: 741 SEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVR 562
           S  WRPQRGLP++ V+VLRSWLFEHFL+PYP + DKV+L++QTGL+K+QVSNWFINARVR
Sbjct: 226 SNAWRPQRGLPEKVVSVLRSWLFEHFLHPYPRDLDKVMLAKQTGLTKSQVSNWFINARVR 285

Query: 561 LWKPMV 544
           +WKP+V
Sbjct: 286 MWKPLV 291



>gb:AF375965_1792976 Lycopersicon esculentum bell-like homeodomain
           protein 1 (BL1) mRNA, partial cds.
          Length = 393

 Score =  115 bits (287), Expect = 1e-24
 Identities = 51/77 (66%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = -2

Query: 771 ALNQMGMLLDS-EPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQ 595
           +L Q+G++  + + W+P RGLP+ SV  LRSWLFEHFL+PYP++++K++LS QTGLSKNQ
Sbjct: 287 SLQQLGIIQSNRQAWQPIRGLPETSVAFLRSWLFEHFLHPYPNDSEKLMLSSQTGLSKNQ 346

Query: 594 VSNWFINARVRLWKPMV 544
           VSNWFINARVRLWKPM+
Sbjct: 347 VSNWFINARVRLWKPMI 363



>gb:BT000779_1635050 Arabidopsis thaliana clone RAFL07-07-D11
           (R10638) putative homeodomain protein (At5g02030) mRNA,
           complete cds.
          Length = 575

 Score =  115 bits (287), Expect = 1e-24
 Identities = 47/63 (74%), Positives = 60/63 (95%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRP RGLP+R+V VLR+WLF+HFL+PYP++ DK++L++QTGLS+NQVSNWFINARVR+WK
Sbjct: 349 WRPHRGLPERAVTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWK 408

Query: 552 PMV 544
           PMV
Sbjct: 409 PMV 411



>gb:ATH519491_1552854 Arabidopsis thaliana mRNA for homeodomain
           protein vaamana (vaamana gene).>gb:AY084243_1569335
           Arabidopsis thaliana clone 101035 mRNA, complete
           sequence.
          Length = 575

 Score =  115 bits (287), Expect = 1e-24
 Identities = 47/63 (74%), Positives = 60/63 (95%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRP RGLP+R+V VLR+WLF+HFL+PYP++ DK++L++QTGLS+NQVSNWFINARVR+WK
Sbjct: 349 WRPHRGLPERAVTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWK 408

Query: 552 PMV 544
           PMV
Sbjct: 409 PMV 411



>pir|T48224|T48224 probable homeodomain protein - Arabidopsis
           thaliana>gb:ATT7H20_1556418 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T7H20 (ESSA
           project).>gb:AY328314_1599758 Arabidopsis thaliana
           bellringer homeodomain protein mRNA, complete
           cds.>gb:BT020537_1642931 Arabidopsis thaliana At5g02030
           gene, complete cds.
          Length = 575

 Score =  115 bits (287), Expect = 1e-24
 Identities = 47/63 (74%), Positives = 60/63 (95%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRP RGLP+R+V VLR+WLF+HFL+PYP++ DK++L++QTGLS+NQVSNWFINARVR+WK
Sbjct: 349 WRPHRGLPERAVTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWK 408

Query: 552 PMV 544
           PMV
Sbjct: 409 PMV 411



>gb:AF375967_1792978 Lycopersicon esculentum bell-like homeodomain
           protein 4 (BL4) mRNA, partial cds.
          Length = 323

 Score =  108 bits (270), Expect = 1e-22
 Identities = 45/67 (67%), Positives = 62/67 (92%)
 Frame = -2

Query: 744 DSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARV 565
           D + WRPQRGLP+RSV+VLR+W+F++FL+PYP +A+K LL+ ++GL+++QVSNWFINARV
Sbjct: 222 DHQLWRPQRGLPERSVSVLRAWMFQNFLHPYPKDAEKQLLAVKSGLTRSQVSNWFINARV 281

Query: 564 RLWKPMV 544
           RLWKPM+
Sbjct: 282 RLWKPMI 288



>gb:AP005003_1847111 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0495C02.
          Length = 539

 Score =  106 bits (265), Expect = 5e-22
 Identities = 43/67 (64%), Positives = 60/67 (89%)
 Frame = -2

Query: 744 DSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARV 565
           + + WRPQRGLP++SV VL++W+FE+FL PYP +++K +L+ ++GLS+NQVSNWFINARV
Sbjct: 441 EQQCWRPQRGLPEKSVAVLKAWMFENFLRPYPKDSEKEMLAARSGLSRNQVSNWFINARV 500

Query: 564 RLWKPMV 544
           RLWKPM+
Sbjct: 501 RLWKPMI 507



>gb:AP003714_1832364 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0656E03.>gb:AP003762_1833115 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0456F09.
          Length = 573

 Score =  106 bits (265), Expect = 5e-22
 Identities = 43/67 (64%), Positives = 60/67 (89%)
 Frame = -2

Query: 744 DSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARV 565
           D + WRPQRGLP++SV VL++W+FE+FL PYP +++K +L+ ++GLS++QVSNWFINARV
Sbjct: 474 DQQSWRPQRGLPEKSVAVLKAWMFENFLRPYPKDSEKDMLAARSGLSRSQVSNWFINARV 533

Query: 564 RLWKPMV 544
           RLWKPM+
Sbjct: 534 RLWKPMI 540



>gb:AY082396_1569182 Zea mays knotted1-interacting protein (kip)
           mRNA, complete cds.
          Length = 359

 Score =  104 bits (260), Expect = 2e-21
 Identities = 44/65 (67%), Positives = 56/65 (86%)
 Frame = -2

Query: 738 EPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRL 559
           + WRP RGLPD SV VLR+WLF+HFL+PYP++ +K+ L+  TGLS+ Q+SNWFINARVRL
Sbjct: 266 QAWRPLRGLPDGSVAVLRAWLFDHFLHPYPNDGEKLRLAVTTGLSRRQISNWFINARVRL 325

Query: 558 WKPMV 544
           WKPM+
Sbjct: 326 WKPMI 330



>gb:ATHIGEN_1553244 A.thaliana AtH1 gene.
          Length = 469

 Score =  104 bits (259), Expect = 2e-21
 Identities = 42/63 (66%), Positives = 60/63 (95%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRPQRGLP++SV+VLR+W+F++FL+PYP +++K LL+ ++GL+++QVSNWFINARVRLWK
Sbjct: 369 WRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVRLWK 428

Query: 552 PMV 544
           PM+
Sbjct: 429 PMI 431



>sp|P48731|ATH1_ARATH Homeobox protein ATH1.>pir|T05306|T05306
           homeobox protein ATH1 - Arabidopsis
           thaliana>gb:ATCHRIV78_1547218 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           78.>gb:ATF26P21_1550173 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F26P21 (ESSA
           project).>gb:ATH1RNA_1552048 A.thaliana AtH1
           mRNA.>gb:AY072174_1567065 Arabidopsis thaliana putative
           homeobox gene ATH1 protein (At4g32980) mRNA, complete
           cds.>gb:AY096513_1576055 Arabidopsis thaliana putative
           homeobox gene ATH1 protein (At4g32980) mRNA, complete
           cds.
          Length = 473

 Score =  104 bits (259), Expect = 2e-21
 Identities = 42/63 (66%), Positives = 60/63 (95%)
 Frame = -2

Query: 732 WRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           WRPQRGLP++SV+VLR+W+F++FL+PYP +++K LL+ ++GL+++QVSNWFINARVRLWK
Sbjct: 373 WRPQRGLPEKSVSVLRNWMFQNFLHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVRLWK 432

Query: 552 PMV 544
           PM+
Sbjct: 433 PMI 435



>gb:AC103550_1737265 Oryza sativa chromosome 3 BAC OSJNBa0079G12
           genomic sequence, complete sequence.
          Length = 631

 Score =  103 bits (258), Expect = 3e-21
 Identities = 52/87 (59%), Positives = 65/87 (74%)
 Frame = -2

Query: 837 GLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLN 658
           GLTKGETP            + A + MG +++ E WRPQRGLP+RSVN+LRSWLFEHFL+
Sbjct: 547 GLTKGETPRLRAIDQSLRQQR-AFHHMG-IMEQEAWRPQRGLPERSVNILRSWLFEHFLH 604

Query: 657 PYPSEADKVLLSRQTGLSKNQVSNWFI 577
           PYPS+ADK LL+RQTGLS+NQ+  + I
Sbjct: 605 PYPSDADKHLLARQTGLSRNQMHIYVI 631



>gb:AC079736_1732774 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 346

 Score =  103 bits (258), Expect = 3e-21
 Identities = 43/65 (66%), Positives = 57/65 (87%)
 Frame = -2

Query: 738 EPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRL 559
           + WRP RGLP+ +V VLR+WLF+HFL+PYP++ +K++L+  TGLS+ Q+SNWFINARVRL
Sbjct: 258 QAWRPLRGLPEDAVGVLRAWLFDHFLHPYPNDNEKLMLAVATGLSRTQISNWFINARVRL 317

Query: 558 WKPMV 544
           WKPMV
Sbjct: 318 WKPMV 322



>gb:GGN318873_1679990 Gnetum gnemon partial mRNA for putative
           BEL1-like protein (melbel3 gene).
          Length = 376

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 37/45 (82%), Positives = 42/45 (93%)
 Frame = -2

Query: 678 LFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LFEHFL+PYP +ADK  L+RQTGL++NQVSNWFINARVRLWKPMV
Sbjct: 1   LFEHFLHPYPKDADKHYLARQTGLTRNQVSNWFINARVRLWKPMV 45



>gb:GGN318872_1679989 Gnetum gnemon partial mRNA for putative
           BEL1-like protein (melbel2 gene).
          Length = 223

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 36/44 (81%), Positives = 42/44 (95%)
 Frame = -2

Query: 675 FEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           FEHFL+PYPS+ADK LL+RQ GL+++QVSNWFINARVRLWKPMV
Sbjct: 3   FEHFLHPYPSDADKHLLARQAGLTRSQVSNWFINARVRLWKPMV 46



>gb:GGN318874_1679991 Gnetum gnemon partial mRNA for putative
           BEL1-like protein (melbel4 gene).
          Length = 49

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 32/46 (69%), Positives = 43/46 (93%)
 Frame = -2

Query: 681 WLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           W FEHFL+PYP++ DK +L++QTGL+++QVSNWFINARVRLWKP++
Sbjct: 1   WFFEHFLHPYPTDGDKHILAKQTGLTRSQVSNWFINARVRLWKPII 46



>sp|Q90655|AKR_CHICK Homeodomain protein AKR (Avian knotted-related
           protein).>pir|S58439|S58439 transcription factor AKR -
           chicken>gb:GGU25353_2573556 Gallus gallus homeodomain
           protein AKR mRNA, complete cds.
          Length = 269

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/63 (63%), Positives = 45/63 (71%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +KVLLSRQT LS  QV NWFINAR RL  
Sbjct: 36  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKVLLSRQTHLSTLQVCNWFINARRRLLP 95

Query: 552 PMV 544
            M+
Sbjct: 96  DML 98



>gb:AY705698_1347637 Oikopleura dioica Meis-b gene, complete cds.
          Length = 378

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 35/68 (51%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -2

Query: 744 DSEPWRPQRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINAR 568
           D +P   +RG+ P ++ N+LR+WLF++  +PYPSE  K  LS+QTGL+  QV+NWFINAR
Sbjct: 220 DKKPQPKKRGIFPKQATNILRAWLFQNLTHPYPSEEQKKNLSQQTGLTILQVNNWFINAR 279

