BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8864
         (1013 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q41350|OLP1_LYCES|OLP1_LYCES Osmotin-like protein precursor.>pir|JC5237|...   379   e-104   Solanum lycopersicum
gb:AF175270_1774488 Benincasa hispida osmotin-like protein (olp)...   348   7e-95   
gb:AY086000_1571061 Arabidopsis thaliana clone 2058 mRNA, comple...   334   2e-90   
pir|H84688|H84688 probable thaumatin [imported] - Arabidopsis th...   334   2e-90   Arabidopsis thaliana [mouse-ear cress]
gb:AF355805_1790722 Brassica oleracea thaumatin-like cytokinin-b...   332   6e-90   
gb:AP003231_1825793 Oryza sativa (japonica cultivar-group) genom...   303   5e-81   
gb:AY664413_1620605 Zea mays cultivar B73 locus 9002, complete s...   202   7e-51   
gb:AY664417_1620643 Zea mays cultivar Mo17 locus 9002, complete ...   202   1e-50   
gb:AB010077_1511032 Arabidopsis thaliana genomic DNA, chromosome...   198   2e-49   
gb:AP003935_1835519 Oryza sativa (japonica cultivar-group) genom...   194   3e-48   
pir|G96806|G96806 thaumatin-like protein, 12104-13574 [imported]...   192   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1020925 Oryza sativa (japonica cultivar-group) chrom...   189   1e-46   
pir|S71175|S71175 thaumatin-like protein - Arabidopsis thaliana>...   185   1e-45   Arabidopsis thaliana [mouse-ear cress]
sp|P50699|TLPH_ARATH|TLPH_ARATH Thaumatin-like protein precursor.                185   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AP006067_1860844 Oryza sativa (japonica cultivar-group) genom...   182   7e-45   
gb:AY863029_1354254 Toxoptera citricida PR-5-like protein (pr-5L...   182   9e-45   
pir|B96763|B96763 thaumatin-like protein, 9376-10898 [imported] ...   182   9e-45   Arabidopsis thaliana [mouse-ear cress]
gb:OSA245900_1692397 Oryza sativa chromosome 4 BAC q3037-207F1 c...   181   2e-44   
gb:AY085688_1570755 Arabidopsis thaliana clone 17109 mRNA, compl...   181   2e-44   
gb:AB010068_1510845 Arabidopsis thaliana genomic DNA, chromosome...   181   2e-44   
pir|T14428|T14428 thaumatin-like protein - turnip>gb:BRU71244_16...   181   2e-44   Brassica rapa
gb:AE016959_1022558 Oryza sativa (japonica cultivar-group) chrom...   181   3e-44   
gb:OSJN00076_1694420 Oryza sativa genomic DNA, chromosome 4, BAC...   180   4e-44   
pir|D96787|D96787 protein T4O12.3 [imported] - Arabidopsis thali...   179   6e-44   Arabidopsis thaliana [mouse-ear cress]
pir|T00838|T00838 hypothetical protein At2g17860 [imported] - Ar...   179   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AP003614_1831413 Oryza sativa (japonica cultivar-group) genom...   178   2e-43   
gb:AF049870_1764103 Arabidopsis thaliana beta tubulin 1, thaumat...   178   2e-43   
pir|T48235|T48235 thaumatin-like protein - Arabidopsis thaliana>...   177   3e-43   Arabidopsis thaliana [mouse-ear cress]
pir|T05493|T05493 pathogenesis-related protein 19K4.140 - Arabid...   177   3e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AY087140_1572175 Arabidopsis thaliana clone 32152 mRNA, compl...   176   7e-43   
gb:AY070407_1566805 Arabidopsis thaliana putative thaumatin prot...   176   7e-43   
gb:NTA6233_1691435 Nicotiana tabacum DNA fragment for H2 left T-...   175   1e-42   
pir|T05694|T05694 pathogenesis-related protein F20M13.220 - Arab...   174   3e-42   Arabidopsis thaliana [mouse-ear cress]
pir|T09881|T09881 thaumatin homolog T22A6.10 - Arabidopsis thali...   174   3e-42   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC002343_1542766 Arabidopsis thaliana chromosome IV BAC T19...   173   4e-42   
gb:AP003745_1832760 Oryza sativa (japonica cultivar-group) genom...   173   6e-42   
gb:AP006067_1860846 Oryza sativa (japonica cultivar-group) genom...   172   7e-42   
gb:AP004708_1843781 Oryza sativa (japonica cultivar-group) genom...   172   1e-41   
gb:AF195653_1775889 Vitis vinifera SCUTL1 mRNA, partial cds.          172   1e-41   
gb:AF195654_1775890 Vitis vinifera SCUTL2 mRNA, complete cds.         172   1e-41   
gb:AE005172_890891 Arabidopsis thaliana chromosome 1, top arm co...   171   2e-41   
gb:AK117316_1815356 Arabidopsis thaliana At4g38670 mRNA for puta...   170   4e-41   
gb:BT002528_1636131 Arabidopsis thaliana calreticulin, putative ...   170   4e-41   
pir|G86333|G86333 hypothetical protein T20H2.19 [imported] - Ara...   170   4e-41   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SMH2|TLP1_CASSA|TLP1_CASSA Thaumatin-like protein 1 precursor.>gb:CSA2...   170   4e-41   Castanea sativa
gb:AB000834_1508436 Nicotiana tabacum gene for thaumatin-like pr...   170   5e-41   
pir|E96780|E96780 thaumatin-like protein, 23251-22305 [imported]...   170   5e-41   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FSG7|TP1A_MALDO|TP1A_MALDO Thaumatin-like protein 1a precursor (Allerg...   169   6e-41   Malus domestica [apple tree]
sp|P50694|TLP_PRUAV|TLP_PRUAV Thaumatin-like protein precursor.>gb:PAU3244...   169   6e-41   Prunus avium [gean]
gb:BT005764_1638688 Arabidopsis thaliana clone RAFL15-33-P21 (R2...   169   8e-41   
pir|T22396|T22396 hypothetical protein F49A5.6 - Caenorhabditis ...   169   8e-41   Caenorhabditis elegans [roundworm]
gb:AF090143_1767327 Malus domestica thaumatin-like protein precu...   169   1e-40   
pir|JC7201|JC7201 thaumatin-like protein 1 - apple tree               169   1e-40   Malus domestica [apple tree]
gb:AE016959_1020922 Oryza sativa (japonica cultivar-group) chrom...   167   2e-40   
pir|T05695|T05695 pathogenesis-related protein F20M13.230 - Arab...   167   3e-40   Arabidopsis thaliana [mouse-ear cress]
pir|C96780|C96780 thaumatin-like protein, 28949-28112 [imported]...   167   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AY863030_1354255 Lysiphlebus testaceipes PR-5-like protein (p...   166   5e-40   
gb:AP005168_1848650 Oryza sativa (japonica cultivar-group) genom...   166   9e-40   
gb:AY512591_1332022 Schistocerca gregaria thaumatin-like protein...   165   2e-39   
gb:OSJN00160_1695904 Oryza sativa genomic DNA, chromosome 4, BAC...   164   3e-39   
gb:H0806H05_1681374 Oryza sativa genomic DNA, chromosome 4, BAC ...   164   3e-39   
sp|P28493|PR5_ARATH|PR5_ARATH Pathogenesis-related protein 5 precursor (PR...   162   8e-39   Arabidopsis thaliana [mouse-ear cress]
sp|O80327|TLP1_PYRPY|TLP1_PYRPY Thaumatin-like protein 1 precursor.>gb:AB00...   162   1e-38   Pyrus pyrifolia [sha li]
pir|T21496|T21496 hypothetical protein F28D1.5 - Caenorhabditis ...   161   2e-38   Caenorhabditis elegans [roundworm]
gb:ATU83490_1557326 Arabidopsis thaliana thaumatin-like protein ...   161   2e-38   
gb:AB036069_1519003 Pyrus pyrifolia PsTL gene for thaumatin/PR5-...   161   2e-38   
pir|T21494|T21494 hypothetical protein F28D1.3 - Caenorhabditis ...   160   4e-38   Caenorhabditis elegans [roundworm]
gb:AF494393_1805348 Malus x domestica thaumatine-like protein (P...   159   6e-38   
sp|P83332|TLP1_PRUPE|TLP1_PRUPE Thaumatin-like protein 1 precursor (PpAZ44)...   159   1e-37   Prunus persica
gb:AY315152_1598402 Pseudotsuga menziesii PR-5 thaumatin-like pr...   157   4e-37   
sp|P83335|TLP2_PRUPE|TLP2_PRUPE Thaumatin-like protein 2 precursor (PpAZ8)....   157   4e-37   Prunus persica
gb:AY661266_1620406 Pseudotsuga menziesii thaumatin-like protein...   156   5e-37   
gb:AY863028_1354253 Diaprepes abbreviatus PR-5-like protein (pr-...   156   7e-37   
gb:AY315151_1598401 Pseudotsuga menziesii PR-5 thaumatin-like pr...   155   1e-36   
gb:AC024839_1204916 Caenorhabditis elegans cosmid Y59E9AR, compl...   154   2e-36   
gb:AY065642_1566570 Daucus carota thaumatin-like protein mRNA, c...   151   2e-35   
pir|T21495|T21495 hypothetical protein F28D1.4 - Caenorhabditis ...   151   2e-35   Caenorhabditis elegans [roundworm]
sp|P83336|TP1B_MALDO|TP1B_MALDO Thaumatin-like protein 1b (Pathogenesis-rel...   150   3e-35   Malus domestica [apple tree]
gb:CAR010501_1645119 Cicer arietinum L. mRNA for thaumatin-like ...   149   1e-34   
gb:AC103891_1737308 Oryza sativa (japonica cultivar-group) chrom...   148   2e-34   
gb:AC137991_1743862 Oryza sativa chromosome 3 BAC OSJNBa0034D21 ...   147   3e-34   
gb:AY512592_1332023 Schistocerca gregaria thaumatin-like protein...   147   3e-34   
gb:AB081304_1524076 Cryptomeria japonica Cry j 3.2 mRNA for thau...   146   6e-34   
gb:AY181253_1587593 Linum usitatissimum osmotin-like protein lin...   146   7e-34   
pir|B86317|B86317 protein T10O22.21 [imported] - Arabidopsis tha...   144   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb:ATU48698_1557035 Arabidopsis thaliana putative receptor serin...   144   4e-33   
gb:AB005247_1509631 Arabidopsis thaliana genomic DNA, chromosome...   144   4e-33   
gb:AC024838_1204915 Caenorhabditis elegans cosmid Y59E9AL, compl...   144   4e-33   
gb:AF355458_1790706 Hordeum vulgare thaumatin-like protein TLP8 ...   143   5e-33   
gb:PME131731_1700768 Pseudotsuga menziesii mRNA for Thaumatin-li...   143   6e-33   
gb:NTOSPR_1691661 N.tabacum osmotin gene.                             142   8e-33   
gb:AY863027_1354252 Diaprepes abbreviatus PR-5-like protein (pr-...   142   1e-32   
gb:AB081305_1524077 Cryptomeria japonica Cry j 3.3 mRNA for thau...   142   1e-32   
gb:AX112127_1461377 Sequence 1 from Patent WO0127298.                 142   1e-32   
gb:AB081303_1524075 Cryptomeria japonica Cry j 3.1 mRNA for thau...   141   2e-32   
gb:AY795850_1628491 Thuja occidentalis thaumatin-like protein mR...   140   3e-32   
gb:AY093595_1575354 Lycopersicon esculentum PR-5x (PR-5) mRNA, c...   140   3e-32   
sp|P33679|ZEAM_MAIZE|ZEAM_MAIZE Zeamatin precursor.>pir|T02075|T02075 antif...   140   3e-32   Zea mays [maize]
sp|P50702|OS81_SOLCO|OS81_SOLCO Osmotin-like protein OSML81 precursor (PA81...   140   3e-32   Solanum commersonii
gb:AP003219_1825461 Oryza sativa (japonica cultivar-group) genom...   140   4e-32   
gb:AY737310_1626054 Solanum phureja osmotin-like protein (OSM-5a...   140   4e-32   
sp|P81295|PRR3_JUNAS|PRR3_JUNAS Pathogenesis-related protein precursor (Pol...   140   4e-32   Juniperus ashei [Ashe juniper]
sp|P12670|NP24_LYCES|NP24_LYCES NP24 protein precursor (Pathogenesis-relate...   140   4e-32   Solanum lycopersicum
gb:TOMNP24_1725671 Tomato NP24 protein mRNA, 3' end.                  139   9e-32   
gb:S44889_1704169 osmotin=pathogenesis-related protein homolog [...   139   9e-32   
gb:AY743930_1626550 Solanum phureja osmotin-like protein A81 mRN...   139   9e-32   
gb:AY737312_1626059 Solanum tuberosum osmotin-like protein (OSM-...   139   9e-32   
gb:AY007309_1557875 Solanum dulcamara cryoprotective osmotin-lik...   139   9e-32   
pir|S30157|S30157 osmotin precursor - common tobacco>gb:NTAP24G_...   139   9e-32   Nicotiana tabacum [American tobacco]
pir|S07406|S07406 thaumatin homolog NP24 precursor - tomato (fra...   139   9e-32   Solanum lycopersicum
sp|P14170|OSMO_TOBAC|OSMO_TOBAC Osmotin precursor.>gb:A16780_1447685 osmoti...   139   9e-32   Nicotiana tabacum [American tobacco]
gb:OSU77657_1698518 Oryza sativa pathogenesis-related thaumatin-...   139   1e-31   
gb:AY737310_1626053 Solanum phureja osmotin-like protein (OSM-5a...   139   1e-31   
pir|T04166|T04166 thaumatin-like protein - rice                       139   1e-31   Oryza sativa [red rice]
pir|S33197|S33197 osmotin-like protein precursor (clone pA81) - ...   139   1e-31   Solanum commersonii
sp|P13046|PRR1_TOBAC|PRR1_TOBAC Pathogenesis-related protein R major form p...   139   1e-31   Nicotiana tabacum [American tobacco]
gb:AY353703_1601805 Juniperus rigida PR5 allergen Jun r 3.1 prec...   138   2e-31   
gb:A16782_1447686 osmotin-like protein gene without 20 C- termin...   138   2e-31   
gb:AY353704_1601806 Juniperus rigida PR5 allergen Jun r 3.2 prec...   138   2e-31   
pir|JS0646|JS0646 22K antifungal protein - maize                      138   2e-31   Zea mays [maize]
gb:AF450277_1800793 Solanum nigrum osmotin-like protein (OSML) g...   137   3e-31   
gb:AY737316_1626063 Solanum tuberosum putative thaumatin-like pr...   137   3e-31   
gb:AY737317_1626065 Solanum tuberosum PR-5/321d (PR-5/321d) pseu...   136   6e-31   
gb:AY737310_1626056 Solanum phureja osmotin-like protein (OSM-5a...   135   1e-30   
gb:AY548366_1613159 Malus x domestica thamatin-like PR5 mRNA, pa...   135   1e-30   
gb:AF178653_1774722 Vitis riparia thaumatin mRNA, complete cds.       135   1e-30   
gb:AY262059_1593670 Capsicum annuum osmotin-like protein (OSM1) ...   135   1e-30   
gb:AB031870_1518643 Cestrum elegans CETLP mRNA for thaumatin-lik...   135   1e-30   
sp|P07052|PRR2_TOBAC|PRR2_TOBAC Pathogenesis-related protein R minor form p...   135   1e-30   Nicotiana tabacum [American tobacco]
gb:AF376058_1792996 Petunia x hybrida osmotin (OSM) mRNA, comple...   135   2e-30   
gb:ASU57787_1542620 Avena sativa permatin precursor mRNA, comple...   134   2e-30   
gb:AY353706_1601808 Cupressus sempervirens PR5 allergen Cup s 3....   134   3e-30   
gb:AY353705_1601807 Cupressus sempervirens PR5 allergen Cup s 3....   134   3e-30   
gb:AY257487_1593252 Lycopersicon esculentum PR5-like protein mRN...   134   3e-30   
sp|P13867|IAAT_MAIZE|IAAT_MAIZE Alpha-amylase/trypsin inhibitor (Antifungal...   134   3e-30   Zea mays [maize]
gb:AF355457_1790705 Hordeum vulgare thaumatin-like protein TLP7 ...   134   4e-30   
gb:CAR294411_1645223 Cupressus arizonica partial mRNA for Cup a ...   134   4e-30   
pir|S28001|S28001 osmotin-like protein TPM1 precursor - tomato (...   134   4e-30   Solanum lycopersicum
sp|Q01591|TPM1_LYCES|TPM1_LYCES Osmotin-like protein TPM-1 precursor (PR P2...   134   4e-30   Solanum lycopersicum
gb:AY737313_1626060 Solanum tuberosum osmotin-like protein (OSM-...   133   5e-30   
gb:AY737310_1626055 Solanum phureja osmotin-like protein (OSM-5a...   133   5e-30   
gb:AB121785_1528020 Nicotiana tabacum PR-5dB mRNA for pathogenes...   133   5e-30   
sp|P50703|OS35_SOLCO|OS35_SOLCO Osmotin-like protein OSML15 precursor (PA15...   133   5e-30   Solanum commersonii
sp|P50701|OS13_SOLCO|OS13_SOLCO Osmotin-like protein OSML13 precursor (PA13...   133   5e-30   Solanum commersonii
gb:AY839295_1630499 Hordeum vulgare thaumatin-like protein TLP5 ...   133   6e-30   
gb:AB029918_1518391 Nicotiana tabacum SE39b gene for pistil tran...   133   6e-30   
sp|P25871|OLPA_TOBAC|OLPA_TOBAC Osmotin-like protein precursor (Pathogenesi...   133   6e-30   Nicotiana tabacum [American tobacco]
gb:AF532965_1809438 Vitis vinifera thaumatin-like protein (Tl3) ...   132   8e-30   
gb:AF355456_1790704 Hordeum vulgare thaumatin-like protein TLP6 ...   132   8e-30   
gb:AC137991_1743851 Oryza sativa chromosome 3 BAC OSJNBa0034D21 ...   132   1e-29   
gb:AB121784_1528019 Nicotiana tabacum PR-5dA mRNA for pathogenes...   132   1e-29   
gb:AX008565_1456280 Sequence 2 from Patent WO9966057.                 132   1e-29   
gb:VVOSM1_1727543 V.vinifera mRNA for osmotin-like protein.           131   2e-29   
pir|T04927|T04927 probable serine/threonine-specific protein kin...   131   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AF473702_1803094 Solanum nigrum osmotin-like protein gene, co...   130   3e-29   
gb:AF450276_1800792 Solanum nigrum osmotin-like protein precurso...   130   3e-29   
gb:AF442967_1800291 Triticum aestivum clone WAS-3a thaumatin-lik...   130   3e-29   
gb:AF227324_1778836 Vitis vinifera thaumatin-like protein gene, ...   130   3e-29   
gb:AF016327_1761500 Hordeum vulgare Barperm1 (perm1) mRNA, parti...   130   3e-29   
gb:LES277064_1684530 Lycopersicon esculentum PR-5 gene for patho...   130   3e-29   
gb:LEPRPA_1684412 L.esculentum pr p23 mRNA for pathogenesis-rela...   130   3e-29   
pir|T04370|T04370 perm1 protein - barley (fragment)                   130   3e-29   Hordeum vulgare [barley]
pir|PQ0742|S31829 pathogenesis-related protein P23 precursor - t...   130   3e-29   
gb:AJ853476_1814922 Nicotiana glauca mRNA for putative osmotin-l...   130   4e-29   
gb:TOBNP5O_1725454 Nicotiana sylvestris DNA for neutral PR-5 (os...   130   4e-29   
gb:NTOSMOTIN_1691660 N.tabacum mRNA for osmotin.                      130   4e-29   
gb:AY737315_1626062 Solanum tuberosum putative thaumatin-like pr...   130   4e-29   
gb:BT010137_1640203 Arabidopsis thaliana At4g11650 gene, complet...   129   1e-28   
gb:AY743928_1626548 Solanum phureja osmotin-like protein A13 mRN...   129   1e-28   
gb:A15677_1447629 proprothaumatine and the coding stand of its s...   128   2e-28   
sp|P02884|THM2_THADA|THM2_THADA Thaumatin II precursor.>pir|A03378|QTTC2 th...   128   2e-28   Thaumatococcus daniellii [katemfe]
gb:AF516207_1807491 Chenopodium quinoa osmotin-like protein 4 (o...   128   2e-28   
gb:CAN297410_1645073 Capsicum annuum mRNA for osmotin-like prote...   128   2e-28   
gb:A15675_1447628 proprothaumatine and the coding strand of its ...   128   2e-28   
gb:A15660_1447625 Mature thaumatin.                                   128   2e-28   
sp|P50700|OSL3_ARATH|OSL3_ARATH Osmotin-like protein OSM34 precursor.>pir|T...   127   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AF378574_1793403 Sambucus nigra clone VL88 thaumatin-like pro...   127   4e-28   
gb:AF378571_1793400 Sambucus nigra clone VBL85 thaumatin-like pr...   127   4e-28   
gb:A46806_1449315 Sequence 3 from Patent EP0684312.                   127   4e-28   
gb:AF003007_1760630 Vitis vinifera thaumatin-like protein VVTL1 ...   127   5e-28   
gb:VVI237999_1727514 Vitis vinifera mRNA for thaumatin-like prot...   127   5e-28   
sp|P25096|P21_SOYBN|P21_SOYBN P21 protein.>pir|A33176|A33176 P21 protein -...   127   5e-28   Glycine max [soybeans]
gb:AY085200_1570279 Arabidopsis thaliana clone 13796 mRNA, compl...   126   6e-28   
gb:ATRNAOSM_1554068 A.thaliana mRNA for osmotin protein.              126   6e-28   
gb:AY485229_1608448 Brassica juncea putative osmotin-like protei...   126   8e-28   
pir|S34794|S34794 osmotin - common tobacco                            126   8e-28   Nicotiana tabacum [American tobacco]
gb:SYNTHAUMA_2153759 Synthetic thaumatin gene, complete cds.          125   2e-27   
gb:AF294847_1783921 Capsicum annuum clone GC167 PR5-like protein...   125   2e-27   
sp|P02883|THM1_THADA|THM1_THADA Thaumatin I.>pir|A03377|QTTC1 thaumatin I [...   125   2e-27   Thaumatococcus daniellii [katemfe]
gb:AF355098_1790696 Thaumatococcus daniellii thaumatin I mRNA, p...   124   2e-27   
gb:TOBOSM_1725473 N.tabacum osmotin mRNA, complete cds.               124   2e-27   
gb:AY737312_1626058 Solanum tuberosum osmotin-like protein (OSM-...   124   3e-27   
gb:A46810_1449317 Sequence 7 from Patent EP0684312.                   124   3e-27   
pir|T05973|T05973 permatin homolog PR5 - barley>gb:HVPATHPR5_168...   123   5e-27   Hordeum vulgare [barley]
gb:AF364864_1791606 Helianthus annuus pathogenesis-related prote...   123   7e-27   
pir|E96725|E96725 hypothetical protein F20P5.3 [imported] - Arab...   123   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AF378572_1793401 Sambucus nigra clone VL79 thaumatin-like pro...   122   1e-26   
gb:A46804_1449314 Sequence 1 from Patent EP0684312.                   122   1e-26   
gb:AY256429_1593154 Solanum tuberosum cultivar Yellow Finn osmot...   121   2e-26   
gb:AF378573_1793402 Sambucus nigra clone VL85 thaumatin-like pro...   120   3e-26   
gb:AY256439_1593164 Solanum tuberosum cultivar Atlantic osmotin ...   120   3e-26   
gb:AY737314_1626061 Solanum tuberosum osmotin-like protein (OSM-...   120   4e-26   
gb:AJ871175_1815102 Actinidia deliciosa partial mRNA for thaumat...   120   6e-26   
gb:AF294846_1783920 Capsicum annuum clone GC168 PR5-like protein...   119   7e-26   
gb:AF548358_1810722 Solanum gilo osmotin-like protein precursor ...   119   1e-25   
gb:AF548357_1810721 Solanum gilo thaumatin-like protein (TLP) ge...   119   1e-25   
gb:AF199508_1776448 Fragaria x ananassa osmotin-like protein (ol...   119   1e-25   
gb:A46808_1449316 Sequence 5 from Patent EP0684312.                   119   1e-25   
gb:RIC14B_1703498 Oryza sativa (clone 14b) osmotin protein (14b)...   118   2e-25   
pir|T03287|T03287 osmotin protein homolog - rice (fragment)           118   2e-25   Oryza sativa [red rice]
gb:AC137991_1743852 Oryza sativa chromosome 3 BAC OSJNBa0034D21 ...   117   4e-25   
gb:AY256441_1593166 Solanum tuberosum cultivar 24-3 osmotin 81 g...   117   4e-25   
gb:OSU77656_1698517 Oryza sativa pathogenesis-related thaumatin-...   116   6e-25   
pir|T04165|T04165 pathogenesis-related thaumatin-like protein - ...   116   6e-25   Oryza sativa [red rice]
gb:ATPPA9A_1553877 Atriplex nummularia osmotin-like protein (pA9...   115   2e-24   
gb:F25A4_1678011 Arabidopsis thaliana chromosome 1 BAC F25A4 seq...   114   2e-24   
gb:AY256437_1593162 Solanum tuberosum cultivar Snowchip osmotin ...   114   3e-24   
gb:AY766059_1627605 Theobroma cacao osmotin-like (osm1) gene, pa...   114   4e-24   
gb:AY256440_1593165 Solanum tuberosum cultivar Iditared osmotin ...   114   4e-24   
gb:AY256436_1593161 Solanum tuberosum cultivar Peanut osmotin 81...   113   5e-24   
gb:BVU309172_1643193 Beta vulgaris mRNA for thaumatin like protein.   113   7e-24   
gb:AY256431_1593156 Solanum tuberosum cultivar Idarose osmotin 8...   113   7e-24   
gb:AY256428_1593153 Solanum tuberosum cultivar Yellow Finn osmot...   113   7e-24   
gb:VVI237998_1727513 Vitis vinifera mRNA for putative thaumatin-...   112   2e-23   
gb:AY256434_1593159 Solanum tuberosum cultivar Andover osmotin 8...   112   2e-23   
gb:AY256430_1593155 Solanum tuberosum cultivar Norkotah osmotin ...   112   2e-23   
gb:AY256427_1593152 Solanum tuberosum cultivar All Blue osmotin ...   112   2e-23   
gb:AY256426_1593151 Solanum tuberosum cultivar German Butterball...   112   2e-23   
gb:AY256425_1593150 Solanum tuberosum cultivar Kennebec osmotin ...   112   2e-23   
gb:AY256435_1593160 Solanum tuberosum cultivar AK 114 osmotin 81...   109   8e-23   
gb:AJ586518_1811834 Fagus sylvatica partial tau1 mRNA for taumatin.   109   1e-22   
gb:AY256433_1593158 Solanum tuberosum cultivar Gold Rush osmotin...   108   1e-22   
gb:AP003219_1825464 Oryza sativa (japonica cultivar-group) genom...   108   2e-22   
gb:AE017345_1756672 Cryptococcus neoformans var. neoformans JEC2...   108   2e-22   
gb:BX842641_1644205 Neurospora crassa DNA linkage group I BAC co...   108   2e-22   
gb:AY256438_1593163 Solanum tuberosum cultivar Highlat Russet os...   107   3e-22   
gb:AC024839_1204919 Caenorhabditis elegans cosmid Y59E9AR, compl...   107   3e-22   
gb:AY256432_1593157 Solanum tuberosum cultivar Yukon Gold osmoti...   106   6e-22   
gb:AY589699_1616579 Mirabilis jalapa clone FS-87 thaumatin-like ...   105   2e-21   
gb:AY398665_1605115 Solanum tuberosum cultivar Green Mountain os...   105   2e-21   
gb:AY204864_1589118 Solanum tuberosum cultivar Alaska Frostless ...   104   2e-21   
gb:AF001528_1760548 Musa acuminata ripening-associated protein m...   103   5e-21   
gb:AY204870_1589124 Solanum tuberosum cultivar 24-3 osmotin-like...   102   1e-20   
gb:AY204872_1589126 Solanum tuberosum cultivar German Butterball...   102   2e-20   
gb:AY204871_1589125 Solanum tuberosum cultivar All Blue osmotin-...   102   2e-20   
gb:CQ827170_1453682 Sequence 1 from Patent WO2004050696.              100   8e-20   
gb:AY204863_1589117 Solanum tuberosum cultivar Gold Rush osmotin...    98   3e-19   
sp|P27357|TLP_WHEAT|TLP_WHEAT Thaumatin-like protein PWIR2 precursor.>pir|...    98   3e-19   Triticum aestivum [Canadian hard winter wheat]
sp|P32938|PR1C_HORVU|PR1C_HORVU Pathogenesis-related protein 1C precursor.>...    98   3e-19   Hordeum vulgare [barley]
sp|P32937|PR1A_HORVU|PR1A_HORVU Pathogenesis-related protein 1A/1B precurso...    98   3e-19   Hordeum vulgare [barley]
gb:FSY298303_1679410 Fagus sylvatica partial olp gene for osmoti...    97   4e-19   
gb:AY204860_1589114 Solanum tuberosum cultivar AK 114 osmotin-li...    97   4e-19   
sp|P50695|RST1_AVESA|RST1_AVESA Thaumatin-like pathogenesis-related protein...    97   5e-19   Avena sativa [cultivated oat]
gb:AY204869_1589123 Solanum tuberosum cultivar Yellow Finn osmot...    96   9e-19   
sp|P50697|RST3_AVESA|RST3_AVESA Thaumatin-like pathogenesis-related protein...    96   9e-19   Avena sativa [cultivated oat]
gb:AF096927_1767846 Secale cereale thaumatin-like protein 1 prec...    96   1e-18   
gb:AF384146_1794192 Triticum aestivum thaumatin-like protein mRN...    96   1e-18   
sp|P50696|RST2_AVESA|RST2_AVESA Thaumatin-like pathogenesis-related protein...    95   2e-18   Avena sativa [cultivated oat]
gb:AF100142_1768087 Secale cereale thaumatin-like protein 4 prec...    94   4e-18   
gb:AF389883_1795169 Triticum aestivum thaumatin-like protein 1 g...    92   1e-17   
pir|T05492|T05492 thaumatin homolog T19K4.130 - Arabidopsis thal...    92   1e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T06790|T06790 thaumatin-like protein precursor - wheat>gb:TA...    91   4e-17   Triticum aestivum [Canadian hard winter wheat]
gb:AC006434_1534204 Genomic sequence for Arabidopsis thaliana BA...    90   6e-17   
gb:AF045608_1763833 Citrus sinensis osmotin mRNA, partial cds.         89   1e-16   
pir|T08097|T08097 osmotin - sweet orange (fragment)                    89   1e-16   Citrus sinensis [apfelsine]
gb:QSAJ692_1703213 Quercus suber mRNA for an osmotin-like protein.     87   4e-16   
gb:AY500845_1609729 Pinus monticola thaumatin-like protein mRNA,...    87   4e-16   
gb:AY204861_1589115 Solanum tuberosum cultivar Bake King osmotin...    87   4e-16   
gb:ATPPA8A_1553876 Atriplex nummularia osmotin-like protein (pA8...    87   4e-16   
gb:AY204866_1589120 Solanum tuberosum cultivar Idarose osmotin-l...    87   5e-16   
gb:FSY298304_1679411 Fagus sylvatica partial olp2 gene for osmot...    87   7e-16   
sp|P31110|TLP_ORYSA|TLP_ORYSA Thaumatin-like protein precursor.>pir|S25551...    87   7e-16   Oryza sativa [red rice]
sp|P50698|RST4_AVESA|RST4_AVESA Thaumatin-like pathogenesis-related protein...    87   7e-16   Avena sativa [cultivated oat]
gb:AF389884_1795170 Triticum aestivum thaumatin-like protein 2 g...    86   9e-16   
pir|T02055|T02055 pathogenesis related protein-5 - maize>gb:ZMU8...    86   9e-16   Zea mays [maize]
gb:AY204867_1589121 Solanum tuberosum cultivar Nordonna osmotin-...    86   1e-15   
gb:AX191255_1463658 Sequence 37 from Patent WO0149843.                 83   8e-15   
gb:QRO298305_1703205 Quercus robur partial olp gene for osmotin-...    83   1e-14   
gb:AY204865_1589119 Solanum tuberosum cultivar Yukon Gold osmoti...    83   1e-14   
gb:AY204862_1589116 Solanum tuberosum cultivar Cal White osmotin...    82   2e-14   
gb:AE017346_1757197 Cryptococcus neoformans var. neoformans JEC2...    81   3e-14   
gb:AY204873_1589127 Solanum tuberosum cultivar Kennebec osmotin-...    81   3e-14   
gb:AF453407_1800959 Glomerella cingulata PR5-like protein gene, ...    80   5e-14   
gb:AY462134_1607537 Cucumis melo thaumatin-like protein precurso...    80   5e-14   
gb:CAR010502_1645120 Cicer arietinum L. mRNA for thaumatin-like ...    80   6e-14   
gb:AF355455_1790703 Hordeum vulgare thaumatin-like protein TLP4 ...    78   2e-13   
gb:AP004090_1837538 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AY839294_1630498 Hordeum vulgare thaumatin-like protein TLP3 ...    72   2e-11   
gb:AY589711_1616585 Mirabilis jalapa clone FS-82 thaumatin-like ...    67   4e-10   
gb:AY204868_1589122 Solanum tuberosum cultivar Norkotah osmotin-...    66   1e-09   
gb:AF528179_1808545 Brassica rapa subsp. pekinensis thaumatin-li...    65   3e-09   
gb:AE016959_1023523 Oryza sativa (japonica cultivar-group) chrom...    63   8e-09   
pir|G84640|G84640 hypothetical protein At2g24810 [imported] - Ar...    61   4e-08   
pir|G28027|G28027 protein P10 - curled-leaved tobacco (fragment)       60   9e-08   
gb:AP005846_1858997 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AF151428_1772627 Juniperus virginiana pollen allergen 3-2 mRN...    51   3e-05   
gb:AP003829_1833941 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AF466646_1802307 Zea mays clone ZMMBBb_Z195D10 putative trans...    49   1e-04   
gb:AY863026_1354251 Diaprepes abbreviatus PR-5-like protein (pr-...    47   8e-04   
sp|P47179|DAN4_YEAST|DAN4_YEAST Cell wall protein DAN4 precursor.>pir|S5718...    42   0.019   
gb:HSA298317_2003038 Homo sapiens partial mRNA for mucin 5 (MUC5...    41   0.043   
gb:AE014134_1127553 Drosophila melanogaster chromosome 2L, compl...    38   0.28    
gb:AK117896_1815904 Arabidopsis thaliana mRNA for unknown protei...    37   0.63    
gb:AF399706_1796012 Spartina anglica osmotin-like protein mRNA, ...    36   1.1     
gb:AY605181_1502522 Burkholderia cepacia complex phage BcepC6B, ...    36   1.4     
gb:AF457585_1801393 Cicer arietinum PR-5-thaumatin-like protein ...    35   1.8     
gb:CR382127_1660316 Yarrowia lipolytica chromosome A of strain C...    35   1.8     
gb:AE017261_419035 Picrophilus torridus DSM 9790, complete genome.     35   3.1     
pir|JC7958|JC7958 galaxin precursor - reef coral>gb:AB086183_119...    34   4.1     