Query: 567 VRLWKPMV 544
            R+ +PM+
Sbjct: 280 RRIVQPMI 287



>gb:BC054667_2551074 Danio rerio pbx/knotted 1 homeobox 1.1, mRNA
           (cDNA clone MGC:66244 IMAGE:3819079), complete cds.
          Length = 377

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 33/67 (49%), Positives = 48/67 (71%)
 Frame = -2

Query: 744 DSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARV 565
           DS P   +  LP ++ NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR 
Sbjct: 263 DSSPKNKRGVLPKQATNVMRSWLFQHIAHPYPTEEEKKQIATQTNLTLLQVNNWFINARR 322

Query: 564 RLWKPMV 544
           R+ +PM+
Sbjct: 323 RILQPML 329



>gb:AF382393_2490548 Danio rerio pbx/knotted-1 homeobox Prep1.1
           mRNA, complete cds.>gb:AY052752_2509771 Danio rerio
           homeodomain transcription factor Prep1 (prep1) mRNA,
           complete cds.
          Length = 433

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 33/67 (49%), Positives = 48/67 (71%)
 Frame = -2

Query: 744 DSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARV 565
           DS P   +  LP ++ NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR 
Sbjct: 263 DSSPKNKRGVLPKQATNVMRSWLFQHIAHPYPTEEEKKQIATQTNLTLLQVNNWFINARR 322

Query: 564 RLWKPMV 544
           R+ +PM+
Sbjct: 323 RILQPML 329



>gb:BC064716_2553885 Xenopus tropicalis hypothetical protein
           MGC75852, mRNA (cDNA clone MGC:75852 IMAGE:5382716),
           complete cds.
          Length = 272

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 39/63 (61%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLSRQT LS  QV NWFINAR RL  
Sbjct: 36  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSRQTHLSTLQVCNWFINARRRLLP 95

Query: 552 PMV 544
            M+
Sbjct: 96  DML 98



>gb:BC044016_2548423 Xenopus laevis TGFB-induced factor (TALE family
           homeobox), mRNA (cDNA clone MGC:53347 IMAGE:5571016),
           complete cds.
          Length = 272

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 39/63 (61%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLSRQT LS  QV NWFINAR RL  
Sbjct: 36  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSRQTHLSTLQVCNWFINARRRLLP 95

Query: 552 PMV 544
            M+
Sbjct: 96  DML 98



>gb:HSU68385_2025669 Human Meis1-related protein 2 (MRG2), mRNA,
           partial cds.
          Length = 209

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 36/70 (51%), Positives = 51/70 (72%), Gaps = 2/70 (2%)
 Frame = -2

Query: 747 LDSEPWR-PQRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFIN 574
           LD EP R  +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFIN
Sbjct: 89  LDQEPRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFIN 148

Query: 573 ARVRLWKPMV 544
           AR R+ +PM+
Sbjct: 149 ARRRIVQPMI 158



>gb:BC086156_2564738 Xenopus laevis hypothetical LOC495635, mRNA
           (cDNA clone IMAGE:7199548), partial cds.
          Length = 287

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 51  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 110

Query: 552 PMV 544
            M+
Sbjct: 111 DML 113



>gb:MMTGIFPRO_2117712 M.musculus mRNA for mTGIF protein.
          Length = 272

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 36  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 95

Query: 552 PMV 544
            M+
Sbjct: 96  DML 98



>gb:BC012700_2091629 Mus musculus TG interacting factor, mRNA (cDNA
           clone MGC:13962 IMAGE:4011149), complete cds.
          Length = 252

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 16  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 75

Query: 552 PMV 544
            M+
Sbjct: 76  DML 78



>gb:BC031268_1980108 Homo sapiens TGFB-induced factor (TALE family
           homeobox), transcript variant 1, mRNA (cDNA clone
           MGC:39747 IMAGE:5284849), complete cds.
          Length = 401

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 165 RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 224

Query: 552 PMV 544
            M+
Sbjct: 225 DML 227



>gb:AY665270_1958575 Pan troglodytes transforming growth
           factor-beta-induced factor mRNA, complete cds.
          Length = 401

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 165 RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 224

Query: 552 PMV 544
            M+
Sbjct: 225 DML 227



>gb:AY650366_1958313 Macaca fascicularis transforming growth
           factor-beta-induced factor mRNA, partial cds.
          Length = 245

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 20  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 79

Query: 552 PMV 544
            M+
Sbjct: 80  DML 82



>gb:AF179900_1888389 Homo sapiens TALE homeobox TG-interacting
           factor (TGIF) mRNA, complete cds.>gb:CR450333_1992599
           Homo sapiens full open reading frame cDNA clone
           RZPDo834A022D for gene TGIF, TGFB-induced factor (TALE
           family homeobox); complete cds; without stopcodon.
          Length = 272

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 36  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 95

Query: 552 PMV 544
            M+
Sbjct: 96  DML 98



>gb:AY705697_1347636 Oikopleura dioica Meis-a gene, partial cds.
          Length = 176

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 34/61 (55%), Positives = 48/61 (78%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RGL P ++ N+LR+WLF++  +PYPSE  K  LS+QTGL+  QV+NWFINAR R+ +PM
Sbjct: 29  KRGLFPKQATNILRAWLFQNLTHPYPSEEQKKHLSQQTGLTILQVNNWFINARRRIVQPM 88

Query: 546 V 544
           +
Sbjct: 89  I 89



>sp|P70284|TGIF_MOUSE 5'-TG-3' interacting factor (Homeobox protein
           TGIF).>gb:BC005724_2090113 Mus musculus TG interacting
           factor, mRNA (cDNA clone MGC:11635 IMAGE:3595273),
           complete cds.
          Length = 272

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 36  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 95

Query: 552 PMV 544
            M+
Sbjct: 96  DML 98



>sp|Q15583|TGIF_HUMAN 5'-TG-3' interacting factor (Homeobox protein
           TGIF).>gb:BC000814_1967049 Homo sapiens TGFB-induced
           factor (TALE family homeobox), transcript variant 4,
           mRNA (cDNA clone MGC:5066 IMAGE:3453337), complete
           cds.>gb:HSTGIFPRO_2021043 H.sapiens mRNA for TGIF
           protein.
          Length = 272

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 36  RRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLP 95

Query: 552 PMV 544
            M+
Sbjct: 96  DML 98



>gb:AY391467_2531603 Danio rerio TGFB-induced factor (TGIF) mRNA,
           complete cds.>gb:BC044510_2548813 Danio rerio zgc:55852,
           mRNA (cDNA clone MGC:55852 IMAGE:3818231), complete cds.
          Length = 273

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 37/63 (58%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL++H  N YPSE +K LLS+QT LS  QV NWFINAR RL  
Sbjct: 37  RKRRGNLPKESVQILRDWLYQHRYNAYPSEQEKALLSKQTHLSTLQVCNWFINARRRLLP 96

Query: 552 PMV 544
            M+
Sbjct: 97  EML 99



>gb:AF487460_2066955 Mus musculus homeodomain containing
           transcription factor PREP2 (Prep2) mRNA, complete
           cds.>gb:BC050865_2100503 Mus musculus Pbx/knotted 1
           homeobox 2, mRNA (cDNA clone MGC:59500 IMAGE:6332968),
           complete cds.
          Length = 461

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD+E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 267 LLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 326

Query: 579 INARVRLWKPMV 544
           INAR R+ +PM+
Sbjct: 327 INARRRILQPML 338



>gb:BC045626_1983599 Homo sapiens PBX/knotted 1 homeobox 2, mRNA
           (cDNA clone MGC:39607 IMAGE:5261106), complete cds.
          Length = 459

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD+E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 268 LLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 327

Query: 579 INARVRLWKPMV 544
           INAR R+ +PM+
Sbjct: 328 INARRRILQPML 339



>gb:AY665227_1958532 Saimiri boliviensis transforming growth
           factor-beta-induced factor mRNA, partial cds.
          Length = 236

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  SV +LR WL+EH  N YPSE +K LLS+QT LS  QV NWFINAR RL   
Sbjct: 1   RRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPD 60

Query: 549 MV 544
           M+
Sbjct: 61  ML 62



>gb:HSM808766_1188023 Homo sapiens mRNA; cDNA DKFZp686G20229 (from
           clone DKFZp686G20229).
          Length = 472

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD+E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 280 LLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 339

Query: 579 INARVRLWKPMV 544
           INAR R+ +PM+
Sbjct: 340 INARRRILQPML 351



>gb:AK082952_1173756 Mus musculus 12 days embryo spinal cord cDNA,
           RIKEN full-length enriched library, clone:C530020J07
           product:PREP2 PROTEIN homolog [Homo sapiens], full
           insert sequence.>gb:AB086817_2047842 Mus musculus PREP2
           gene for TALE homeodomain transcription factor Prep2,
           complete cds.
          Length = 474

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD+E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 280 LLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 339

Query: 579 INARVRLWKPMV 544
           INAR R+ +PM+
Sbjct: 340 INARRRILQPML 351



>pir|JC7766|JC7766 three-amino-acid loop extension(TALE) homeodomain
           protein, PKNOX2 - human
          Length = 460

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD+E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 268 LLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 327

Query: 579 INARVRLWKPMV 544
           INAR R+ +PM+
Sbjct: 328 INARRRILQPML 339



>sp|Q96KN3|PNX2_HUMAN Homeobox protein PKNOX2 (PBX/knotted homeobox
           2) (Homeobox protein PREP-2).>gb:AB065001_1869659 Homo
           sapiens mRNA for PKNOX2, complete
           cds.>gb:HSA417081_2006728 Homo sapiens mRNA for PREP2
           protein.
          Length = 460

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD+E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 268 LLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 327

Query: 579 INARVRLWKPMV 544
           INAR R+ +PM+
Sbjct: 328 INARRRILQPML 339



>gb:AB086818_2463973 Danio rerio prep2 gene for TALE homeodomain
           transcription factor Prep2, complete cds.
          Length = 474

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 32/68 (47%), Positives = 50/68 (73%), Gaps = 1/68 (1%)
 Frame = -2

Query: 744 DSEPWRPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINAR 568
           D +  + +RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWFINAR
Sbjct: 284 DDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 343

Query: 567 VRLWKPMV 544
            R+ +PM+
Sbjct: 344 RRILQPML 351



>gb:AB086816_2463972 Gallus gallus PREP2 gene for TALE homeodomain
           transcription factor Prep2, complete cds.
          Length = 477

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 35/72 (48%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 279 LLDGEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 338

Query: 579 INARVRLWKPMV 544
           INAR R+ +PM+
Sbjct: 339 INARRRILQPML 350



>gb:CR860477_1184544 Pongo pygmaeus mRNA; cDNA DKFZp459B221 (from
           clone DKFZp459B221).
          Length = 472

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 34/72 (47%), Positives = 53/72 (73%), Gaps = 3/72 (4%)
 Frame = -2

Query: 750 LLDSEPWRPQ--RG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWF 580
           LLD+E  + +  RG LP  + N++RSWLF+H ++PYP+E +K  ++ QT L+  QV+NWF
Sbjct: 280 LLDNEDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWF 339

Query: 579 INARVRLWKPMV 544
           +NAR R+ +PM+
Sbjct: 340 VNARRRILQPML 351



>gb:AF170065_2478261 Danio rerio meis2 mRNA, complete cds.
          Length = 393

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 278 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINARRRIVQPM 337