>sp|Q41350|OLP1_LYCES Osmotin-like protein
           precursor.>pir|JC5237|JC5237 osmotin-like protein
           precursor - tomato>gb:TOMOLP_1725672 Lycopersicon
           esculentum osmotin-like protein mRNA, complete cds.
          Length = 252

 Score =  379 bits (973), Expect = e-104
 Identities = 174/256 (67%), Positives = 205/256 (80%)
 Frame = -1

Query: 956 MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF 777
           MA +    +L ++L  +L + + ++ P   I+T+VNNCP+TIWPAIQPN G+PVLERGGF
Sbjct: 1   MASSSAKILLPLSLLFTLLSLSQSTNP-NFILTLVNNCPYTIWPAIQPNAGHPVLERGGF 59

Query: 776 ALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQ 597
            L+ LTHRSF AP A WSGRIWARTGC   HG+F CATGDC GR+EC+G GGAAPATLAQ
Sbjct: 60  TLHSLTHRSFPAPNAHWSGRIWARTGCNYQHGKFYCATGDCGGRIECDGLGGAAPATLAQ 119

Query: 596 FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRAR 417
           F LH GHADFSTYG+SLVDGFN+P+T+TPH+GK  CPVVGCRANLL +CP  LQ   R+ 
Sbjct: 120 FVLHHGHADFSTYGVSLVDGFNIPLTVTPHEGKGVCPVVGCRANLLESCPAVLQ--FRSH 177

Query: 416 RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL 237
            G GPVVGC S C AFK+DE CCRN+YN+P  CK S YS FFKHACP+TFTYAHD+P SL
Sbjct: 178 GGHGPVVGCKSACEAFKSDEFCCRNHYNSPQTCKPSSYSQFFKHACPATFTYAHDSP-SL 236

Query: 236 MHECSAARELKIIFCH 189
           MHECS+ RELK+IFCH
Sbjct: 237 MHECSSPRELKVIFCH 252



>gb:AF175270_1774488 Benincasa hispida osmotin-like protein (olp)
           gene, complete cds.
          Length = 248

 Score =  348 bits (894), Expect = 7e-95
 Identities = 163/249 (65%), Positives = 191/249 (76%), Gaps = 1/249 (0%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAG-LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH 756
           I+ +   +SL + + A+ P G LI+T+VNNCP+ IWPAIQPN G+PV ERGGF L  L+H
Sbjct: 3   IVFLLALLSLSSLSEATYPGGGLILTLVNNCPYPIWPAIQPNAGHPVPERGGFFLPSLSH 62

Query: 755 RSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH 576
           RSF AP   WSGR+WARTGCV +    TC TGDC G+LECNG GG  PATLAQF LH GH
Sbjct: 63  RSFPAPYQHWSGRVWARTGCVGDLNYLTCQTGDCGGKLECNGAGGKTPATLAQFSLHHGH 122

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
            DFS+YG+SLVDGFN+P+T+TPH+G   CPVVGC+ANLL  CPR+LQV    R G+  V+
Sbjct: 123 KDFSSYGVSLVDGFNIPLTITPHEGHGVCPVVGCKANLLQTCPRELQVHAPQRYGQ--VI 180

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
            C SGC AF TD LCCR +YN+P  CKAS  S FFKHACPSTFTYAHDTP SLMHEC+A 
Sbjct: 181 ACKSGCEAFNTDALCCRGHYNSPQTCKASSCSLFFKHACPSTFTYAHDTP-SLMHECAAP 239

Query: 215 RELKIIFCH 189
           RELK+IFCH
Sbjct: 240 RELKVIFCH 248



>gb:AY086000_1571061 Arabidopsis thaliana clone 2058 mRNA, complete
           sequence.
          Length = 249

 Score =  334 bits (856), Expect = 2e-90
 Identities = 154/243 (63%), Positives = 188/243 (77%), Gaps = 1/243 (0%)
 Frame = -1

Query: 914 FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR 735
           F+ L +F++A   + L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF  P 
Sbjct: 12  FLLLISFSSAVDTSRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFNVPT 71

Query: 734 ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY 558
             WSGRIWART C   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct: 72  THWSGRIWARTWCAHYNGKFSCLTGDCGNRLECNGLGGAPPASLAQFDLHHGGHHDFSSY 131

Query: 557 GLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
           G+SLVDG+N+PMT+TPH+G   CPVVGCR +L+  CP  LQVR  +    G VV C SGC
Sbjct: 132 GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLIKTCPAHLQVRSHS----GHVVACKSGC 187

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
            AF TDELCCR +YN+P  CKAS +S FFKHACPS+FT+AHD+P SLMH+C++ RELK+I
Sbjct: 188 EAFHTDELCCRGHYNSPNTCKASSHSLFFKHACPSSFTFAHDSP-SLMHDCASPRELKVI 246

Query: 197 FCH 189
           FCH
Sbjct: 247 FCH 249



>pir|H84688|H84688 probable thaumatin [imported] - Arabidopsis
           thaliana>gb:AC005727_1532969 Arabidopsis thaliana
           chromosome 2 clone F8N16 map mi54, complete
           sequence.>gb:BT006222_1639114 Arabidopsis thaliana
           At2g28790 gene, complete cds.>gb:AF355806_1790723
           Arabidopsis thaliana thaumatin-like cytokinin binding
           protein (CBP1) mRNA, complete cds.>gb:AK118499_1816472
           Arabidopsis thaliana At2g28790 mRNA for putative
           thaumatin, complete cds, clone: RAFL19-73-G08.
          Length = 249

 Score =  334 bits (856), Expect = 2e-90
 Identities = 154/243 (63%), Positives = 188/243 (77%), Gaps = 1/243 (0%)
 Frame = -1

Query: 914 FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR 735
           F+ L +F++A   + L +T+VNNCP T+WPAIQPN G+PVLE+GGFAL   THRSF  P 
Sbjct: 12  FLLLISFSSAVDTSRLFLTVVNNCPFTVWPAIQPNAGHPVLEKGGFALPTFTHRSFNVPT 71

Query: 734 ARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTY 558
             WSGRIWART C   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH DFS+Y
Sbjct: 72  THWSGRIWARTWCAHYNGKFSCLTGDCGNRLECNGLGGAPPASLAQFDLHHGGHHDFSSY 131

Query: 557 GLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
           G+SLVDG+N+PMT+TPH+G   CPVVGCR +L+  CP  LQVR  +    G VV C SGC
Sbjct: 132 GVSLVDGYNVPMTVTPHEGHGVCPVVGCREDLIKTCPAHLQVRSHS----GHVVACKSGC 187

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
            AF TDELCCR +YN+P  CKAS +S FFKHACPS+FT+AHD+P SLMH+C++ RELK+I
Sbjct: 188 EAFHTDELCCRGHYNSPNTCKASSHSLFFKHACPSSFTFAHDSP-SLMHDCASPRELKVI 246

Query: 197 FCH 189
           FCH
Sbjct: 247 FCH 249



>gb:AF355805_1790722 Brassica oleracea thaumatin-like
           cytokinin-binding protein (CBP1) mRNA, complete cds.
          Length = 250

 Score =  332 bits (852), Expect = 6e-90
 Identities = 155/244 (63%), Positives = 187/244 (76%), Gaps = 2/244 (0%)
 Frame = -1

Query: 914 FISLCAFTTASLPAG-LIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           F+ L   + A+  AG L +T+VN+CP T+WPAIQPN G+PVLE+GGFAL   THRSF  P
Sbjct: 12  FLLLLISSAAAADAGRLFLTVVNHCPFTVWPAIQPNAGHPVLEKGGFALPTNTHRSFFPP 71

Query: 737 RARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFST 561
              WSGRIW RTGC   +G+F+C TGDC  RLECNG GGA PA+LAQF+LH  GH D S+
Sbjct: 72  STHWSGRIWGRTGCSHYNGKFSCVTGDCGHRLECNGLGGATPASLAQFDLHHGGHQDLSS 131

Query: 560 YGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG 381
           YG+SLVDGFN+PMT+TPH+G+  CPVVGCR +LL  CP  LQ+R       G VV C SG
Sbjct: 132 YGVSLVDGFNVPMTVTPHEGRGVCPVVGCREDLLKTCPAHLQLRSHG----GHVVACKSG 187

Query: 380 CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI 201
           C AF+TDELCCRN+YN+P  C+AS +S FFKHACPST T+AHD+P SLMH+CS+ RELK+
Sbjct: 188 CEAFRTDELCCRNHYNSPQTCRASSHSLFFKHACPSTMTFAHDSP-SLMHDCSSPRELKV 246

Query: 200 IFCH 189
           IFCH
Sbjct: 247 IFCH 250



>gb:AP003231_1825793 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0031D11.>gb:AP003241_1826061 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0408C03.
          Length = 247

 Score =  303 bits (775), Expect = 5e-81
 Identities = 145/254 (57%), Positives = 180/254 (70%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL 771
           MA    +L V   +  C    A   A + +TIVNNCP+ +WP IQ N+G+ VLE GGF L
Sbjct: 1   MASAKLLLLVATSLLSCGVILADY-APMTLTIVNNCPYPVWPGIQANSGHDVLEGGGFFL 59

Query: 770 YKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFE 591
             L+HRSF AP   WSGRIWARTGC     +  CATGDC GRL+C G GGAAPATLAQ  
Sbjct: 60  PALSHRSFAAPAHPWSGRIWARTGCTGAGAQLHCATGDCGGRLQCAGLGGAAPATLAQVS 119

Query: 590 LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRG 411
           LH G+ D ++YG+S+VDGFN+ +++TPH+G+ +CPV+ CR NL   CP +LQ+R  A   
Sbjct: 120 LHHGN-DQTSYGVSVVDGFNVGLSVTPHEGRGNCPVLACRKNLTETCPSELQLRTPA--- 175

Query: 410 RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH 231
            G VV C SGC AF+TDELCCRN YN+P  C++S+YS+FFK  CP  FTYAHD+P SL H
Sbjct: 176 -GSVVACKSGCEAFRTDELCCRNMYNSPRTCRSSKYSEFFKRECPQAFTYAHDSP-SLTH 233

Query: 230 ECSAARELKIIFCH 189
           EC+A RELK+IFCH
Sbjct: 234 ECAAPRELKVIFCH 247



>gb:AY664413_1620605 Zea mays cultivar B73 locus 9002, complete
           sequence.
          Length = 288

 Score =  202 bits (515), Expect = 7e-51
 Identities = 110/272 (40%), Positives = 147/272 (54%), Gaps = 8/272 (2%)
 Frame = -1

Query: 983 YIATTSTEQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTG 804
           Y A T++      F   ++++  F++  A     L   ++  + N CP  +WPA  PNTG
Sbjct: 6   YSAWTTSAARHRVFSCALMALVSFVA--AGRPMVLADAIVFHVANRCPFPVWPASAPNTG 63

Query: 803 YPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH---GRFTCATGDCDGRLECN 633
           +PVL  GGF + +   R  VAP A W+GR WARTGC       G   C TGDC+GRL CN
Sbjct: 64  HPVLAGGGFYVPQGKSRRVVAP-ANWNGRFWARTGCNFTANGMGVAGCLTGDCEGRLACN 122

Query: 632 GRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT--PHDG---KEHCPVVGCRA 468
           G  GA PATL +  LH+     S+Y +SLVDG+NLP+ ++  P  G      C + GC  
Sbjct: 123 GSVGAPPATLVEVSLHEDAPKGSSYDVSLVDGYNLPVAVSAKPATGGADPNKCAIAGCAK 182

Query: 467 NLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFK 288
           N+   CP +LQV      G   VV C S C AF  D  CCR  Y  P  C+ + YS  FK
Sbjct: 183 NVNAVCPPELQVTATGSGGGKTVVACKSACLAFGLDAFCCRGAYATPATCRGTVYSRLFK 242

Query: 287 HACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            ACP+ ++YA+DT ++    C  A+E  I FC
Sbjct: 243 DACPAYYSYAYDTAATTASGC-YAQEYIITFC 273



>gb:AY664417_1620643 Zea mays cultivar Mo17 locus 9002, complete
           sequence.
          Length = 289

 Score =  202 bits (513), Expect = 1e-50
 Identities = 111/273 (40%), Positives = 149/273 (54%), Gaps = 9/273 (3%)
 Frame = -1

Query: 983 YIATTSTEQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTG 804
           Y A T++      F   ++++  F++  A     L   ++  + N CP  +WPA  PNTG
Sbjct: 6   YSAWTTSAARHRVFSCALMALVSFVA--AGRPIVLADAIVFHVANRCPFPVWPASAPNTG 63

Query: 803 YPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH---GRFTCATGDCDGRLECN 633
           +PVL  GGF + +   R  VAP A W+GR WARTGC       G   C TGDC+GRL CN
Sbjct: 64  HPVLAGGGFYVPQGKSRRVVAP-ANWNGRFWARTGCNFTANGMGVAGCLTGDCEGRLACN 122

Query: 632 GRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT--PHDG---KEHCPVVGCRA 468
           G  GA PATL +  LH+  A  S+Y +SLVDG+NLP+ ++  P  G      C + GC  
Sbjct: 123 GSVGAPPATLVEVSLHEDAAKGSSYDVSLVDGYNLPVAVSAKPATGGADPNKCAIAGCAK 182

Query: 467 NLLPACPRQLQVRLRARRGRG-PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFF 291
           N+   CP +LQV      G G  VV C S C AF  D  CCR  Y  P  C+ + YS  F
Sbjct: 183 NVNAVCPPELQVTATGSGGGGKTVVACKSACLAFGLDAFCCRGAYATPATCRGTVYSRLF 242

Query: 290 KHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           K ACP+ ++YA+DT ++    C  A+E  + FC
Sbjct: 243 KDACPAYYSYAYDTAAATASGC-YAQEYIMTFC 274



>gb:AB010077_1511032 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MYH19.>gb:BT010875_1640821 Arabidopsis thaliana
           At5g40020 gene, complete cds.
          Length = 256

 Score =  198 bits (503), Expect = 2e-49
 Identities = 108/254 (42%), Positives = 137/254 (53%), Gaps = 1/254 (0%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL 771
           M F +T L     IS C          +   + N C   IWPA+ PN+G+PVL  GGF L
Sbjct: 1   MKFQSTSLLQLFIISSCIVYGKVTSHEVTFYVQNKCSFPIWPAVAPNSGHPVLASGGFYL 60

Query: 770 YKLTHRSFVAPRARWSGRIWARTGC-VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQF 594
                +   AP   WSGRIWARTGC   ++ +  C TGDCDG LECNG  G  PATL Q 
Sbjct: 61  PCGGIKRIDAPLG-WSGRIWARTGCDFTSNSKQACETGDCDGHLECNGLIGKPPATLIQI 119

Query: 593 ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARR 414
            +    +  + Y +SLVDG+NLP+ +        C ++GC  +L   CP +LQV      
Sbjct: 120 AVQADKSKPNFYDVSLVDGYNLPVVVNSKPVSSKCTILGCHKDLKTTCPEELQV----LN 175

Query: 413 GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM 234
             G VV C S C AF  D  CCRN Y  P  CK + YS  FK ACP+ ++YA++TP  L+
Sbjct: 176 EEGRVVACKSACLAFDNDRFCCRNAYGTPEKCKRNTYSMLFKEACPNYYSYAYETPPPLV 235

Query: 233 HECSAARELKIIFC 192
             CS A+E  I FC
Sbjct: 236 -TCS-AKEYLITFC 247



>gb:AP003935_1835519 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0661G04.>gb:AP005457_1852168 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0532H03.
          Length = 251

 Score =  194 bits (492), Expect = 3e-48
 Identities = 100/226 (44%), Positives = 128/226 (56%), Gaps = 2/226 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           + + N C  T+WP IQP+ G  +L RGGF L      S   P A WSGR+W R GC  + 
Sbjct: 26  LALYNRCAETVWPGIQPSAGKELLARGGFQLAPNRATSIRLP-AGWSGRVWGRQGCSFDA 84

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR  CATGDC G L CNG GGA PATLA+  L    A    Y +SLVDG+N+P+ +TP 
Sbjct: 85  AGRGRCATGDCGGALYCNGAGGAPPATLAEITLASTPAAQDFYDVSLVDGYNIPIAMTPS 144

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
           H    +C   GC ++L   CP  L V  R   G   VVGC S CAA+   + CC   + +
Sbjct: 145 HGSGANCVPAGCISDLNRVCPAGLAV--RGGGGDNRVVGCRSACAAYGAPQYCCTGQFGS 202

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           P  CK + YS  FK ACP  ++YA+D P+S++  CSA     + FC
Sbjct: 203 PQQCKPTAYSRLFKTACPKAYSYAYDDPTSIL-TCSAGASYIVTFC 247



>pir|G96806|G96806 thaumatin-like protein, 12104-13574 [imported] -
           Arabidopsis thaliana>gb:AE005173_895292 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012193_1537551 Arabidopsis thaliana
           chromosome 1 BAC T32E8 genomic sequence, complete
           sequence.
          Length = 356

 Score =  192 bits (487), Expect = 1e-47
 Identities = 103/226 (45%), Positives = 135/226 (59%), Gaps = 1/226 (0%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           + TI+N+C  TIWPAI P   +     GGF L       F AP   WSGRIW RTGC  +
Sbjct: 90  VFTIINSCDQTIWPAITPGENF---NGGGFELKPGQSIVFHAP-VGWSGRIWGRTGCKFD 145

Query: 686 H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
             G  TC TG C   L+C+   G  PA+LA+F L    A    Y +SLVDGFNLPM++TP
Sbjct: 146 STGTGTCETGSCGSTLKCSA-SGKPPASLAEFTL----AALDFYDVSLVDGFNLPMSVTP 200

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
            +GK +C V GC A+L P CP++L V+       G V+ C S C  F  DE CCR  Y N
Sbjct: 201 MNGKGNCSVAGCVADLRPHCPQELAVK-----SNGKVISCRSACDVFDRDEYCCRGVYGN 255

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           P++C+ + YS  FK ACP+ ++YA+D P+S+M  C+A+ +  I FC
Sbjct: 256 PVVCQPTYYSKIFKQACPTAYSYAYDDPTSIM-TCTAS-DYVISFC 299



>gb:AE016959_1020925 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074105_1541200
           Oryza sativa chromosome 10 clone OSJNBa0030B02, complete
           sequence.>gb:AE017056_1750744 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 10 of 77 of the
           complete sequence.
          Length = 325

 Score =  189 bits (479), Expect = 1e-46
 Identities = 103/258 (39%), Positives = 138/258 (53%), Gaps = 5/258 (1%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL 771
           M+  ++ L   +F+++     A        TI NNC +T+WP +  + G   L   GFAL
Sbjct: 8   MSSRSSSLLAMVFVAVAVLARAQDERAATFTITNNCAYTVWPGLLSSAGSAPLSTTGFAL 67

Query: 770 YKLTHRSFVAPRARWSGRIWARTGCVLNHG--RFTCATGDC-DGRLECNGRGGAAPATLA 600
                ++  AP   WSGR+W RT C  +    +F+CATGDC  G ++CNG G A PATLA
Sbjct: 68  APGASQAVPAPSG-WSGRMWGRTLCAADGAGAKFSCATGDCGSGDVQCNGGGAAPPATLA 126

Query: 599 QFELHQGHADFSTYGLSLVDGFNLPMTLTPH--DGKEHCPVVGCRANLLPACPRQLQVRL 426
           +F L  G      + +SLVDG+NLPM +TP    G   C   GC A L  ACP  L+V  
Sbjct: 127 EFTL-DGSGGLDFFDVSLVDGYNLPMLVTPSATSGSGKCAATGCVAELNGACPADLRVAS 185

Query: 425 RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP 246
            +    GP V C S C AF + E CC   Y NP  C+ S YS+FFK ACP  ++YA+D  
Sbjct: 186 AS----GPAVACRSACEAFGSAEYCCSGAYGNPNTCRPSAYSEFFKAACPRAYSYAYDDS 241

Query: 245 SSLMHECSAARELKIIFC 192
           +S     + A +  I FC
Sbjct: 242 TSTFTCAAGATDYAITFC 259



>pir|S71175|S71175 thaumatin-like protein - Arabidopsis
           thaliana>gb:ATHTLP_1553429 Arabidopsis thaliana
           thaumatin-like protein mRNA, complete cds.
          Length = 243

 Score =  185 bits (469), Expect = 1e-45
 Identities = 103/246 (41%), Positives = 133/246 (54%), Gaps = 1/246 (0%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF 747
           S+ LF+       +   A  +I   N C H +WP IQP+ G  +L  GGF L      S 
Sbjct: 3   SINLFLYAFLLLLSHASASTVI-FYNKCKHPVWPGIQPSAGQNLLAGGGFKLPANKAHSL 61

Query: 746 VAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHAD 570
             P   WSGR W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L     +
Sbjct: 62  QLPPL-WSGRFWGRHGCTFDRSGRGHCATGDCGGSLSCNGAGGEPPATLAEITLGP---E 117

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
              Y +SLVDG+NL M++ P  G   C   GC ++L   CP  LQVR  +R G+  VV C
Sbjct: 118 LDFYDVSLVDGYNLAMSIMPVKGSGQCTYAGCVSDLNQMCPVGLQVR--SRNGKR-VVAC 174

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
            S C+AF + + CC   + NP  CK + YS  FK ACP  ++YA+D P+S+   CS A  
Sbjct: 175 KSACSAFNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDEPTSIA-TCSKANY 233

Query: 209 LKIIFC 192
           + + FC
Sbjct: 234 I-VTFC 238



>sp|P50699|TLPH_ARATH Thaumatin-like protein precursor.
          Length = 243

 Score =  185 bits (469), Expect = 1e-45
 Identities = 103/246 (41%), Positives = 133/246 (54%), Gaps = 1/246 (0%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF 747
           S+ LF+       +   A  +I   N C H +WP IQP+ G  +L  GGF L      S 
Sbjct: 3   SINLFLFAFLLLLSHASASTVI-FYNKCKHPVWPGIQPSAGQNLLAGGGFKLPANKAHSL 61

Query: 746 VAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHAD 570
             P   WSGR W R GC  +  GR  CATGDC G L CNG GG  PATLA+  L     +
Sbjct: 62  QLPPL-WSGRFWGRHGCTFDRSGRGHCATGDCGGSLSCNGAGGEPPATLAEITLGP---E 117

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
              Y +SLVDG+NL M++ P  G   C   GC ++L   CP  LQVR  +R G+  VV C
Sbjct: 118 LDFYDVSLVDGYNLAMSIMPVKGSGQCSYAGCVSDLNQMCPVGLQVR--SRNGKR-VVAC 174

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
            S C+AF + + CC   + NP  CK + YS  FK ACP  ++YA+D P+S+   CS A  
Sbjct: 175 KSACSAFNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIA-TCSKANY 233

Query: 209 LKIIFC 192
           + + FC
Sbjct: 234 I-VTFC 238



>gb:AP006067_1860844 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0569E11.
          Length = 251

 Score =  182 bits (463), Expect = 7e-45
 Identities = 103/255 (40%), Positives = 132/255 (51%), Gaps = 5/255 (1%)
 Frame = -1

Query: 941 PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           P T+L ++L  +LC             T+ N+C +T+WP +  + G P L   GFAL   
Sbjct: 9   PVTLLLISLSRALCT----------TFTLTNSCAYTVWPGLLSSAGSPPLATTGFALAPG 58

Query: 761 THRSFVAPRARWSGRIWARTGCVLN---HGRFTCATGDC-DGRLECNGRGGAAPATLAQF 594
              +  AP A WSGR+W RT C  +    GRF CATGDC  G +EC G G A PATLA+F
Sbjct: 59  ESLAVDAPAA-WSGRVWGRTLCGADPGGSGRFACATGDCGSGAVECGGGGAAPPATLAEF 117

Query: 593 ELH-QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRAR 417
            L   G  DF  Y +SLVDG NLPM + P  G   C   GC  +L   CP  L+V     
Sbjct: 118 TLDGAGGNDF--YDVSLVDGSNLPMVVVPQGGGAACGATGCLVDLNGPCPADLKVA---- 171

Query: 416 RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL 237
              G  + C S C AF T E CC   +  P  C+ S YS FFK+ACP  ++YA+D  +S 
Sbjct: 172 GADGAGIACRSACEAFGTPEYCCNGAFGTPATCRPSAYSQFFKNACPRAYSYAYDDATST 231

Query: 236 MHECSAARELKIIFC 192
               S      ++FC
Sbjct: 232 FTCASGTASYLVVFC 246



>gb:AY863029_1354254 Toxoptera citricida PR-5-like protein (pr-5L-1)
           mRNA, complete cds.
          Length = 233

 Score =  182 bits (462), Expect = 9e-45
 Identities = 98/237 (41%), Positives = 128/237 (54%), Gaps = 12/237 (5%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           +ITI NNCP TIWP IQ N G+  L  GGF+L      +F  PR  W+GRIW RT C   
Sbjct: 4   VITIKNNCPFTIWPGIQGNPGHEHLGNGGFSLGSQKTHTFNTPR-NWAGRIWGRTRC--- 59

Query: 686 HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
           + +  C TGDC  +++CNG GG  P +LA+     G      Y +SLVDG+NLP+ + P 
Sbjct: 60  NSKGKCETGDCGNKIQCNGAGGVPPVSLAEMTF-TGAGGLDFYDVSLVDGYNLPIRMLPT 118

Query: 509 ------HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
                   GK  C   GC ++L   CP +L VR     G   VV C S CA F TD  CC
Sbjct: 119 AQFKSSKKGKYDCKPAGCVSDLNSRCPSELAVR---TSGGSSVVACKSACAKFNTDTYCC 175

Query: 347 RNNYNNPLMCKAS----RYSDFFKHACPSTFTYAH-DTPSSLMHECSAARELKIIFC 192
           R ++N P  CK+S     Y  +FK ACP  ++YA+ DT S+     + +    +IFC
Sbjct: 176 RGSHNTPATCKSSSWPKNYPSYFKAACPDAYSYAYDDTTSTFTCRGNPSTNYDVIFC 232



>pir|B96763|B96763 thaumatin-like protein, 9376-10898 [imported] -
           Arabidopsis thaliana>gb:AE005173_894908 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012679_1537771 Arabidopsis thaliana
           chromosome 1 BAC F25P22 genomic sequence, complete
           sequence.
          Length = 264

 Score =  182 bits (462), Expect = 9e-45
 Identities = 104/251 (41%), Positives = 134/251 (53%), Gaps = 1/251 (0%)
 Frame = -1

Query: 941 PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           P+   S +LF+       +   A  +I   N C +T+WP IQP++G  +L  GGF L   
Sbjct: 19  PSMASSSSLFLLPLLLLVSQASASTVI-FYNKCTYTVWPGIQPSSGQSLLAGGGFKLSPN 77

Query: 761 THRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELH 585
              +   P   WSGR W R GC  +  GR  CATGDC G   CNG GG  PATLA+  L 
Sbjct: 78  RAYTLQLPPL-WSGRFWGRHGCSFDRSGRGRCATGDCGGSFLCNGAGGVPPATLAEITL- 135

Query: 584 QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRG 405
            GH D   Y +SLVDG+NL M++ P  G   C   GC ++L   CP  LQVR    R   
Sbjct: 136 -GH-DMDFYDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVR---SRDGT 190

Query: 404 PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC 225
            VV C S C+AF +   CC   + NP  CK + YS  FK ACP  ++YA+D P+S+   C
Sbjct: 191 QVVACKSACSAFNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIA-TC 249

Query: 224 SAARELKIIFC 192
           S A  + + FC
Sbjct: 250 SKANYV-VTFC 259



>gb:OSA245900_1692397 Oryza sativa chromosome 4 BAC q3037-207F1
            complete genome.
          Length = 749

 Score =  181 bits (459), Expect = 2e-44
 Identities = 100/239 (41%), Positives = 130/239 (54%), Gaps = 1/239 (0%)
 Frame = -1

Query: 905  LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
            LC        +  + TI+N C   +WPA+ P   +     GGFAL       F AP   W
Sbjct: 485  LCCCFVRRCESARVFTIINQCKTMVWPAVTPGESF---SGGGFALKPGQSMVFTAP-VGW 540

Query: 725  SGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS 549
            SGRIW RT C  +  G  +CATG C   L+C G  GA PATLA+F L    A    Y +S
Sbjct: 541  SGRIWGRTECDFDQAGNGSCATGSCGSELKCGG-SGATPATLAEFTL----ATKDFYDVS 595

Query: 548  LVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAF 369
            LVDGFNLPM + P +G+ +C V GC  +L  +CP +L  ++  R      V C S C  F
Sbjct: 596  LVDGFNLPMVVRPLNGEGNCSVAGCDGDLRDSCPSELSKKVNGR-----TVACRSACDVF 650

Query: 368  KTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             TD+ CCR  Y NP  C+ + YS  FK ACP+ ++YA+D P+S+   CS A +  I FC
Sbjct: 651  DTDQYCCRGMYGNPSTCQPTFYSKKFKAACPTAYSYAYDDPTSIF-TCSNA-DYTITFC 707



>gb:AY085688_1570755 Arabidopsis thaliana clone 17109 mRNA, complete
           sequence.>gb:AK118229_1816217 Arabidopsis thaliana
           At1g73620 mRNA for putative thaumatin, complete cds,
           clone: RAFL19-54-F15.
          Length = 244

 Score =  181 bits (459), Expect = 2e-44
 Identities = 104/256 (40%), Positives = 136/256 (53%), Gaps = 1/256 (0%)
 Frame = -1

Query: 956 MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF 777
           MA +    +L + L +S  + +T        +   N C +T+WP IQP++G  +L  GGF
Sbjct: 1   MASSSSLFLLPLLLLVSQASAST--------VIFYNKCTYTVWPGIQPSSGQSLLAGGGF 52

Query: 776 ALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLA 600
            L      +   P   WSGR W R GC  +  GR  CATGDC G   CNG GG  PATLA
Sbjct: 53  KLSPNRAYTLQLPPL-WSGRFWGRHGCSFDRSGRGRCATGDCGGSFLCNGAGGVPPATLA 111

Query: 599 QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRA 420
           +  L  GH D   Y +SLVDG+NL M++ P  G   C   GC ++L   CP  LQVR   
Sbjct: 112 EITL--GH-DMDFYDVSLVDGYNLAMSIMPVKGTGKCTYAGCVSDLNRMCPVGLQVR--- 165

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
            R    VV C S C+AF +   CC   + NP  CK + YS  FK ACP  ++YA+D P+S
Sbjct: 166 SRDGTQVVACKSACSAFNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTS 225

Query: 239 LMHECSAARELKIIFC 192
           +   CS A  + + FC
Sbjct: 226 IA-TCSKANYV-VTFC 239



>gb:AB010068_1510845 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18P6.
          Length = 255

 Score =  181 bits (459), Expect = 2e-44
 Identities = 107/258 (41%), Positives = 137/258 (53%), Gaps = 4/258 (1%)
 Frame = -1

Query: 941 PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           P   ++V +++SL    + S  +  +IT  NNCP TIWP     +G   L   GF L   
Sbjct: 5   PMVPMAVLVYVSL--LFSVSYSSTFVIT--NNCPFTIWPGTLAGSGTQPLPTTGFRLD-- 58

Query: 761 THRSFVAPRAR-WSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFEL 588
             +S   P A  WSGRIWARTGC  + +G   C TGDC G+LEC G G A P +L +  L
Sbjct: 59  VGQSVRIPTALGWSGRIWARTGCNFDANGAGKCMTGDCGGKLECAGNGAAPPTSLFEITL 118

Query: 587 HQGHADFSTYGLSLVDGFNLPMTLTPHDGK--EHCPVVGCRANLLPACPRQLQVRLRARR 414
             G  D   Y +SLVDG+NLP+   P  G     C   GC A++  +CP++LQV      
Sbjct: 119 GHGSDDKDFYDVSLVDGYNLPIVALPTGGGLVGACNATGCVADINISCPKELQVMGEEEA 178

Query: 413 GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM 234
            RG VV C S C AF  D+ CC   + NP  C+ S YS  FK ACP  ++YA D  +S  
Sbjct: 179 ERGGVVACKSACEAFGLDQYCCSGQFANPTTCRPSLYSSIFKRACPRAYSYAFDDGTSTF 238

Query: 233 HECSAARELKIIFCH*EY 180
             C A+ E  IIFC   Y
Sbjct: 239 -TCKAS-EYAIIFCPGRY 254



>pir|T14428|T14428 thaumatin-like protein -
           turnip>gb:BRU71244_1634196 Brassica rapa
           pathogenesis-related group 5 protein (BFTP) mRNA,
           complete cds.
          Length = 243

 Score =  181 bits (459), Expect = 2e-44
 Identities = 96/225 (42%), Positives = 127/225 (56%), Gaps = 1/225 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN- 687
           +   N C + +WP IQP     +L  GGF L      +   P   WSGR W R GC  + 
Sbjct: 23  VVFFNKCRYPVWPGIQPIAAQNILAGGGFKLPANKAYTLQLPPL-WSGRFWGRHGCTFDG 81

Query: 686 HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH 507
            GR  CATGDC G L CNG GG+ PATLA+  L Q   +   Y +SLVDG+NL M++ P 
Sbjct: 82  SGRGRCATGDCGGSLTCNGAGGSPPATLAEITLGQ---ELDFYDVSLVDGYNLAMSIMPL 138

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
            G+  C   GC ++L   CP  LQVR  +R G+  V+ C S C+AF + + CC   + NP
Sbjct: 139 KGRGQCSYAGCVSDLNRMCPVGLQVR--SRNGKR-VLACKSACSAFNSPQYCCTGTFGNP 195

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           L CK + YS  FK ACP  ++YA+D P+S+   CS A  + + FC
Sbjct: 196 LTCKPTSYSKIFKVACPKAYSYAYDDPTSIA-TCSKANYI-VTFC 238



>gb:AE016959_1022558 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017094_1752377
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 48 of 77 of the complete sequence.
          Length = 275

 Score =  181 bits (458), Expect = 3e-44
 Identities = 98/241 (40%), Positives = 127/241 (52%), Gaps = 15/241 (6%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           L + +      +L  G+   +VN CP  +WPA  PN G+PVL  GGF L     R   AP
Sbjct: 15  LLLLITLLGPVALVRGVTFRVVNKCPFPVWPAAAPNAGHPVLAGGGFLLPPGQSRRVSAP 74

Query: 737 RARWSGRIWARTGCVL------NHGRF--TCATGDCDGRLECNGRGGAAPATLAQFELHQ 582
              W+GR W RTGC        +HG    +C TGDC GRL CNG  GA PATL + +LH+
Sbjct: 75  PT-WNGRFWGRTGCNFTSTATNHHGNAAASCLTGDCGGRLACNGTAGAPPATLVEVDLHE 133

Query: 581 GHADFSTYGLSLVDGFNLPM---TLTPHDG----KEHCPVVGCRANLLPACPRQLQVRLR 423
             +  S+Y +SLVDG+NLP+   T  P  G       C + GC  N+   CP +LQV   
Sbjct: 134 DQSKGSSYDVSLVDGYNLPVAVWTKPPTPGAAAADRKCVIPGCAKNVNAVCPPELQVTAA 193

Query: 422 ARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPS 243
           A      VV C S C AF TD  CCR  +     C+ S YS  F+ ACP+  +Y +DT +
Sbjct: 194 A-----AVVACKSACVAFGTDAFCCRGAHGTAETCRGSAYSRVFRDACPAYVSYPYDTAA 248

Query: 242 S 240
           +
Sbjct: 249 A 249



>gb:OSJN00076_1694420 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039K24, complete sequence.
          Length = 278

 Score =  180 bits (457), Expect = 4e-44
 Identities = 100/239 (41%), Positives = 130/239 (54%), Gaps = 1/239 (0%)
 Frame = -1

Query: 905 LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
           LC        +  + TI+N C   +WPA+ P   +     GGFAL       F AP   W
Sbjct: 14  LCCCFVRHCESARVFTIINQCKTMVWPAVTPGESFG---GGGFALKPGQSMVFTAP-VGW 69

Query: 725 SGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS 549
           SGRIW RT C  +  G  +CATG C   L+C G  GA PATLA+F L    A    Y +S
Sbjct: 70  SGRIWGRTECDFDQAGNGSCATGSCGSELKCGG-SGATPATLAEFTL----ATKDFYDVS 124

Query: 548 LVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAF 369
           LVDGFNLPM + P +G+ +C V GC  +L  +CP +L  ++  R      V C S C  F
Sbjct: 125 LVDGFNLPMVVRPLNGEGNCSVAGCDGDLRDSCPSELSKKVNGR-----TVACRSACDVF 179

Query: 368 KTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            TD+ CCR  Y NP  C+ + YS  FK ACP+ ++YA+D P+S+   CS A +  I FC
Sbjct: 180 DTDQYCCRGMYGNPSTCQPTFYSKKFKAACPTAYSYAYDDPTSIF-TCSNA-DYTITFC 236



>pir|D96787|D96787 protein T4O12.3 [imported] - Arabidopsis
           thaliana>gb:AE005173_895116 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007396_1535821 Genomic sequence for
           Arabidopsis thaliana BAC T4O12 from chromosome I,
           complete sequence.>gb:AY074577_1567616 Arabidopsis
           thaliana At1g75800/T4O12_2 mRNA, complete
           cds.>gb:AY094013_1575519 Arabidopsis thaliana
           At1g75800/T4O12_2 mRNA, complete cds.
          Length = 330

 Score =  179 bits (455), Expect = 6e-44
 Identities = 97/225 (43%), Positives = 125/225 (55%), Gaps = 3/225 (1%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           +VN C +T+WP +  N G P L   GF L K   R+  AP + W GR W RT C  +  G
Sbjct: 27  MVNKCEYTVWPGLLSNAGVPPLPTTGFVLQKGEERTISAPTS-WGGRFWGRTQCSTDTDG 85

Query: 680 RFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD 504
           +FTC TGDC  G LEC+G G   PATLA+F L  G      Y +SLVDG+N+PM + P  
Sbjct: 86  KFTCLTGDCGSGTLECSGSGATPPATLAEFTL-DGSNGLDFYDVSLVDGYNVPMLVAPQG 144

Query: 503 GKE-HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
           G   +C   GC  +L  +CP +L+V     RG+  + GC S C AF+T E CC   +  P
Sbjct: 145 GSGLNCSSTGCVVDLNGSCPSELKVTSLDGRGKQSM-GCKSACEAFRTPEYCCSGAHGTP 203

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             CK S YS  FK ACP  ++YA+D  SS    C+ +    I FC
Sbjct: 204 DTCKPSSYSLMFKTACPRAYSYAYDDQSSTF-TCAESPNYVITFC 247



>pir|T00838|T00838 hypothetical protein At2g17860 [imported] -
           Arabidopsis thaliana>gb:AC003952_1531210 Arabidopsis
           thaliana chromosome II section 104 of 255 of the
           complete sequence. Sequence from clones T13L16.
          Length = 253

 Score =  179 bits (453), Expect = 1e-43
 Identities = 106/253 (41%), Positives = 137/253 (54%), Gaps = 6/253 (2%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           +L++  FI+  + TT         TIVN C +T+WP +    G   L   GF+L     R
Sbjct: 10  LLAIMFFINGGSSTT--------FTIVNQCNYTVWPGLLSGAGTAPLPTTGFSLNSFESR 61

Query: 752 SFVAPRARWSGRIWARTGCVLNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQ 582
               P A WSGRIW RT C  N   G FTC TGDC   ++EC+G G   PATLA+F L+ 
Sbjct: 62  LISIPAA-WSGRIWGRTLCNQNEITGIFTCVTGDCGSSQIECSGAGAIPPATLAEFTLN- 119

Query: 581 GHADFSTYGLSLVDGFNLPMTLTPHDGK---EHCPVVGCRANLLPACPRQLQVRLRARRG 411
           G  +   Y +SLVDG+N+PMT+ P+ G      C   GC A+L   CP QL+V + A  G
Sbjct: 120 GAENLDFYDVSLVDGYNIPMTIVPYGGAIGVGKCNATGCAADLNGLCPEQLKVTVEAA-G 178

Query: 410 RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH 231
            G  V C S C AF T E CC   +  P  C+ S YS FFK  CP+ ++YA+D  +S   
Sbjct: 179 TG-AVACKSACEAFGTPEFCCNGAFGTPDTCQPSEYSVFFKKTCPTAYSYAYDDGTSTF- 236

Query: 230 ECSAARELKIIFC 192
            CS A +  I FC
Sbjct: 237 TCSGA-DYVITFC 248



>gb:AP003614_1831413 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0481E08.
          Length = 300

 Score =  178 bits (451), Expect = 2e-43
 Identities = 109/264 (41%), Positives = 138/264 (52%), Gaps = 18/264 (6%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           LS+ LF+SL     A+       TI N C +T+WP I  N G       GFAL       
Sbjct: 8   LSLLLFLSLLQGAQAAT-----FTISNRCGYTVWPGILSNAGVAPPSTTGFALSP-GQTL 61

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGH 576
            V+  A WSGRIW RT C  +  G+FTCATGDC  G +EC+GRG A PATLA+F L  G 
Sbjct: 62  AVSVAAAWSGRIWGRTLCGQDSSGKFTCATGDCGSGAVECSGRGAAPPATLAEFTLAGGS 121

Query: 575 A-----DFSTYGLSLVDGFNLPMTLTPH-----------DGKEHCPVVGCRANLLPACPR 444
                 DF  Y +SLVDG+NLPM + P            +    C V GC  +L  +CP 
Sbjct: 122 GGGGGDDF--YDVSLVDGYNLPMLVAPSTPPPASGGAASNNGSSCQVTGCVMDLNKSCPA 179

Query: 443 QLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFT 264
           +LQV + A   R  V  C S C AF T E CC   + +P  C A+ YS FFK ACP  ++
Sbjct: 180 ELQV-VAASAARRAVAACKSACEAFGTAEYCCSGAHGSPATCAATAYSRFFKGACPRAYS 238

Query: 263 YAHDTPSSLMHECSAARELKIIFC 192
           YA+D  +S     +A     ++FC
Sbjct: 239 YAYDDATSTFTCAAAGGGYDVVFC 262



>gb:AF049870_1764103 Arabidopsis thaliana beta tubulin 1,
           thaumatin-like protein (TL1), small hydrophobic protein,
           receptor kinase (CLAVATA1), and antifungal protein
           (PDF1.1) genes, complete cds.
          Length = 253

 Score =  178 bits (451), Expect = 2e-43
 Identities = 96/225 (42%), Positives = 125/225 (55%), Gaps = 3/225 (1%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           +VN C +T+WP +  N G P L   GF L K   R+  AP + W GR W RT C  +  G
Sbjct: 27  MVNKCEYTVWPGLLSNAGVPPLPTTGFVLQKGEERTISAPTS-WGGRFWGRTQCSTDTDG 85

Query: 680 RFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD 504
           +FTC TGDC  G LEC+G G   PATLA+F L  G      Y +SLVDG+N+P+ + P  
Sbjct: 86  KFTCLTGDCGSGTLECSGSGATPPATLAEFTL-DGSNGLDFYDVSLVDGYNVPVLVAPQG 144

Query: 503 GKE-HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
           G   +C   GC  +L  +CP +L+V     RG+  + GC S C AF+T E CC   +  P
Sbjct: 145 GSGLNCSSTGCVVDLNGSCPSELKVTSLDGRGKQSM-GCKSACEAFRTPEYCCSGAHGTP 203

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             CK S YS  FK ACP  ++YA+D  SS    C+ +    I FC
Sbjct: 204 DTCKPSSYSLMFKTACPRAYSYAYDDQSSTF-TCAESPNYVITFC 247



>pir|T48235|T48235 thaumatin-like protein - Arabidopsis
           thaliana>gb:ATT7H20_1556429 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T7H20 (ESSA project).
          Length = 294

 Score =  177 bits (449), Expect = 3e-43
 Identities = 97/244 (39%), Positives = 132/244 (54%), Gaps = 2/244 (0%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           LF+++ AFT      G  + IVNNC  +IWP I    G      GGF +      + +  
Sbjct: 10  LFLTISAFTD-----GAQLIIVNNCQESIWPGILGGGGQITPRNGGFHMGS-GEETIIDV 63

Query: 737 RARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFS 564
             +WSGRIW R GC  N +G+ +C TGDC DG + C G GG  PAT+ +  L    +   
Sbjct: 64  PDKWSGRIWGRQGCTFNQNGKGSCQTGDCNDGSINCQGTGGVPPATVVEMTLGSSSSPLH 123

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            Y +SLVDGFNLP+++ P  G   C V  C  NL   CP  L+V     +  G VVGC S
Sbjct: 124 FYDVSLVDGFNLPVSMKPIGGGVGCGVAACEVNLNICCPSALEV-----KRDGKVVGCKS 178

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C A ++ + CC   Y NP  CK + +++ FK  CP  ++YA D  SSL ++C A+R + 
Sbjct: 179 ACLAMQSAKYCCTGEYANPQACKPTLFANLFKAICPKAYSYAFDDSSSL-NKCRASRYV- 236

Query: 203 IIFC 192
           I FC
Sbjct: 237 ITFC 240



>pir|T05493|T05493 pathogenesis-related protein 19K4.140 -
           Arabidopsis thaliana>gb:ATCHRIV84_1547561 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           84.>gb:ATT19K4_1554822 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T19K4 (ESSAII
           project).>gb:AY113913_1578324 Arabidopsis thaliana
           putative thaumatin protein (At4g36010) mRNA, complete
           cds.>gb:AF360165_1791121 Arabidopsis thaliana putative
           thaumatin protein (At4g36010) mRNA, complete cds.
          Length = 301

 Score =  177 bits (449), Expect = 3e-43
 Identities = 101/232 (43%), Positives = 124/232 (53%), Gaps = 9/232 (3%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH- 684
           TIVN C +T+WP +    G   L   GF+L     R    P A WSGRIW RT C  +  
Sbjct: 26  TIVNQCSYTVWPGLLSGAGTSPLPTTGFSLNPTETRVIPIPAA-WSGRIWGRTLCTQDAT 84

Query: 683 -GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
            GRFTC TGDC    +EC+G G A PATLA+F L+ G      Y +SLVDG+N+PMT+ P
Sbjct: 85  TGRFTCITGDCGSSTVECSGSGAAPPATLAEFTLN-GANGLDFYDVSLVDGYNIPMTIVP 143

Query: 509 HDGKE------HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
             G +      +C   GC A L   CP QL+V      G    V C S C AF T E CC
Sbjct: 144 QGGGDAGGVAGNCTTTGCVAELNGPCPAQLKVATTGAEG----VACKSACEAFGTPEYCC 199

Query: 347 RNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
              +  P  CK S YS FFK+ACP  ++YA+D  +S    C  A +  I FC
Sbjct: 200 SGAFGTPDTCKPSEYSQFFKNACPRAYSYAYDDGTSTF-TCGGA-DYVITFC 249



>gb:AY087140_1572175 Arabidopsis thaliana clone 32152 mRNA, complete
           sequence.
          Length = 345

 Score =  176 bits (446), Expect = 7e-43
 Identities = 104/248 (41%), Positives = 128/248 (51%), Gaps = 3/248 (1%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPA-GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           S TL +S      AS  + G   T  N C +T+WP I  N G P L   GF L K T RS
Sbjct: 10  SSTLTLSFTVLLLASTGSYGSTFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRS 69

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGR-LECNGRGGAAPATLAQFELHQGH 576
             AP   WSGR WARTGC  +  G  TC TGDC    +EC G G A P TLA+F L  G 
Sbjct: 70  LQAPTG-WSGRFWARTGCKFDSSGSGTCKTGDCGSNSVECAGLGAAPPVTLAEFTLGTGG 128

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
            DF  Y +SLVDG+N+PM +    G   C   GC  +L   CP +L      R G G   
Sbjct: 129 DDF--YDVSLVDGYNIPMIVEVAGGSGQCASTGCTTDLNIQCPAEL------RFGDGDA- 179

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
            C S C AF++ E CC   Y  P  C+ S YS+ FK ACP +++YA+D  +S      A 
Sbjct: 180 -CKSACLAFRSPEYCCSGAYATPSSCRPSVYSEMFKAACPRSYSYAYDDATSTF--TCAG 236

Query: 215 RELKIIFC 192
            +  + FC
Sbjct: 237 GDYTVTFC 244



>gb:AY070407_1566805 Arabidopsis thaliana putative thaumatin protein
           (At4g38660) mRNA, complete cds.>gb:AY096582_1576122
           Arabidopsis thaliana putative thaumatin (At4g38660)
           mRNA, complete cds.
          Length = 345

 Score =  176 bits (446), Expect = 7e-43
 Identities = 104/248 (41%), Positives = 128/248 (51%), Gaps = 3/248 (1%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPA-GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           S TL +S      AS  + G   T  N C +T+WP I  N G P L   GF L K T RS
Sbjct: 10  SSTLTLSFTVLLLASTGSYGSTFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRS 69

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGR-LECNGRGGAAPATLAQFELHQGH 576
             AP   WSGR WARTGC  +  G  TC TGDC    +EC G G A P TLA+F L  G 
Sbjct: 70  LQAPTG-WSGRFWARTGCKFDSSGSGTCKTGDCGSNAVECAGLGAAPPVTLAEFTLGTGG 128

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
            DF  Y +SLVDG+N+PM +    G   C   GC  +L   CP +L      R G G   
Sbjct: 129 DDF--YDVSLVDGYNIPMIVEVAGGSGQCASTGCTTDLNIQCPAEL------RFGDGDA- 179

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
            C S C AF++ E CC   Y  P  C+ S YS+ FK ACP +++YA+D  +S      A 
Sbjct: 180 -CKSACLAFRSPEYCCSGAYATPSSCRPSVYSEMFKAACPRSYSYAYDDATSTF--TCAG 236

Query: 215 RELKIIFC 192
            +  + FC
Sbjct: 237 GDYTVTFC 244



>gb:NTA6233_1691435 Nicotiana tabacum DNA fragment for H2 left T-DNA
           border.
          Length = 258

 Score =  175 bits (444), Expect = 1e-42
 Identities = 102/247 (41%), Positives = 131/247 (53%), Gaps = 5/247 (2%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           L + L  F+  S        IVN C HT+WP +        +   GF L     R+   P
Sbjct: 11  LSLLLLTFSLFSDVQSTTFKIVNKCRHTVWPGVLTGADRAPINPTGFTLKTGKSRTLKMP 70

Query: 737 RARWSGRIWARTGCV---LNHGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHAD 570
           R+ WSGR+W RT C     N G+FTC TGDC  G++EC G G   PATLA+F L+ G   
Sbjct: 71  RS-WSGRVWGRTLCSNDPSNGGKFTCVTGDCGSGKVECAGGGAIPPATLAEFTLN-GDQG 128

Query: 569 FSTYGLSLVDGFNLPMTLTPHDG-KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG 393
              Y +SLVDG+NLPM +    G +  C   GC  +L  ACPR L+V    +      VG
Sbjct: 129 LDFYDVSLVDGYNLPMLIVAKGGTRGGCSATGCLVDLNGACPRDLRVA-SGKGSHSESVG 187

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           C S C AF     CC   +N P  C+ S YS FFKHACP +++YA+D  +S    C++A 
Sbjct: 188 CKSACLAFNDPIYCCSEAHNTPDTCQPSSYSLFFKHACPRSYSYAYDDKTSTF-TCASAD 246

Query: 212 ELKIIFC 192
            L IIFC
Sbjct: 247 YL-IIFC 252



>pir|T05694|T05694 pathogenesis-related protein F20M13.220 -
           Arabidopsis thaliana>gb:ATCHRIV89_1547819 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           89.>gb:ATF20M13_1549525 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20M13 (ESSA project).
          Length = 323

 Score =  174 bits (440), Expect = 3e-42
 Identities = 98/229 (42%), Positives = 120/229 (52%), Gaps = 2/229 (0%)
 Frame = -1

Query: 872 GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCV 693
           G   T  N C +T+WP I  N G P L   GF L K T RS  AP   WSGR WARTGC 
Sbjct: 7   GSTFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTG-WSGRFWARTGCK 65

Query: 692 LNH-GRFTCATGDCDGR-LECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMT 519
            +  G  TC TGDC    +EC G G A P TLA+F L  G  DF  Y +SLVDG+N+PM 
Sbjct: 66  FDSSGSGTCKTGDCGSNAVECAGLGAAPPVTLAEFTLGTGGDDF--YDVSLVDGYNIPMI 123

Query: 518 LTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNN 339
           +    G   C   GC  +L   CP +L      R G G    C S C AF++ E CC   
Sbjct: 124 VEVAGGSGQCASTGCTTDLNIQCPAEL------RFGDGDA--CKSACLAFRSPEYCCSGA 175

Query: 338 YNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           Y  P  C+ S YS+ FK ACP +++YA+D  +S      A  +  + FC
Sbjct: 176 YATPSSCRPSVYSEMFKAACPRSYSYAYDDATSTF--TCAGGDYTVTFC 222



>pir|T09881|T09881 thaumatin homolog T22A6.10 - Arabidopsis
           thaliana>gb:ATCHRIV61_1546301 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 61.>gb:ATT22A6_1555167
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22A6
           (ESSA project).
          Length = 255

 Score =  174 bits (440), Expect = 3e-42
 Identities = 106/252 (42%), Positives = 134/252 (53%), Gaps = 8/252 (3%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V+ +  + +F       G  ITIVN C  T+WP I  N+G   +   GF L     RSF 
Sbjct: 10  VSFYFIILSFLFFHGSDGATITIVNRCSFTVWPGILSNSGSGDIGTTGFELVPGGSRSFQ 69

Query: 743 APRARWSGRIWARTGCVLNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHA 573
           AP A WSGR WARTGC  N   G+ TC TGDC   ++ECNG G   PATLA+F +  G A
Sbjct: 70  AP-ASWSGRFWARTGCNFNSDTGQGTCLTGDCGSNQVECNGAGAKPPATLAEFTIGSGPA 128

Query: 572 DFST----YGLSLVDGFNLPMTLTPHDGKEH-CPVVGCRANLLPACPRQLQVRLRARRGR 408
           D +     Y +SLVDG+N+PM +    G E  C   GC  +L   CP +L      R G 
Sbjct: 129 DPARKQDFYDVSLVDGYNVPMLVEASGGSEGTCLTTGCVTDLNQKCPTEL------RFGS 182

Query: 407 GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE 228
           G    C S C AF + E CC   Y +P  CK S YS+ FK ACP +++YA D  +S    
Sbjct: 183 GSA--CKSACEAFGSPEYCCSGAYASPTECKPSMYSEIFKSACPRSYSYAFDDATSTF-T 239

Query: 227 CSAARELKIIFC 192
           C+ A +  I FC
Sbjct: 240 CTDA-DYTITFC 250



>gb:ATAC002343_1542766 Arabidopsis thaliana chromosome IV BAC T19F6
           genomic sequence, complete sequence.
          Length = 262

 Score =  173 bits (439), Expect = 4e-42
 Identities = 104/235 (44%), Positives = 128/235 (54%), Gaps = 8/235 (3%)
 Frame = -1

Query: 872 GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCV 693
           G  ITIVN C  T+WP I  N+G   +   GF L     RSF AP A WSGR WARTGC 
Sbjct: 34  GATITIVNRCSFTVWPGILSNSGSGDIGTTGFELVPGGSRSFQAP-ASWSGRFWARTGCN 92

Query: 692 LNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFST----YGLSLVDGF 534
            N   G+ TC TGDC   ++ECNG G   PATLA+F +  G AD +     Y +SLVDG+
Sbjct: 93  FNSDTGQGTCLTGDCGSNQVECNGAGAKPPATLAEFTIGSGPADPARKQDFYDVSLVDGY 152

Query: 533 NLPMTLTPHDGKEH-CPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDE 357
           N+PM +    G E  C   GC  +L   CP +L      R G G    C S C AF + E
Sbjct: 153 NVPMLVEASGGSEGTCLTTGCVTDLNQKCPTEL------RFGSGSA--CKSACEAFGSPE 204

Query: 356 LCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            CC   Y +P  CK S YS+ FK ACP +++YA D  +S    C+ A +  I FC
Sbjct: 205 YCCSGAYASPTECKPSMYSEIFKSACPRSYSYAFDDATSTF-TCTDA-DYTITFC 257



>gb:AP003745_1832760 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1123_B01.>gb:AP004264_1839420 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0025D09.
          Length = 276

 Score =  173 bits (438), Expect = 6e-42
 Identities = 99/237 (41%), Positives = 120/237 (50%), Gaps = 17/237 (7%)
 Frame = -1

Query: 851 NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFT 672
           NNCP T+WPA   + G P     GFAL      S     A WSGR+W R  C    GRF+
Sbjct: 36  NNCPETVWPAALSSAGRPPFPTTGFALPPGASLSVAGVTATWSGRVWGRHRCATGGGRFS 95

Query: 671 CATGDC-DGRLECNGRGGAAPATLAQFELHQGH------ADFSTYGLSLVDGFNLPMTLT 513
           C +GDC  G++ CNG GGA PATLA+F L  G       +DF  Y +S VDGFNLP+ + 
Sbjct: 96  CESGDCGTGQVACNGAGGAPPATLAEFTLGGGGGGAGALSDF--YDVSNVDGFNLPVEVR 153

Query: 512 PH--------DGKEHCPVVGCRANLLPACPRQLQVRLRARRG--RGPVVGCNSGCAAFKT 363
           P              C    C A++   CP +L VR   R G     VV C S C AF T
Sbjct: 154 PELLERRQEGAAAALCRTTACPADINRVCPSELAVRAADRGGAAAAAVVACKSACLAFGT 213

Query: 362 DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           DE CCR  + +P  C  S YS  FK  CP  ++YA D  SS    C+ A   +I FC
Sbjct: 214 DEQCCRGRFASPDKCAPSEYSRLFKAQCPQAYSYAFDDRSSTF-TCANATGYRITFC 269



>gb:AP006067_1860846 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0569E11.
          Length = 312

 Score =  172 bits (437), Expect = 7e-42
 Identities = 103/250 (41%), Positives = 129/250 (51%), Gaps = 3/250 (1%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           I+SV  F+ L  F    +  G+  T  N C  T+WP +  N+G   L   GFAL     R
Sbjct: 12  IMSV-FFVILSFFQGLVMVGGVTFTFTNRCGGTVWPGVLSNSGSSALGTTGFALGAGETR 70

Query: 752 SFVAPRARWSGRIWARTGCVL-NHGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQG 579
           S  AP A WSGR WARTGC   + G+ TCATGDC  G +EC G G   PATL +F L  G
Sbjct: 71  SLAAP-AGWSGRFWARTGCTFDDDGKGTCATGDCGSGEVECRGAGATPPATLVEFTLGSG 129

Query: 578 HADFST-YGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGP 402
                  Y +SLVDG+NLPM +        CP  GC  +L   CP +L      + G G 
Sbjct: 130 GGGGKDYYDVSLVDGYNLPMVV--EAAAAGCPATGCVVDLNQRCPAEL------KAGHGQ 181

Query: 401 VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS 222
              C S C AF T E CC  ++ NP  C  S YS  FK ACP +++YA+D  +S    C+
Sbjct: 182 --ACRSACEAFGTPEYCCSGDHGNPDTCHPSVYSQMFKRACPRSYSYAYDDATSTF-TCT 238

Query: 221 AARELKIIFC 192
              +  I FC
Sbjct: 239 GT-DYSITFC 247



>gb:AP004708_1843781 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0700D12.
          Length = 383

 Score =  172 bits (436), Expect = 1e-41
 Identities = 106/270 (39%), Positives = 132/270 (48%), Gaps = 20/270 (7%)
 Frame = -1

Query: 941 PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           PA ++ V   ++   + ++S+ A    TI N+C  TIWPA     G P L   GF L   
Sbjct: 10  PACVIFVLALVA--QWWSSSMAASCSFTISNHCAQTIWPATLAGAGTPQLATTGFRLDPG 67

Query: 761 THRSFVAPRARWSGRIWARTGCVLNH----------GRFTCATGDCDGRLECNGRGGAAP 612
                 AP A WSGRIWARTGC  +           G   C TGDC GRLEC G G   P
Sbjct: 68  QSVQVPAP-AGWSGRIWARTGCDFSGAGGAAAAAAAGAAACQTGDCGGRLECGGTGATPP 126

Query: 611 ATLAQFELHQ-----GHADFSTYGLSLVDGFNLPMTLTPHDGKEH-----CPVVGCRANL 462
           ATL +  L +     G  D   Y +SLVDG+NLP+   P  G        C   GC A+L
Sbjct: 127 ATLFEVTLGKVGGGAGAGDLDYYDVSLVDGYNLPVVAVPQAGGATGGGGGCATTGCTADL 186

Query: 461 LPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHA 282
             +CP++LQV      G    V C S C AF  +E CC   Y  P  C+ + YS  FK A
Sbjct: 187 NRSCPKELQVDGVDGGGGSGTVACRSACEAFGEEEYCCSGAYATPATCRPTAYSAIFKTA 246

Query: 281 CPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           CP  ++YA+D  +S    CSAA    I FC
Sbjct: 247 CPRAYSYAYDDGTSTF-TCSAA-AYTIAFC 274



>gb:AF195653_1775889 Vitis vinifera SCUTL1 mRNA, partial cds.
          Length = 307

 Score =  172 bits (436), Expect = 1e-41
 Identities = 105/255 (41%), Positives = 136/255 (53%), Gaps = 4/255 (1%)
 Frame = -1

Query: 944 FPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK 765
           F ATIL++     LC     S        +VN C HTIWP          L   GF L  
Sbjct: 1   FVATILAL-----LCVSEVDSAT----FRLVNKCRHTIWPGFLSGATTAPLASTGFVLKS 51

Query: 764 LTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFE 591
              R+   PR+ WSGR+W RT C  +  G+F+CAT DC  G++EC+G     PATLA+F 
Sbjct: 52  GKSRTISVPRS-WSGRMWGRTLCAEDDSGKFSCATADCGSGKVECDGGNAEPPATLAEFT 110

Query: 590 LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKE-HCPVVGCRANLLPACPRQLQVRLRARR 414
           L+ G      Y +SLVDG+NLPM +    G    C   GC  +L  ACP++L+V   A  
Sbjct: 111 LN-GDQGLDFYDVSLVDGYNLPMLVVARGGHGGDCSATGCLVDLNGACPKELRVVASATN 169

Query: 413 G-RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL 237
           G RG  V C S C AF     CC   Y+ P  C+ S YS FFKHACP +++YA+D  +S 
Sbjct: 170 GSRGASVACKSACEAFGDPMYCCSQAYSTPDTCQPSVYSQFFKHACPRSYSYAYDDKTST 229

Query: 236 MHECSAARELKIIFC 192
              C++A +  IIFC
Sbjct: 230 F-TCASA-DYIIIFC 242



>gb:AF195654_1775890 Vitis vinifera SCUTL2 mRNA, complete cds.
          Length = 243

 Score =  172 bits (435), Expect = 1e-41
 Identities = 95/232 (40%), Positives = 127/232 (54%), Gaps = 1/232 (0%)
 Frame = -1

Query: 884 SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWAR 705
           S  +  + T+ N+C +TIWP      G  +L  GGF L         AP   WSGR WAR
Sbjct: 18  STVSATVFTLENHCSYTIWPGTLSGNGAALLGNGGFVLPPGASIQLQAPFG-WSGRFWAR 76