Query: 546 V 544
           +
Sbjct: 338 I 338



>gb:BC056317_2551757 Danio rerio myeloid ecotropic viral integration
           site 4.1a, mRNA (cDNA clone MGC:65739 IMAGE:6799906),
           complete cds.
          Length = 380

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  LS+ TGL+  QV+NWFINAR R+ +PM
Sbjct: 264 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKRQLSQDTGLTILQVNNWFINARRRIVQPM 323

Query: 546 V 544
           +
Sbjct: 324 I 324



>gb:AF222995_2480857 Danio rerio homeobox transcription factor Meis3
           (meis3) mRNA, complete cds.
          Length = 415

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  LS+ TGL+  QV+NWFINAR R+ +PM
Sbjct: 257 KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLSQDTGLTILQVNNWFINARRRIVQPM 316

Query: 546 V 544
           +
Sbjct: 317 I 317



>gb:AY449637_1950775 Callithrix jacchus X-linked TGIF-like protein
           (tgiflx) gene, partial cds.>gb:AY449638_1950776 Saguinus
           oedipus X-linked TGIF-like protein (tgiflx) gene,
           partial cds.
          Length = 239

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 32/62 (51%), Positives = 44/62 (70%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           +P+  LP  SV +LR W+++H    YPSEA+K++LS  T LS +QVSNWFINAR R+   
Sbjct: 52  KPKGNLPVESVKILRDWMYKHRFRAYPSEAEKLMLSEITNLSFSQVSNWFINARRRILPK 111

Query: 549 MV 544
           M+
Sbjct: 112 ML 113



>gb:AF202933_2479957 Gallus gallus myeloid ecotropic viral insertion
           site-1a protein mRNA, partial cds.
          Length = 386

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 271 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 330

Query: 546 V 544
           V
Sbjct: 331 V 331



>gb:BC069251_1987888 Homo sapiens Meis1, myeloid ecotropic viral
           integration site 1 homolog 3 (mouse), transcript variant
           2, mRNA (cDNA clone MGC:78607 IMAGE:6211294), complete
           cds.
          Length = 358

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 2/70 (2%)
 Frame = -2

Query: 747 LDSEPWR-PQRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFIN 574
           LD E  R  +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFIN
Sbjct: 239 LDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFIN 298

Query: 573 ARVRLWKPMV 544
           AR R+ +PM+
Sbjct: 299 ARRRIVQPMI 308



>gb:AY449635_1950773 Cercopithecus aethiops X-linked TGIF-like
           protein (tgiflx) gene, complete cds.
          Length = 249

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 31/57 (54%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR+W+++H    YPSEA+K +LSR+T LS +Q+SNWFINAR R+   M+
Sbjct: 64  LPAESVKILRNWMYKHRFRAYPSEAEKRMLSRKTNLSLSQISNWFINARRRILPDML 120



>gb:TCA518941_1399639 Tribolium castaneum mRNA for homothorax (hth
           gene).
          Length = 456

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N+LR+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 337 KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPM 396

Query: 546 V 544
           +
Sbjct: 397 I 397



>gb:AF036584_1234922 Drosophila melanogaster homothorax homeoprotein
           (hth2) mRNA, complete cds.
          Length = 472

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N+LR+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 353 KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPM 412

Query: 546 V 544
           +
Sbjct: 413 I 413



>gb:AF026788_1234331 Drosophila melanogaster homothorax (hth) mRNA,
           complete cds.
          Length = 458

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N+LR+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 339 KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPM 398

Query: 546 V 544
           +
Sbjct: 399 I 399



>gb:AE014297_1138861 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003687_1220854 Drosophila melanogaster
           chromosome 3R, section 25 of 118 of the complete
           sequence.
          Length = 457

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N+LR+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 338 KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPM 397

Query: 546 V 544
           +
Sbjct: 398 I 398



>gb:AE014297_1138860 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003687_1220853 Drosophila melanogaster
           chromosome 3R, section 25 of 118 of the complete
           sequence.>gb:AF032865_1234641 Drosophila melanogaster
           dorsotonals (dtl) mRNA, complete
           cds.>gb:AF035825_1234850 Drosophila melanogaster
           homothorax (hth1) mRNA, complete cds.
          Length = 487

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N+LR+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 368 KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPM 427

Query: 546 V 544
           +
Sbjct: 428 I 428



>gb:AE014297_1138859 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003687_1220852 Drosophila melanogaster
           chromosome 3R, section 25 of 118 of the complete
           sequence.
          Length = 471

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 32/61 (52%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N+LR+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 352 KRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPM 411

Query: 546 V 544
           +
Sbjct: 412 I 412



>sp|Q99687|MEI3_HUMAN Homeobox protein Meis3 (Meis1-related protein
           2) (Fragment).>gb:CR749687_1181230 Homo sapiens mRNA;
           cDNA DKFZp547H236 (from clone
           DKFZp547H236).>gb:HSM802719_2017541 Homo sapiens mRNA;
           cDNA DKFZp547H236 (from clone DKFZp547H236).
          Length = 382

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 2/70 (2%)
 Frame = -2

Query: 747 LDSEPWR-PQRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFIN 574
           LD E  R  +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFIN
Sbjct: 263 LDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFIN 322

Query: 573 ARVRLWKPMV 544
           AR R+ +PM+
Sbjct: 323 ARRRIVQPMI 332



>gb:XLU68388_2583499 Xenopus laevis XMeis1-3 protein mRNA, partial
           cds.
          Length = 137

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 22  KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 81

Query: 546 V 544
           +
Sbjct: 82  I 82



>gb:BC066375_2554266 Danio rerio myeloid ecotropic viral integration
           site 2.1, mRNA (cDNA clone MGC:76815 IMAGE:6964314),
           complete cds.>gb:DRE300652_2571060 Danio rerio mRNA for
           meis2.1 protein.
          Length = 393

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 278 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 337

Query: 546 V 544
           +
Sbjct: 338 I 338



>gb:BC065980_2554233 Danio rerio myeloid ecotropic viral integration
           site 2.2, mRNA (cDNA clone MGC:76847 IMAGE:6971497),
           complete cds.
          Length = 390

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>gb:BC056515_2551790 Danio rerio myeloid ecotropic viral integration
           site 2.2, mRNA (cDNA clone MGC:65757 IMAGE:6789004),
           complete cds.
          Length = 397

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>gb:AF375872_2490227 Danio rerio transcription factor Meis2.2
           (meis2.2) mRNA, complete cds.
          Length = 397

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>gb:AF375871_2490226 Danio rerio transcription factor Meis1.1
           (meis1.1) mRNA, complete cds, alternatively
           spliced.>gb:BC060891_2552985 Danio rerio myeloid
           ecotropic viral integration 1, mRNA (cDNA clone
           MGC:73029 IMAGE:4145050), complete cds.
          Length = 388

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 273 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 332

Query: 546 V 544
           +
Sbjct: 333 I 333



>gb:AF202934_2479958 Gallus gallus myeloid ecotropic viral insertion
           site-2a protein mRNA, partial cds.
          Length = 390

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>gb:AF199011_2479668 Gallus gallus homeoprotein Meis2 (Meis2) mRNA,
           complete cds.
          Length = 401

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>gb:BC052701_2101222 Mus musculus Pbx/knotted 1 homeobox, mRNA (cDNA
           clone MGC:64705 IMAGE:5721441), complete cds.
          Length = 436

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 37/78 (47%), Positives = 53/78 (67%), Gaps = 3/78 (3%)
 Frame = -2

Query: 768 LNQMGMLLDSEPW--RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKN 598
           LNQ   +L  E    + +RG LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  
Sbjct: 245 LNQDLSILHQEDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLL 304

Query: 597 QVSNWFINARVRLWKPMV 544
           QV+NWFINAR R+ +PM+
Sbjct: 305 QVNNWFINARRRILQPML 322



>gb:BC023689_2094212 Mus musculus myeloid ecotropic viral
           integration site 1, mRNA (cDNA clone MGC:36059
           IMAGE:5344307), complete cds.
          Length = 370

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>gb:BC017375_2092462 Mus musculus myeloid ecotropic viral
           integration site-related gene 1, mRNA (cDNA clone
           MGC:13943 IMAGE:4191098), complete
           cds.>gb:MMMEIS2D_2116459 Mus musculus mRNA for
           homeodomain protein Meis2d.>gb:MMU68384_2123206 Mus
           musculus Meis1-related protein 1b (Mrg1b) mRNA, complete
           cds.
          Length = 470

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>gb:AL603984_2071254 Mouse DNA sequence from clone RP23-137B16 on
           chromosome 11 Contains a novel gene, the 5' end of the
           Meis1 gene for myeloid ecotropic viral integration site
           1 and two Cpg islands, complete
           sequence.>gb:AL645570_2071714 Mouse DNA sequence from
           clone RP23-377H12 on chromosome 11 Contains two novel
           genes, the 3' end of the Meis1 gene for myeloid
           ecotropic viral integration site 1 and two CpG islands,
           complete sequence.>gb:MMU33630_2120882 Mus musculus
           myeloid ecotropic viral integration site-1b (Meis1b)
           mRNA, complete cds.
          Length = 465

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>gb:BC001516_1967651 Homo sapiens Meis1, myeloid ecotropic viral
           integration site 1 homolog 2 (mouse), transcript variant
           f, mRNA (cDNA clone MGC:2820 IMAGE:2964406), complete
           cds.>gb:BC001844_1967897 Homo sapiens Meis1, myeloid
           ecotropic viral integration site 1 homolog 2 (mouse),
           transcript variant f, mRNA (cDNA clone MGC:4493
           IMAGE:2964406), complete cds.
          Length = 381

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 266 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 325

Query: 546 V 544
           +
Sbjct: 326 I 326



>gb:AY449641_1950779 Lagothrix lagotricha X-linked TGIF-like protein
           (tgiflx) gene, partial cds.
          Length = 240

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 35/86 (40%), Positives = 48/86 (55%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           +P+  LP  SV +LR W+++H    YPSE +K +LS +T LS +QVSNWF NAR R+   
Sbjct: 52  KPKGNLPVESVKILRDWMYKHRFRAYPSEVEKQMLSEKTNLSLSQVSNWFTNARRRILPE 111

Query: 549 MVXXXXXXXXXXXENAQTPMPRDDDD 472
           M+                 M +DDDD
Sbjct: 112 MLLQSGNDSF-----VDQEMGKDDDD 132



>gb:AF179898_1888387 Homo sapiens TALE homeobox protein Meis2d mRNA,
           complete cds.>gb:BC050431_1984338 Homo sapiens Meis1,
           myeloid ecotropic viral integration site 1 homolog 2
           (mouse), mRNA (cDNA clone MGC:54158 IMAGE:6066728),
           complete cds.
          Length = 470

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>gb:AF179896_1888385 Homo sapiens TALE homeobox protein Meis2b mRNA,
           complete cds.>gb:MMMEIS2B_2116457 Mus musculus mRNA for
           homeodomain protein Meis2b.>gb:MMU68383_2123205 Mus
           musculus Meis1-related protein 1a (Mrg1a) mRNA, complete
           cds.
          Length = 394

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>gb:AF178948_1888209 Homo sapiens TALE homeobox protein Meis2a mRNA,
           complete cds.>gb:MMMEIS2A_2116456 Mus musculus mRNA for
           homeodomain protein Meis2a.
          Length = 401

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>gb:AF017418_1876779 Homo sapiens homeobox protein MEIS2 (MEIS2)
           mRNA, partial cds.
          Length = 124

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 9   KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 68

Query: 546 V 544
           +
Sbjct: 69  I 69



>gb:CSA518945_1375707 Cupiennius salei mRNA for homothorax 1 (hth1
           gene).
          Length = 505

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = -2

Query: 741 SEPWRPQRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARV 565
           S+  + +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR 
Sbjct: 325 SKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARR 384

Query: 564 RLWKPMV 544
           R+ +PM+
Sbjct: 385 RIVQPMI 391



>gb:CSA518935_1375699 Cupiennius salei mRNA for homothorax 2 (hth2
           gene).
          Length = 471

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 308 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 367

Query: 546 V 544
           +
Sbjct: 368 I 368



>gb:CR857152_1181401 Pongo pygmaeus mRNA; cDNA DKFZp469A1832 (from
           clone DKFZp469A1832).
          Length = 401

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>sp|P97367|MEI2_MOUSE Homeobox protein Meis2 (Meis1-related protein
           1).>gb:MMMEIS2C_2116458 Mus musculus mRNA for
           homeodomain protein Meis2c.
          Length = 477

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>sp|O14770|MEI2_HUMAN Homeobox protein Meis2 (Meis1-related protein
           1).>gb:AF179897_1888386 Homo sapiens TALE homeobox
           protein Meis2c mRNA, complete cds.
          Length = 477

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>sp|Q60954|MEI1_MOUSE Homeobox protein Meis1 (Myeloid ecotropic
           viral integration site-1).>gb:AL603984_2071255 Mouse DNA
           sequence from clone RP23-137B16 on chromosome 11
           Contains a novel gene, the 5' end of the Meis1 gene for
           myeloid ecotropic viral integration site 1 and two Cpg
           islands, complete sequence.>gb:AL645570_2071715 Mouse
           DNA sequence from clone RP23-377H12 on chromosome 11
           Contains two novel genes, the 3' end of the Meis1 gene
           for myeloid ecotropic viral integration site 1 and two
           CpG islands, complete sequence.>gb:MMU33629_2120881 Mus
           musculus myeloid ecotropic viral integration site-1
           (Meis1) mRNA, complete cds.
          Length = 390

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>sp|O00470|MEI1_HUMAN Homeobox protein Meis1.>gb:BC043503_1983430
           Homo sapiens Meis1, myeloid ecotropic viral integration
           site 1 homolog (mouse), mRNA (cDNA clone MGC:49924
           IMAGE:5531644), complete cds.>gb:HSU85707_2026844 Human
           leukemogenic homolog protein (MEIS1) mRNA, complete cds.
          Length = 390

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 334

Query: 546 V 544
           +
Sbjct: 335 I 335



>gb:BC084920_2564156 Xenopus laevis Meis3 homeoprotein, mRNA (cDNA
           clone MGC:79919 IMAGE:6864577), complete cds.
          Length = 453

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 270 KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 329

Query: 546 V 544
           +
Sbjct: 330 I 330



>gb:BC081037_2561946 Xenopus laevis MGC81734 protein, mRNA (cDNA
           clone MGC:81734 IMAGE:6865523), complete cds.
          Length = 269

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 34/58 (58%), Positives = 42/58 (72%), Gaps = 1/58 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRL 559
           R +RG LP +SV +LR WLFEH  N YPSE +K+ LS QT L+  Q+ NWFINAR R+
Sbjct: 38  RKRRGNLPKQSVKILRDWLFEHRFNAYPSEQEKLCLSGQTNLTVLQICNWFINARRRV 95



>gb:BC075589_2558685 Xenopus tropicalis Meis1, myeloid ecotropic
           viral integration site 1 homolog (mouse), mRNA (cDNA
           clone MGC:89584 IMAGE:6994394), complete cds.
          Length = 453

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 270 KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 329

Query: 546 V 544
           +
Sbjct: 330 I 330



>gb:BC044024_2548430 Xenopus laevis similar to myeloid ecotropic
           viral integration site-related gene 1, mRNA (cDNA clone
           MGC:52546 IMAGE:5571486), complete cds.
          Length = 451

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 270 KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 329

Query: 546 V 544
           +
Sbjct: 330 I 330



>gb:AF072895_2471716 Xenopus laevis Meis3 homeoprotein (Meis3) mRNA,
           complete cds.
          Length = 385

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 270 KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 329

Query: 546 V 544
           +
Sbjct: 330 I 330



>gb:BC003762_2089319 Mus musculus myeloid ecotropic viral
           integration site-related gene 2, mRNA (cDNA clone
           MGC:5914 IMAGE:3593200), complete cds.
          Length = 361

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 251 KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 310

Query: 546 V 544
           +
Sbjct: 311 I 311



>gb:HSY13613_2028332 Homo sapiens mRNA for homeodomain protein
           Prep-1.
          Length = 436

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 30/57 (52%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR R+ +PM+
Sbjct: 266 LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML 322



>gb:HSU68727_2025680 Human homeobox-containing protein mRNA,
           complete cds.
          Length = 435

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 30/57 (52%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR R+ +PM+
Sbjct: 265 LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML 321



>gb:BC000735_1966988 Homo sapiens PBX/knotted 1 homeobox 1, mRNA
           (cDNA clone IMAGE:3504770), partial cds.
          Length = 336

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 30/57 (52%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR R+ +PM+
Sbjct: 266 LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML 322



>gb:AY196965_1938961 Homo sapiens homeobox-containing protein PKNOX1
           mRNA, complete cds.>gb:BC007746_1970956 Homo sapiens
           PBX/knotted 1 homeobox 1, transcript variant 1, mRNA
           (cDNA clone MGC:12791 IMAGE:4099156), complete cds.
          Length = 436

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 30/57 (52%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR R+ +PM+
Sbjct: 266 LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML 322



>gb:AY142115_1937003 Homo sapiens PKNOX1B (PKNOX1) mRNA, complete
           cds; alternatively spliced.
          Length = 405

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 30/57 (52%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR R+ +PM+
Sbjct: 266 LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML 322



>sp|O70477|PNX1_MOUSE Homeobox protein PKNOX1 (PBX/knotted homeobox
           1).>gb:AF061270_2052863 Mus musculus homeobox protein
           PKNOX1 (Pknox1) mRNA, complete cds.
          Length = 435

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 30/57 (52%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR R+ +PM+
Sbjct: 265 LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML 321



>sp|P55347|PNX1_HUMAN Homeobox protein PKNOX1 (PBX/knotted homeobox
           1) (Homeobox protein PREP-1).>gb:AP001748_1933547 Homo
           sapiens genomic DNA, chromosome 21q, section 92/105.
          Length = 435

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 30/57 (52%), Positives = 43/57 (75%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  + NV+RSWLF+H  +PYP+E +K  ++ QT L+  QV+NWFINAR R+ +PM+
Sbjct: 265 LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPML 321



>sp|P97368|MEI3_MOUSE Homeobox protein Meis3 (Meis1-related protein
           2).>gb:MMU57344_2122567 Mus musculus homeobox protein
           Meis3 mRNA, complete cds.
          Length = 378

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 31/61 (50%), Positives = 46/61 (75%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM
Sbjct: 268 KRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM 327

Query: 546 V 544
           +
Sbjct: 328 I 328



>sp|P79937|MEI1_XENLA Homeobox protein Meis1
           (XMeis1).>gb:XLU68386_2583497 Xenopus laevis XMeis1-1
           protein mRNA, complete cds.
          Length = 390

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 31/60 (51%), Positives = 45/60 (75%), Gaps = 1/60 (1%)
 Frame = -2

Query: 720 RGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R+ +PM+
Sbjct: 276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335



>gb:BC065977_2554230 Danio rerio myeloid ecotropic viral integration
           site 4.1a, mRNA (cDNA clone MGC:76814 IMAGE:6972035),
           complete cds.
          Length = 380

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K   S+ TGL+  QV+NWFINAR R+ +PM
Sbjct: 264 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKRQFSQDTGLTILQVNNWFINARRRIVQPM 323

Query: 546 V 544
           +
Sbjct: 324 I 324



>gb:AY449640_1950778 Saimiri sciureus X-linked TGIF-like protein
           (tgiflx) gene, partial cds.
          Length = 232

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 34/91 (37%), Positives = 53/91 (58%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  SV +LR W+++H    YPSEA+K++L+ +T LS +Q+SNWF+NAR R+   
Sbjct: 50  RKKAKLPVESVKILRKWMYKHRFRAYPSEAEKLMLAEKTNLSFSQISNWFVNARRRILPG 109

Query: 549 MVXXXXXXXXXXXENAQTPMPRDDDDDNSKE 457
           M+                 M +DD+D N ++
Sbjct: 110 ML---------RKSGNDQEMRKDDNDTNLQD 131



>gb:AY204697_1309652 Venturia canescens homeodomain-containing
           protein (HOX) mRNA, complete cds.
          Length = 456

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 30/63 (47%), Positives = 48/63 (76%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP ++ +++R+WLF H ++PYP+E +K  ++ QT L+  QV+NWFINAR R+ +
Sbjct: 307 RQKRGVLPKQATSIMRAWLFHHLVHPYPTEDEKRQIASQTNLTLLQVNNWFINARRRILQ 366

Query: 552 PMV 544
           PM+
Sbjct: 367 PML 369



>sp|Q8MID1|TGLX_MIOTA Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:MTA345077_2039669 Miopithecus talapoin mRNA for
           TGIF-like protein on the X (tgiflx gene).
          Length = 249

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 30/57 (52%), Positives = 42/57 (73%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSEA+K +LS++T LS +Q+SNWFINAR R+   M+
Sbjct: 64  LPAESVKILRDWMYKHRFRAYPSEAEKRMLSKKTNLSLSQISNWFINARRRILPDML 120



>sp|Q8MID8|TGLX_MACFA Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:MFA345079_2039026 Macaca fascicularis mRNA for
           TGIF-like protein on the X (tgiflx gene).
          Length = 249

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 30/57 (52%), Positives = 42/57 (73%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSEA+K +LS++T LS +Q+SNWFINAR R+   M+
Sbjct: 64  LPAESVKILRDWMYKHRFRAYPSEAEKRMLSKKTNLSLSQISNWFINARRRILPDML 120



>sp|Q8MIC2|TGLX_PAPHA Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:PHA345080_2039812 Papio hamadryas mRNA for
           TGIF-like protein on the X (tgiflx gene).
          Length = 256

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 30/57 (52%), Positives = 42/57 (73%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSEA+K +LS++T LS +Q+SNWFINAR R+   M+
Sbjct: 71  LPAESVKILRRWMYKHRFRAYPSEAEKRMLSKKTNLSLSQISNWFINARRRILPDML 127



>sp|Q8MIE6|TGLX_HYLLA Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:HLA345076_1996199 Hylobates lar mRNA for
           TGIF-like protein on the X (tgiflx gene).
          Length = 241

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 30/62 (48%), Positives = 43/62 (69%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           +P+  LP  SV +LR W+++H    YPSE +K +LS +T LS +Q+SNWFINAR R+   
Sbjct: 52  KPKGYLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLSQISNWFINARRRILPD 111

Query: 549 MV 544
           M+
Sbjct: 112 ML 113



>gb:MMU57343_2122566 Mus musculus homeobox protein Meis2 mRNA,
           complete cds.
          Length = 401

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 30/61 (49%), Positives = 45/61 (73%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++  GL+  QV+NWFINAR R+ +PM
Sbjct: 279 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDAGLTILQVNNWFINARRRIVQPM 338