Query: 704 TGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNL 528
           TGC  +  G+ TC TGDC G L C G GG  P +LA+F +    AD   Y +SLVDG+N+
Sbjct: 77  TGCNFDSAGKGTCITGDC-GALNCIG-GGVPPVSLAEFTIGADSADKDFYDVSLVDGYNV 134

Query: 527 PMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
            M++    G   C   GC A+L   CP +LQ+        G VV C S CAAF T + CC
Sbjct: 135 GMSIESSGGTGDCQRAGCVADLNSNCPAELQIT-----DSGSVVACKSACAAFNTAQYCC 189

Query: 347 RNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             +++ P  C  ++YS+ FK ACP+ ++YA+D P+S    C+ A  L I FC
Sbjct: 190 TGDHSTPQTCSPTQYSEIFKKACPTAYSYAYDDPTSTC-TCTGANYL-ITFC 239



>gb:AE005172_890891 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC025808_1539551 Genomic sequence
           for Arabidopsis thaliana BAC F18O14 from chromosome I,
           complete sequence.>gb:BT014884_1641874 Arabidopsis
           thaliana At1g19320 gene, complete cds.
          Length = 247

 Score =  171 bits (434), Expect = 2e-41
 Identities = 100/246 (40%), Positives = 127/246 (51%), Gaps = 4/246 (1%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           LFIS    T     +G   T+ N+C  TIWP I    G   L  GGFAL   +  +F   
Sbjct: 10  LFISFIIATCTISVSGTTFTLTNHCGSTIWPGILTANGAQ-LGDGGFALASGSSVTFTVS 68

Query: 737 RARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG---HAD 570
              WSGR WART C  +  G   C TGDC  +L+C G GGA PATLA+F +      +A 
Sbjct: 69  PG-WSGRFWARTYCNFDASGSGKCGTGDCGSKLKCAGAGGAPPATLAEFTIGSSGKKNAV 127

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
              Y +SLVDG+N+ M +TP  G   C   GC +++   CP++LQV      G   V  C
Sbjct: 128 QDFYDVSLVDGYNVQMKITPQGGSGDCKTAGCVSDVNAICPKELQVT-----GPSGVAAC 182

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
            S C AF   E CC   Y+ P  C  + YS  FK ACPS ++YA+D  SS    C+ A  
Sbjct: 183 KSACEAFNKPEYCCTGAYSTPATCPPTNYSKIFKQACPSAYSYAYDDASSTF-TCTNA-N 240

Query: 209 LKIIFC 192
            +I FC
Sbjct: 241 YEISFC 246



>gb:AK117316_1815356 Arabidopsis thaliana At4g38670 mRNA for
           putative thaumatin, complete cds, clone: RAFL16-88-D10.
          Length = 281

 Score =  170 bits (431), Expect = 4e-41
 Identities = 98/248 (39%), Positives = 131/248 (52%), Gaps = 4/248 (1%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           + LF+ L   ++ S    +   I N C +TIWP +        L   GF L +   ++  
Sbjct: 5   ILLFMILAFVSSLSEVEPISFKITNRCRNTIWPGLLSGANSAPLPTTGFRLSRGKSKTVA 64

Query: 743 APRARWSGRIWARTGCVLNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHA 573
            P + WSGR+WART C  +   G F C TGDC  G++EC+G G   PATLA+F L+ G  
Sbjct: 65  IPES-WSGRLWARTLCSQDRSSGSFVCLTGDCGSGKVECSGSGAKPPATLAEFTLN-GTG 122

Query: 572 DFSTYGLSLVDGFNLPMTLTPHDGK-EHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
               Y +SLVDG+NLPM + P       C   GC  +L  ACPR L++     RG G  V
Sbjct: 123 GLDFYDVSLVDGYNLPMLILPKKIVIGGCGATGCLVDLNGACPRDLKL---VTRGNGNGV 179

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
            C S C AF     CC + Y  P  C+ S YS FFKHACP  ++YA+D  +S  + C+  
Sbjct: 180 ACRSACEAFGDPRYCCSDAYATPDTCQPSVYSLFFKHACPRAYSYAYDDKTS-TYTCATG 238

Query: 215 RELKIIFC 192
            +  IIFC
Sbjct: 239 ADYFIIFC 246



>gb:BT002528_1636131 Arabidopsis thaliana calreticulin, putative
           (At1g20030) mRNA, complete cds.>gb:BT006327_1639219
           Arabidopsis thaliana At1g20030 mRNA, complete cds.
          Length = 299

 Score =  170 bits (431), Expect = 4e-41
 Identities = 94/227 (41%), Positives = 126/227 (55%), Gaps = 4/227 (1%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH- 684
           T  N C +T+WP I  N G   L   GF L K   R+  AP + W GR W RT C  +  
Sbjct: 6   TFSNKCDYTVWPGILSNAGVSPLPTTGFVLLKGETRTINAPSS-WGGRFWGRTLCSTDSD 64

Query: 683 GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH 507
           G+F+CATGDC  G++EC+G G A PATLA+F L  G      Y +SLVDG+N+ M + P 
Sbjct: 65  GKFSCATGDCGSGKIECSGAGAAPPATLAEFTL-DGSGGLDFYDVSLVDGYNVQMLVVPQ 123

Query: 506 DGK-EHCPVVGCRANLLPACPRQLQVRLRARRGRGPV-VGCNSGCAAFKTDELCCRNNYN 333
            G  ++C   GC  +L  +CP +L  R+ +  G+  V + C S C AF+  E CC   + 
Sbjct: 124 GGSGQNCSSTGCVVDLNGSCPSEL--RVNSVDGKEAVAMACKSACEAFRQPEYCCSGAFG 181

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           +P  CK S YS  FK ACP  ++YA+D  SS    C+ +    I FC
Sbjct: 182 SPDTCKPSTYSRIFKSACPRAYSYAYDDKSSTF-TCAKSPNYVITFC 227



>pir|G86333|G86333 hypothetical protein T20H2.19 [imported] -
           Arabidopsis thaliana>gb:AE005172_890963 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:T20H2_1723716 Sequence of BAC T20H2 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 316

 Score =  170 bits (431), Expect = 4e-41
 Identities = 94/227 (41%), Positives = 126/227 (55%), Gaps = 4/227 (1%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH- 684
           T  N C +T+WP I  N G   L   GF L K   R+  AP + W GR W RT C  +  
Sbjct: 23  TFSNKCDYTVWPGILSNAGVSPLPTTGFVLLKGETRTINAPSS-WGGRFWGRTLCSTDSD 81

Query: 683 GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH 507
           G+F+CATGDC  G++EC+G G A PATLA+F L  G      Y +SLVDG+N+ M + P 
Sbjct: 82  GKFSCATGDCGSGKIECSGAGAAPPATLAEFTL-DGSGGLDFYDVSLVDGYNVQMLVVPQ 140

Query: 506 DGK-EHCPVVGCRANLLPACPRQLQVRLRARRGRGPV-VGCNSGCAAFKTDELCCRNNYN 333
            G  ++C   GC  +L  +CP +L  R+ +  G+  V + C S C AF+  E CC   + 
Sbjct: 141 GGSGQNCSSTGCVVDLNGSCPSEL--RVNSVDGKEAVAMACKSACEAFRQPEYCCSGAFG 198

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           +P  CK S YS  FK ACP  ++YA+D  SS    C+ +    I FC
Sbjct: 199 SPDTCKPSTYSRIFKSACPRAYSYAYDDKSSTF-TCAKSPNYVITFC 244



>sp|Q9SMH2|TLP1_CASSA Thaumatin-like protein 1
           precursor.>gb:CSA242828_1673802 Castanea sativa mRNA for
           thaumatin-like protein (tl1 gene).
          Length = 243

 Score =  170 bits (431), Expect = 4e-41
 Identities = 88/226 (38%), Positives = 117/226 (51%), Gaps = 2/226 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           IT  NNCP TIWP    +   P L   GF L      + +  +A W GR WART C  N 
Sbjct: 25  ITFTNNCPRTIWPGTLTSDQKPQLPNTGFVLASKASLT-LGVQAPWKGRFWARTRCTTNS 83

Query: 683 GRFTCATGDCD-GRLECNGRGGAAPATLAQFELHQGHA-DFSTYGLSLVDGFNLPMTLTP 510
           G+FTC T DC  G++ CNG G   PA+L +  +      DF  Y +SLVDG+NLP+++  
Sbjct: 84  GKFTCETADCSTGQVACNGNGAIPPASLVEINIAANRGMDF--YDVSLVDGYNLPVSVAT 141

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
             G   C    CRAN+   CP +LQV+         V+ C S C AF   + CC   ++ 
Sbjct: 142 RGGTGDCKATSCRANVNAVCPAELQVK----GSDASVLACKSACTAFNQPQYCCTGAFDT 197

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
              C A++YS  FK  CP  ++YA+D  +S    CS A +  I FC
Sbjct: 198 ARTCPATKYSRIFKQQCPQAYSYAYDDSTSTF-TCSGAPDYVITFC 242



>gb:AB000834_1508436 Nicotiana tabacum gene for thaumatin-like
           protein SE39b, complete cds.
          Length = 238

 Score =  170 bits (430), Expect = 5e-41
 Identities = 93/226 (41%), Positives = 123/226 (54%), Gaps = 1/226 (0%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           + T+ N C   IWP I    G+P+L  GG  L         AP   WSGR W R+ C  +
Sbjct: 23  VFTLKNKCNMKIWPGILSGGGHPLLMNGGLQLQPNETAEIKAPTG-WSGRFWPRSQCNFD 81

Query: 686 -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
             G+ TCAT DC G LECNG GG  PA+LA+F L     DF  Y +S VDGFN+P+++ P
Sbjct: 82  TSGKGTCATADCGGVLECNGAGGNPPASLAEFTL-DSPMDF--YDVSFVDGFNIPISIYP 138

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
             G  +C  V C ++L   CP +LQV+         V+ C S C AF   E CC   +N+
Sbjct: 139 LGGSGNCSNVQCVSDLNLQCPPELQVKTN----NDTVIACKSACLAFNKPEYCCTEEFND 194

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           P +CK ++YS+ FK ACP  ++Y +D  +S    C  A  L I FC
Sbjct: 195 PNICKPTKYSEIFKKACPDAYSYPYDDATSTF-TCKGADYL-ISFC 238



>pir|E96780|E96780 thaumatin-like protein, 23251-22305 [imported] -
           Arabidopsis thaliana>gb:AE005173_895047 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC013258_1537822 Arabidopsis thaliana
           chromosome 1 BAC F9E10 genomic sequence, complete
           sequence.
          Length = 257

 Score =  170 bits (430), Expect = 5e-41
 Identities = 99/252 (39%), Positives = 134/252 (53%), Gaps = 5/252 (1%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTA---SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           ++ +T+FI +  F  A   ++ A  + T+ N+CP+T+WP I        L  GGF L   
Sbjct: 12  LVFITIFIVVVCFEIAGGIAVSAATVFTLQNSCPYTVWPGILSGNDN-TLGDGGFPLTPG 70

Query: 761 THRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFEL- 588
                 AP A WSGR WARTGC  +  G   C TGDC G L+CNG GG  P TLA+F L 
Sbjct: 71  ASVQLTAP-AGWSGRFWARTGCNFDASGHGNCGTGDCGGVLKCNG-GGVPPVTLAEFTLV 128

Query: 587 HQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGR 408
             G  DF  Y +SLVDG+N+ M + P  G   C   GC A++   CP +L++        
Sbjct: 129 GDGGKDF--YDVSLVDGYNVEMGIKPQGGSGDCHYAGCVADVNAVCPNELRLM---DPHT 183

Query: 407 GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE 228
           G +  C S CAAF ++E CC   +  P  C  + YS  FK ACP  ++YA+D  +S    
Sbjct: 184 GIIAACKSACAAFNSEEFCCTGAHATPQTCSPTHYSAMFKSACPGAYSYAYDDATSTF-T 242

Query: 227 CSAARELKIIFC 192
           C+ +  L I FC
Sbjct: 243 CTGSNYL-ISFC 253



>sp|Q9FSG7|TP1A_MALDO Thaumatin-like protein 1a precursor (Allergen
           Mal d 2) (Mdtl1) (Pathogenesis-related protein 5a)
           (PR-5a).>gb:MDO243427_1685943 Malus domestica mRNA for
           thaumatin-like protein (tl gene).
          Length = 246

 Score =  169 bits (429), Expect = 6e-41
 Identities = 98/252 (38%), Positives = 128/252 (50%), Gaps = 3/252 (1%)
 Frame = -1

Query: 938 ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT 759
           A++L +TL I   +   A+      IT  NNCP+T+WP        P L   GF L    
Sbjct: 7   ASLLGLTLAILFFSGAHAAK-----ITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKA 61

Query: 758 HRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH 585
            RS  AP + WSGR W RT C  +  G+FTC T DC  G++ CNG G   PATL +  + 
Sbjct: 62  SRSVDAP-SPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIA 120

Query: 584 -QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGR 408
             G  D+  Y +SLVDGFNLPM++ P  G   C    C AN+   CP  LQV+       
Sbjct: 121 ANGGQDY--YDVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKA----AD 174

Query: 407 GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE 228
           G V+ C S C AF   + CC    N P  C  + YS+ F+  CP  ++YA+D  +S    
Sbjct: 175 GSVISCKSACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTF-T 233

Query: 227 CSAARELKIIFC 192
           CS   +  I FC
Sbjct: 234 CSGGPDYVITFC 245



>sp|P50694|TLP_PRUAV Thaumatin-like protein
           precursor.>gb:PAU32440_1698898 Prunus avium
           thaumatin-like protein precursor, mRNA, complete cds.
          Length = 245

 Score =  169 bits (429), Expect = 6e-41
 Identities = 97/249 (38%), Positives = 124/249 (49%), Gaps = 3/249 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L V L +SL   +     A  I +  NNCP+ +WP    +   P L   GF L       
Sbjct: 5   LVVVLSLSLTILSFGGAHAATI-SFKNNCPYMVWPGTLTSDQKPQLSTTGFELASQASFQ 63

Query: 749 FVAPRARWSGRIWARTGCVLN-HGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGH 576
              P   W+GR WARTGC  +  G+F CAT DC  G++ CNG G   PATLA+F +  G 
Sbjct: 64  LDTP-VPWNGRFWARTGCSTDASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPAGG 122

Query: 575 A-DFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
             DF  Y +SLVDGFNLPM++TP  G   C    C AN+   CP +LQ     +   G V
Sbjct: 123 GQDF--YDVSLVDGFNLPMSVTPQGGTGDCKTASCPANVNAVCPSELQ----KKGSDGSV 176

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
           V C S C  F T + CC    N P  C  + YS+ F +ACP  ++YA+D        C+ 
Sbjct: 177 VACLSACVKFGTPQYCCTPPQNTPETCPPTNYSEIFHNACPDAYSYAYDDKRGTF-TCNG 235

Query: 218 ARELKIIFC 192
                I FC
Sbjct: 236 GPNYAITFC 244



>gb:BT005764_1638688 Arabidopsis thaliana clone RAFL15-33-P21
           (R20939) putative pathogenesis-related protein 5
           precursor (At1g19320) mRNA, complete cds.
          Length = 247

 Score =  169 bits (428), Expect = 8e-41
 Identities = 99/246 (40%), Positives = 126/246 (51%), Gaps = 4/246 (1%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           LFIS    T     +G   T+ N+C  TIWP I    G   L  GGFAL   +  +F   
Sbjct: 10  LFISFIIATCTISVSGTTFTLTNHCGSTIWPGILTANGAQ-LGDGGFALASGSSVTFTVS 68

Query: 737 RARWSGRIWARTGCVLNHGRF-TCATGDCDGRLECNGRGGAAPATLAQFELHQG---HAD 570
              WSGR WART C  +      C TGDC  +L+C G GGA PATLA+F +      +A 
Sbjct: 69  PG-WSGRFWARTYCNFDASSSGKCGTGDCGSKLKCAGAGGAPPATLAEFTIGSSGKKNAV 127

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
              Y +SLVDG+N+ M +TP  G   C   GC +++   CP++LQV      G   V  C
Sbjct: 128 QDFYDVSLVDGYNVQMKITPQGGSGDCKTAGCVSDVNAICPKELQVT-----GPSGVAAC 182

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
            S C AF   E CC   Y+ P  C  + YS  FK ACPS ++YA+D  SS    C+ A  
Sbjct: 183 KSACEAFNKPEYCCTGAYSTPATCPPTNYSKMFKQACPSAYSYAYDDASSTF-TCTNA-N 240

Query: 209 LKIIFC 192
            +I FC
Sbjct: 241 YEISFC 246



>pir|T22396|T22396 hypothetical protein F49A5.6 - Caenorhabditis
           elegans>gb:CEF49A5_1364135 Caenorhabditis elegans cosmid
           F49A5, complete sequence.
          Length = 233

 Score =  169 bits (428), Expect = 8e-41
 Identities = 94/224 (41%), Positives = 120/224 (53%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           ITI N CP TIWP IQ   G P    GGF L+    R      +  +GRIWARTGC  N 
Sbjct: 22  ITIYNRCPFTIWPGIQ-GPGNPA--GGGFTLHSEHSRDITVSDSWTAGRIWARTGCDAN- 77

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD 504
             F C TG C    +CNG GG  PA+LA+F L+ G A    Y +S+VDG+N+P+ + PH 
Sbjct: 78  --FNCETGFCGNSEQCNGAGGVPPASLAEFTLN-GRAGQDFYDVSMVDGYNIPVFIQPHG 134

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
                   GC  ++   CP  L VR R     G VV C S C  +++D  CCRN YNNP 
Sbjct: 135 VSGCHRAGGCVTDMNANCPGDLIVRGRD----GRVVACKSACLKYQSDRECCRNEYNNPR 190

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  S  +  FK+ACP+ ++YA+D  SS    C  +    + FC
Sbjct: 191 TCTRSALAQLFKNACPTAYSYAYDDASSTF-TCQPSASYTVQFC 233



>gb:AF090143_1767327 Malus domestica thaumatin-like protein
           precursor Mdtl1 (MDTL1) mRNA, complete cds.
          Length = 245

 Score =  169 bits (427), Expect = 1e-40
 Identities = 92/227 (40%), Positives = 117/227 (51%), Gaps = 3/227 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           IT  NNCP+T+WP        P L   GF L     RS  AP + WSGR W RT C  + 
Sbjct: 26  ITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKASRSVDAP-SPWSGRFWGRTRCSTDA 84

Query: 683 -GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLT 513
            G+FTC T DC  G++ CNG G   PATL +  +   G  D+  Y +SLVDGFNLPM++ 
Sbjct: 85  AGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDY--YDVSLVDGFNLPMSVA 142

Query: 512 PHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN 333
           P  G   C    C AN+   CP  LQV+       G V+ C S C AF   + CC    N
Sbjct: 143 PQGGTGECKPSSCPANVNKVCPAPLQVKA----ADGSVISCKSACLAFGDSKYCCTPPNN 198

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            P  C  + YS+ F+  CP  ++YA+D  +S    CS   +  I FC
Sbjct: 199 TPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTF-TCSGGPDYVITFC 244



>pir|JC7201|JC7201 thaumatin-like protein 1 - apple tree
          Length = 247

 Score =  169 bits (427), Expect = 1e-40
 Identities = 92/227 (40%), Positives = 117/227 (51%), Gaps = 3/227 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           IT  NNCP+T+WP        P L   GF L     RS  AP + WSGR W RT C  + 
Sbjct: 28  ITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKASRSVDAP-SPWSGRFWGRTRCSTDA 86

Query: 683 -GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLT 513
            G+FTC T DC  G++ CNG G   PATL +  +   G  D+  Y +SLVDGFNLPM++ 
Sbjct: 87  AGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDY--YDVSLVDGFNLPMSVA 144

Query: 512 PHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN 333
           P  G   C    C AN+   CP  LQV+       G V+ C S C AF   + CC    N
Sbjct: 145 PQGGTGECKPSSCPANVNKVCPAPLQVKA----ADGSVISCKSACLAFGDSKYCCTPPNN 200

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            P  C  + YS+ F+  CP  ++YA+D  +S    CS   +  I FC
Sbjct: 201 TPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTF-TCSGGPDYVITFC 246



>gb:AE016959_1020922 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074105_1541197
           Oryza sativa chromosome 10 clone OSJNBa0030B02, complete
           sequence.>gb:AE017056_1750741 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 10 of 77 of the
           complete sequence.
          Length = 389

 Score =  167 bits (424), Expect = 2e-40
 Identities = 98/242 (40%), Positives = 119/242 (49%), Gaps = 19/242 (7%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVL--- 690
           T VN C  T+WP +  N G   L   GF L     R+  AP A WSGR+WARTGC +   
Sbjct: 32  TFVNRCTDTVWPGVLSNAGSARLATTGFELPPGVARAVPAP-AGWSGRMWARTGCAVVQD 90

Query: 689 ---NHGRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPM 522
                GR  CATGDC  G  ECNG G A PATLA+F L  G      Y +SLVDG+NLP+
Sbjct: 91  GGAGGGRMVCATGDCGSGGAECNGAGAAPPATLAEFTL-DGSGGLDFYDVSLVDGYNLPV 149

Query: 521 TLTPHDG------------KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
            + P                  C   GC A+L   CP +L      R G G    C S C
Sbjct: 150 LVEPSSSGGGGGGGGSLTSAATCAAAGCAADLNAMCPAEL------RAGGG--AACRSAC 201

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
            AF   E CC   + NP  C+ + YS  FK ACP +++YA D P+S    CS   +  + 
Sbjct: 202 DAFGRPEFCCSGAFANPSTCRPTAYSQVFKSACPRSYSYAFDDPTSTF-TCSGGPDYTLT 260

Query: 197 FC 192
           FC
Sbjct: 261 FC 262



>pir|T05695|T05695 pathogenesis-related protein F20M13.230 -
           Arabidopsis thaliana>gb:ATCHRIV89_1547820 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           89.>gb:ATF20M13_1549526 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20M13 (ESSA project).
          Length = 236

 Score =  167 bits (423), Expect = 3e-40
 Identities = 94/226 (41%), Positives = 122/226 (53%), Gaps = 4/226 (1%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-- 684
           I N C +TIWP +        L   GF L +   ++   P + WSGR+WART C  +   
Sbjct: 11  ITNRCRNTIWPGLLSGANSAPLPTTGFRLSRGKSKTVAIPES-WSGRLWARTLCSQDRSS 69

Query: 683 GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH 507
           G F C TGDC  G++EC+G G   PATLA+F L+ G      Y +SLVDG+NLPM + P 
Sbjct: 70  GSFVCLTGDCGSGKVECSGSGAKPPATLAEFTLN-GTGGLDFYDVSLVDGYNLPMLILPK 128

Query: 506 DGK-EHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
                 C   GC  +L  ACPR L++     RG G  V C S C AF     CC + Y  
Sbjct: 129 KIVIGGCGATGCLVDLNGACPRDLKL---VTRGNGNGVACRSACEAFGDPRYCCSDAYAT 185

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           P  C+ S YS FFKHACP  ++YA+D  +S  + C+   +  IIFC
Sbjct: 186 PDTCQPSVYSLFFKHACPRAYSYAYDDKTS-TYTCATGADYFIIFC 230



>pir|C96780|C96780 thaumatin-like protein, 28949-28112 [imported] -
           Arabidopsis thaliana>gb:AE005173_895045 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC013258_1537824 Arabidopsis thaliana
           chromosome 1 BAC F9E10 genomic sequence, complete
           sequence.>gb:AK175343_1817331 Arabidopsis thaliana mRNA
           for thaumatin-like protein, complete cds, clone:
           RAFL21-78-M04.
          Length = 246

 Score =  167 bits (423), Expect = 3e-40
 Identities = 91/235 (38%), Positives = 123/235 (52%), Gaps = 1/235 (0%)
 Frame = -1

Query: 893 TTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRI 714
           T+    +  + T+ N+C +T+WP          L  GGF L         AP   WSGR 
Sbjct: 16  TSGIADSATVFTLQNSCAYTVWPGTLSGNSI-TLGDGGFPLTPGASVQLTAPTG-WSGRF 73

Query: 713 WARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDG 537
           WARTGC  +  G  TC TGDC G L+C G GG  PATLA+F +   +A    Y +SLVDG
Sbjct: 74  WARTGCNFDASGHGTCVTGDCGGVLKCTG-GGVPPATLAEFTVGSSNAGMDFYDVSLVDG 132

Query: 536 FNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDE 357
           +N+ M + P  G  +C   GC +++   CP +L++        G V  C S CAAF + E
Sbjct: 133 YNVKMGIKPQGGFGNCKYAGCVSDINEICPSELRIM---DPNSGSVAACKSACAAFSSPE 189

Query: 356 LCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            CC   +  P  C  + YS  FK+ACPS ++YA+D  SS    C+ +  L I FC
Sbjct: 190 FCCTGAHATPQTCSPTYYSSMFKNACPSAYSYAYDDASSTF-TCTGSNYL-ITFC 242



>gb:AY863030_1354255 Lysiphlebus testaceipes PR-5-like protein
           (pr-5L-1) mRNA, complete cds.
          Length = 248

 Score =  166 bits (421), Expect = 5e-40
 Identities = 91/236 (38%), Positives = 122/236 (51%), Gaps = 12/236 (5%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           + + NNCP  +WP IQ N G   LE GGF L +   + F+     W+GRIWART C    
Sbjct: 22  LKLYNNCPFAVWPGIQGNPGKAHLENGGFKLGQYEAK-FIDTSDDWAGRIWARTNC---D 77

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH- 507
               C TGDC  +++CNG GG  P +LA+  L +G      Y +SLVDG+NLP+ + P  
Sbjct: 78  SSGHCETGDCGNKIQCNGAGGVPPVSLAEVTL-KGWGGLDYYDISLVDGYNLPIKMEPTG 136

Query: 506 ------DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCR 345
                 +G+  C   GC A+L   CP +L V+       G  V C S CA F TD  CCR
Sbjct: 137 GFVNSGNGQYDCKRAGCHADLNAKCPNELAVKQN-----GWTVACKSACATFNTDAYCCR 191

Query: 344 NNYNNPLMCKAS----RYSDFFKHACPSTFTYAH-DTPSSLMHECSAARELKIIFC 192
             +N P  CK++     Y   FK ACP  ++YA+ DT S+     +      I+FC
Sbjct: 192 GAHNTPQTCKSTNWPVNYPAIFKQACPDAYSYAYDDTTSTFTCRGNPDTSYDIVFC 247



>gb:AP005168_1848650 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0066B06.
          Length = 249

 Score =  166 bits (419), Expect = 9e-40
 Identities = 93/247 (37%), Positives = 127/247 (51%), Gaps = 3/247 (1%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V L +        ++ A  + T  NNC   ++P +            GF L      ++ 
Sbjct: 11  VVLVLVASVLAPGAMSAKFVFT--NNCHEVLYPGVLTPATAQAFPTTGFELQPGASAAYD 68

Query: 743 APRARWSGRIWARTGCVLN-HGRFTCATGDCD-GRLECNGRGGAAPATLAQFELHQGHA- 573
                WSG IWAR  C  +  GRF+C +GDC  GR+EC+GRG   P+TL++F L  G A 
Sbjct: 69  GVPDNWSGNIWARRLCSTDASGRFSCESGDCGTGRVECDGRGNGPPSTLSEFTLRGGSAR 128

Query: 572 DFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG 393
           D   Y +S VDGFN+P+ + P      C  V C A++  +CP +L V+       G VVG
Sbjct: 129 DTDFYDISNVDGFNVPVQVAPSGAG--CSAVACAADIDASCPAELAVK----GAGGAVVG 182

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           C SGC AF  D+LCCR  Y  P  C  S+YS FFK  CP  ++YA+D  SS    C++  
Sbjct: 183 CKSGCLAFGRDDLCCRGAYGTPDKCPPSQYSKFFKDKCPQAYSYAYDDKSSTF-TCTSGA 241

Query: 212 ELKIIFC 192
             +I FC
Sbjct: 242 SYQITFC 248



>gb:AY512591_1332022 Schistocerca gregaria thaumatin-like protein 1
           (Tau1) mRNA, complete cds.
          Length = 246

 Score =  165 bits (417), Expect = 2e-39
 Identities = 96/238 (40%), Positives = 124/238 (52%), Gaps = 10/238 (4%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           +T+  SL     ASL  G      N    TIW     N G+  +  GG+ +   +  + V
Sbjct: 2   ITVAHSLLVLAVASLSEGRTFQFQNKYGETIWVGSLGNPGHQSINGGGWEMAAGSTMT-V 60

Query: 743 APRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
                W GRIW RTGC  +  GR +C TGDC G L+CNG GG  P++L +  L +G    
Sbjct: 61  NVDDSWQGRIWGRTGCKFDASGRGSCQTGDCGGVLKCNGAGGKPPSSLLEVTL-RGSGGN 119

Query: 566 STYGLSLVDGFNLPMTLTPHD---GKEH--CPVVGCRANLLPACPRQLQVRLRARRGRGP 402
             Y +SLVDG+N+P+T+TP D   G +H  C    C AN+   CP +LQV        G 
Sbjct: 120 DYYDVSLVDGYNIPITMTPTDASGGGDHYRCRPATCTANVNAKCPSELQVV-----ANGA 174

Query: 401 VVGCNSGCAAFKTDELCCRNNYNNPLMCKAS----RYSDFFKHACPSTFTYAHDTPSS 240
           VV C S C AF TD+ CCR  YN P  CK+S     Y  FFK  CP  ++YA+D  SS
Sbjct: 175 VVACKSACLAFNTDQYCCRGAYNTPQTCKSSTWPKNYPSFFKGLCPDAYSYAYDDKSS 232



>gb:OSJN00160_1695904 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0019G23, complete sequence.
          Length = 276

 Score =  164 bits (414), Expect = 3e-39
 Identities = 100/260 (38%), Positives = 129/260 (49%), Gaps = 10/260 (3%)
 Frame = -1

Query: 941 PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           PA I    LF +L A   +S       +  N+C + +W  +      P L R GF L   
Sbjct: 27  PAIIFLQLLFRALGADGASSF------SFTNSCQYPVWVGVLHGASSPALARSGFYLAPS 80

Query: 761 THRSFVAPRA-RWSGRIWARTGCVLNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQF 594
                 AP +  WSG  WARTGC ++   GRFTCAT DC  G + CNGRG + P TLA+ 
Sbjct: 81  GTYHLAAPSSGTWSGTFWARTGCAVDSSTGRFTCATADCGSGDVACNGRGPSPPVTLAEI 140

Query: 593 ELH---QGHADFSTYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQV 432
            L     G  DF  Y +SLVDGFN+P+ L P     G   C  V C  ++  ACP  L+V
Sbjct: 141 TLAAPGSGGQDF--YDVSLVDGFNVPVRLAPSSSGGGGGDCHAVSCAGDVNAACPSDLRV 198

Query: 431 RLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHD 252
                 G G VV C S C A+++   CC   Y +P  C  + YS  FK ACP+ ++YA+D
Sbjct: 199 V----SGAGAVVACRSACDAYRSARYCCTGAYGSPAACGPTDYSQVFKAACPAAYSYAYD 254

Query: 251 TPSSLMHECSAARELKIIFC 192
             SS    C  A    + FC
Sbjct: 255 DASSTF-TCFGASSYDVTFC 273



>gb:H0806H05_1681374 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: H0806H05, complete sequence.
          Length = 264

 Score =  164 bits (414), Expect = 3e-39
 Identities = 100/260 (38%), Positives = 129/260 (49%), Gaps = 10/260 (3%)
 Frame = -1

Query: 941 PATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           PA I    LF +L A   +S       +  N+C + +W  +      P L R GF L   
Sbjct: 15  PAIIFLQLLFRALGADGASSF------SFTNSCQYPVWVGVLHGASSPALARSGFYLAPS 68

Query: 761 THRSFVAPRA-RWSGRIWARTGCVLNH--GRFTCATGDC-DGRLECNGRGGAAPATLAQF 594
                 AP +  WSG  WARTGC ++   GRFTCAT DC  G + CNGRG + P TLA+ 
Sbjct: 69  GTYHLAAPSSGTWSGTFWARTGCAVDSSTGRFTCATADCGSGDVACNGRGPSPPVTLAEI 128

Query: 593 ELH---QGHADFSTYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQV 432
            L     G  DF  Y +SLVDGFN+P+ L P     G   C  V C  ++  ACP  L+V
Sbjct: 129 TLAAPGSGGQDF--YDVSLVDGFNVPVRLAPSSSGGGGGDCHAVSCAGDVNAACPSDLRV 186

Query: 431 RLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHD 252
                 G G VV C S C A+++   CC   Y +P  C  + YS  FK ACP+ ++YA+D
Sbjct: 187 V----SGAGAVVACRSACDAYRSARYCCTGAYGSPAACGPTDYSQVFKAACPAAYSYAYD 242