Query: 546 V 544
           +
Sbjct: 339 I 339



>gb:AY449639_1950777 Aotus trivirgatus X-linked TGIF-like protein
           (tgiflx) gene, partial cds.
          Length = 233

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 31/62 (50%), Positives = 43/62 (69%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           +P+  LP  SV +LR W+++H    YPSEA+K +LS +T LS +QVS WFINAR R+   
Sbjct: 49  KPRVNLPIESVKILRRWMYKHRFRAYPSEAEKQMLSEKTNLSFSQVSTWFINARRRILPK 108

Query: 549 MV 544
           M+
Sbjct: 109 ML 110



>gb:AY091593_1936207 Homo sapiens MEIS1-related protein 2 (MEIS3)
           mRNA, partial cds.
          Length = 267

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 34/70 (48%), Positives = 49/70 (70%), Gaps = 2/70 (2%)
 Frame = -2

Query: 747 LDSEPWR-PQRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFIN 574
           LD E  R  +RG+ P  + N++R+WL +H  +PYPSE  K  L++ TGL+  QV+NWFIN
Sbjct: 148 LDQERRRNKKRGIFPKVATNIMRAWLVQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFIN 207

Query: 573 ARVRLWKPMV 544
           AR R+ +PM+
Sbjct: 208 ARRRIVQPMI 217



>gb:AY705696_1347635 Oikopleura dioica Prep gene, partial cds.
          Length = 214

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 32/58 (55%), Positives = 45/58 (77%), Gaps = 1/58 (1%)
 Frame = -2

Query: 729 RPQRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRL 559
           R +RGL P ++ + LR WLF+H ++PYPSE +K  L++QTGL+  QV+NWFINAR R+
Sbjct: 155 RLKRGLLPRQATDTLRGWLFQHLVHPYPSEDEKRNLAQQTGLTLLQVNNWFINARRRI 212



>gb:AC006692_1203746 Caenorhabditis elegans cosmid T28F12, complete
           sequence.>gb:AF427476_1270013 Caenorhabditis elegans
           UNC-62 splice variant 1b-7a (unc-62) mRNA, complete cds;
           alternatively spliced.
          Length = 523

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 31/60 (51%), Positives = 45/60 (75%), Gaps = 1/60 (1%)
 Frame = -2

Query: 720 RGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           RG+ P ++ N LR WLF++  +PYPSE  K  L+++TGL+  QV+NWFINAR R+ +PM+
Sbjct: 355 RGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 414



>gb:AC006692_1203744 Caenorhabditis elegans cosmid T28F12, complete
           sequence.>gb:AF427474_1270011 Caenorhabditis elegans
           UNC-62 splice variant 1a-7a (unc-62) mRNA, complete cds;
           alternatively spliced.
          Length = 560

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 31/60 (51%), Positives = 45/60 (75%), Gaps = 1/60 (1%)
 Frame = -2

Query: 720 RGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           RG+ P ++ N LR WLF++  +PYPSE  K  L+++TGL+  QV+NWFINAR R+ +PM+
Sbjct: 392 RGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 451



>gb:AE013599_1131480 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003822_1226287 Drosophila melanogaster
           chromosome 2R, section 28 of 74 of the complete
           sequence.
          Length = 555

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 37/82 (45%), Positives = 50/82 (60%), Gaps = 8/82 (9%)
 Frame = -2

Query: 765 NQMGMLLDSE-------PWRPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTG 610
           N   M++DSE         R +RG LP  SV +L+ WL+EH  N YPS+A+K  LS++  
Sbjct: 75  NYHDMMVDSEHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEAN 134

Query: 609 LSKNQVSNWFINARVRLWKPMV 544
           L+  QV NWFINAR R+   M+
Sbjct: 135 LTVLQVCNWFINARRRILPEMI 156



>gb:AE013599_1131479 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003822_1226286 Drosophila melanogaster
           chromosome 2R, section 28 of 74 of the complete
           sequence.>gb:BT003510_1356912 Drosophila melanogaster
           RE30881 full insert cDNA.
          Length = 426

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 37/82 (45%), Positives = 50/82 (60%), Gaps = 8/82 (9%)
 Frame = -2

Query: 765 NQMGMLLDSE-------PWRPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTG 610
           N   M++DSE         R +RG LP  SV +L+ WL+EH  N YPS+A+K  LS++  
Sbjct: 75  NYHDMMVDSEHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEAN 134

Query: 609 LSKNQVSNWFINARVRLWKPMV 544
           L+  QV NWFINAR R+   M+
Sbjct: 135 LTVLQVCNWFINARRRILPEMI 156



>gb:AE013599_1131478 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003822_1226285 Drosophila melanogaster
           chromosome 2R, section 28 of 74 of the complete
           sequence.>gb:AY058750_1291904 Drosophila melanogaster
           SD01238 full length cDNA.
          Length = 424

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 37/82 (45%), Positives = 50/82 (60%), Gaps = 8/82 (9%)
 Frame = -2

Query: 765 NQMGMLLDSE-------PWRPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTG 610
           N   M++DSE         R +RG LP  SV +L+ WL+EH  N YPS+A+K  LS++  
Sbjct: 73  NYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEAN 132

Query: 609 LSKNQVSNWFINARVRLWKPMV 544
           L+  QV NWFINAR R+   M+
Sbjct: 133 LTVLQVCNWFINARRRILPEMI 154



>gb:AE013599_1131477 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003822_1226284 Drosophila melanogaster
           chromosome 2R, section 28 of 74 of the complete
           sequence.
          Length = 524

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 37/82 (45%), Positives = 50/82 (60%), Gaps = 8/82 (9%)
 Frame = -2

Query: 765 NQMGMLLDSE-------PWRPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTG 610
           N   M++DSE         R +RG LP  SV +L+ WL+EH  N YPS+A+K  LS++  
Sbjct: 73  NYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEAN 132

Query: 609 LSKNQVSNWFINARVRLWKPMV 544
           L+  QV NWFINAR R+   M+
Sbjct: 133 LTVLQVCNWFINARRRILPEMI 154



>gb:AX400034_1467347 Sequence 205 from Patent WO0218424.
          Length = 324

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+ H  N YPSE +K+ LS QT LS  Q+ NWFINAR RL  
Sbjct: 19  RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLP 78

Query: 552 PMV 544
            M+
Sbjct: 79  DML 81



>gb:AK029490_1161516 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4921501K24
           product:DJ977B1.4.1 (ISOFORM 1) (TGIF2) (TGFB-INDUCED
           FACTOR 2) (TALE FAMILY HOMEOBOX) homolog [Homo sapiens],
           full insert sequence.
          Length = 237

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+ H  N YPSE +K+ LS QT LS  Q+ NWFINAR RL  
Sbjct: 19  RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLP 78

Query: 552 PMV 544
            M+
Sbjct: 79  DML 81



>gb:AK017884_1159367 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730599O09
           product:DJ977B1.4.1 (ISOFORM 1) (TGIF2) (TGFB-INDUCED
           FACTOR 2) (TALE FAMILY HOMEOBOX) homolog [Homo sapiens],
           full insert sequence.
          Length = 157

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+ H  N YPSE +K+ LS QT LS  Q+ NWFINAR RL  
Sbjct: 19  RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLP 78

Query: 552 PMV 544
            M+
Sbjct: 79  DML 81



>sp|Q8MID6|TGLX_MACMU Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:MMU345078_2039407 Macaca mulatta mRNA for
           TGIF-like protein on the X (tgiflx gene).
          Length = 249

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 29/56 (51%), Positives = 41/56 (73%)
 Frame = -2

Query: 711 PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           P  SV +LR W+++H    YPSEA+K +LS++T LS +Q+SNWFINAR R+   M+
Sbjct: 65  PAESVKILRDWMYKHRFRAYPSEAEKRMLSKKTNLSLSQISNWFINARRRILPDML 120



>sp|Q9GZN2|TGI2_HUMAN Homeobox protein TGIF2 (TGFB-induced factor 2)
           (5'-TG-3' interacting factor 2) (TGF(beta)-induced
           transcription factor 2).>pir|JC7392|JC7392
           5'TG3'-interacting factor 2 - human>gb:CQ783690_1452581
           Sequence 3830 from Patent EP1396543.>gb:AB042646_1867061
           Homo sapiens TGIF2 mRNA, complete
           cds.>gb:AK074802_1912702 Homo sapiens cDNA FLJ90321 fis,
           clone NT2RP2001662, moderately similar to HOMEODOMAIN
           PROTEIN AKR.>gb:BC006549_1970379 Homo sapiens
           TGFB-induced factor 2 (TALE family homeobox), mRNA (cDNA
           clone MGC:2459 IMAGE:2964507), complete
           cds.>gb:BC012816_1973786 Homo sapiens TGFB-induced
           factor 2 (TALE family homeobox), mRNA (cDNA clone
           MGC:4139 IMAGE:2964507), complete
           cds.>gb:HSDJ977B1_2012581 Human DNA sequence from clone
           RP5-977B1 on chromosome 20 Contains the 3' end of the
           SLA2 gene for Src-like-adaptor 2, the HNRPA3P gene for
           heterogeneous nuclear ribonucleoprotein A3 pseudogene,
           the C20orf24 gene for chromosome 24 open reading frame
           24 (putative RAB5-interacting protein), the TGIF2 gene
           for TGF(beta)-induced transcription factor 2, the MYRL2
           gene for myosin regulatory light chain 2 (smooth muscle
           variant), the 3' end of a novel gene (KIAA0964), a novel
           gene, and three CpG islands, complete sequence.
          Length = 237

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 35/63 (55%), Positives = 42/63 (66%), Gaps = 1/63 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWK 553
           R +RG LP  SV +LR WL+ H  N YPSE +K+ LS QT LS  Q+ NWFINAR RL  
Sbjct: 19  RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLP 78

Query: 552 PMV 544
            M+
Sbjct: 79  DML 81



>gb:BC081024_2561933 Xenopus laevis MGC81646 protein, mRNA (cDNA
           clone MGC:81646 IMAGE:6864271), complete cds.
          Length = 256

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%)
 Frame = -2

Query: 729 RPQRG-LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRL 559
           R +RG LP  +V +LR WL+EH  N YPSE +K+ LS QT L+  Q+ NWFINAR R+
Sbjct: 25  RKRRGNLPKEAVKILRDWLYEHRFNAYPSEQEKLSLSGQTNLTVLQICNWFINARRRI 82



>gb:AC092697_1735557 Oryza sativa chromosome 10 BAC OSJNBb0060I05
           genomic sequence, complete sequence.
          Length = 364

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 34/61 (55%), Positives = 42/61 (68%)
 Frame = -2

Query: 837 GLTKGETPXXXXXXXXXXXXKGALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLN 658
           G+TKGETP            K    Q GML +S PWRPQRGLP+R+V++LR+WLFEHFL+
Sbjct: 293 GMTKGETPRLRVLDQCLRQHKAY--QAGML-ESHPWRPQRGLPERAVSILRAWLFEHFLH 349

Query: 657 P 655
           P
Sbjct: 350 P 350



>sp|Q8MIB8|TGLX_PONPY Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:PPY345075_2039965 Pongo pygmaeus mRNA for
           TGIF-like on the X (tgiflx gene).
          Length = 241

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 30/57 (52%), Positives = 40/57 (70%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP +SV +LR W+++H    YPSE +K +LS +T LS  QVSNWFINAR R+   M+
Sbjct: 57  LPAKSVKILRDWMYKHRFRAYPSEEEKQMLSEKTNLSLLQVSNWFINARRRILPDML 113