Query: 251 TPSSLMHECSAARELKIIFC 192
             SS    C  A    + FC
Sbjct: 243 DASSTF-TCFGASSYDVTFC 261



>sp|P28493|PR5_ARATH Pathogenesis-related protein 5 precursor
           (PR-5).>pir|JQ1695|JQ1695 pathogenesis-related protein 5
           precursor - Arabidopsis thaliana>gb:AE005173_895046
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC013258_1537823 Arabidopsis thaliana
           chromosome 1 BAC F9E10 genomic sequence, complete
           sequence.>gb:ATHRPRP1C_1553366 Arabidopsis thaliana
           thaumatin-like mRNA, complete cds.>gb:ATHTLPA_1553430
           Arabidopsis thaliana thaumatin-like protein mRNA,
           complete cds.>gb:AY035168_1559935 Arabidopsis thaliana
           putative thaumatin protein (At1g75040) mRNA, complete
           cds.>gb:AY059114_1564478 Arabidopsis thaliana putative
           thaumatin protein (At1g75040) mRNA, complete cds.
          Length = 239

 Score =  162 bits (411), Expect = 8e-39
 Identities = 97/225 (43%), Positives = 120/225 (53%), Gaps = 2/225 (0%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-H 684
           T+ NNCP T+W       G P L  GGF L     R   AP A WSGR WARTGC  +  
Sbjct: 27  TLRNNCPTTVWAGTLAGQG-PKLGDGGFELTPGASRQLTAP-AGWSGRFWARTGCNFDAS 84

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFEL-HQGHADFSTYGLSLVDGFNLPMTLTPH 507
           G   C TGDC G L CNG GG  P TLA+F L   G  DF  Y +SLVDG+N+ + + P 
Sbjct: 85  GNGRCVTGDCGG-LRCNG-GGVPPVTLAEFTLVGDGGKDF--YDVSLVDGYNVKLGIRPS 140

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
            G   C   GC ++L  ACP  L+V       +  VV C S C  F TD+ CCR   + P
Sbjct: 141 GGSGDCKYAGCVSDLNAACPDMLKVM-----DQNNVVACKSACERFNTDQYCCRGANDKP 195

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             C  + YS  FK+ACP  ++YA+D  +S    C+ A   +I FC
Sbjct: 196 ETCPPTDYSRIFKNACPDAYSYAYDDETSTF-TCTGA-NYEITFC 238



>sp|O80327|TLP1_PYRPY Thaumatin-like protein 1
           precursor.>gb:AB006009_1509719 Pyrus pyrifolia mRNA for
           thaumatin-like protein precursor, complete cds.
          Length = 244

 Score =  162 bits (410), Expect = 1e-38
 Identities = 95/256 (37%), Positives = 126/256 (49%), Gaps = 3/256 (1%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL 771
           M F A I  V +F+S  A   ++       T  N CP+T+WP      G P L   GF L
Sbjct: 1   MKFEALIGLVLVFLSEHAGVYSAK-----FTFTNKCPNTVWPGTLTGGGGPQLLSTGFEL 55

Query: 770 YKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQ 597
                 S    +A WSGR W R+ C ++  G+F C+TGDC  G++ CNG G + PA+L +
Sbjct: 56  ASGASTSLTV-QAPWSGRFWGRSHCSIDSSGKFKCSTGDCGSGQISCNGAGASPPASLVE 114

Query: 596 FELH-QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRA 420
             L   G  DF  Y +SLVDGFNLP+ L P  G   C    C AN+   CP +L      
Sbjct: 115 LTLATNGGQDF--YDVSLVDGFNLPIKLAPRGGSGDCNSTSCAANINTVCPAELS----D 168

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
           +   G V+GC S C A    + CC   Y  P  C  + +S  FK+ CP  ++YA+D  SS
Sbjct: 169 KGSDGSVIGCKSACLALNQPQYCCTGAYGTPDTCPPTDFSKVFKNQCPQAYSYAYDDKSS 228

Query: 239 LMHECSAARELKIIFC 192
               C      +I FC
Sbjct: 229 TF-TCFGGPNYEITFC 243



>pir|T21496|T21496 hypothetical protein F28D1.5 - Caenorhabditis
           elegans>gb:CEF28D1_1363100 Caenorhabditis elegans cosmid
           F28D1, complete sequence.
          Length = 233

 Score =  161 bits (408), Expect = 2e-38
 Identities = 94/225 (41%), Positives = 115/225 (51%), Gaps = 1/225 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           ITI N CP TIWP I    G P    GGF L     R+     A  +GR+WARTGC    
Sbjct: 22  ITIYNKCPFTIWPGIL-GPGNPA--GGGFQLTAGQSRNIDVDDAWTAGRVWARTGC---D 75

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPH 507
           G F C TG C    +CNG GG  PA+LA+F L   G  DF  Y +SLVDG+NLP+ + PH
Sbjct: 76  GNFNCETGFCRNSEQCNGAGGVPPASLAEFTLKAWGGQDF--YDVSLVDGYNLPVLIDPH 133

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
            G       GC  ++   CP  L V+       G  V C SGC  + TD+ CCR  Y  P
Sbjct: 134 GGSGCKRAGGCVKDINAECPAALSVKGH----NGNTVACKSGCLGYNTDQECCRGAYGTP 189

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             C  S  +  FK ACP+ ++YA+D  SS    C A     + FC
Sbjct: 190 DKCHRSATAQMFKDACPTAYSYAYDDGSSTF-TCRATASYTVQFC 233



>gb:ATU83490_1557326 Arabidopsis thaliana thaumatin-like protein
           mRNA, complete cds.
          Length = 245

 Score =  161 bits (407), Expect = 2e-38
 Identities = 90/235 (38%), Positives = 122/235 (51%), Gaps = 1/235 (0%)
 Frame = -1

Query: 893 TTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRI 714
           T+    +  + T+ N+C +T+WP          L  GGF L         AP   WSGR 
Sbjct: 16  TSGIADSATVFTLQNSCAYTVWPGTLSGNSI-TLGDGGFPLTPGASVQLTAPTG-WSGRF 73

Query: 713 WARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDG 537
           WARTGC  +  G  TC TGDC G L+C G GG  PATLA+F +   +A    Y +SLVDG
Sbjct: 74  WARTGCNFDASGHGTCVTGDCGGVLKCTG-GGVPPATLAEFTVGSSNAGMDFYDVSLVDG 132

Query: 536 FNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDE 357
           +N+ M + P  G  +C   GC +++   CP +L++        G V  C S C AF + E
Sbjct: 133 YNVKMGIKPQGGFGNCKYAGCVSDINEICPSELRI---MDPNSGSVAACKSAC-AFSSPE 188

Query: 356 LCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            CC   +  P  C  + YS  FK+ACPS ++YA+D  SS    C+ +  L I FC
Sbjct: 189 FCCTGAHATPQTCSPTYYSSMFKNACPSAYSYAYDDASSTF-TCTGSNYL-ITFC 241



>gb:AB036069_1519003 Pyrus pyrifolia PsTL gene for
           thaumatin/PR5-like protein, complete cds.
          Length = 244

 Score =  161 bits (407), Expect = 2e-38
 Identities = 95/256 (37%), Positives = 125/256 (48%), Gaps = 3/256 (1%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL 771
           M F A I  V +F+S  A   ++       T  N CP+T+WP      G P L   GF L
Sbjct: 1   MKFEALIGLVLVFLSEHAGVYSAK-----FTFTNKCPNTVWPGTLTGGGGPQLLSTGFEL 55

Query: 770 YKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQ 597
                 S    +A WSGR W R+ C ++  G+F C+TGDC  G++ CNG G + PA+L +
Sbjct: 56  ASGASTSLTL-QAPWSGRFWGRSHCSIDSSGKFKCSTGDCGSGQISCNGAGASPPASLVE 114

Query: 596 FELH-QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRA 420
             L   G  DF  Y +SLVDGFNLP+ L P  G   C    C AN+   CP +L      
Sbjct: 115 LTLATNGGQDF--YDVSLVDGFNLPIKLAPRGGSGDCNSTSCAANINTVCPAELS----D 168

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
           +   G V+GC S C A    + CC   Y  P  C  + +S  FK  CP  ++YA+D  SS
Sbjct: 169 KGSDGSVIGCKSACLALNQPQYCCTGAYGTPDTCPPTDFSKVFKKQCPQAYSYAYDDKSS 228

Query: 239 LMHECSAARELKIIFC 192
               C      +I FC
Sbjct: 229 TF-TCFGGPNYEITFC 243



>pir|T21494|T21494 hypothetical protein F28D1.3 - Caenorhabditis
           elegans>gb:CEF28D1_1363098 Caenorhabditis elegans cosmid
           F28D1, complete sequence.
          Length = 233

 Score =  160 bits (405), Expect = 4e-38
 Identities = 93/225 (41%), Positives = 114/225 (50%), Gaps = 1/225 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           ITI N CP TIWP I    G P    GGF L     R      A  +GR+WARTGC    
Sbjct: 22  ITIYNKCPFTIWPGIL-GPGNP--SGGGFKLNAGQSRDINVDDAWTAGRVWARTGC---D 75

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPH 507
           G F C TG C    +CNG GG  PA+LA+F L   G  DF  Y +SLVDG+NLP+ + PH
Sbjct: 76  GNFNCETGFCRNSEQCNGAGGVPPASLAEFTLKAWGGQDF--YDVSLVDGYNLPVLIDPH 133

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
            G       GC  ++   CP  L V+       G  V C SGC  + TD+ CCR  Y  P
Sbjct: 134 GGSGCKRAGGCVKDINAECPAALSVKGH----NGKTVACKSGCLGYNTDQECCRGAYGTP 189

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             C  S  +  FK ACP+ ++YA+D  SS    C  +    + FC
Sbjct: 190 DKCHRSATAQMFKDACPTAYSYAYDDGSSTF-TCQPSASYTVQFC 233



>gb:AF494393_1805348 Malus x domestica thaumatine-like protein
           (PR-5a) mRNA, partial cds.
          Length = 212

 Score =  159 bits (403), Expect = 6e-38
 Identities = 89/219 (40%), Positives = 113/219 (51%), Gaps = 3/219 (1%)
 Frame = -1

Query: 839 HTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCAT 663
           +T+WP        P L   GF L     RS  AP + WSGR W RT C  +  G+FTC T
Sbjct: 1   NTVWPGTLTGDQKPQLSLTGFELASKASRSVDAP-SPWSGRFWGRTRCSTDAAGKFTCET 59

Query: 662 GDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHC 489
            DC  G++ CNG G   PATL +  +   G  DF  Y +SLVDGFNLPM++ P  G   C
Sbjct: 60  ADCGSGQVACNGAGAVPPATLVEITIAANGGQDF--YDVSLVDGFNLPMSVAPQGGTGEC 117

Query: 488 PVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKAS 309
               C AN+  ACP QLQV+       G V+ C S C AF   + CC    N P  C  +
Sbjct: 118 KPSSCPANVNKACPAQLQVKA----ADGSVISCKSACLAFGDSKYCCTPPNNTPETCPPT 173

Query: 308 RYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            YS+ F+  CP  ++YA+D  +S    CS   +  I FC
Sbjct: 174 EYSEIFEKQCPQAYSYAYDDKNSTF-TCSGGPDYVITFC 211



>sp|P83332|TLP1_PRUPE Thaumatin-like protein 1 precursor
           (PpAZ44).>gb:AF362988_1791515 Prunus persica clone 2
           thaumatin-like protein mRNA, complete cds.
          Length = 246

 Score =  159 bits (401), Expect = 1e-37
 Identities = 92/227 (40%), Positives = 114/227 (50%), Gaps = 3/227 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN- 687
           IT  N C +T+WP        P L   GF L     RS  AP + WSGR + RT C  + 
Sbjct: 27  ITFTNKCSYTVWPGTLTGDQKPQLSLTGFELATGISRSVDAP-SPWSGRFFGRTRCSTDA 85

Query: 686 HGRFTCATGDC-DGRLECNGRGGAAPATLAQFEL-HQGHADFSTYGLSLVDGFNLPMTLT 513
            G+FTCAT DC  G++ CNG G A PATL +  +   G  DF  Y +SLVDGFNLPM++ 
Sbjct: 86  SGKFTCATADCGSGQVSCNGNGAAPPATLVEITIASNGGQDF--YDVSLVDGFNLPMSVA 143

Query: 512 PHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN 333
           P  G   C    C A++   CP  LQV+       G V+ C S C AF   + CC    +
Sbjct: 144 PQGGTGKCKASTCPADINKVCPAPLQVK----GSDGSVIACKSACLAFNQPKYCCTPPND 199

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            P  C    YS  FK  CP  ++YA+D  SS    CS      I FC
Sbjct: 200 KPETCPPPDYSKLFKTQCPQAYSYAYDDKSSTF-TCSGRPAYLITFC 245



>gb:AY315152_1598402 Pseudotsuga menziesii PR-5 thaumatin-like
           protein (TLP) gene, complete cds.
          Length = 233

 Score =  157 bits (396), Expect = 4e-37
 Identities = 98/257 (38%), Positives = 132/257 (51%), Gaps = 2/257 (0%)
 Frame = -1

Query: 956 MAMAFP-ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGG 780
           +A++FP A  +++ L + L          G   TI N C  T+W A     G PV   GG
Sbjct: 6   IAVSFPVAATMALVLMVYLQGV------GGATFTIQNQCSFTVWAA-----GIPV--GGG 52

Query: 779 FALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATL 603
            AL +    S   P    +GR W RTGC  +  G+ +C TG+C G L C G  G  PATL
Sbjct: 53  QALAQGQTWSVEVPAGTSAGRFWGRTGCSFDASGQGSCTTGNCGGVLNCTG-AGQPPATL 111

Query: 602 AQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLR 423
           A++ L+ G  +  TY +SLVDGFNLP+++TP +    CP V C +N+   CP QLQV   
Sbjct: 112 AEYTLN-GSNNLDTYDISLVDGFNLPLSITPSNSS--CPTVDCSSNVTANCPTQLQV--- 165

Query: 422 ARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPS 243
                    GCNS C A  T + CC  +Y N   C A+ YS++FK  CP  ++YA D  +
Sbjct: 166 -------AEGCNSACTALNTPQYCCTGDYLN--NCPATSYSEYFKGQCPQAYSYAKDDNT 216

Query: 242 SLMHECSAARELKIIFC 192
           S    C +     I FC
Sbjct: 217 STF-TCPSGANYNIAFC 232



>sp|P83335|TLP2_PRUPE Thaumatin-like protein 2 precursor
           (PpAZ8).>gb:AF362987_1791514 Prunus persica clone 1
           thaumatin-like protein mRNA, complete cds.
          Length = 242

 Score =  157 bits (396), Expect = 4e-37
 Identities = 97/249 (38%), Positives = 120/249 (48%), Gaps = 3/249 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L   L +SL   +     A  + +  NNCP+T+WPA   + G P L   GF L       
Sbjct: 5   LGAVLSLSLTLLSFGGAHAATM-SFKNNCPYTVWPA---SFGNPQLSTTGFELASQASFQ 60

Query: 749 FVAPRARWSGRIWARTGCVLN-HGRFTCATGDCD-GRLECNGRGGAAPATLAQFELHQGH 576
              P   WSGR WART C  +  G+F C T DCD G+L CNG+ G  PATLA+F +  G 
Sbjct: 61  LDTP-VPWSGRFWARTRCSTDASGKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGG 119

Query: 575 A-DFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
             DF  Y +SLVDGFNLPM++TP  G   C +  C AN+   CP +LQ         G V
Sbjct: 120 GQDF--YDVSLVDGFNLPMSVTPQGGTGTCKMGSCAANVNLVCPSELQ----KIGSDGSV 173

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
           V C S C  F   + CC         C  + YS  F   CP  ++YA D    L   CS 
Sbjct: 174 VACLSACVKFGEPQYCCTPPQETKEKCPPTNYSQIFHEQCPDAYSYAFDDNKGLF-TCSG 232

Query: 218 ARELKIIFC 192
                I FC
Sbjct: 233 GPNYLITFC 241



>gb:AY661266_1620406 Pseudotsuga menziesii thaumatin-like protein
           (TLP) gene, complete cds.
          Length = 233

 Score =  156 bits (395), Expect = 5e-37
 Identities = 98/257 (38%), Positives = 132/257 (51%), Gaps = 2/257 (0%)
 Frame = -1

Query: 956 MAMAFP-ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGG 780
           +A++FP A  L++ L + L          G   TI N C  T+W A     G PV   GG
Sbjct: 6   IAVSFPVAATLALVLMVYLQGV------GGATFTIQNQCSFTVWAA-----GIPV--GGG 52

Query: 779 FALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATL 603
            AL +    +   P    +GR W RTGC  +  G+ +C TG+C G L C G  G  PATL
Sbjct: 53  QALAQGQTWTVEVPAGTSAGRFWGRTGCSFDASGQGSCTTGNCGGVLNCTG-AGQPPATL 111

Query: 602 AQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLR 423
           A++ L+ G  +  TY +SLVDGFNLP+++TP +    CP V C +N+   CP QLQV   
Sbjct: 112 AEYTLN-GSNNLDTYDISLVDGFNLPLSITPSNSS--CPTVDCSSNVTANCPTQLQV--- 165

Query: 422 ARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPS 243
                    GCNS C A  T + CC  +Y N   C A+ YS++FK  CP  ++YA D  +
Sbjct: 166 -------AEGCNSACTALNTPQYCCTGDYLN--NCPATSYSEYFKGQCPQAYSYAKDDNT 216

Query: 242 SLMHECSAARELKIIFC 192
           S    C +     I FC
Sbjct: 217 STF-TCPSGANYNIAFC 232



>gb:AY863028_1354253 Diaprepes abbreviatus PR-5-like protein
           (pr-5L-3) mRNA, complete cds.
          Length = 247

 Score =  156 bits (394), Expect = 7e-37
 Identities = 86/221 (38%), Positives = 113/221 (51%), Gaps = 9/221 (4%)
 Frame = -1

Query: 875 AGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC 696
           A +I  I+N  P  +W  IQ N G+P L  GGF L +    +  AP   W+GR W RT C
Sbjct: 21  ANVIFEIINREPGPVWVGIQGNPGHPHLNGGGFVLNQGQVVTVSAPD-NWAGRFWPRTWC 79

Query: 695 VLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL 516
             N     C TGDC  +LECNG GG  P TL +  L +G      Y +SLVDGFN+   +
Sbjct: 80  DWNSKH--CLTGDCGNKLECNGAGGVPPVTLVEITL-KGWQGLDYYDISLVDGFNIRAFI 136

Query: 515 TP-----HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELC 351
            P       G+  C  + C +++   CP +L+V+       G  + CNS C  F TD+ C
Sbjct: 137 EPVGGRGDGGQYSCTRINCMSDIDSKCPEELRVK-----HNGLTIACNSACNKFNTDQYC 191

Query: 350 CRNNYNNPLMCKAS----RYSDFFKHACPSTFTYAHDTPSS 240
           CR  YN P  CK+S     Y  FFK  CP  ++YA+D   S
Sbjct: 192 CRGAYNKPETCKSSTWPVNYPAFFKRECPDAYSYAYDDHKS 232



>gb:AY315151_1598401 Pseudotsuga menziesii PR-5 thaumatin-like
           protein (TLP) mRNA, complete cds.
          Length = 233

 Score =  155 bits (392), Expect = 1e-36
 Identities = 98/257 (38%), Positives = 132/257 (51%), Gaps = 2/257 (0%)
 Frame = -1

Query: 956 MAMAFP-ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGG 780
           +A++FP A  L++ L + L          G   TI N C  T+W A     G PV   GG
Sbjct: 6   IAVSFPVAATLALVLMVYLQGV------GGATFTIQNQCSFTVWAA-----GIPV--GGG 52

Query: 779 FALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATL 603
            AL +    +   P    +GR W RTGC  +  G+ +C TG+C G L C G  G  PATL
Sbjct: 53  QALAQGQTWTVEVPAGTSAGRFWGRTGCSFDASGQGSCTTGNCGGVLNCIG-AGQPPATL 111

Query: 602 AQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLR 423
           A++ L+ G  +  TY +SLVDGFNLP+++TP +    CP V C +N+   CP QLQV   
Sbjct: 112 AEYTLN-GSNNLDTYDISLVDGFNLPLSITPSNSS--CPTVDCSSNVTANCPTQLQV--- 165

Query: 422 ARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPS 243
                    GCNS C A  T + CC  +Y N   C A+ YS++FK  CP  ++YA D  +
Sbjct: 166 -------AEGCNSACTALNTPQYCCTGDYLN--NCPATSYSEYFKGQCPQAYSYAKDDNT 216

Query: 242 SLMHECSAARELKIIFC 192
           S    C +     I FC
Sbjct: 217 STF-TCPSGANYNIAFC 232



>gb:AC024839_1204916 Caenorhabditis elegans cosmid Y59E9AR, complete
           sequence.
          Length = 232

 Score =  154 bits (390), Expect = 2e-36
 Identities = 96/239 (40%), Positives = 124/239 (51%), Gaps = 2/239 (0%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPA-GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFA 774
           M F A ILS++LF+         +P+    I I N CP T W  I    G P  E GGF 
Sbjct: 1   MLFFAGILSISLFV---------IPSLSREIKIYNKCPFTTWAGIL-GPGNP--EGGGFR 48

Query: 773 LYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQF 594
           L     RS        S RIW RT C    G   CATG+C  R +CNG GG  PA+LA+F
Sbjct: 49  LNAGEARSIYVDDGWKSARIWPRTDC---DGNMNCATGNCGRREQCNGAGGEPPASLAEF 105

Query: 593 ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG-CRANLLPACPRQLQVRLRAR 417
            L +G      Y +SLVDG+N+P+ + P+ G+  C   G C  N+   CP  L VR   R
Sbjct: 106 TL-RGADGKDFYDVSLVDGYNIPVLIDPYGGEGDCRRAGGCFKNINDFCPGDLAVRKDGR 164

Query: 416 RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
                 VGC SGC A+  D+ CCR  +  P  C+ SR +  FK ACP+ ++YA+D  +S
Sbjct: 165 -----TVGCKSGCVAYNNDQECCRGAFGTPDKCRQSRTAMLFKDACPTAYSYAYDDATS 218



>gb:AY065642_1566570 Daucus carota thaumatin-like protein mRNA,
           complete cds.
          Length = 214

 Score =  151 bits (382), Expect = 2e-35
 Identities = 90/209 (43%), Positives = 110/209 (52%), Gaps = 2/209 (0%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNHG 681
           TIV+NCP+TIWPA    TG       GF L     +    P A WSGRIWART C     
Sbjct: 20  TIVDNCPNTIWPAALTGTGSQP-STTGFELASKATKPIDIP-APWSGRIWARTFCAA--- 74

Query: 680 RFTCATGDCD-GRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLTPH 507
             TC TG+C  G   C+G GGA P TL +F L+  G  DF  Y +S VDGFNLP+++TP 
Sbjct: 75  --TCLTGECGKGTGPCSGAGGAPPVTLVEFTLNGDGGKDF--YDVSNVDGFNLPVSITPE 130

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
           +    C    C AN+   CP   +V+       G  VGC S CA     E CC   +NN 
Sbjct: 131 NSP--CATTSCAANINEGCPAGQEVK----GPDGATVGCKSACAVTNKPEDCCTGEFNNA 184

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSS 240
             CK S  S +FK  CP  ++YA+D  SS
Sbjct: 185 EKCKPSASSKYFKGKCPQAYSYAYDDKSS 213



>pir|T21495|T21495 hypothetical protein F28D1.4 - Caenorhabditis
           elegans>gb:CEF28D1_1363099 Caenorhabditis elegans cosmid
           F28D1, complete sequence.
          Length = 234

 Score =  151 bits (382), Expect = 2e-35
 Identities = 93/226 (41%), Positives = 114/226 (50%), Gaps = 2/226 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           ITI+N C  TIWP I    G P    GGF L     R         +GRIWARTGC  N 
Sbjct: 22  ITILNKCKFTIWPGIL-GPGNPA--EGGFKLNAGEPRDIDVDDGWTAGRIWARTGCNEN- 77

Query: 683 GRFTCATGDCDGRLE-CNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLTP 510
             F C TG C  +L  CNG GG  PA+LA+F L+  G  DF  Y +SLVDG+NLP+ + P
Sbjct: 78  --FDCDTGSCGVKLRACNGAGGVPPASLAEFTLNGDGGKDF--YDVSLVDGYNLPVLIDP 133

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
           +DG       GC  ++   CP  L V+       G  V C  GC  + TDE CCR   N 
Sbjct: 134 NDGSGCDRAGGCVKDMNAECPADLAVQ----GSNGNTVACKFGCVGYNTDEECCRGVRNT 189

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           P  C  S  +  FK ACP+ ++YA+D  SS    C       + FC
Sbjct: 190 PETCDRSTTAQKFKDACPTAYSYAYDDKSSTF-TCQTGATYTVQFC 234



>sp|P83336|TP1B_MALDO Thaumatin-like protein 1b
           (Pathogenesis-related protein 5b) (PR-5b)
           (Fragment).>gb:AF494394_1805349 Malus x domestica
           thaumatine-like protein (PR-5b) mRNA, partial cds.
          Length = 212

 Score =  150 bits (380), Expect = 3e-35
 Identities = 84/219 (38%), Positives = 112/219 (51%), Gaps = 3/219 (1%)
 Frame = -1

Query: 839 HTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCAT 663
           +T+WP        P L    F L     +S  AP + WSGR W RT C  +  G+F+C T
Sbjct: 1   NTVWPGTLTGDQKPQLSLTAFELASKASQSVDAP-SPWSGRFWGRTRCSTDAAGKFSCET 59

Query: 662 GDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHC 489
            DC  G++ CNG G   PATL +  +   G  D+  Y +SLVDGFNLPM++ P  G   C
Sbjct: 60  ADCGSGQVACNGAGAVPPATLVEITIAANGGQDY--YDVSLVDGFNLPMSVAPQGGTGEC 117

Query: 488 PVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKAS 309
               C AN+  ACP QLQV+       G V+ C S C AF   + CC    + P  C  +
Sbjct: 118 KPSSCPANVNMACPAQLQVKA----ADGSVISCKSACLAFGDSKYCCTPPNDTPETCPPT 173

Query: 308 RYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            YS+ F+  CP  ++YA+D  +S    CS   +  I FC
Sbjct: 174 EYSEIFEKQCPQAYSYAYDDKNSTF-TCSGGPDYVITFC 211



>gb:CAR010501_1645119 Cicer arietinum L. mRNA for thaumatin-like
           protein PR-5b, partial.
          Length = 239

 Score =  149 bits (375), Expect = 1e-34
 Identities = 102/261 (39%), Positives = 135/261 (51%), Gaps = 7/261 (2%)
 Frame = -1

Query: 935 TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH 756
           +IL++TL  SL    T S  A     IVNNCP+T+W A  P  G   L+RG      +  
Sbjct: 3   SILTITL-CSLLFLLTPSQAANF--EIVNNCPYTVWAAASPGGGRR-LDRGQTWNLWVNA 58

Query: 755 RSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ- 582
            + +A       RIW RTGC  +  GR  C TGDC G L+C G  G  P TLA+F L+Q 
Sbjct: 59  GTSMA-------RIWGRTGCNFDGSGRGRCETGDCTGGLQCTG-WGVPPNTLAEFALNQY 110

Query: 581 GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGP 402
           G+ DF  Y +SLVDGFN+PM   P +G   C  + C A++   CP +L       R +G 
Sbjct: 111 GNLDF--YDISLVDGFNIPMDFFPINGG--CHKISCTADINGQCPNEL-------RAQG- 158

Query: 401 VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS 222
             GCN+ C  +KT+E CC N   +   C  + +S FFK  C   ++Y  D P+S    C 
Sbjct: 159 --GCNNPCTVYKTNEYCCTNGQGS---CGPTNFSTFFKDRCHDAYSYPQDDPTSTF-TCP 212

Query: 221 AARELKIIFC-----H*EYPL 174
           A    K++FC     H E PL
Sbjct: 213 AGSNYKVVFCPLGAPHIEMPL 233



>gb:AC103891_1737308 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1175C11, complete sequence.
          Length = 265

 Score =  148 bits (373), Expect = 2e-34
 Identities = 87/234 (37%), Positives = 118/234 (50%), Gaps = 9/234 (3%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           + T+ NNC +T+WPA         +  GGF L    + SF AP A WSGR+WART C  +
Sbjct: 31  VFTLRNNCTYTVWPATLSGNTAVAVGGGGFELSPGANVSFPAP-AGWSGRLWARTDCAPS 89

Query: 686 H-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
                 C TGDC G + C+  GGA P TLA+F L  G      Y +SLVDG+N+ + +  
Sbjct: 90  GTASLACVTGDCGGAVSCS-LGGAPPVTLAEFTLG-GTDGKDFYDVSLVDGYNVGIGVAA 147

Query: 509 HDGKEH---CPVVGCRANLLPACPRQLQVRLRARRGRG-----PVVGCNSGCAAFKTDEL 354
              + +   C   GC  ++   CP +LQV  +    +        V C S C AF T E 
Sbjct: 148 TGARVNRSTCGYAGCVGDVNALCPAELQVAGKENDQQSGAAATTTVACRSACEAFGTAEY 207

Query: 353 CCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           CC   +  P  C  +RYS  FK ACP+ ++YA+D P+S    C    +  I FC
Sbjct: 208 CCTGAHGGPDSCGPTRYSRLFKAACPAAYSYAYDDPTSTF-TCGTGAQYVITFC 260



>gb:AC137991_1743862 Oryza sativa chromosome 3 BAC OSJNBa0034D21
           genomic sequence, complete sequence.>gb:AC139174_1744028
           Oryza sativa chromosome 3 BAC OSJNBb0065L20 genomic
           sequence, complete sequence.
          Length = 232

 Score =  147 bits (372), Expect = 3e-34
 Identities = 89/253 (35%), Positives = 122/253 (48%), Gaps = 4/253 (1%)
 Frame = -1

Query: 938 ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT 759
           A  L+ +  ++L      S+       I N C +T+WPA  P+ G   L+ G      + 
Sbjct: 2   APSLATSSTLALFLLVAVSIADAATFAITNRCQYTVWPAAVPSGGGTKLDPGQTWTINV- 60

Query: 758 HRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ 582
                 P     GR+WARTGC  +  G   C TGDC G+L C   G AAP TLA+F L+Q
Sbjct: 61  ------PAGTTGGRVWARTGCGFDGSGNGQCQTGDCGGKLRCTAYG-AAPNTLAEFALNQ 113

Query: 581 -GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG--CRANLLPACPRQLQVRLRARRG 411
             + DF  + +SL+DGFN+PM   P      CP  G  C   + P CP +L         
Sbjct: 114 WNNLDF--FDISLIDGFNVPMAFLPAGSGAGCPKGGPRCATAITPQCPSEL--------- 162

Query: 410 RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH 231
           R P  GCN+ C  F+ D  CC  +  N   C  + YS+FFK  CP  ++Y  D  SS  +
Sbjct: 163 RAPG-GCNNACTVFRQDRYCCTGSAANS--CGPTNYSEFFKRLCPDAYSYPKDDASS-TY 218

Query: 230 ECSAARELKIIFC 192
            C A    +++FC
Sbjct: 219 TCPAGTNYQVVFC 231



>gb:AY512592_1332023 Schistocerca gregaria thaumatin-like protein 2
           (Tau2) mRNA, complete cds.
          Length = 241

 Score =  147 bits (371), Expect = 3e-34
 Identities = 86/222 (38%), Positives = 113/222 (50%), Gaps = 10/222 (4%)
 Frame = -1

Query: 887 ASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWA 708
           A+L  G      N    T+W     N G    + GG+ +   +  +     + W+GR W 
Sbjct: 14  AALSEGRRFVFENRRGETVWVGALGNAGKGTPKSGGWEMRPGSSVTIYVDDS-WAGRFWG 72

Query: 707 RTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFN 531
           RTGC  +  GR  C TGDC  RL CNG GG  PATLA+  L  G      Y +SLVDGFN
Sbjct: 73  RTGCSFDGSGRGRCRTGDCGNRLYCNGAGGQPPATLAEVTL-SGWGGQDYYDISLVDGFN 131

Query: 530 LPMTLTPHD---GKEH--CPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFK 366
           +P+T+ P D   G +H  C    CRA++   CP +L       R  G   GC S C AF 
Sbjct: 132 IPVTMEPIDRRGGGDHYRCNAASCRADINAQCPPEL-------RSDG---GCKSACLAFN 181

Query: 365 TDELCCRNNYNNPLMCKAS----RYSDFFKHACPSTFTYAHD 252
           TD+ CCR ++  P  C+AS     Y  FFK+ CP  ++YA+D
Sbjct: 182 TDQYCCRGSFGTPQTCRASSWPRNYPAFFKNLCPDAYSYAYD 223



>gb:AB081304_1524076 Cryptomeria japonica Cry j 3.2 mRNA for
           thaumatin-like protein, complete cds.
          Length = 233