>gb:XLU68387_2583498 Xenopus laevis XMeis1-2 protein mRNA, complete
           cds.
          Length = 464

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 31/61 (50%), Positives = 45/61 (73%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL   QV+NWFINAR R+ +PM
Sbjct: 275 KRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLIL-QVNNWFINARRRIVQPM 333

Query: 546 V 544
           +
Sbjct: 334 I 334



>gb:AY449636_1950774 Pygathrix nemaeus X-linked TGIF-like protein
           (tgiflx) gene, complete cds.
          Length = 255

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSE  K +LSR+T LS +Q+SNWF NAR R+   M+
Sbjct: 64  LPAESVKILRDWMYKHRFRAYPSEVQKQMLSRKTNLSLSQISNWFTNARRRVLPDML 120



>gb:CR382131_1664665 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 510

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVR 562
           R +  LP    ++LR WL +H  +PYPSE +K LL +QTGL+ +Q+SNWFINAR R
Sbjct: 428 RRRGNLPKSVTSILREWLNDHISHPYPSEYEKSLLLQQTGLTMSQLSNWFINARRR 483



>gb:AB016001_1512742 Ipomoea nil PKn2s1 (knotted-like gene) mRNA,
           complete cds.
          Length = 237

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L  W  +H+  PYP+EADK+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 161 LPKEARQTLLDWWSDHYKWPYPTEADKIALAESTGLDQKQINNWFINQRKRHWKP 215



>gb:AB016000_1512741 Ipomoea nil PKn2 (knotted-like gene) mRNA,
           complete cds.
          Length = 322

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L  W  +H+  PYP+EADK+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 246 LPKEARQTLLDWWSDHYKWPYPTEADKIALAESTGLDQKQINNWFINQRKRHWKP 300



>sp|Q8MIB7|TGLX_PANTR Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:PTR345073_2040045 Pan troglodytes mRNA for
           TGIF-like on the X (tgiflx gene).
          Length = 241

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 30/57 (52%), Positives = 39/57 (68%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV VLR W+++H    YPSE +K +LS +T LS  Q+SNWFINAR R+   M+
Sbjct: 57  LPAESVKVLRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDML 113



>gb:AF497480_1905258 Homo sapiens TGF beta-induced transcription
           factor 2-like protein mRNA, complete cds.
          Length = 241

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSE +K +LS +T LS  Q+SNWFINAR R+   M+
Sbjct: 57  LPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDML 113



>gb:AF100326_1768094 Dendrobium grex Madame Thong-IN homeobox
           protein OVG2 (ovg2) mRNA, partial cds.
          Length = 101

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +  +L  W   H+  PYP+EADK+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 26  LPKEARQILFEWWTAHYKWPYPTEADKIALAEATGLDQKQINNWFINQRKRHWKP 80



>gb:DOR276389_1675995 Dendrobium grex Madame Thong-IN mRNA for
           knotted1-like homeobox protein.
          Length = 286

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +  +L  W   H+  PYP+EADK+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 211 LPKEARQILFEWWTAHYKWPYPTEADKIALAEATGLDQKQINNWFINQRKRHWKP 265



>gb:AY532908_1612134 Emericella nidulans AhpA (ahpA) gene, complete
           cds.
          Length = 293

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 3/71 (4%)
 Frame = -2

Query: 765 NQMGMLLDSEPWRPQR---GLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQ 595
           +  G+L DS   R +R    LP     +L++W   H  +PYPSE DK +L  +TGL+ NQ
Sbjct: 185 SNFGILGDSTDARNRRRRGNLPKPVTEILKAWFHAHLDHPYPSEEDKQMLMSRTGLTINQ 244

Query: 594 VSNWFINARVR 562
           +SNWFINAR R
Sbjct: 245 ISNWFINARRR 255



>sp|Q8IUE1|TGLX_HUMAN Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:AL590041_1929295 Human DNA sequence from clone
           RP13-436D9 on chromosome X Contains the TGIF2LX gene for
           TGFB-induced factor 2-like, X-linked, complete
           sequence.>gb:HSA427749_2007237 Homo sapiens TGIFLX gene
           for putative transcription factor, exons 1-2.
          Length = 241

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSE +K +LS +T LS  Q+SNWFINAR R+   M+
Sbjct: 57  LPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDML 113



>sp|Q8MIE9|TGLX_GORGO Homeobox protein TGIF2LX (TGFB-induced factor
           2-like protein, X- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           X).>gb:GGO345074_1995825 Gorilla gorilla mRNA for
           TGIF-like on the X (tgiflx gene).
          Length = 241

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 29/57 (50%), Positives = 39/57 (68%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSE +K +LS +T LS  Q+SNWFINAR R+   M+
Sbjct: 57  LPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDML 113



>gb:AC090683_1734401 Oryza sativa chromosome 3 BAC OSJNBa0035I24
           genomic sequence, complete sequence.
          Length = 337

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 32/75 (42%), Positives = 42/75 (56%)
 Frame = -2

Query: 774 GALNQMGMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQ 595
           G LN +   + ++       LP  + + L  W   H+  PYPSEA+K  L+  TGL K Q
Sbjct: 216 GYLNSLWTEISNKKKNSTGHLPRDARHKLLQWWHLHYRWPYPSEAEKAALAESTGLDKKQ 275

Query: 594 VSNWFINARVRLWKP 550
           V+NWFIN R R WKP
Sbjct: 276 VTNWFINQRKRHWKP 290



>gb:CR380954_1651181 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 259

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVR 562
           + +  LP  +V +L  WL++H  NPYP+  +K+ LS +TGL+K Q+SNWFIN R R
Sbjct: 163 KKRANLPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRR 218



>gb:AB043956_1520039 Ceratopteris richardii mRNA for CRKNOX2,
           complete cds.
          Length = 430

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +  +L  W  +H+  PYPSEA+K  L+  TGL + Q++NWFIN R R WKP
Sbjct: 318 LPREARQMLLDWWTQHYKWPYPSEAEKTALAESTGLDQKQINNWFINQRKRHWKP 372



>gb:AY667450_1620713 Selaginella kraussiana KNOTTED1-like protein
           (KNOX2) mRNA, complete cds.
          Length = 315

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 27/55 (49%), Positives = 33/55 (60%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   LR W F+H  +PYPSEA K  L+  T L   Q++NWFIN R R W P
Sbjct: 240 LPSAATKTLRDWWFQHLEHPYPSEAQKATLAATTKLDPKQINNWFINQRKRHWDP 294



>gb:GMA551279_1385409 Glomeris marginata partial mRNA for homothorax
           protein (hth gene).
          Length = 272

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 29/55 (52%), Positives = 41/55 (74%), Gaps = 1/55 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVR 562
           +RG+ P  + N++R+WLF+H  +PYPSE  K  L++ TGL+  QV+NWFINAR R
Sbjct: 218 KRGIFPKVATNIMRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 272



>pir|T07777|T07777 probable homeobox protein H1 -
           potato>gb:STU65648_1723145 Solanum tuberosum homeodomain
           protein POTH1 mRNA, complete cds.
          Length = 345

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +  +L +W  +HF  PYP+EADK  L+  TGL   Q++NWFIN R R WKP
Sbjct: 270 LPKEARQMLLAWWDDHFRWPYPTEADKNSLAESTGLDPKQINNWFINQRKRHWKP 324



>gb:AF434662_2065691 Mus musculus testis expressed homeobox mRNA,
           complete cds.
          Length = 231

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 30/52 (57%), Positives = 36/52 (69%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRL 559
           LP +SV +LR WL EH  N YP+ ADK +LS+ T LS  QVSNWF+N R  L
Sbjct: 45  LPLKSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHL 96



>gb:AY072735_1567388 Antirrhinum majus invaginata (ina) mRNA,
           complete cds.
          Length = 351

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 28/60 (46%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+ QTGL + Q++NWFIN R R WKP
Sbjct: 256 RKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLALAEQTGLDQKQINNWFINQRKRHWKP 315



>gb:AX969880_1485189 Sequence 683 from Patent EP1104808.
          Length = 142

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSE +K +LS +T LS  ++SNWFINAR R+   M+
Sbjct: 57  LPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDML 113



>sp|Q8IUE0|TGLY_HUMAN Homeobox protein TGIF2LY (TGFB-induced factor
           2-like protein, Y- linked) (TGF(beta)induced
           transcription factor 2-like protein) (TGIF- like on the
           Y).>gb:AF332223_1897072 Homo sapiens TGF beta-induced
           transcription factor 2-like mRNA, partial
           sequence.>gb:HSA427750_2007238 Homo sapiens TGIFLY gene
           for TG-interacting factor-like, exons 1-2.
          Length = 185

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           LP  SV +LR W+++H    YPSE +K +LS +T LS  ++SNWFINAR R+   M+
Sbjct: 57  LPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDML 113



>gb:LEU76408_1684761 Lycopersicon esculentum knotted 3 protein
           (TKn3) mRNA, complete cds.
          Length = 320

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +  +L +W ++HF  PY +EADK  L+  TGL   Q++NWFIN R R WKP
Sbjct: 244 LPKEAREMLLAWWYDHFRWPYSTEADKNSLAESTGLDPKQINNWFINQRKRHWKP 298



>gb:AY680398_1622073 Pinus taeda homeobox transcription factor KN4
           (Kn4) gene, exons 4, 5 and partial cds.
          Length = 135

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 28/55 (50%), Positives = 34/55 (61%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L  W   H+  PYPSE DKV L+  TGL + Q++NWFIN R R WKP
Sbjct: 55  LPKEARQKLLEWWNVHYKWPYPSETDKVALAESTGLDQKQINNWFINQRKRHWKP 109



>gb:AY667449_1620712 Selaginella kraussiana KNOTTED1-like protein
           (KNOX1) mRNA, complete cds.
          Length = 460

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  S  +L +W   H+  PYPSE++K  L+  TGL + Q++NWFIN R R WKP
Sbjct: 385 LPKDSRQILLNWWSVHYKWPYPSESEKASLAESTGLDQKQINNWFINQRKRHWKP 439



>gb:AY096803_1576297 Helianthus annuus knotted-1-like protein 2
           (kn2) mRNA, complete cds.
          Length = 358

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 266 LPKEARQKLLSWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKRHWKP 320



>sp|O04134|HKL1_MALDO Homeobox protein knotted-1 like 1
           (KNAP1).>pir|T17009|T17009 knotted1-like homeobox
           protein - apple tree>gb:MDKN11_1685934 M.domestica mRNA
           for kn1-like protein (1759 bp).
          Length = 398

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 309 LPKEARQKLLSWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKRHWKP 363



>gb:AF376049_2490256 Danio rerio transcription factor Meis4.1a
           (meis4.1a) mRNA, complete cds.
          Length = 380

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 29/61 (47%), Positives = 43/61 (70%), Gaps = 1/61 (1%)
 Frame = -2

Query: 723 QRGL-PDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPM 547
           +RG+ P  +  ++  W+F+H  +PYPSE  K  LS+ TGL+  QV+NWFINAR R+ +PM
Sbjct: 264 KRGIFPKVASTIMIPWVFQHLTHPYPSEEQKRQLSQDTGLTILQVNNWFINARRRIVQPM 323

Query: 546 V 544
           +
Sbjct: 324 I 324



>gb:AE016819_1748787 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 257

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 29/65 (44%), Positives = 41/65 (63%)
 Frame = -2

Query: 756 GMLLDSEPWRPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFI 577
           G L +++    +  LP  +V++L  WL  H+ NPYPS  +K  L +QTGL+  Q+SNWFI
Sbjct: 124 GKLKETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFI 183

Query: 576 NARVR 562
           N R R
Sbjct: 184 NVRRR 188



>gb:HTU519674_1682195 Helianthus tuberosus mRNA for putative
           knotted-1-like protein (knot1HT gene).
          Length = 362

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSEA K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 270 RKKGKLPKEARQQLLDWWTRHYKWPYPSEAQKLALAESTGLDQKQINNWFINQRKRHWKP 329



>gb:AY680405_1622080 Picea mariana homeobox transcription factor KN4
           (Kn4) mRNA, complete cds.
          Length = 438

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 28/55 (50%), Positives = 34/55 (61%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L  W   H+  PYPSE DKV L+  TGL + Q++NWFIN R R WKP
Sbjct: 358 LPKEARQKLLEWWNVHYKWPYPSETDKVSLAESTGLDQKQINNWFINQRKRHWKP 412



>gb:AY680400_1622075 Picea abies homeobox transcription factor KN4
           (Kn4) gene, exons 4, 5 and partial
           cds.>gb:AY680401_1622076 Picea glauca homeobox
           transcription factor KN4 (Kn4) gene, exons 4, 5 and
           partial cds.
          Length = 135

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 28/55 (50%), Positives = 34/55 (61%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L  W   H+  PYPSE DKV L+  TGL + Q++NWFIN R R WKP
Sbjct: 55  LPKEARQKLLEWWNVHYKWPYPSETDKVSLAESTGLDQKQINNWFINQRKRHWKP 109



>gb:AY096804_1576298 Helianthus annuus knotted-1-like protein 3
           (kn3) mRNA, partial cds.
          Length = 189

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSEA K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 97  RKKGKLPKEARQQLLDWWTRHYKWPYPSEAQKLALAESTGLDQKQINNWFINQRKRHWKP 156



>gb:AY096802_1576296 Helianthus annuus knotted-1-like protein 1
           (kn1) mRNA, complete cds.
          Length = 362

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSEA K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 268 RKKGKLPKEARQQLLDWWTRHYKWPYPSEAQKLALAESTGLDQKQINNWFINQRKRHWKP 327



>gb:AB043955_1520038 Ceratopteris richardii mRNA for CRKNOX1s,
           complete cds.
          Length = 240

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 27/55 (49%), Positives = 35/55 (63%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L  W  +H+  PYPSEA+K  L+  TGL + Q++NWFIN R R WKP
Sbjct: 128 LPKNAREKLLDWWNQHYKWPYPSEAEKAALAETTGLDQKQINNWFINQRKRHWKP 182



>gb:AB043954_1520037 Ceratopteris richardii mRNA for CRKNOX1,
           complete cds.
          Length = 512

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 27/55 (49%), Positives = 35/55 (63%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L  W  +H+  PYPSEA+K  L+  TGL + Q++NWFIN R R WKP
Sbjct: 400 LPKNAREKLLDWWNQHYKWPYPSEAEKAALAETTGLDQKQINNWFINQRKRHWKP 454



>gb:AB025715_1516736 Nicotiana tabacum mRNA for homeobox 22,
           complete cds.
          Length = 319

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +  +L +W  +H+  PYP+EADK  L+  TGL   Q++NWFIN R R WKP
Sbjct: 245 LPKEARQMLLAWWNDHYRWPYPTEADKNSLAESTGLDPKQINNWFINQRKRHWKP 299



>sp|P24345|HKN1_MAIZE Homeotic protein knotted-1.>pir|S14283|S14283
           transcription factor Knotted-1 -
           maize>gb:AY260164_1593425 Zea mays KNOTTED1 (kn1) gene,
           complete cds.>gb:AY312169_1598230 Zea mays homeobox
           transcription factor KNOTTED1 (kn1) gene, complete
           cds.>gb:ZMKN1_1731915 Z.mays Knotted-1 (Kn-1) gene.
          Length = 359

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 28/55 (50%), Positives = 34/55 (61%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW  +H+  PYPSE  KV L+  TGL   Q++NWFIN R R WKP
Sbjct: 271 LPKEARQQLLSWWDQHYKWPYPSETQKVALAESTGLDLKQINNWFINQRKRHWKP 325



>gb:AF457124S2_1801310 Zea mays knotted1-like homeodomain protein
           liguleless3 (lg3) gene, exons 4, 5 and partial cds.
          Length = 146

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 29/60 (48%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +  VL  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 57  RKKGKLPKDARTVLLEWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 116



>gb:AF100455_1768101 Zea mays knotted class 1 homeodomain protein
           liguleless3 (lg3) mRNA, complete cds.
          Length = 295

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 29/60 (48%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +  VL  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 206 RKKGKLPKDARTVLLEWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 265



>gb:AY684938_1622269 Populus balsamifera subsp. trichocarpa x
           Populus deltoides homeobox transcription factor KN3
           (Kn3) mRNA, complete cds.
          Length = 368

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/55 (50%), Positives = 35/55 (63%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE +KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 279 LPKEARQKLLSWWELHYKWPYPSETEKVALAETTGLDQKQINNWFINQRKRHWKP 333



>gb:AY601274_1617427 Chelidonium majus shoot meristemless-like
           protein (STM) mRNA, partial cds.
          Length = 159

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 100 RKKGKLPKEARQQLLEWWSRHYKWPYPSESQKIALAESTGLDQKQINNWFINQRKRHWKP 159



>gb:AY423709_1605483 Populus alba x Populus tremula putative
           Kn1-like homeobox protein mRNA, partial cds.
          Length = 186

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/55 (50%), Positives = 35/55 (63%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE +KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 116 LPKEARQKLLSWWELHYKWPYPSETEKVALAETTGLDQKQINNWFINQRKRHWKP 170



>gb:AC117176_1208020 Dictyostelium discoideum chromosome 2 map
           5018074-5200947 strain AX4, complete sequence.
          Length = 740

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = -2

Query: 729 RPQRG--LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVR 562
           RP++G  L   S ++L +W+  H  +PYP+  +K  L RQTGL+ NQ+SNWFIN R R
Sbjct: 605 RPKKGAKLSKESKDILENWIKNHIAHPYPTNDEKEQLQRQTGLTPNQISNWFINTRRR 662



>sp|P56669|HLG3_MAIZE Homeobox protein liguleless 3 (Fragment).
          Length = 85

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 29/60 (48%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +  VL  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 25  RKKGKLPKDARTVLLEWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 84



>sp|P56661|HKL3_MAIZE Homeobox protein knotted-1 like 3 (Fragment).
          Length = 88

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/60 (46%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L SW   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 28  RKKDKLPKEARQKLLSWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 87



>sp|O04135|HKL2_MALDO Homeobox protein knotted-1 like 2
           (KNAP2).>pir|T17008|T17008 knotted1-like homeobox
           protein - apple tree>gb:MDKN12_1685935 M.domestica mRNA
           for kn1-like protein (1791 bp).
          Length = 397

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 308 LPKDARQKLLSWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKRHWKP 362



>gb:AF544054_1810420 Nicotiana tabacum knotted 3 (kn3) mRNA, partial
           cds.
          Length = 340

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 250 LPKDARQKLLSWWELHYKWPYPSESEKVALAETTGLDQKQINNWFINQRKRHWKP 304



>gb:AF544053_1810419 Nicotiana tabacum knotted 2 (kn2) mRNA, partial
           cds.
          Length = 341

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 251 LPKDARQKLLSWWELHYKWPYPSESEKVALAETTGLDQKQINNWFINQRKRHWKP 305



>gb:AF482995_1804027 Arabidopsis thaliana RLD homeodomain protein
           KNAT1/BP mRNA, complete cds.
          Length = 400

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L +W   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 310 LPKEARQKLLTWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKRHWKP 364



>gb:AF482994_1804026 Arabidopsis thaliana Landsberg erecta
           homeodomain protein KNAT1/BP mRNA, complete cds.
          Length = 400

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L +W   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 310 LPKEARQKLLTWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKRHWKP 364



>gb:AB025714_1516735 Nicotiana tabacum mRNA for homeobox 20,
           complete cds.
          Length = 356

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 266 LPKDARQKLLSWWELHYKWPYPSESEKVALAETTGLDQKQINNWFINQRKRHWKP 320



>gb:AB025713_1516734 Nicotiana tabacum mRNA for homeobox 9, complete
           cds.
          Length = 322

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +  +L +W   H+  PYP+E +K+ L+  TGL   Q++NWFIN R R WKP
Sbjct: 250 LPREARQILLNWWTTHYKWPYPTEGEKICLAESTGLDPKQINNWFINQRKRHWKP 304



>gb:CNS07EGG_1374133 chromosome X of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 192

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 28/57 (49%), Positives = 39/57 (68%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRL 559
           R +   P  +  +LRSWL E+  NPYPS+A+K  L ++TGL   Q++NWFINAR R+
Sbjct: 124 RTRANFPMDTSQLLRSWLKENMDNPYPSDAEKAYLCQKTGLGPAQINNWFINARRRI 180



>gb:CEH25HOME_1365042 Caenorhabditis elegans mRNA for CEH-25
           homeobox protein.
          Length = 265

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 39/53 (73%)
 Frame = -2

Query: 702 SVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           ++   R+WLF +  +PYPSE  K  L+++TGL+  QV+NWFINAR R+ +PM+
Sbjct: 104 AITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 156



>gb:AC006692_1203748 Caenorhabditis elegans cosmid T28F12, complete
           sequence.
          Length = 490

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 39/53 (73%)
 Frame = -2

Query: 702 SVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           ++   R+WLF +  +PYPSE  K  L+++TGL+  QV+NWFINAR R+ +PM+
Sbjct: 329 AITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 381



>gb:AC006692_1203747 Caenorhabditis elegans cosmid T28F12, complete
           sequence.>gb:AF427477_1270014 Caenorhabditis elegans
           UNC-62 splice variant 1b-7b (unc-62) mRNA, complete cds;
           alternatively spliced.
          Length = 527

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 39/53 (73%)
 Frame = -2

Query: 702 SVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           ++   R+WLF +  +PYPSE  K  L+++TGL+  QV+NWFINAR R+ +PM+
Sbjct: 366 AITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 418



>gb:AC006692_1203745 Caenorhabditis elegans cosmid T28F12, complete
           sequence.>gb:AF427475_1270012 Caenorhabditis elegans
           UNC-62 splice variant 1a-7b (unc-62) mRNA, complete cds;
           alternatively spliced.
          Length = 564

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 39/53 (73%)
 Frame = -2

Query: 702 SVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKPMV 544
           ++   R+WLF +  +PYPSE  K  L+++TGL+  QV+NWFINAR R+ +PM+
Sbjct: 403 AITKFRAWLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 455



>sp|P46639|HKL1_ARATH Homeobox protein knotted-1 like 1
           (KNAT1).>pir|D85080|D85080 KNAT1 homeobox-like protein
           [imported] - Arabidopsis thaliana>gb:AC006267_1533941
           Arabidopsis thaliana BAC F9M13 from chromosome IV near
           21.5 cM, complete sequence.>gb:ATCHRIV22_1544531
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 22.>gb:ATU14174_1556769 Arabidopsis thaliana clone
           KNAT1 knotted-like homeobox protein gene, partial
           cds.>gb:AY080834_1568527 Arabidopsis thaliana putative
           KNAT1 homeobox protein (At4g08150) mRNA, complete
           cds.>gb:AY113982_1578393 Arabidopsis thaliana putative
           KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
          Length = 398