 Score =  146 bits (369), Expect = 6e-34
 Identities = 83/224 (37%), Positives = 115/224 (51%), Gaps = 2/224 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           I N CP+T+W A  P         GG  L K    +   P     GR+WARTGC  +  G
Sbjct: 32  ITNQCPYTVWAAASPG--------GGRQLAKGQTWTIQVPAGTTGGRVWARTGCSFDRSG 83

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R TC TGDC+G L C G  G  PATLA++ L+Q + +   Y +SLVDGFN+P+++TP   
Sbjct: 84  RGTCQTGDCNGMLSCQGY-GQVPATLAEYALNQ-YMNLDFYDISLVDGFNVPISMTPTST 141

Query: 500 KEHCP-VVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
             +C   + C +++   CP +L+V            GC S CA + T + CC     N  
Sbjct: 142 NPNCKGRITCLSDINSKCPSELKVN----------GGCKSACARYNTAQYCCTGASAN-- 189

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  + YS FFK  CP  ++YA D  +S    C +    K++FC
Sbjct: 190 NCGPTNYSKFFKGQCPQAYSYAKDDATSTF-TCPSGTNYKVVFC 232



>gb:AY181253_1587593 Linum usitatissimum osmotin-like protein
           linusitin mRNA, complete cds.
          Length = 263

 Score =  146 bits (368), Expect = 7e-34
 Identities = 92/251 (36%), Positives = 126/251 (50%), Gaps = 4/251 (1%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGG-FALYKLTH 756
           IL + LF SL  +   S+    +I I NNCP+T+W A  P  G   L+ G  + +Y    
Sbjct: 6   ILLIPLFSSLLLWV--SITNAAVIDIFNNCPYTVWAASTPIGGGRQLDHGQTWTIYP--- 60

Query: 755 RSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG 579
                P      RIW R  C  +  GR  C TGDC G L C G  G  P TLA++ L+Q 
Sbjct: 61  -----PAGTSMARIWGRRNCNFDGSGRGWCETGDCGGVLNCQG-WGVPPNTLAEYALNQ- 113

Query: 578 HADFSTYGLSLVDGFNLPMTLTP--HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRG 405
            ++   Y +SLVDGFN+PM  TP  + G  +C  + C A++   CP +L         R 
Sbjct: 114 FSNLDFYDISLVDGFNIPMIFTPTANVGSGNCQSLTCTADINTQCPGEL---------RA 164

Query: 404 PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC 225
           P  GCN+ C  FKT+E CC   Y     C  + +S FFK  CP++++Y  D PSS    C
Sbjct: 165 PG-GCNNPCTVFKTNEYCCTQGYGT---CGPTGFSRFFKDRCPTSYSYPQDDPSSTF-TC 219

Query: 224 SAARELKIIFC 192
                 +++FC
Sbjct: 220 PGGTNYRVVFC 230



>pir|B86317|B86317 protein T10O22.21 [imported] - Arabidopsis
           thaliana>gb:AE005172_890788 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069551_1540962 Genomic sequence for
           Arabidopsis thaliana BAC T10O22 from chromosome I,
           complete sequence.
          Length = 221

 Score =  144 bits (363), Expect = 3e-33
 Identities = 88/253 (34%), Positives = 113/253 (44%), Gaps = 1/253 (0%)
 Frame = -1

Query: 947 AFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALY 768
           AF   +   + F +   F   SL A   +   N C H +WP IQP+ G  +L  GGF L 
Sbjct: 10  AFLLLLSHASDFSNTTIFVVVSLRAASTVIFYNKCKHPVWPGIQPSAGQNLLAGGGFKLP 69

Query: 767 KLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFE 591
                S   P   WSGR W R GC  +  GR  CATGDC G L CNG GG+         
Sbjct: 70  ANKAHSLQLP-PLWSGRFWGRHGCTFDRSGRGHCATGDCGGSLSCNGAGGSG-------- 120

Query: 590 LHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRG 411
                                            C   GC ++L   CP  LQV  R+R G
Sbjct: 121 --------------------------------QCSYAGCVSDLNQMCPVGLQV--RSRNG 146

Query: 410 RGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMH 231
           +  VV C S C+AF + + CC   + NP  CK + YS  FK ACP  ++YA+D P+S+  
Sbjct: 147 K-RVVACKSACSAFNSPQYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAYDDPTSIA- 204

Query: 230 ECSAARELKIIFC 192
            CS A  + + FC
Sbjct: 205 TCSKANYI-VTFC 216



>gb:ATU48698_1557035 Arabidopsis thaliana putative receptor
           serine/threonine kinase PR5K (PR5K) mRNA, complete cds.
          Length = 665

 Score =  144 bits (362), Expect = 4e-33
 Identities = 83/228 (36%), Positives = 114/228 (50%), Gaps = 5/228 (2%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH- 684
           TI N C +T+WP     T    L   GF+L K   R    P + WSGR+W R+ C  +  
Sbjct: 28  TIENKCDYTVWPGFLTMTTAVSLPTNGFSLKKGESRVINVPPS-WSGRLWGRSFCSTSST 86

Query: 683 GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHA-DFSTYGLSLVDGFNLPMTLTP 510
           G F+CATGDC  G++EC+  G   P TL  F L      DF  Y +S+VDG+NLP+ + P
Sbjct: 87  GNFSCATGDCGSGKIECSDSGARPPTTLIDFTLDATDGQDF--YDVSVVDGYNLPLVVVP 144

Query: 509 H--DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY 336
                   C  VGC  NL   CP +L+V   + +     + C + C  F   E CC   Y
Sbjct: 145 QRLGSGRTCSNVGCVVNLNKTCPSELKVMGSSNKEHP--IACMNACQKFGLPEFCCYGEY 202

Query: 335 NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             P  C+ + YS  FK+ CP  ++YA+D  ++    CS +    I FC
Sbjct: 203 GKPAKCQPTLYSTNFKNECPLAYSYAYDNENNTF-RCSNSPNYVITFC 249



>gb:AB005247_1509631 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MXA21.
          Length = 665

 Score =  144 bits (362), Expect = 4e-33
 Identities = 83/228 (36%), Positives = 114/228 (50%), Gaps = 5/228 (2%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH- 684
           TI N C +T+WP     T    L   GF+L K   R    P + WSGR+W R+ C  +  
Sbjct: 28  TIENKCDYTVWPGFLTMTTAVSLPTNGFSLKKGESRVINVPPS-WSGRLWGRSFCSTSST 86

Query: 683 GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHA-DFSTYGLSLVDGFNLPMTLTP 510
           G F+CATGDC  G++EC+  G   P TL  F L      DF  Y +S+VDG+NLP+ + P
Sbjct: 87  GNFSCATGDCGSGKIECSDSGARPPTTLIDFTLDATDGQDF--YDVSVVDGYNLPLVVVP 144

Query: 509 H--DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY 336
                   C  VGC  NL   CP +L+V   + +     + C + C  F   E CC   Y
Sbjct: 145 QRLGSGRTCSNVGCVVNLNKTCPSELKVMGSSNKEHP--IACMNACQKFGLPEFCCYGEY 202

Query: 335 NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             P  C+ + YS  FK+ CP  ++YA+D  ++    CS +    I FC
Sbjct: 203 GKPAKCQPTLYSTNFKNECPLAYSYAYDNENNTF-RCSNSPNYVITFC 249



>gb:AC024838_1204915 Caenorhabditis elegans cosmid Y59E9AL, complete
           sequence.
          Length = 234

 Score =  144 bits (362), Expect = 4e-33
 Identities = 80/224 (35%), Positives = 114/224 (50%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I I N CP  +WP I    G P  E GGF L    +R  ++    W G IW RT C    
Sbjct: 20  INIFNRCPFPVWPGIV-GPGNP--EGGGFRLGNEQNR-IISVEDGWEGVIWGRTLC---D 72

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD 504
            R  CATG C  R +CNG  G  P T+A+F L++ + D   Y +SL++G+N+P+ + P  
Sbjct: 73  SRMRCATGTCGNREQCNGTIGRFPFTVAEFSLNESN-DEDVYSVSLINGYNVPILIDPFG 131

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
           G+      GC +++   CP ++++    R     VVGC S C A ++D  CCR N+  P 
Sbjct: 132 GQGCRRAGGCVSDINDFCPERMRITSNRRSVNNNVVGCRSPCDALRSDRECCRGNFETPD 191

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  S  +  FK ACPS +++  D  +S    C    E  + FC
Sbjct: 192 KCFRSHVAQTFKDACPSAYSFLFDDATS-SFGCQTNAEYLVQFC 234



>gb:AF355458_1790706 Hordeum vulgare thaumatin-like protein TLP8
           mRNA, complete cds.
          Length = 233

 Score =  143 bits (361), Expect = 5e-33
 Identities = 90/248 (36%), Positives = 121/248 (48%), Gaps = 3/248 (1%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF 747
           SV L I L     A+  A    T++N C +T+W A  P  G   L+ G          S 
Sbjct: 8   SVLLPILLLVLVAATADAATF-TVINKCQYTVWAAAVPAGGGQKLDAG-------QTWSI 59

Query: 746 VAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHAD 570
             P    SGR+WARTGC  +  G   C TGDC G+L C  + G AP TLA+F L++ +  
Sbjct: 60  NVPAGTTSGRVWARTGCSFDGAGNGRCQTGDCGGKLRCT-QYGQAPNTLAEFGLNK-YMG 117

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG--CRANLLPACPRQLQVRLRARRGRGPVV 396
              + +SL+DG+N+PM+  P  G   CP  G  C   + PACP +L       R  G   
Sbjct: 118 QDFFDISLIDGYNVPMSFVPAPGSTGCPKGGPRCPKVITPACPNEL-------RAAG--- 167

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  FK D  CC  +  N   C  + YS FFK  CP  ++Y  D  +S+   C   
Sbjct: 168 GCNNACTVFKEDRYCCTGSAAN--SCGPTDYSRFFKGQCPDAYSYPKDDATSIF-TCPGG 224

Query: 215 RELKIIFC 192
              ++IFC
Sbjct: 225 TNYQVIFC 232



>gb:PME131731_1700768 Pseudotsuga menziesii mRNA for Thaumatin-like
           protein.
          Length = 234

 Score =  143 bits (360), Expect = 6e-33
 Identities = 83/228 (36%), Positives = 115/228 (50%), Gaps = 1/228 (0%)
 Frame = -1

Query: 872 GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCV 693
           G+ +T+ N C +T+W A  P         GG  L +    SF        GRIW RTGC 
Sbjct: 31  GVTMTVKNQCSYTVWAAGSPG--------GGKQLGQGETWSFDVAADTTGGRIWGRTGCS 82

Query: 692 LNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL 516
            +  G+ TC TGDC G L C G G   PATL ++ L++ + +     +SLVDGFNLP+T+
Sbjct: 83  FDATGKGTCNTGDCGGLLSCQGYG-TVPATLFEYGLNK-YMNLDFLDISLVDGFNLPLTV 140

Query: 515 TPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY 336
           TP +    C  + C +++   CP +L+V            GC S CA F T + CC  +Y
Sbjct: 141 TPSNSA--CKTISCTSDINAVCPSELKV----------TDGCKSACAEFNTPQYCCTGDY 188

Query: 335 NNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            N   C  S YS FFK  CP  ++YA D  +S    C+      ++FC
Sbjct: 189 LNN--CSPSDYSKFFKAQCPQAYSYAKDDATSTF-TCATGSNYNVVFC 233



>gb:NTOSPR_1691661 N.tabacum osmotin gene.
          Length = 246

 Score =  142 bits (359), Expect = 8e-33
 Identities = 94/253 (37%), Positives = 122/253 (48%), Gaps = 9/253 (3%)
 Frame = -1

Query: 905 LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
           L AF T +  A   I + NNCP+T+W A  P  G   L+RG   +         APR   
Sbjct: 12  LLAFVTCTYAA--TIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTK 62

Query: 725 SGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS 549
             RIW RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +    + +S
Sbjct: 63  MARIWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGLDFWDIS 120

Query: 548 LVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
           LVDGFN+PMT  P +   GK  C  + C AN+   CPR+L+V            GCN+ C
Sbjct: 121 LVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPRELRVP----------GGCNNPC 168

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
             F   + CC         C  + +S FFK  CP  ++Y  D P+S       +   K+I
Sbjct: 169 TTFGGQQYCCTQG-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGSTNYKVI 223

Query: 197 FC-----H*EYPL 174
           FC     H  +PL
Sbjct: 224 FCPNGQAHPNFPL 236



>gb:AY863027_1354252 Diaprepes abbreviatus PR-5-like protein
           (pr-5L-2) mRNA, complete cds.
          Length = 245

 Score =  142 bits (358), Expect = 1e-32
 Identities = 83/219 (37%), Positives = 112/219 (51%), Gaps = 11/219 (5%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC--VLNH 684
           I N     +W  IQ N   P L  GGF L      + +AP   W GR+W RTGC    NH
Sbjct: 24  ITNKGGEILWIGIQGNPNNPNLNNGGFKLNPGETITVLAPD-NWQGRLWGRTGCDDQTNH 82

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD 504
               C TGDC  +LEC G GG  P TL +  L +G +    Y +SLVDG+N+  ++ P +
Sbjct: 83  ----CVTGDCGDKLECAGSGGVPPVTLVEITL-KGDSGLDNYDVSLVDGYNIEASIEPVN 137

Query: 503 GKE-----HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNN 339
           G+       C    C  N+   CP +LQ     ++    VV C S C AF TDE CC+  
Sbjct: 138 GQSDGSDTSCKKGECGNNVNDQCPPELQ-----QKNGDQVVACKSACLAFNTDEYCCKGA 192

Query: 338 YNNPLMCKAS----RYSDFFKHACPSTFTYAHDTPSSLM 234
           ++    C+ S     Y+  FK+ACP+ ++YA+D P SLM
Sbjct: 193 HDTRETCQRSDWPTDYAAPFKNACPNAYSYAYDDPGSLM 231



>gb:AB081305_1524077 Cryptomeria japonica Cry j 3.3 mRNA for
           thaumatin-like protein, complete cds.
          Length = 230

 Score =  142 bits (357), Expect = 1e-32
 Identities = 86/246 (34%), Positives = 121/246 (49%), Gaps = 2/246 (0%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           + L  +L  F            I N CP+T+W A  P  G   L++G     ++   +  
Sbjct: 7   IALVAALSVFLHGMEVRAATFDITNQCPYTVWAAASPGGGQQ-LDQGQTWTIQVAAGTTQ 65

Query: 743 APRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           A       RIWARTGC  +  GR TC TGDC+G L C G  G  PATLA++ L+Q + + 
Sbjct: 66  A-------RIWARTGCSFDGSGRGTCQTGDCNGMLSCQGY-GQVPATLAEYALNQ-YMNL 116

Query: 566 STYGLSLVDGFNLPMTLTPHDGKEHCP-VVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
             Y +SLVDGFN+P+++TP     +C   + C +++   CP  L+V            GC
Sbjct: 117 DFYDISLVDGFNVPLSMTPTSTDPNCKGRIACLSDINSQCPSDLKV----------TGGC 166

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
            S CA + T E CC     N   C  + YS FFK  CP  ++YA D  +S    C +   
Sbjct: 167 KSACARYNTPEYCCTGASEN--TCGPTDYSKFFKGQCPQAYSYAKDDATSTF-TCPSGTN 223

Query: 209 LKIIFC 192
            K++FC
Sbjct: 224 YKVVFC 229



>gb:AX112127_1461377 Sequence 1 from Patent WO0127298.
          Length = 229

 Score =  142 bits (357), Expect = 1e-32
 Identities = 96/251 (38%), Positives = 129/251 (51%), Gaps = 4/251 (1%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNT--GYPVLERGGFALYKLT 759
           +LS+TL +S+  FT   L  G    ++N C + +W A    T  G   LE G    +++T
Sbjct: 8   LLSITL-LSIGCFT---LTRGATFDVINQCQYPVWAAWASTTPGGGKRLENG--QSWQIT 61

Query: 758 HRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ 582
               VAP      RIW RTGC  + +GR  C TGDC+G LEC G G A P TLA+F L+Q
Sbjct: 62  ----VAPGTA-QARIWGRTGCNFDANGRGRCDTGDCNGMLECQGYG-APPNTLAEFALNQ 115

Query: 581 -GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRG 405
             + DF    +SLVDGFN+PM  +P      C  + C  NL   CP +L+ +        
Sbjct: 116 DNNNDF--VDISLVDGFNIPMEFSPVGAS--CKTMRCAGNLNGECPNELRTQ-------- 163

Query: 404 PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC 225
              GCN+ C  +KT+E CC N    P  C  +  S FFK  CP  ++Y  D P+SL   C
Sbjct: 164 --GGCNNPCTVYKTNEYCCTNG---PGSCGPTPLSRFFKDRCPDAYSYPQDDPTSLF-TC 217

Query: 224 SAARELKIIFC 192
                 K++FC
Sbjct: 218 PGGTNYKVVFC 228



>gb:AB081303_1524075 Cryptomeria japonica Cry j 3.1 mRNA for
           thaumatin-like protein, complete cds.
          Length = 232

 Score =  141 bits (355), Expect = 2e-32
 Identities = 84/246 (34%), Positives = 118/246 (47%), Gaps = 2/246 (0%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           + L  +L  F            I N CP+T+W A  P         GG  L K    +  
Sbjct: 9   IALVATLSVFLQGINVKAATFDITNQCPYTVWAAASPG--------GGRQLAKGQTWTIQ 60

Query: 743 APRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
                  GR+WARTGC  +  GR TC TGDC+G L C G  G  PATLA++ L++   + 
Sbjct: 61  VAAGTTGGRVWARTGCSFDGSGRGTCQTGDCNGMLSCQGY-GQVPATLAEYGLNK-FQNL 118

Query: 566 STYGLSLVDGFNLPMTLTPHDGKEHCP-VVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
             Y +SLVDGFN+P+++TP     +C   + C +++   CP +L+V            GC
Sbjct: 119 DFYDISLVDGFNVPLSMTPTSTNPNCKGRITCLSHINSMCPAELKVN----------GGC 168

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
            S CA + T + CC     N   C  + YS FFK  CP  ++YA D  +S    C +   
Sbjct: 169 KSACARYNTAQYCCTGASAN--NCGPTNYSKFFKGQCPQAYSYAKDDATSTF-TCPSGTN 225

Query: 209 LKIIFC 192
            K++FC
Sbjct: 226 YKVVFC 231



>gb:AY795850_1628491 Thuja occidentalis thaumatin-like protein mRNA,
           complete cds.
          Length = 230

 Score =  140 bits (354), Expect = 3e-32
 Identities = 93/251 (37%), Positives = 129/251 (51%), Gaps = 2/251 (0%)
 Frame = -1

Query: 938 ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT 759
           A +L   L ISLC     ++       I N C +T+W A  P  G   L++G       T
Sbjct: 8   ALLLVAGLAISLCTQEAGAVK----FNIRNQCGYTVWAAGLPGGGKQ-LDQGQ------T 56

Query: 758 HRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ 582
               VA   +   R W RTGC  +  GR +C TGDC G+L C    GA PATLA++ L+ 
Sbjct: 57  WSVDVAAGTK-GARFWGRTGCSFDGSGRGSCQTGDCGGQLSCT-LSGAVPATLAEYSLN- 113

Query: 581 GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGP 402
           G+ +   Y +SLVDGFN+P+++ P +    C    C+A++  ACP +L+V          
Sbjct: 114 GNDNKDFYDVSLVDGFNVPLSINPTN--TGCTAPACKADVNAACPAELKVNS-------- 163

Query: 401 VVGCNSGCAAFKTDELCCRN-NYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC 225
             GCNS C  F+TD+ CCR  N +N   C A+ YS  FK+ CP  ++YA D  SS     
Sbjct: 164 --GCNSACNVFQTDQYCCRGANVDN---CPATNYSMIFKNQCPQAYSYAKDDTSSTFTCP 218

Query: 224 SAARELKIIFC 192
           S   +  I+FC
Sbjct: 219 SGTTDYSIVFC 229



>gb:AY093595_1575354 Lycopersicon esculentum PR-5x (PR-5) mRNA,
           complete cds.
          Length = 226

 Score =  140 bits (354), Expect = 3e-32
 Identities = 88/248 (35%), Positives = 123/248 (49%), Gaps = 4/248 (1%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           +  F++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 9   IFFFLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 56

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     RIW RT C  N  GR +C TGDC G L C G  G  P TLA++ L Q  ++ 
Sbjct: 57  APRGTKMARIWGRTNCNFNGAGRGSCQTGDCGGVLHCTG-WGKPPNTLAEYALDQ-FSNL 114

Query: 566 STYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
             + +SLVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V            
Sbjct: 115 DFWDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPSPLRVP----------G 162

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +++S FFK  CP+ ++Y  D P+SL    S +
Sbjct: 163 GCNNPCTTFGGQQYCCTQG-----PCGPTKFSRFFKQRCPNAYSYPQDDPTSLFTCPSGS 217

Query: 215 RELKIIFC 192
              +++FC
Sbjct: 218 TNYRVVFC 225



>sp|P33679|ZEAM_MAIZE Zeamatin precursor.>pir|T02075|T02075
           antifungal zeamatin-like protein -
           maize>gb:ZMU06831_1732060 Zea mays B73 antifungal
           zeamatin-like protein mRNA, complete cds.
          Length = 227

 Score =  140 bits (354), Expect = 3e-32
 Identities = 91/250 (36%), Positives = 126/250 (50%), Gaps = 2/250 (0%)
 Frame = -1

Query: 935 TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH 756
           ++  V +F++L A    +     + T+VN CP T+W A  P  G   L RG    +++T 
Sbjct: 4   SVAIVGIFVALLAVAGEAA----VFTVVNQCPFTVWAASVPVGGGRQLNRG--ESWRIT- 56

Query: 755 RSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ- 582
               AP    + RIWARTGC  +  GR +C TGDC G L+C G G  AP TLA++ L Q 
Sbjct: 57  ----APAGTTAARIWARTGCKFDASGRGSCRTGDCGGVLQCTGYG-RAPNTLAEYALKQF 111

Query: 581 GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGP 402
            + DF  + +SL+DGFN+PM+  P  G       GC     P C   +  R  A   +  
Sbjct: 112 NNLDF--FDISLIDGFNVPMSFLPDGGS------GCSRG--PRCAVDVNARCPAELRQDG 161

Query: 401 VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS 222
           V  CN+ C  FK DE CC  +  N   C  + YS +FK  CP  ++Y  D  +S    C 
Sbjct: 162 V--CNNACPVFKKDEYCCVGSAAND--CHPTNYSRYFKGQCPDAYSYPKDDATSTF-TCP 216

Query: 221 AARELKIIFC 192
           A    K++FC
Sbjct: 217 AGTNYKVVFC 226



>sp|P50702|OS81_SOLCO Osmotin-like protein OSML81 precursor
           (PA81).>pir|S33196|S33196 osmotin-like protein -
           Commerson's wild potato>gb:SC81OLP_1705515 S.commersonii
           (pOSML81) gene for osmotin-like protein.
          Length = 247

 Score =  140 bits (354), Expect = 3e-32
 Identities = 89/248 (35%), Positives = 118/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L  +   SL AF T +  A   I + NNCP+T+W A  P  G   L +G   +       
Sbjct: 4   LRSSFIFSLLAFVTYTYAA--TIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN----- 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
             APR     RIW RTGC  N  GR +C TGDC G L+C G  G  P TLA++ L Q  +
Sbjct: 57  --APRGTKMARIWGRTGCNFNAAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FS 112

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +SLVDGFN+PMT  P       C  + C AN+   CPR L+V            
Sbjct: 113 NLDFWDISLVDGFNIPMTFAPTKPSAGKCHAIHCTANINGECPRALKVP----------G 162

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +
Sbjct: 163 GCNNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPSGS 217

Query: 215 RELKIIFC 192
              +++FC
Sbjct: 218 TNYRVVFC 225



>gb:AP003219_1825461 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBb0032H19.>gb:AP003338_1828222 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OJ1212_B09.
          Length = 652

 Score =  140 bits (353), Expect = 4e-32
 Identities = 91/254 (35%), Positives = 118/254 (46%), Gaps = 7/254 (2%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTAS-LPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH 756
           +L + L  ++ A TT +   A   + I N CP T+WPA  P  G   L+ G       T 
Sbjct: 15  LLPLLLLAAIVATTTTNHAAAAATLNITNLCPFTVWPAAVPVGGGRRLDPG-------TS 67

Query: 755 RSFVAPRARWSGRIWARTGCVLNH--GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ 582
            +   P     GR+WARTGC  +      TC TGDC G L C G G   P TLA+F L Q
Sbjct: 68  WALDVPAGAAPGRVWARTGCTFDATGANGTCLTGDCGGALSCTGYG-EPPQTLAEFSLGQ 126

Query: 581 GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG----CRANLLPACPRQLQVRLRARR 414
                  + +SLVDGFN+PM   P    +  P       C AN+   CP +L       R
Sbjct: 127 ADGQ-DLFDISLVDGFNVPMDFLPAPPPDQSPPCSKGPRCPANVTAQCPGEL-------R 178

Query: 413 GRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLM 234
             G   GCNS C  FK D+ CC  N  N   C+ + YS  F   CP  ++Y+ +  SS  
Sbjct: 179 AHG---GCNSACRVFKQDKYCCTGNGTN--TCEPTTYSLPFVRMCPDAYSYSRNDASSPG 233

Query: 233 HECSAARELKIIFC 192
             C +    +IIFC
Sbjct: 234 FTCPSGTNYQIIFC 247



>gb:AY737310_1626054 Solanum phureja osmotin-like protein (OSM-5a),
           osmotin-like protein (OSM-3b), osmotin-like protein
           (OSM-3f), and osmotin-like protein (OSM-3c) genes,
           complete cds.
          Length = 247

 Score =  140 bits (353), Expect = 4e-32
 Identities = 89/248 (35%), Positives = 117/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L  +   SL AF T +  A   I + NNCP+T+W A  P  G   L +G   +       
Sbjct: 4   LRSSFIFSLLAFVTYTYAA--TIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN----- 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
             APR     RIW RTGC  N  GR +C TGDC G L+C G  G  P TLA++ L Q  +
Sbjct: 57  --APRGTKMARIWGRTGCNFNAAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FS 112

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +SLVDGFN+PMT  P       C  + C AN+   CPR L+V            
Sbjct: 113 NLDFWDISLVDGFNIPMTFAPTKPSAGKCHAIHCTANINGECPRALKVP----------G 162

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S       +
Sbjct: 163 GCNNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGS 217

Query: 215 RELKIIFC 192
              K++FC
Sbjct: 218 TNYKVVFC 225



>sp|P81295|PRR3_JUNAS Pathogenesis-related protein precursor (Pollen
           allergen Jun a 3).>gb:AF121776_1769825 Juniperus ashei
           allergen Jun a 3 mRNA, complete cds.
          Length = 225

 Score =  140 bits (353), Expect = 4e-32
 Identities = 90/251 (35%), Positives = 129/251 (51%), Gaps = 2/251 (0%)
 Frame = -1

Query: 938 ATILSVTLFISLCAFTTASLPAGLI-ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKL 762
           A +L+ TL ISL         AG++   I N C +T+W A  P  G   L++G      L
Sbjct: 8   AFLLAATLAISL-----HMQEAGVVKFDIKNQCGYTVWAAGLPGGGKR-LDQGQTWTVNL 61

Query: 761 THRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELH 585
              +        S R W RTGC  +  G+ +C TGDC G+L C    GA PATLA++   
Sbjct: 62  AAGTA-------SARFWGRTGCTFDASGKGSCQTGDCGGQLSCTV-SGAVPATLAEYT-- 111

Query: 584 QGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRG 405
              +D   Y +SLVDGFN+P+ + P + +  C    C+A++   CP +L+V         
Sbjct: 112 --QSDQDYYDVSLVDGFNIPLAINPTNAQ--CTAPACKADINAVCPSELKVD-------- 159

Query: 404 PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC 225
              GCNS C  FKTD+ CCRN Y +   C A+ YS  FK+ CP  ++YA D  ++    C
Sbjct: 160 --GGCNSACNVFKTDQYCCRNAYVD--NCPATNYSKIFKNQCPQAYSYAKDDTATF--AC 213

Query: 224 SAARELKIIFC 192
           ++  +  I+FC
Sbjct: 214 ASGTDYSIVFC 224



>sp|P12670|NP24_LYCES NP24 protein precursor (Pathogenesis-related
           protein PR P23) (Salt- induced
           protein).>gb:AF093743_1767718 Lycopersicon esculentum
           pathogenesis-related protein osmotin precursor (NP24)
           gene, complete cds.
          Length = 247

 Score =  140 bits (353), Expect = 4e-32
 Identities = 91/249 (36%), Positives = 117/249 (46%), Gaps = 4/249 (1%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF 747
           S  LF  LC   T +      I + NNCP+T+W A  P  G   L RG   +        
Sbjct: 7   SFVLFFLLCVTYTYAAT----IEVRNNCPYTVWAASTPIGGGRRLNRGQTWVIN------ 56

Query: 746 VAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHAD 570
            APR     RIW RTGC  N  GR TC TGDC G L+C G  G  P TLA++ L Q  ++
Sbjct: 57  -APRGTKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSN 113

Query: 569 FSTYGLSLVDGFNLPMTLTP---HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
              + +SLVDGFN+PMT  P     GK  C  + C AN+   CPR L+V           
Sbjct: 114 LDFWDISLVDGFNIPMTFAPTKPSGGK--CHAIHCTANINGECPRALKVP---------- 161

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S       
Sbjct: 162 GGCNNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGG 216

Query: 218 ARELKIIFC 192
           +   +++FC
Sbjct: 217 STNYRVVFC 225



>gb:TOMNP24_1725671 Tomato NP24 protein mRNA, 3' end.
          Length = 239

 Score =  139 bits (350), Expect = 9e-32
 Identities = 90/246 (36%), Positives = 116/246 (47%), Gaps = 4/246 (1%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           LF  LC   T +      I + NNCP+T+W A  P  G   L RG   +         AP
Sbjct: 2   LFFLLCVTYTYAAT----IEVRNNCPYTVWAASTPIGGGRRLNRGQTWVIN-------AP 50

Query: 737 RARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST 561
           R     RIW RTGC  N  GR TC TGDC G L+C G  G  P TLA++ L Q  ++   
Sbjct: 51  RGTKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDF 108

Query: 560 YGLSLVDGFNLPMTLTP---HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
           + +SLVDGFN+PMT  P     GK  C  + C AN+   CPR L+V            GC
Sbjct: 109 WDISLVDGFNIPMTFAPTKPSGGK--CHAIHCTANINGECPRALKVP----------GGC 156

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
           N+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S       +  
Sbjct: 157 NNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTN 211

Query: 209 LKIIFC 192
            +++FC
Sbjct: 212 YRVVFC 217



>gb:S44889_1704169 osmotin=pathogenesis-related protein homolog
           [Nicotiana tabacum=tobacco, cv Samsun nn, floral bud day
           7 explant, mRNA Partial, 928 nt].
          Length = 244

 Score =  139 bits (350), Expect = 9e-32
 Identities = 91/259 (35%), Positives = 124/259 (47%), Gaps = 9/259 (3%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V   ++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 7   VFFLLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 54

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     R+W RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +  
Sbjct: 55  APRGTKMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGL 112

Query: 566 STYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
             + +SLVDGFN+PMT  P +   GK  C  + C AN+   CPR+L+V            
Sbjct: 113 DFWDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPRELRVP----------G 160

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  + +S FFK  CP  ++Y  D P+S       +
Sbjct: 161 GCNNPCTTFGGQQYCCTQG-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGS 215

Query: 215 RELKIIFC-----H*EYPL 174
              ++IFC     H  +PL
Sbjct: 216 TNYRVIFCPNGQAHPNFPL 234



>gb:AY743930_1626550 Solanum phureja osmotin-like protein A81 mRNA,
           complete cds.
          Length = 247

 Score =  139 bits (350), Expect = 9e-32
 Identities = 88/248 (35%), Positives = 117/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L  +   SL +F T +  A   I + NNCP+T+W A  P  G   L +G   +       
Sbjct: 4   LRSSFIFSLASFVTYTYAA--TIEVRNNCPYTVWAASXPIGGGRRLNKGQTWVIN----- 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
             APR     RIW RTGC  N  GR +C TGDC G L+C G  G  P TLA++ L Q  +
Sbjct: 57  --APRGTKMARIWGRTGCNFNAAGRGSCQTGDCRGVLQCTG-WGKPPNTLAEYALDQ-FS 112

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +SLVDGFN+PMT  P       C  + C AN+   CPR L+V            
Sbjct: 113 NLDFWDISLVDGFNIPMTFAPTKPSAGKCHAIHCTANINGECPRALKVP----------G 162

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S       +
Sbjct: 163 GCNNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGS 217