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 27/55 (49%), Positives = 36/55 (65%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L +W   H+  PYPSE++KV L+  TGL + Q++NWFIN R R WKP
Sbjct: 308 LPKEARQKLLTWWELHYKWPYPSESEKVALAESTGLDQKQINNWFINQRKRHWKP 362



>gb:AF457122S2_1801308 Zea mays knotted1-like homeodomain protein
           liguleless4b (lg4b) gene, exons 4, 5 and partial cds.
          Length = 148

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  + + L  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 58  RKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 117



>gb:AF457119_1801304 Zea mays knotted1-like homeodomain protein
           liguleless4b (lg4b) mRNA, complete cds.
          Length = 298

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  + + L  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 208 RKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 267



>gb:AF308454_1784801 Medicago truncatula knotted class I homeodomain
           KNOX mRNA, complete cds.
          Length = 381

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 287 RKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 346



>gb:AF022390_1761991 Hordeum vulgare knotted class 1 homeodomain
           protein (k) mRNA, complete cds.
          Length = 364

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/55 (50%), Positives = 34/55 (61%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE+ KV L+  TGL   Q++NWFIN R R WKP
Sbjct: 275 LPKEARQQLLSWWEMHYKWPYPSESQKVALAESTGLDLKQINNWFINQRKRHWKP 329



>gb:AY755413_1626930 Populus alba x Populus tremula homeodomain
           protein ARBORKNOX1 (ARBORKNOX1) mRNA, complete cds.
          Length = 361

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 267 RKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 326



>gb:AY684937_1622268 Populus balsamifera subsp. trichocarpa x
           Populus deltoides homeobox transcription factor KN2
           (Kn2) mRNA, complete cds.
          Length = 373

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 279 RKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 338



>gb:AY655754_1620249 Streptocarpus saxorum STM1 protein mRNA,
           complete cds.
          Length = 353

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 259 RKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLALAESTGLEQKQINNWFINQRKRHWKP 318



>gb:AY655753_1620248 Streptocarpus rexii STM1 protein mRNA, complete
           cds.
          Length = 358

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 264 RKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 323



>gb:AY655752_1620247 Streptocarpus dunnii STM1 protein mRNA, partial
           cds.
          Length = 356

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 262 RKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 321



>gb:AY169493_1586531 Nicotiana tabacum Knotted-1-like homeobox
           protein H1 (H1) mRNA, complete cds.
          Length = 343

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 249 RKKGKLPKEARQQLLDWWTRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 308



>gb:AY112704_1578154 Petunia x hybrida shootmeristemless-like mRNA,
           complete cds.
          Length = 347

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 253 RKKGKLPKEARQQLLDWWTRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 312



>gb:AY072736_1567389 Antirrhinum majus hirzina (hirz) mRNA, complete
           cds.
          Length = 353

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 259 RKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 318



>gb:AB071452_1522821 Oryza sativa gene for transcription factor
           OSH3, partial cds, cultivar:701.
          Length = 138

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWCELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88



>pir|T06382|T06382 Knox protein 1 - garden pea>gb:AF063307_1765410
           Pisum sativum Knox class 1 protein (Hop1) mRNA, complete
           cds.>gb:AF080104_1766433 Pisum sativum knotted1-like
           class I homeodomain protein (PsKn1) mRNA, complete cds.
          Length = 371

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 277 RKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 336



>pir|T02783|T02783 probable homeotic protein -
           rice>gb:AB007624_1510115 Oryza sativa (japonica
           cultivar-group) HOS9 mRNA, partial
           cds.>gb:AB028885_1518120 Oryza sativa mRNA for
           knotted1-type homeobox protein OSH71, complete
           cds.>gb:AC130598_1740717 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0056I11,
           complete sequence.>gb:AF050180_1764149 Oryza sativa
           strain Indica IR58 KNOX class homeodomain protein
           (Oskn2) mRNA, complete cds.
          Length = 311

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  + + L  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 221 RKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 280



>pir|T01735|T01735 homeobox protein NTH15 - common
           tobacco>gb:AB004785_1509180 Nicotiana tabacum NTH15
           mRNA, complete cds.
          Length = 342

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/60 (45%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L  W   H+  PYPSE+ K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 248 RKKGKLPKEARQQLLDWWTRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKP 307



>sp|P53147|YGJ6_YEAST Hypothetical homeobox protein in PRP20-VPS45
           intergenic region.>pir|S64103|S64103 hypothetical
           protein YGL096w - yeast (Saccharomyces
           cerevisiae)>gb:AY558496_1614723 Saccharomyces cerevisiae
           clone FLH002707.01X YGL096W gene, complete
           cds.>gb:SCYGL096W_1712018 S.cerevisiae chromosome VII
           reading frame ORF YGL096w.
          Length = 276

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/51 (54%), Positives = 36/51 (70%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVR 562
           LP  +V++L  WL EH  NPYP+  +K  L  +TGL+K Q+SNWFINAR R
Sbjct: 201 LPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR 251



>sp|Q43484|KNX3_HORVU Homeobox protein KNOX3 (Hooded
           protein).>pir|S58871|S58871 homeotic protein Knox3 -
           barley>gb:HVKNOX3_1682435 H.vulgare Knox3 gene.
          Length = 364

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/55 (50%), Positives = 34/55 (61%)
 Frame = -2

Query: 714 LPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           LP  +   L SW   H+  PYPSE+ KV L+  TGL   Q++NWFIN R R WKP
Sbjct: 275 LPKEARQQLLSWWEMHYKWPYPSESQKVALAESTGLDLKQINNWFINQRKRHWKP 329



>sp|P56663|HKL5_MAIZE Homeobox protein knotted-1 like 5 (Fragment).
          Length = 85

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  + + L  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 25  RKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 84



>gb:AF457120S2_1801306 Zea mays knotted1-like homeodomain protein
           liguleless4a (lg4a) gene, exons 4, 5, and partial cds.
          Length = 151

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  + + L  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 60  RKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAATGLDPKQINNWFINQRKRHWKP 119



>gb:AF457118_1801303 Zea mays knotted1-like homeodomain protein
           liguleless4a (lg4a) mRNA, complete cds.
          Length = 307

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  + + L  W   H+  PYP+E DKV L+  TGL   Q++NWFIN R R WKP
Sbjct: 216 RKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLAAATGLDPKQINNWFINQRKRHWKP 275



>gb:AB071664_1522926 Oryza sativa (indica cultivar-group) gene for
           transcription factor OSH3, complete cds, cultivar:IR24.
          Length = 365

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 251 RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 310



>gb:AB071513_1522882 Oryza meridionalis gene for transcription
           factor OSH3, partial cds, cultivar:W1629.
          Length = 136

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88



>gb:AB071504_1522873 Oryza glaberrima gene for transcription factor
           OSH3, partial cds, cultivar:C8549.>gb:AB071509_1522878
           Oryza barthii gene for transcription factor OSH3,
           partial cds, cultivar:W1468.
          Length = 138

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88



>gb:AB071498_1522867 Oryza glaberrima gene for transcription factor
           OSH3, partial cds, cultivar:W440.>gb:AB071505_1522874
           Oryza glaberrima gene for transcription factor OSH3,
           partial cds, cultivar:W025.>gb:AB071506_1522875 Oryza
           glumaepatula gene for transcription factor OSH3, partial
           cds, cultivar:W1187.>gb:AB071508_1522877 Oryza barthii
           gene for transcription factor OSH3, partial cds,
           cultivar:W1416.>gb:AB071512_1522881 Oryza longistaminata
           gene for transcription factor OSH3, partial cds,
           cultivar:W1649.
          Length = 138

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88



>gb:AB071477_1522846 Oryza rufipogon gene for transcription factor
           OSH3, partial cds, cultivar:W629.
          Length = 138

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88



>gb:AB071460_1522829 Oryza sativa (japonica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:532.>gb:AB071463_1522832 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:M24.>gb:AB071467_1522836 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:220.>gb:AB071468_1522837 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:P9.>gb:AB071485_1522854 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:444.>gb:AB071491_1522860 Oryza
           sativa (japonica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:538.>gb:AB071499_1522868 Oryza sativa gene for
           transcription factor OSH3, partial cds, cultivar:221.
          Length = 138

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88



>gb:AB071454_1522823 Oryza sativa gene for transcription factor
           OSH3, partial cds, cultivar:Is6.>gb:AB071455_1522824
           Oryza sativa gene for transcription factor OSH3, partial
           cds, cultivar:Is108.>gb:AB071456_1522825 Oryza sativa
           gene for trascription factor OSH3, partial cds,
           cultivar:325.>gb:AB071457_1522826 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:644.>gb:AB071465_1522834 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:201.>gb:AB071466_1522835 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:206.>gb:AB071470_1522839 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:624.>gb:AB071497_1522866 Oryza sativa gene for
           transcription factor OSH3, partial cds, cultivar:306.
          Length = 138

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88



>gb:AB071439_1522809 Oryza sativa (indica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:A39.>gb:AB071440_1522810 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:Km5.>gb:AB071441_1522811 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:710.>gb:AB071442_1522812 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:717.>gb:AB071443_1522813 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:Is24.>gb:AB071444_1522814 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:451.>gb:AB071445_1522815 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:M23.>gb:AB071446_1522816 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:230.>gb:AB071448_1522817 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:C9329.>gb:AB071449_1522818 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:C9392.>gb:AB071450_1522819 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:C9463.>gb:AB071471_1522840 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1654.>gb:AB071472_1522841 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1965.>gb:AB071473_1522842 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W137.>gb:AB071474_1522843 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1976.>gb:AB071475_1522844 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1987.>gb:AB071476_1522845 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W596.>gb:AB071478_1522847 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W630.>gb:AB071479_1522848 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1811.>gb:AB071480_1522849 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1680.>gb:AB071481_1522850 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1865.>gb:AB071482_1522851 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:IR24.>gb:AB071483_1522852 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:721.>gb:AB071484_1522853 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:423.>gb:AB071486_1522855 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:Kasalath.>gb:AB071487_1522856 Oryza sativa
           (indica cultivar-group) gene for transcription factor
           OSH3, partial cds, cultivar:IVT1.>gb:AB071500_1522869
           Oryza sativa (indica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:414.>gb:AB071501_1522870 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:868.>gb:AB071502_1522871 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:Acc10818.>gb:AB071503_1522872 Oryza sativa
           (indica cultivar-group) gene for transcription factor
           OSH3, partial cds, cultivar:Acc6622.>gb:AB071507_1522876
           Oryza glumaepatula gene for transcription factor OSH3,
           partial cds, cultivar:W1192.>gb:AB071510_1522879 Oryza
           longistaminata gene for transcription factor OSH3,
           partial cds, cultivar:W1618.>gb:AB071511_1522880 Oryza
           meridionalis gene for transcription factor OSH3, partial
           cds, cultivar:W1631.>gb:AB071897_1522966 Oryza sativa
           (indica cultivar-group) gene for Transcription factor
           OSH3, partial cds.
          Length = 138

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/60 (45%), Positives = 37/60 (61%)
 Frame = -2

Query: 729 RPQRGLPDRSVNVLRSWLFEHFLNPYPSEADKVLLSRQTGLSKNQVSNWFINARVRLWKP 550
           R +  LP  +   L +W   H+  PYPSE +K+ L+  TGL + Q++NWFIN R R WKP
Sbjct: 29  RKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAESTGLEQKQINNWFINQRKRHWKP 88


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 813,885,137
Number of Sequences: 1806583
Number of extensions: 16061569
Number of successful extensions: 48060
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 43853
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47801
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 57553322560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)