Query: 215 RELKIIFC 192
              K++FC
Sbjct: 218 TNYKVVFC 225



>gb:AY737312_1626059 Solanum tuberosum osmotin-like protein (OSM-1g)
           and osmotin-like protein (OSM-1h) genes, complete cds.
          Length = 226

 Score =  139 bits (350), Expect = 9e-32
 Identities = 89/250 (35%), Positives = 123/250 (49%), Gaps = 4/250 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+ +  +   AF T +  A   I + NNCP+T+W A  P  G   L+RG   +       
Sbjct: 4   LTSSFILFFLAFVTYTYAA--TIEVRNNCPYTVWVASTPIGGGRRLDRGQTWVIN----- 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
             APR     RIW RT C  N  GR +C TGDC G L+C G  G  P TLA++ L Q  +
Sbjct: 57  --APRGTKMARIWGRTNCNFNGAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FS 112

Query: 572 DFSTYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGP 402
           +   + +SLVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V          
Sbjct: 113 NLDFWDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGPLRVP--------- 161

Query: 401 VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS 222
             GCN+ C  F   + CC         C  + +S FFK  CP+ ++Y  D P+SL    S
Sbjct: 162 -GGCNNPCTTFGGQQYCCTQG-----PCGPTNFSRFFKQRCPNAYSYPQDDPTSLFTCPS 215

Query: 221 AARELKIIFC 192
            +   +++FC
Sbjct: 216 GSTNYRVVFC 225



>gb:AY007309_1557875 Solanum dulcamara cryoprotective osmotin-like
           protein mRNA, complete cds.
          Length = 248

 Score =  139 bits (350), Expect = 9e-32
 Identities = 91/246 (36%), Positives = 120/246 (48%), Gaps = 4/246 (1%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           L   L AF T +  A   I + NNCP+T+W A  P  G   L+RG   +         AP
Sbjct: 9   LVFFLLAFVTYTYAA--TIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------AP 59

Query: 737 RARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST 561
           R     RIW RTGC  N  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   
Sbjct: 60  RGTKMARIWGRTGCNFNGAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDF 117

Query: 560 YGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
           + +SLVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GC
Sbjct: 118 WDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGC 165

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
           N+ C  F   + CC     NP     +  S FFK  CP  ++Y  D P+S     S +  
Sbjct: 166 NNPCTTFGGQQYCCTQGPCNP-----TDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTN 220

Query: 209 LKIIFC 192
            +++FC
Sbjct: 221 YRVVFC 226



>pir|S30157|S30157 osmotin precursor - common
           tobacco>gb:NTAP24G_1691466 N.tabacum ap24 gene.
          Length = 250

 Score =  139 bits (350), Expect = 9e-32
 Identities = 91/259 (35%), Positives = 124/259 (47%), Gaps = 9/259 (3%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V   ++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 13  VFFLLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 60

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     R+W RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +  
Sbjct: 61  APRGTKMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGL 118

Query: 566 STYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
             + +SLVDGFN+PMT  P +   GK  C  + C AN+   CPR+L+V            
Sbjct: 119 DFWDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPRELRVP----------G 166

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  + +S FFK  CP  ++Y  D P+S       +
Sbjct: 167 GCNNPCTTFGGQQYCCTQG-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGS 221

Query: 215 RELKIIFC-----H*EYPL 174
              ++IFC     H  +PL
Sbjct: 222 TNYRVIFCPNGQAHPNFPL 240



>pir|S07406|S07406 thaumatin homolog NP24 precursor - tomato
           (fragment)
          Length = 239

 Score =  139 bits (350), Expect = 9e-32
 Identities = 90/246 (36%), Positives = 116/246 (47%), Gaps = 4/246 (1%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           LF  LC   T +      I + NNCP+T+W A  P  G   L RG   +         AP
Sbjct: 2   LFFLLCVTYTYAAT----IEVRNNCPYTVWAASTPIGGGRRLNRGQTWVIN-------AP 50

Query: 737 RARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST 561
           R     RIW RTGC  N  GR TC TGDC G L+C G  G  P TLA++ L Q  ++   
Sbjct: 51  RGTKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDF 108

Query: 560 YGLSLVDGFNLPMTLTP---HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
           + +SLVDGFN+PMT  P     GK  C  + C AN+   CPR L+V            GC
Sbjct: 109 WDISLVDGFNIPMTFAPTKPSGGK--CHAIHCTANINGECPRALKVP----------GGC 156

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
           N+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S       +  
Sbjct: 157 NNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTN 211

Query: 209 LKIIFC 192
            +++FC
Sbjct: 212 YRVVFC 217



>sp|P14170|OSMO_TOBAC Osmotin precursor.>gb:A16780_1447685
           osmotin-like protein gene seq ID No:
           5.>gb:A83550_1450984 Sequence 1 from Patent
           WO9849331.>gb:NTAP24_1691465 N.tabacum mRNA
           ap24.>gb:S40046_1704122 abscisic acid-activated
           [Nicotiana tabacum L.=tobacco, leaf, Genomic, 3033 nt].
          Length = 246

 Score =  139 bits (350), Expect = 9e-32
 Identities = 91/259 (35%), Positives = 124/259 (47%), Gaps = 9/259 (3%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V   ++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 9   VFFLLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 56

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     R+W RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +  
Sbjct: 57  APRGTKMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGL 114

Query: 566 STYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
             + +SLVDGFN+PMT  P +   GK  C  + C AN+   CPR+L+V            
Sbjct: 115 DFWDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPRELRVP----------G 162

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  + +S FFK  CP  ++Y  D P+S       +
Sbjct: 163 GCNNPCTTFGGQQYCCTQG-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGS 217

Query: 215 RELKIIFC-----H*EYPL 174
              ++IFC     H  +PL
Sbjct: 218 TNYRVIFCPNGQAHPNFPL 236



>gb:OSU77657_1698518 Oryza sativa pathogenesis-related
           thaumatin-like protein mRNA, complete cds.
          Length = 238

 Score =  139 bits (349), Expect = 1e-31
 Identities = 90/264 (34%), Positives = 123/264 (46%), Gaps = 3/264 (1%)
 Frame = -1

Query: 974 TTSTEQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPV 795
           T  T+ MA +  AT  ++ LF+        S+       I N C +T+WPA  P+ G   
Sbjct: 2   TKKTKAMAPSL-ATSSTLALFL----LVAVSIADAATFAITNRCQYTVWPAAVPSGGGTK 56

Query: 794 LERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAA 615
           L+ G      +       P     GR+WA        G   C TGDC G+L C    GAA
Sbjct: 57  LDPGQTWTINV-------PAGTTGGRVWAGRCGFDGSGNGQCETGDCGGKLRCTAY-GAA 108

Query: 614 PATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG--CRANLLPACPR 444
           P TLA+F L+Q  + DF  + +SL+DGFN+PM   P      CP  G  C   + P CP 
Sbjct: 109 PNTLAEFALNQWNNLDF--FDISLIDGFNVPMAFLPAGSGAGCPKGGPRCATAITPQCPS 166

Query: 443 QLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFT 264
           +L         R P  GCN+ C  F+ D  CC  +  N   C  + YS+FFK  CP  ++
Sbjct: 167 EL---------RAP-GGCNNACTVFRQDRYCCTGSAAN--SCGPTNYSEFFKRLCPDAYS 214

Query: 263 YAHDTPSSLMHECSAARELKIIFC 192
           Y  D  SS  + C A    +++FC
Sbjct: 215 YPKDDASS-TYTCPAGTNYQVVFC 237



>gb:AY737310_1626053 Solanum phureja osmotin-like protein (OSM-5a),
           osmotin-like protein (OSM-3b), osmotin-like protein
           (OSM-3f), and osmotin-like protein (OSM-3c) genes,
           complete cds.
          Length = 247

 Score =  139 bits (349), Expect = 1e-31
 Identities = 89/250 (35%), Positives = 123/250 (49%), Gaps = 4/250 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L  +   SL AF T +    + I + NNCP+ +W A  P  G   L+RG   +       
Sbjct: 4   LRSSFVFSLLAFVTFTY--AVTIEVRNNCPYIVWAASTPIGGGRRLDRGQTWVID----- 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
             APR     RIW RTGC  +  GR +C TGDC G L+C G  G  P TLA++ L Q  +
Sbjct: 57  --APRGTTMARIWGRTGCNFDGAGRGSCMTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FS 112

Query: 572 DFSTYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGP 402
           +   + +SLVDGFN+PMT  P +   GK  C  + C AN+   CP QL+V          
Sbjct: 113 NLDFWDISLVDGFNIPMTFAPTNPSGGK--CHAIQCTANINGECPGQLKVP--------- 161

Query: 401 VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECS 222
             GCN+ C  F   + CC         C  + +S+FFK  CP  ++Y  D P+S     S
Sbjct: 162 -GGCNNPCTTFGGQQYCCTQG-----PCGPTFFSNFFKQRCPDAYSYPQDDPTSTFTCPS 215

Query: 221 AARELKIIFC 192
            +   +++FC
Sbjct: 216 GSTNYRVVFC 225



>pir|T04166|T04166 thaumatin-like protein - rice
          Length = 238

 Score =  139 bits (349), Expect = 1e-31
 Identities = 90/264 (34%), Positives = 123/264 (46%), Gaps = 3/264 (1%)
 Frame = -1

Query: 974 TTSTEQMAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPV 795
           T  T+ MA +  AT  ++ LF+        S+       I N C +T+WPA  P+ G   
Sbjct: 2   TKKTKAMAPSL-ATSSTLALFL----LVAVSIADAATFAITNRCQYTVWPAAVPSGGGTK 56

Query: 794 LERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAA 615
           L+ G      +       P     GR+WA        G   C TGDC G+L C    GAA
Sbjct: 57  LDPGQTWTINV-------PAGTTGGRVWAGRCGFDGSGNGQCETGDCGGKLRCTAY-GAA 108

Query: 614 PATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG--CRANLLPACPR 444
           P TLA+F L+Q  + DF  + +SL+DGFN+PM   P      CP  G  C   + P CP 
Sbjct: 109 PNTLAEFALNQWNNLDF--FDISLIDGFNVPMAFLPAGSGAGCPKGGPRCATAITPQCPS 166

Query: 443 QLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFT 264
           +L         R P  GCN+ C  F+ D  CC  +  N   C  + YS+FFK  CP  ++
Sbjct: 167 EL---------RAP-GGCNNACTVFRQDRYCCTGSAAN--SCGPTNYSEFFKRLCPDAYS 214

Query: 263 YAHDTPSSLMHECSAARELKIIFC 192
           Y  D  SS  + C A    +++FC
Sbjct: 215 YPKDDASS-TYTCPAGTNYQVVFC 237



>pir|S33197|S33197 osmotin-like protein precursor (clone pA81) -
           Commerson's wild potato>gb:SCA81OLP_1706438
           S.commersonii (pA81) mRNA for osmotin-like protein.
          Length = 247

 Score =  139 bits (349), Expect = 1e-31
 Identities = 89/248 (35%), Positives = 117/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L  +   SL AF T +  A   I + NNCP+T+W A  P  G   L +G   +       
Sbjct: 4   LRSSFIFSLLAFVTYTYAA--TIEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN----- 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
             APR     RIW RTGC  N  GR +C TGDC G L C G  G  P TLA++ L Q  +
Sbjct: 57  --APRGTKMARIWGRTGCNFNAAGRGSCQTGDCGGVLLCTG-WGKPPNTLAEYALDQ-FS 112

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +SLVDGFN+PMT  P       C  + C AN+   CPR L+V            
Sbjct: 113 NLDFWDISLVDGFNIPMTFAPTKPSAGKCHAIHCTANINGECPRALKVP----------G 162

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +
Sbjct: 163 GCNNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPSGS 217

Query: 215 RELKIIFC 192
              +++FC
Sbjct: 218 TNYRVVFC 225



>sp|P13046|PRR1_TOBAC Pathogenesis-related protein R major form
           precursor (Thaumatin-like protein
           E22).>pir|JH0230|JH0230 pathogenesis-related protein R
           precursor - common tobacco>gb:NTE22TLP_1691544 Tobacco
           E22 gene for a thaumatin-like
           protein.>gb:NTPRRMAJ_1691732 N. tabacum mRNA for
           pathogenesis-related protein R major form.
          Length = 226

 Score =  139 bits (349), Expect = 1e-31
 Identities = 85/223 (38%), Positives = 110/223 (49%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           IVN C +T+W A  P         GG  L      S          RIW RT C  +  G
Sbjct: 30  IVNKCTYTVWAAASPG--------GGRRLDSGQSWSINVNPGTVQARIWGRTNCNFDGSG 81

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TGDC+G LEC G  G AP TLA+F L+Q + DF    +SLVDGFN+PM  +P +G
Sbjct: 82  RGNCETGDCNGMLECQGY-GKAPNTLAEFALNQPNQDF--VDISLVDGFNIPMEFSPTNG 138

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  + C A +   CP QL+ +           GCN+ C   KT+E CC    N P  
Sbjct: 139 --GCRNLRCTAPINEQCPAQLKTQ----------GGCNNPCTVIKTNEYCCT---NGPGS 183

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  +  S FFK  CP  ++Y  D P+SL   C +    +++FC
Sbjct: 184 CGPTDLSRFFKERCPDAYSYPQDDPTSLF-TCPSGTNYRVVFC 225



>gb:AY353703_1601805 Juniperus rigida PR5 allergen Jun r 3.1
           precursor, mRNA, complete cds.
          Length = 225

 Score =  138 bits (348), Expect = 2e-31
 Identities = 84/244 (34%), Positives = 125/244 (51%), Gaps = 2/244 (0%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLI-ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVA 741
           L ++  A +     AG +   I N C +T+W A  P  G  + +   + L      +  A
Sbjct: 10  LLVATLAISLHMQEAGAVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTL------NLAA 63

Query: 740 PRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFS 564
             A  S R W RTGC  +  G+ +C TGDC G+L C    GA PATLA++      +D  
Sbjct: 64  GTA--SARFWGRTGCTFDASGKGSCKTGDCGGQLSCTV-SGAVPATLAEYT----QSDQD 116

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            Y +SLVDGFN+P+ + P + +  C    C+A++   CP +L+V            GCNS
Sbjct: 117 YYDVSLVDGFNIPLAINPTNAQ--CTAPACKADINAVCPSELKVE----------GGCNS 164

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C  F+TD+ CCRN Y +   C A+ YS  FK+ CP  ++YA D  ++    C++  +  
Sbjct: 165 ACNVFQTDQYCCRNAYVD--NCPATNYSKIFKNQCPQAYSYAKDDTATF--ACASGTDYS 220

Query: 203 IIFC 192
           I+FC
Sbjct: 221 IVFC 224



>gb:A16782_1447686 osmotin-like protein gene without 20 C- terminal
           amino acids.
          Length = 226

 Score =  138 bits (348), Expect = 2e-31
 Identities = 88/248 (35%), Positives = 120/248 (48%), Gaps = 4/248 (1%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V   ++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 9   VFFLLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 56

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     R+W RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +  
Sbjct: 57  APRGTKMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGL 114

Query: 566 STYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
             + +SLVDGFN+PMT  P +   GK  C  + C AN+   CPR+L+V            
Sbjct: 115 DFWDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPRELRVP----------G 162

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  + +S FFK  CP  ++Y  D P+S       +
Sbjct: 163 GCNNPCTTFGGQQYCCTQG-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGS 217

Query: 215 RELKIIFC 192
              ++IFC
Sbjct: 218 TNYRVIFC 225



>gb:AY353704_1601806 Juniperus rigida PR5 allergen Jun r 3.2
           precursor, mRNA, complete cds.
          Length = 225

 Score =  138 bits (347), Expect = 2e-31
 Identities = 84/244 (34%), Positives = 125/244 (51%), Gaps = 2/244 (0%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLI-ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVA 741
           L ++  A +     AG +   I N C +T+W A  P  G  + +   + L      +  A
Sbjct: 10  LLVATLAISLHMQEAGAVKFDIRNQCGYTVWAAGLPGGGKRLDQGQTWTL------NLAA 63

Query: 740 PRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFS 564
             A  S R W RTGC  +  G+ +C TGDC G+L C    GA PATLA++      +D  
Sbjct: 64  GTA--SARFWGRTGCTFDASGKGSCKTGDCGGQLSCTV-SGAVPATLAEYT----QSDQD 116

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            Y +SLVDGFN+P+ + P + +  C    C+A++   CP +L+V            GCNS
Sbjct: 117 YYDVSLVDGFNIPLAINPTNAQ--CTAPACKADINAVCPSELKVE----------GGCNS 164

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C  F+TD+ CCRN Y +   C A+ YS  FK+ CP  ++YA D  ++    C++  +  
Sbjct: 165 ACNVFQTDQYCCRNAYVD--NCPATNYSKIFKNQCPQAYSYAKDDTATF--ACASGTDYS 220

Query: 203 IIFC 192
           I+FC
Sbjct: 221 IVFC 224



>pir|JS0646|JS0646 22K antifungal protein - maize
          Length = 206

 Score =  138 bits (347), Expect = 2e-31
 Identities = 86/227 (37%), Positives = 116/227 (51%), Gaps = 2/227 (0%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           + T+VN CP T+W A  P  G   L RG    +++T     AP    + RIWARTGC  +
Sbjct: 2   VFTVVNQCPFTVWAASVPVGGGRQLNRG--ESWRIT-----APAGTTAARIWARTGCQFD 54

Query: 686 -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLT 513
             GR +C TGDC G ++C G G  AP TLA++ L Q  + DF  + +SL+DGFN+PM+  
Sbjct: 55  ASGRGSCRTGDCGGVVQCTGYG-RAPNTLAEYALKQFNNLDF--FDISLIDGFNVPMSFL 111

Query: 512 PHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN 333
           P  G       GC     P C   +  R  A   +  V  CN+ C  FK DE CC  +  
Sbjct: 112 PDGGS------GCSRG--PRCAVDVNARCPAELRQDGV--CNNACPVFKKDEYCCVGSAA 161

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           N   C  + YS +FK  CP  ++Y  D  +S    C A    K++FC
Sbjct: 162 N--NCHPTNYSRYFKGQCPDAYSYPKDDATSTF-TCPAGTNYKVVFC 205



>gb:AF450277_1800793 Solanum nigrum osmotin-like protein (OSML)
           gene, partial cds.
          Length = 207

 Score =  137 bits (346), Expect = 3e-31
 Identities = 87/229 (37%), Positives = 111/229 (48%), Gaps = 5/229 (2%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L RG   +         APR     RIW RTGC  N 
Sbjct: 3   IEVRNNCPYTVWAASTPIGGGRRLNRGQTWVIN-------APRGTKMARIWGRTGCNFNA 55

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTP 510
            GR +C TGDC G L C G  G  P TLA++ L Q G+ DF  + +SLVDGFN+PMT  P
Sbjct: 56  AGRGSCQTGDCGGVLRCTG-WGKPPNTLAEYALDQFGNLDF--WDISLVDGFNIPMTFAP 112

Query: 509 ---HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNN 339
                GK  C  + C AN+   CPR L+V            GCN+ C  F   + CC   
Sbjct: 113 TKPSGGK--CHAIHCTANINGECPRALKVP----------GGCNNPCTTFGGQQYCCTQG 160

Query: 338 YNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
                 C  +  S FFK  CP  ++Y  D P+S       +   +++FC
Sbjct: 161 -----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFC 204



>gb:AY737316_1626063 Solanum tuberosum putative thaumatin-like
           protein (PR-5/21) gene, complete cds.
          Length = 229

 Score =  137 bits (346), Expect = 3e-31
 Identities = 91/246 (36%), Positives = 124/246 (50%), Gaps = 3/246 (1%)
 Frame = -1

Query: 920 TLFISLCAFTT-ASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           + FISL   T+  S+ A  II I NNCP T+W A  P  G   LE G    +K+      
Sbjct: 6   SFFISLYIITSHISIQANAIIDIQNNCPFTVWAAAVPGGGRQ-LEYGD--TWKIEPDMTT 62

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHAD 570
           +   +  GRIW RT C  +  G   C TGDC+G LEC       P TLA+  L+Q  + D
Sbjct: 63  SSTKK--GRIWGRTNCNFDSLGHSQCQTGDCNGLLECQTFSNTPPNTLAENALNQYNNND 120

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
           F  + LSLV+GFN+PM  +P    E    + C A+++  CP +L+             GC
Sbjct: 121 F--FDLSLVEGFNVPMEFSPVFADECSTRIRCTADIIGQCPNELRT----------PGGC 168

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
           N+ C  FKTDE CC +       C  + YS FFK  C ++F+Y  D  SSL   C +   
Sbjct: 169 NNPCTIFKTDEYCCTSG-----NCGPTNYSRFFKDRCSTSFSYPADDLSSLF-TCPSGTT 222

Query: 209 LKIIFC 192
            +++FC
Sbjct: 223 YRVVFC 228



>gb:AY737317_1626065 Solanum tuberosum PR-5/321d (PR-5/321d)
           pseudogene and putative thaumatin-like protein
           (PR-5/321c) gene, complete cds.
          Length = 246

 Score =  136 bits (343), Expect = 6e-31
 Identities = 90/224 (40%), Positives = 113/224 (50%), Gaps = 2/224 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           I N C + +W A  P  G   L+ G       T    V P     GRIW RT C  +  G
Sbjct: 26  ITNRCTYPVWAAASPGGGRR-LDLGQ------TWNINVNPGTTM-GRIWGRTNCNFDGSG 77

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHD 504
           R  C TGDC+GRLEC G G   P TLA+F L+Q  + DF    +SLVDGFN+PM  +P +
Sbjct: 78  RGKCQTGDCNGRLECQGFG-TVPNTLAEFALNQPNNLDF--VDISLVDGFNIPMEFSPIN 134

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
           G   C  + C A++   CP +L         R P  GCN+ C  FK  E CC N    P 
Sbjct: 135 GG--CRKIRCSADINGQCPSEL---------RAPG-GCNNPCTVFKMKEFCCTNG---PG 179

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  + YS FFK  CP  ++Y  D P+S M  C A    K++FC
Sbjct: 180 SCGPTDYSKFFKQRCPDAYSYPLDDPTS-MFTCHAGTNYKVVFC 222



>gb:AY737310_1626056 Solanum phureja osmotin-like protein (OSM-5a),
           osmotin-like protein (OSM-3b), osmotin-like protein
           (OSM-3f), and osmotin-like protein (OSM-3c) genes,
           complete cds.
          Length = 250

 Score =  135 bits (341), Expect = 1e-30
 Identities = 90/249 (36%), Positives = 121/249 (48%), Gaps = 3/249 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTCLVFFLLAFVTYTYASG-VFEVHNNCPYTVWAAAVPVGGGRRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH 576
           F AP      RIW RT C  +  GR  C TGDC G L+C G  G  P TLA++ L+Q G+
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGGCQTGDCGGVLDCKG-WGKPPNTLAEYALNQFGN 114

Query: 575 ADFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
            DF  + +S++DGFN+PM+  P   G   C  + C AN+   CP  L+V           
Sbjct: 115 LDF--WDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGSLRVP---------- 162

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  F   + CC +       C  +  S FFK  CP  ++Y  D P+S     S 
Sbjct: 163 GGCNNPCTTFGGQQYCCNHG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSW 217

Query: 218 ARELKIIFC 192
             + KI+FC
Sbjct: 218 TTDYKIMFC 226



>gb:AY548366_1613159 Malus x domestica thamatin-like PR5 mRNA,
           partial cds.
          Length = 182

 Score =  135 bits (341), Expect = 1e-30
 Identities = 73/182 (40%), Positives = 95/182 (52%), Gaps = 3/182 (1%)
 Frame = -1

Query: 728 WSGRIWARTGCVLNH-GRFTCATGDC-DGRLECNGRGGAAPATLAQFELH-QGHADFSTY 558
           WSGR W RT C  +  G+FTC T DC  G++ CNG G   PATL +  +   G  D+  Y
Sbjct: 7   WSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDY--Y 64

Query: 557 GLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
            +SLVDGFNLPM++ P  G   C    C AN+   CP  LQV+       G V+ C S C
Sbjct: 65  DVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKA----ADGSVISCKSAC 120

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
            AF   + C     N P  C  + YS+ F+  CP  ++YA+D  +S    CS   +  I 
Sbjct: 121 LAFGDSKYCYTPPNNAPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTF-TCSGGPDYVIT 179

Query: 197 FC 192
           FC
Sbjct: 180 FC 181



>gb:AF178653_1774722 Vitis riparia thaumatin mRNA, complete cds.
          Length = 247

 Score =  135 bits (340), Expect = 1e-30
 Identities = 87/244 (35%), Positives = 117/244 (47%), Gaps = 2/244 (0%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           LFI    F ++   A   IT  N C +T+W A  P         GG  L +    +   P
Sbjct: 15  LFIFFLCFISSIHAATFQIT--NQCSYTVWAAASPG--------GGRRLDRGQSWTLNVP 64

Query: 737 RARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFS 564
                 RIW RT C  +  GR  C TGDC G L C G  G+ P TLA++ L+Q G+ DF 
Sbjct: 65  AGTKMARIWGRTNCHFDASGRGRCDTGDCGGVLNCQG-WGSPPNTLAEYALNQFGNKDF- 122

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            + +SLVDGFN+PM  +P  G   C  + C AN+   CP+ L+             GCN+
Sbjct: 123 -FDISLVDGFNIPMDFSPTSGG--CRGIKCTANINGQCPQALKAS----------GGCNN 169

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C  FKT + CC N     + C  + YS FFK  CP  ++Y  D P+S    C      +
Sbjct: 170 PCTVFKTPQYCCNN-----IKCGPTDYSRFFKTRCPDAYSYPQDDPTSTF-TCPGGANYR 223

Query: 203 IIFC 192
           ++FC
Sbjct: 224 VVFC 227



>gb:AY262059_1593670 Capsicum annuum osmotin-like protein (OSM1)
           mRNA, complete cds.
          Length = 250

 Score =  135 bits (340), Expect = 1e-30
 Identities = 87/248 (35%), Positives = 119/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G  +LERG           
Sbjct: 4   LTTCLVFFLLAFVTYTYASG-VFEVHNNCPYTVWAAATPVGGGKLLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
           F AP      RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  +
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FS 113

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +S++DGFN+PM+  P   G   C  + C AN+   CP  L+V            
Sbjct: 114 NLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCVANINGECPGSLRVP----------G 163

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S  
Sbjct: 164 GCNNPCTTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWT 218

Query: 215 RELKIIFC 192
            + K++FC
Sbjct: 219 TDYKVMFC 226



>gb:AB031870_1518643 Cestrum elegans CETLP mRNA for thaumatin-like
           protein, partial cds.
          Length = 177

 Score =  135 bits (340), Expect = 1e-30
 Identities = 77/183 (42%), Positives = 99/183 (54%), Gaps = 4/183 (2%)
 Frame = -1

Query: 728 WSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH---ADFST 561
           WSGR WARTGC  +  G   C TG+C G L+C G GG  P +L +F +  G+    DF  
Sbjct: 1   WSGRFWARTGCNFDEAGNGQCKTGNCGGALKCTG-GGEPPVSLVEFTIANGNDQTKDF-- 57

Query: 560 YGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSG 381
           Y +SLVDG+N+ + +    G   C   GC  +L   CP  L+V        G VV C S 
Sbjct: 58  YDVSLVDGYNVGIGVRATGGSGDCQYAGCVTDLNVNCPTDLRVV-----DNGVVVACKSA 112

Query: 380 CAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKI 201
           CAAF T E CC  ++  P  C  ++YS  FK ACPS ++YA+D  SS    CS +  L I
Sbjct: 113 CAAFNTSEYCCTGDHATPTTCPPTQYSKLFKDACPSAYSYAYDDASSTC-TCSGSDYL-I 170

Query: 200 IFC 192
            FC
Sbjct: 171 TFC 173



>sp|P07052|PRR2_TOBAC Pathogenesis-related protein R minor form
           precursor (PR-R) (PROB12) (Thaumatin-like protein
           E2).>pir|JH0231|JH0231 thaumatin-like protein E2 -
           common tobacco>gb:NTE2TLP_1691545 Tobacco E2 gene for a
           thaumatin-like protein.>gb:NTTHAUR_1691795 Tobacco mRNA
           for TMV induced protein homologous to thaumatin.
          Length = 226

 Score =  135 bits (340), Expect = 1e-30
 Identities = 84/223 (37%), Positives = 107/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           IVN C +T+W A  P         GG  L      S          RIW RT C  +  G
Sbjct: 30  IVNQCTYTVWAAASPG--------GGRQLNSGQSWSINVNPGTVQARIWGRTNCNFDGSG 81

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TGDC+G LEC G  G  P TLA+F L+Q + DF    +SLVDGFN+PM  +P +G
Sbjct: 82  RGNCETGDCNGMLECQGY-GKPPNTLAEFALNQPNQDF--VDISLVDGFNIPMEFSPTNG 138

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  + C A +   CP QL+ +           GCN+ C   KT+E CC    N P  
Sbjct: 139 --GCRNLRCTAPINEQCPAQLKTQ----------GGCNNPCTVIKTNEFCCT---NGPGS 183

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  +  S FFK  CP  ++Y  D P SL   C      +++FC
Sbjct: 184 CGPTDLSRFFKARCPDAYSYPQDDPPSLF-TCPPGTNYRVVFC 225



>gb:AF376058_1792996 Petunia x hybrida osmotin (OSM) mRNA, complete
           cds.
          Length = 246

 Score =  135 bits (339), Expect = 2e-30
 Identities = 88/249 (35%), Positives = 119/249 (47%), Gaps = 3/249 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+ +    L A+ T +    + I + NNCP+T+W A  P  G   L+RG   +       
Sbjct: 4   LTTSFVFFLLAYVTCTY--AISIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN----- 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH 576
             AP      RIW RT C  N  GR +C TGDC G L+C G  G  P TLA++ L+Q G+
Sbjct: 57  --APAGTKMARIWGRTKCNFNAAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALNQFGN 113

Query: 575 ADFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
            DF  + +SLVDGFN+PMT  P       C  + C AN+   CP  L+V           
Sbjct: 114 LDF--WDISLVDGFNIPMTFAPTKPSAGKCHPIHCTANINGECPGALRVP---------- 161

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S 
Sbjct: 162 GGCNNPCTTFGGQQYCCTQG-----PCGPTDLSKFFKKRCPDAYSYPQDDPTSTFTCPSG 216

Query: 218 ARELKIIFC 192
           +   K++FC
Sbjct: 217 STNYKVVFC 225



>gb:ASU57787_1542620 Avena sativa permatin precursor mRNA, complete
           cds.
          Length = 228

 Score =  134 bits (338), Expect = 2e-30
 Identities = 85/240 (35%), Positives = 115/240 (47%), Gaps = 2/240 (0%)
 Frame = -1

Query: 905 LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
           + A T A+  A  I T+VN C +T+WP   P  G  +     +AL          P    
Sbjct: 14  MLAITIATTDAATI-TVVNKCSYTVWPGALPGGGVRLDPGKSWALNM--------PAGTR 64

Query: 725 SGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA-DFSTYGL 552
             R+W RTGC  +  GR  C TGDC G L C    G  PATLA++ L +G A DF  + L
Sbjct: 65  GARVWPRTGCTFDASGRGHCVTGDCGGALACRV-SGQQPATLAEYTLGKGGAKDF--FDL 121

Query: 551 SLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAA 372
           S++DGFN+PM+  P  G   C    C A++   CP++L+V            GC S C  
Sbjct: 122 SVIDGFNVPMSFQPVGGAA-CRGATCAADITKQCPQELKV----------AGGCASACGK 170

Query: 371 FKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           F  D  CCR  + +   C  + YS FFK  CP  ++YA D  +S    C      +I+ C
Sbjct: 171 FGGDTYCCRGQFTDK--CPPTNYSKFFKGKCPDAYSYAKDDQTSTF-TCPVGTNYQIVLC 227



>gb:AY353706_1601808 Cupressus sempervirens PR5 allergen Cup s 3.2
           precursor, mRNA, complete cds.
          Length = 225

 Score =  134 bits (337), Expect = 3e-30
 Identities = 83/244 (34%), Positives = 123/244 (50%), Gaps = 2/244 (0%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLI-ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVA 741
           L ++  A +     AG +   I N C +T+W A  P  G   L++G      L   +   
Sbjct: 10  LLVATLAISLHMQEAGAVKFDIKNQCGYTVWAAGLPGGGKR-LDQGQTWTVNLAAGTA-- 66

Query: 740 PRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFS 564
                S R W RTGC  +  G+ +C +GDC G+L C    GA PATLA++      +D  
Sbjct: 67  -----SARFWGRTGCTFDASGKGSCRSGDCGGQLSCTV-SGAVPATLAEYT----QSDKD 116

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            Y +SLVDGFN+P+ + P + K  C    C+A++   CP +L+V            GCNS
Sbjct: 117 YYDVSLVDGFNIPLAINPTNTK--CTAPACKADINAVCPSELKVD----------GGCNS 164

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C   +TD+ CCRN Y +   C A+ YS  FK+ CP  ++YA D  ++    C++  +  
Sbjct: 165 ACNVLQTDQYCCRNAYVD--NCPATNYSKIFKNQCPQAYSYAKDDTATF--ACASGTDYS 220

Query: 203 IIFC 192
           I+FC
Sbjct: 221 IVFC 224



>gb:AY353705_1601807 Cupressus sempervirens PR5 allergen Cup s 3.1
           precursor, mRNA, complete cds.>gb:AY353707_1601809
           Cupressus sempervirens PR5 allergen Cup s 3.3 precursor,
           mRNA, complete cds.
          Length = 225

 Score =  134 bits (337), Expect = 3e-30
 Identities = 83/244 (34%), Positives = 123/244 (50%), Gaps = 2/244 (0%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLI-ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVA 741
           L ++  A +     AG +   I N C +T+W A  P  G   L++G      L   +   
Sbjct: 10  LLVATSAISLHMQEAGAVKFDIKNQCRYTVWAAGLPGGGKR-LDQGQTWTVNLAAGTA-- 66

Query: 740 PRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFS 564
                S R W RTGC  +  G+ +C +GDC G+L C    GA PATLA++      +D  
Sbjct: 67  -----SARFWGRTGCTFDASGKGSCRSGDCGGQLSCTV-SGAVPATLAEYT----QSDQD 116

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            Y +SLVDGFN+P+ + P + K  C    C+A++   CP +L+V            GCNS
Sbjct: 117 YYDVSLVDGFNIPLAINPTNTK--CTAPACKADINAVCPSELKVD----------GGCNS 164

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C   +TD+ CCRN Y +   C A+ YS  FK+ CP  ++YA D  ++    C++  +  
Sbjct: 165 ACNVLQTDQYCCRNAYVD--NCPATNYSKIFKNQCPQAYSYAKDDTATF--ACASGTDYS 220

Query: 203 IIFC 192
           I+FC
Sbjct: 221 IVFC 224



>gb:AY257487_1593252 Lycopersicon esculentum PR5-like protein mRNA,
           complete cds.
          Length = 250

 Score =  134 bits (337), Expect = 3e-30
 Identities = 87/248 (35%), Positives = 119/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTCLVFFLLAFVTYTYASG-VFEVHNNCPYTVWAAATPVGGGRRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
           F AP      RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  +
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FS 113

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +S++DGFN+PM+  P + G   C  + C AN+   CP  L+V            
Sbjct: 114 NLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANINGECPGSLRVP----------G 163

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S  
Sbjct: 164 GCNNPCTTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWT 218

Query: 215 RELKIIFC 192
            + K++FC
Sbjct: 219 TDYKVMFC 226



>sp|P13867|IAAT_MAIZE Alpha-amylase/trypsin inhibitor (Antifungal
           protein).>pir|A29581|A29581 alpha-amylase/trypsin
           inhibitor - maize
          Length = 206

 Score =  134 bits (337), Expect = 3e-30
 Identities = 84/227 (37%), Positives = 115/227 (50%), Gaps = 2/227 (0%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           + T+VN CP T+W A  P  G   L RG    +++T     AP    + RIWARTGC  +
Sbjct: 2   VFTVVNQCPFTVWAASVPVGGGRQLNRG--ESWRIT-----APAGTTAARIWARTGCQFD 54

Query: 686 -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLT 513
             GR +C TGDC G ++C G  G AP TLA++ L Q  + DF  + +S++DGFN+P +  
Sbjct: 55  ASGRGSCRTGDCGGVVQCTGY-GRAPNTLAEYALKQFNNLDF--FDISILDGFNVPYSFL 111

Query: 512 PHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN 333
           P  G       GC     P C   +  R  A   +  V  CN+ C  FK DE CC  +  
Sbjct: 112 PDGGS------GCSRG--PRCAVDVNARCPAELRQDGV--CNNACPVFKKDEYCCVGSAA 161

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           N   C  + YS +FK  CP  ++Y  D  +S    C A    K++FC
Sbjct: 162 N--NCHPTNYSRYFKGQCPDAYSYPKDDATSTF-TCPAGTNYKVVFC 205



>gb:AF355457_1790705 Hordeum vulgare thaumatin-like protein TLP7
           mRNA, complete cds.
          Length = 227

 Score =  134 bits (336), Expect = 4e-30
 Identities = 86/256 (33%), Positives = 119/256 (46%), Gaps = 1/256 (0%)
 Frame = -1

Query: 956 MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF 777
           MA +   ++L+  L  +L A T A+      IT+VN C +T+WP   P  G  +     +
Sbjct: 1   MASSHVVSLLAGLLLAALAASTDAAT-----ITVVNRCSYTVWPGALPGGGVRLDPGQSW 55

Query: 776 ALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLA 600
           AL          P      R+W RTGC  +  GR  C TGDC G L C    G  P TLA
Sbjct: 56  ALNM--------PAGTAGARVWPRTGCTFDGSGRGRCITGDCGGALACRV-SGQQPTTLA 106

Query: 599 QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRA 420
           ++ L QG A+   + LS++DGFN+PM+  P      C    C  ++   C ++LQV    
Sbjct: 107 EYTLGQG-ANKDFFDLSVIDGFNVPMSFEPVGAS--CRAARCATDITKECLKELQVP--- 160

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
                   GC S C  F  D  CCR  + +   C  + YS FFK  CP  ++YA D  +S
Sbjct: 161 -------GGCASACGKFGGDTYCCRGQFEHN--CPPTNYSKFFKGKCPDAYSYAKDDQTS 211

Query: 239 LMHECSAARELKIIFC 192
               C A    +I+ C
Sbjct: 212 TF-TCPAGTNYQIVLC 226



>gb:CAR294411_1645223 Cupressus arizonica partial mRNA for Cup a 3
           protein.
          Length = 199

 Score =  134 bits (336), Expect = 4e-30
 Identities = 79/223 (35%), Positives = 115/223 (51%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           I N C +T+W A  P  G    +   + +      +  A  A  S R W RTGC  +  G
Sbjct: 5   IKNQCGYTVWAAGLPGGGKEFDQGQTWTV------NLAAGTA--SARFWGRTGCTFDASG 56

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           + +C +GDC G+L C    GA PATLA++      +D   Y +SLVDGFN+P+ + P + 
Sbjct: 57  KGSCRSGDCGGQLSCTV-SGAVPATLAEYT----QSDQDYYDVSLVDGFNIPLAINPTNT 111

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
           K  C    C+A++   CP +L+V            GCNS C   +TD+ CCRN Y N   
Sbjct: 112 K--CTAPACKADINAVCPSELKVD----------GGCNSACNVLQTDQYCCRNAYVN--N 157

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C A+ YS  FK+ CP  ++YA D  ++    C++  +  I+FC
Sbjct: 158 CPATNYSKIFKNQCPQAYSYAKDDTATF--ACASGTDYSIVFC 198



>pir|S28001|S28001 osmotin-like protein TPM1 precursor - tomato
           (fragment)
          Length = 238

 Score =  134 bits (336), Expect = 4e-30
 Identities = 87/245 (35%), Positives = 117/245 (47%), Gaps = 4/245 (1%)
 Frame = -1

Query: 914 FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR 735
           F  L AF T +  A     + NNCP+T+W A  P  G   L+RG   +         APR
Sbjct: 1   FFFLLAFVTYTYAA--TFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APR 51

Query: 734 ARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTY 558
                RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   +
Sbjct: 52  GTKMARIWGRTNCNFDGDGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFW 109

Query: 557 GLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCN 387
            +SLVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GCN
Sbjct: 110 DISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGCN 157

Query: 386 SGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAREL 207
           + C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +   
Sbjct: 158 NPCTTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNY 212

Query: 206 KIIFC 192
           +++FC
Sbjct: 213 RVVFC 217



>sp|Q01591|TPM1_LYCES Osmotin-like protein TPM-1 precursor (PR P23)
           (Fragment).>gb:LETPM1M_1684676 L.esculentum tpm 1 mRNA.
          Length = 238

 Score =  134 bits (336), Expect = 4e-30
 Identities = 87/245 (35%), Positives = 117/245 (47%), Gaps = 4/245 (1%)
 Frame = -1

Query: 914 FISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPR 735
           F  L AF T +  A     + NNCP+T+W A  P  G   L+RG   +         APR
Sbjct: 1   FFFLLAFVTYTYAA--TFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APR 51

Query: 734 ARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTY 558
                RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   +
Sbjct: 52  GTKMARIWGRTNCNFDGDGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFW 109

Query: 557 GLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCN 387
            +SLVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GCN
Sbjct: 110 DISLVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGCN 157

Query: 386 SGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAREL 207
           + C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +   
Sbjct: 158 NPCTTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNY 212

Query: 206 KIIFC 192
           +++FC
Sbjct: 213 RVVFC 217



>gb:AY737313_1626060 Solanum tuberosum osmotin-like protein (OSM-2d)
           gene, complete cds.
          Length = 250

 Score =  133 bits (335), Expect = 5e-30
 Identities = 87/248 (35%), Positives = 119/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTCLVFFLLAFVTYTNASG-VFEVHNNCPYTVWAAATPIGGGRRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
           F AP      RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  +
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCETGDCGGVLECKG-WGKPPNTLAEYALNQ-FS 113

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +S++DGFN+PM+  P + G   C  + C AN+   CP  L+V            
Sbjct: 114 NLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANINGECPGSLRVP----------G 163

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S  
Sbjct: 164 GCNNPCTTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWT 218

Query: 215 RELKIIFC 192
            + K++FC
Sbjct: 219 TDYKVMFC 226



>gb:AY737310_1626055 Solanum phureja osmotin-like protein (OSM-5a),
           osmotin-like protein (OSM-3b), osmotin-like protein
           (OSM-3f), and osmotin-like protein (OSM-3c) genes,
           complete cds.
          Length = 246

 Score =  133 bits (335), Expect = 5e-30
 Identities = 87/242 (35%), Positives = 117/242 (48%), Gaps = 4/242 (1%)
 Frame = -1

Query: 905 LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
           L AF T +  A   I + NNCP+T+W A  P  G   L+RG   +         APR   
Sbjct: 12  LLAFVTYTYAA--TIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTK 62

Query: 725 SGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS 549
             RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +S
Sbjct: 63  MARIWGRTNCNFDGAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDIS 120

Query: 548 LVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
           LVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GCN+ C
Sbjct: 121 LVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGCNNPC 168

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
             F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +   +++
Sbjct: 169 TTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVV 223

Query: 197 FC 192
           FC
Sbjct: 224 FC 225



>gb:AB121785_1528020 Nicotiana tabacum PR-5dB mRNA for
           pathogenesis-related protein, complete cds.
          Length = 251

 Score =  133 bits (335), Expect = 5e-30
 Identities = 86/248 (34%), Positives = 118/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTCLVFFLLAFVTYTYASG-VFEVHNNCPYTVWAAATPVGGGKRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
           F AP      RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  +
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FS 113

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +S++DGFN+PM+  P   G   C  + C AN+   CP  L+V            
Sbjct: 114 NLDFWDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGALRVP----------G 163

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S +FK  CP  ++Y  D P+S     S  
Sbjct: 164 GCNNPCTTFGGQQYCCTQG-----PCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWT 218

Query: 215 RELKIIFC 192
            + K++FC
Sbjct: 219 TDYKVMFC 226



>sp|P50703|OS35_SOLCO Osmotin-like protein OSML15 precursor
           (PA15).>pir|S56708|S25114 osmotin-like protein precursor
           (clone pA35) - Commerson's wild
           potato>gb:AY737311_1626057 Solanum phureja osmotin-like
           protein (OSM-4d) gene, complete cds.>gb:AY743929_1626549
           Solanum phureja osmotin-like protein A35 mRNA, complete
           cds.>gb:CSOSLP_1674006 S.commersonii mRNA for
           osmotin-like protein.
          Length = 250

 Score =  133 bits (335), Expect = 5e-30
 Identities = 87/248 (35%), Positives = 119/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTCLVFFLLAFVTYTNASG-VFEVHNNCPYTVWAAATPIGGGRRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
           F AP      RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  +
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FS 113

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +S++DGFN+PM+  P + G   C  + C AN+   CP  L+V            
Sbjct: 114 NLDFWDISVIDGFNIPMSFGPTNPGPGKCHPIQCVANINGECPGSLRVP----------G 163

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D P+S     S  
Sbjct: 164 GCNNPCTTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCQSWT 218

Query: 215 RELKIIFC 192
            + K++FC
Sbjct: 219 TDYKVMFC 226



>sp|P50701|OS13_SOLCO Osmotin-like protein OSML13 precursor
           (PA13).>pir|S30144|S30144 osmotin-like protein precursor
           (clone pA13) - Commerson's wild
           potato>gb:SC13OLP_1705045 S.commersonii (pOSML13) gene
           for osmotin-like protein.>gb:SCOSMLP_1709021
           S.commersonii mRNA for osmotin-like protein.
          Length = 246

 Score =  133 bits (335), Expect = 5e-30
 Identities = 87/242 (35%), Positives = 117/242 (48%), Gaps = 4/242 (1%)
 Frame = -1

Query: 905 LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
           L AF T +  A   I + NNCP+T+W A  P  G   L+RG   +         APR   
Sbjct: 12  LLAFVTYTYAA--TIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTK 62

Query: 725 SGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS 549
             RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +S
Sbjct: 63  MARIWGRTNCNFDGAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDIS 120

Query: 548 LVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
           LVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GCN+ C
Sbjct: 121 LVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGCNNPC 168

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
             F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +   +++
Sbjct: 169 TTFGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVV 223

Query: 197 FC 192
           FC
Sbjct: 224 FC 225



>gb:AY839295_1630499 Hordeum vulgare thaumatin-like protein TLP5
           mRNA, complete cds.
          Length = 236

 Score =  133 bits (334), Expect = 6e-30
 Identities = 89/255 (34%), Positives = 117/255 (45%), Gaps = 2/255 (0%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL 771
           MAF   +  + L I++ A  T +      IT+VN C +TIWP   P         GG  L
Sbjct: 1   MAFSGVVHLIALVIAVAAAATDATT----ITVVNRCSYTIWPGALPG--------GGARL 48

Query: 770 YKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQF 594
                     P      R+W RTGC  +  GR  C TGDC G L C    G  PATLA++
Sbjct: 49  DPGQSWQLNMPAGTAGARVWPRTGCTFDRSGRGRCITGDCAGALVCR-VSGEQPATLAEY 107

Query: 593 ELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRAR 417
            L Q G+ DF  + LS++DGFN+PM+  P  G   C    C  ++   C  +LQV     
Sbjct: 108 TLGQGGNRDF--FDLSVIDGFNVPMSFQPVGGAP-CRAATCAVDITHECLPELQV----- 159

Query: 416 RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL 237
                  GC S C  F  D  CCR  + +   C  + YS FFK  CP  ++YA D  +S 
Sbjct: 160 -----PGGCASACGKFGGDTYCCRGQFEH--NCPPTYYSRFFKGKCPDAYSYAKDDQTST 212

Query: 236 MHECSAARELKIIFC 192
              C A    +I+ C
Sbjct: 213 F-TCPAGTNYQIVLC 226



>gb:AB029918_1518391 Nicotiana tabacum SE39b gene for pistil
           transmitting tissue specific thaumatin (SE39b)-like
           protein, partial cds.
          Length = 192

 Score =  133 bits (334), Expect = 6e-30
 Identities = 73/178 (41%), Positives = 94/178 (52%), Gaps = 1/178 (0%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           + T+ N C   IWP I    G+P+L  GG  L         AP   WSGR W R+ C  +
Sbjct: 23  VFTLKNKCNMKIWPGILSGGGHPLLMNGGLQLQPNETAEIKAPTG-WSGRFWPRSQCNFD 81

Query: 686 -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
             G+ TCAT DC G LECNG GG  PA+LA+F L     DF  Y +S VDGFN+P+++ P
Sbjct: 82  TSGKGTCATADCGGVLECNGAGGNPPASLAEFTL-DSPMDF--YDVSFVDGFNIPISIYP 138

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY 336
             G  +C  V C ++L   CP +LQV    +     V+ C S C AF   E CC   +
Sbjct: 139 LGGSGNCSNVQCVSDLNLQCPPELQV----KTNNDTVIACKSACLAFNKPEYCCTEEF 192



>sp|P25871|OLPA_TOBAC Osmotin-like protein precursor
           (Pathogenesis-related protein PR-5d).>gb:TOBOLP_1725471
           Nicotania tabacum osmotin-like protein (OLP1) mRNA,
           complete cds.
          Length = 251

 Score =  133 bits (334), Expect = 6e-30
 Identities = 86/248 (34%), Positives = 118/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTFLVFFLLAFVTYTYASG-VFEVHNNCPYTVWAAATPVGGGRRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
           F AP      RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  +
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FS 113

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +S++DGFN+PM+  P   G   C  + C AN+   CP  L+V            
Sbjct: 114 NLDFWDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGSLRVP----------G 163

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S +FK  CP  ++Y  D P+S     S  
Sbjct: 164 GCNNPCTTFGGQQYCCTQG-----PCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWT 218

Query: 215 RELKIIFC 192
            + K++FC
Sbjct: 219 TDYKVMFC 226



>gb:AF532965_1809438 Vitis vinifera thaumatin-like protein (Tl3)
           mRNA, complete cds.
          Length = 225

 Score =  132 bits (333), Expect = 8e-30
 Identities = 87/249 (34%), Positives = 116/249 (46%), Gaps = 2/249 (0%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           ILS++ F+    F T S  A     I N+C +T+W A  P         GG  L      
Sbjct: 6   ILSISSFLLTALFFTPSYAA--TFNIQNHCSYTVWAAAVPG--------GGMQLGSGQSW 55

Query: 752 SFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH 576
           S         GR+WART C  +  G   C TGDC G L+C   G   P TLA+F L+Q  
Sbjct: 56  SLNVNAGTTGGRVWARTNCNFDASGNGKCETGDCGGLLQCTAYG-TPPNTLAEFALNQ-F 113

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPV-VGCRANLLPACPRQLQVRLRARRGRGPV 399
           ++   + +SLVDGFN+PM   P      C   + C A+++  CP  L+            
Sbjct: 114 SNLDFFDISLVDGFNVPMAFNPTSNG--CTRGISCTADIVGECPAALKT----------T 161

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  FKTDE CC     N   C A+ YS FFK  CP  ++Y  D  +S    C A
Sbjct: 162 GGCNNPCTVFKTDEYCC-----NSGSCNATDYSRFFKTRCPDAYSYPKDDQTSTF-TCPA 215

Query: 218 ARELKIIFC 192
               +++FC
Sbjct: 216 GTNYEVVFC 224



>gb:AF355456_1790704 Hordeum vulgare thaumatin-like protein TLP6
           mRNA, complete cds.
          Length = 226

 Score =  132 bits (333), Expect = 8e-30
 Identities = 87/256 (33%), Positives = 120/256 (46%), Gaps = 1/256 (0%)
 Frame = -1

Query: 956 MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF 777
           MA +    +L+  L  +L A T A+      IT+VN C +T+WP   P  G  +     +
Sbjct: 1   MASSRVVYLLAGLLLAALAATTDAAT-----ITVVNRCSYTVWPGALPGGGVRLDPGQSW 55

Query: 776 ALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLA 600
           AL          P      R+W RTGC  +  GR  C TGDC+G L C    G  P TLA
Sbjct: 56  ALNM--------PAGTAGARVWPRTGCTFDGSGRGRCITGDCNGVLACRV-SGQQPTTLA 106

Query: 599 QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRA 420
           ++ L QG A+   + LS++DGFN+PM+  P  G   C    C  ++   C ++LQV    
Sbjct: 107 EYTLGQG-ANKDFFDLSVIDGFNVPMSFEPVGG---CRAARCATDITKDCLKELQVP--- 159

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
                   GC S C  F  D  CCR  + +   C  + YS FFK  CP  ++YA D  +S
Sbjct: 160 -------GGCASACGKFGGDTYCCRGQFEHN--CPPTNYSMFFKGKCPDAYSYAKDDQTS 210

Query: 239 LMHECSAARELKIIFC 192
               C A    +I+ C
Sbjct: 211 TF-TCPAGTNYQIVLC 225



>gb:AC137991_1743851 Oryza sativa chromosome 3 BAC OSJNBa0034D21
           genomic sequence, complete sequence.
          Length = 229

 Score =  132 bits (331), Expect = 1e-29
 Identities = 87/256 (33%), Positives = 119/256 (46%), Gaps = 3/256 (1%)
 Frame = -1

Query: 950 MAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFAL 771
           MA PA +  + L +   A   A+       TI N C  T+W A  P+ G   L+ G   +
Sbjct: 1   MAAPAILRLLPLLLLAAAANAATF------TITNKCQITVWAAAVPSGGGQQLDPGQQWV 54

Query: 770 YKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQF 594
             +       P     GR+WARTGC  +  G   C TGDC G L C   G   P TLA+F
Sbjct: 55  IDV-------PAGTTGGRVWARTGCSFDGSGNGRCQTGDCGGVLRCAAYG-QPPNTLAEF 106

Query: 593 ELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG--CRANLLPACPRQLQVRLRA 420
            L+Q  ++   + +SL+DGFN+PM   P      C   G  C A++   CP +L      
Sbjct: 107 ALNQ-FSNLDFFDISLIDGFNVPMDFLPAGDGAGCAKGGPRCEADVAGQCPSEL------ 159

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
              R P  GCN+ C  FK D+ CC  +  N   C  + YS FFK  CP  ++Y  D  +S
Sbjct: 160 ---RAPG-GCNNACTVFKQDQYCCTGSAAN--NCGPTNYSQFFKGLCPDAYSYPKDDQTS 213

Query: 239 LMHECSAARELKIIFC 192
               C A    +++FC
Sbjct: 214 TF-TCPAGTNYQVVFC 228



>gb:AB121784_1528019 Nicotiana tabacum PR-5dA mRNA for
           pathogenesis-related protein, partial cds.
          Length = 244

 Score =  132 bits (331), Expect = 1e-29
 Identities = 85/244 (34%), Positives = 116/244 (47%), Gaps = 2/244 (0%)
 Frame = -1

Query: 917 LFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAP 738
           L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           F AP
Sbjct: 1   LVFFLLAFVTYTYASG-VFEVHNNCPYTVWAAATPVGGGRRLERG-------QSWWFWAP 52

Query: 737 RARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFST 561
                 RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  ++   
Sbjct: 53  PGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDF 110

Query: 560 YGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
           + +S++DGFN+PM+  P   G   C  + C AN+   CP  L+V            GCN+
Sbjct: 111 WDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGSLRVP----------GGCNN 160

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C  F   + CC         C  +  S +FK  CP  ++Y  D P+S     S   + K
Sbjct: 161 PCTTFGGQQYCCTQG-----PCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYK 215

Query: 203 IIFC 192
           ++FC
Sbjct: 216 VMFC 219



>gb:AX008565_1456280 Sequence 2 from Patent WO9966057.
          Length = 223

 Score =  132 bits (331), Expect = 1e-29
 Identities = 85/256 (33%), Positives = 122/256 (47%), Gaps = 1/256 (0%)
 Frame = -1

Query: 956 MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF 777
           ++ AF + +L   L + L +  T         T+ N C +T+W A  P  G  +     +
Sbjct: 3   LSKAFTSLLLLPVLLLPLASAAT--------FTVTNKCTYTVWAAAVPGGGRRLDPNQSW 54

Query: 776 ALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLA 600
            L        VAP      RIW RTGC  +  G   C TGDC G L C   G + P TLA
Sbjct: 55  TLT-------VAPGTT-GARIWGRTGCSFDPSGHGHCQTGDCGGLLACTAYG-SPPDTLA 105

Query: 599 QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRA 420
           +F L+Q +A    Y +SLVDGFN+PM  +P  G  +C  + C A++   CP +L+     
Sbjct: 106 EFALNQ-YAGQDFYDISLVDGFNIPMDFSPTSG--NCHDIRCTADINGQCPAELKA---- 158

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
                   GCN+ C  FKT+E CC +       C  + YS FFK  CP  ++Y  D  +S
Sbjct: 159 ------PGGCNNPCTVFKTNEYCCTSG-----GCGPTDYSKFFKQRCPDAYSYPKDDATS 207

Query: 239 LMHECSAARELKIIFC 192
               C +  + +++FC
Sbjct: 208 TF-TCPSGADYRVVFC 222



>gb:VVOSM1_1727543 V.vinifera mRNA for osmotin-like protein.
          Length = 225

 Score =  131 bits (330), Expect = 2e-29
 Identities = 86/249 (34%), Positives = 116/249 (46%), Gaps = 2/249 (0%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           ILS++ F+    F T+S  A     I N+C +T+W A  P         GG  L      
Sbjct: 6   ILSISSFLLTTLFFTSSYAA--TFNIQNHCSYTVWAAAVPG--------GGMQLGSGQSW 55

Query: 752 SFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGH 576
           S          R+W RT C  +  G   C TGDC G L+C   G   P TLA+F L+Q  
Sbjct: 56  SLNVNAGTTGARVWGRTNCNFDASGNGKCETGDCGGLLQCTAYG-TPPNTLAEFALNQ-F 113

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPV-VGCRANLLPACPRQLQVRLRARRGRGPV 399
           ++   + +SLVDGFN+PM   P      C   + C A+++  CP  L+            
Sbjct: 114 SNLDFFDISLVDGFNVPMAFNPTSNG--CTRGISCTADIVGECPAALKT----------T 161

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  FKTDE CC     N   C A+ YS+FFK  CP  ++Y  D  +S    C A
Sbjct: 162 GGCNNPCTVFKTDEYCC-----NSGSCNATTYSEFFKTRCPDAYSYPKDDQTSTF-TCPA 215

Query: 218 ARELKIIFC 192
               ++IFC
Sbjct: 216 GTNYEVIFC 224



>pir|T04927|T04927 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T9A21.100 - Arabidopsis
           thaliana>gb:ATCHRIV48_1545626 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 48.>gb:ATT9A21_1556576
           Arabidopsis thaliana DNA chromosome 4, BAC clone T9A21
           (ESSA project).
          Length = 687

 Score =  131 bits (329), Expect = 2e-29
 Identities = 76/211 (36%), Positives = 107/211 (50%), Gaps = 2/211 (0%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           I+TI N C HT+WP I        +   GFAL +   R+  AP + W G I ART C ++
Sbjct: 11  ILTIENKCNHTVWPVIFSWNVDSQVSPTGFALRRGEARALQAPSS-WYGLISARTLCSID 69

Query: 686 H-GRFTCATGDCD-GRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT 513
             G F+CATGDC+ G +EC G  G AP T   F ++       +Y +S+  G+NLP+ + 
Sbjct: 70  STGTFSCATGDCESGTIECPGNYGWAPVTYVYFRMN-------SYTISVEYGYNLPLMVV 122

Query: 512 PHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYN 333
           P      C   GC   L   CP+ L      +  R  +V C+S C  F T E CC  ++ 
Sbjct: 123 PSQRSRTCISAGCVVELKKTCPKDLM-----KMSRENLVACSSTCMEFDTPEACCTRDFK 177

Query: 332 NPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
           +   CK + Y+  F+ ACP    YA+D  +S
Sbjct: 178 SKQNCKPTVYTQNFERACPLAHIYAYDDNNS 208



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 25/77 (32%), Positives = 35/77 (45%)
 Frame = -1

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           C S C    +DE CC N +     CK + Y   F  ACPS ++Y     +S    C+ + 
Sbjct: 225 CKSACRQSASDENCCTNYFKYKQTCKPTPYVQNFDRACPSAYSYPFSGNNSTF-TCTNST 283

Query: 212 ELKIIFCH*EYPLTS*G 162
           +  I FC    P T+ G
Sbjct: 284 DYVITFCPSSIPNTTRG 300



>gb:AF473702_1803094 Solanum nigrum osmotin-like protein gene,
           complete cds.
          Length = 247

 Score =  130 bits (328), Expect = 3e-29
 Identities = 81/224 (36%), Positives = 110/224 (49%), Gaps = 4/224 (1%)
 Frame = -1

Query: 851 NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRF 675
           NNCP+T+W A  P  G   L+RG   +         APR     RIW RT C  +  GR 
Sbjct: 28  NNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTSMARIWGRTNCNFDGAGRG 80

Query: 674 TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD--- 504
           +C TGDC G L+C G  G  P TLA++ L+Q  ++   + +SLVDGFN+PMT  P +   
Sbjct: 81  SCQTGDCGGVLQCTG-WGKPPNTLAEYALNQ-FSNLDFWDISLVDGFNIPMTFAPTNPSG 138

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
           GK  C  + C AN+   CP  L+V            GCN+ C  F   + CC        
Sbjct: 139 GK--CHSIQCTANINGECPAALRVP----------GGCNNPCTTFGGQQYCCTQG----- 181

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  +  S FFK  CP  ++Y  D P+S     S +   +++FC
Sbjct: 182 PCGPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVFC 225



>gb:AF450276_1800792 Solanum nigrum osmotin-like protein precursor
           (OLP) gene, complete cds.
          Length = 247

 Score =  130 bits (328), Expect = 3e-29
 Identities = 81/224 (36%), Positives = 110/224 (49%), Gaps = 4/224 (1%)
 Frame = -1

Query: 851 NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRF 675
           NNCP+T+W A  P  G   L+RG   +         APR     RIW RT C  +  GR 
Sbjct: 28  NNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTSMARIWGRTNCNFDGAGRG 80

Query: 674 TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD--- 504
           +C TGDC G L+C G  G  P TLA++ L+Q  ++   + +SLVDGFN+PMT  P +   
Sbjct: 81  SCQTGDCGGVLQCTG-WGKPPNTLAEYALNQ-FSNLDFWDISLVDGFNIPMTFAPTNPSG 138

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
           GK  C  + C AN+   CP  L+V            GCN+ C  F   + CC        
Sbjct: 139 GK--CHSIQCTANINGECPAALRVP----------GGCNNPCTTFGGQQYCCTQG----- 181

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  +  S FFK  CP  ++Y  D P+S     S +   +++FC
Sbjct: 182 PCGPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVFC 225



>gb:AF442967_1800291 Triticum aestivum clone WAS-3a thaumatin-like
           protein mRNA, complete cds.
          Length = 225

 Score =  130 bits (328), Expect = 3e-29
 Identities = 80/226 (35%), Positives = 106/226 (46%), Gaps = 2/226 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN- 687
           IT+VN C +T+WP   P  G  +     +AL          P      R+W RTGC  + 
Sbjct: 25  ITVVNRCSYTVWPGALPGGGVRLDPGQSWALNM--------PAGTAGARVWPRTGCTFDG 76

Query: 686 HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG-HADFSTYGLSLVDGFNLPMTLTP 510
            GR  C TGDC G L C    G  P TLA++ L QG + DF  + LS++DGFN+PM   P
Sbjct: 77  SGRGRCITGDCGGTLACRV-SGQQPTTLAEYTLGQGGNKDF--FDLSVIDGFNVPMNFEP 133

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
             G   C    C  ++   C ++LQV            GC S C  F  D  CCR  + +
Sbjct: 134 VGGS--CRAARCATDITKECLKELQVP----------GGCASACGKFGGDTYCCRGQFEH 181

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
              C  + YS FFK  CP  ++YA D  +S    C A    +I+ C
Sbjct: 182 N--CPPTNYSKFFKGKCPDAYSYAKDDQTSTF-TCPAGTNYQIVLC 224



>gb:AF227324_1778836 Vitis vinifera thaumatin-like protein gene,
           complete cds.
          Length = 226

 Score =  130 bits (328), Expect = 3e-29
 Identities = 80/224 (35%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-H 684
           TI+N C +T+W A  P  G  +     + +        V P    + RIW RT C  + +
Sbjct: 28  TILNKCTYTVWAAASPGRGRRLDSGQSWTIT-------VKPGTT-NARIWGRTSCTFDAN 79

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD 504
           GR  C TGDC+G L C G G + P TLA+F L+Q + +     +SLVDGFN+PM  +P  
Sbjct: 80  GRGKCKTGDCNGLLNCQGYG-SPPNTLAEFALNQPN-NLDYIDISLVDGFNIPMGFSPTT 137

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
               C  + C AN+   CP +L+             GCN+ C  FKT+  CC N    P 
Sbjct: 138 SA--CRGIQCSANINGQCPSELKAP----------DGCNNPCTVFKTNNYCCTNG---PG 182

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  + YS FFK  CP  ++Y  D  +SL   C +    K+ FC
Sbjct: 183 SCGPTTYSKFFKDRCPDAYSYPQDDKTSLF-TCPSGVNYKVTFC 225



>gb:AF016327_1761500 Hordeum vulgare Barperm1 (perm1) mRNA, partial
           cds.
          Length = 205

 Score =  130 bits (328), Expect = 3e-29
 Identities = 78/225 (34%), Positives = 106/225 (47%), Gaps = 1/225 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN- 687
           IT+VN C +T+WP   P  G  +     +AL          P      R+W RTGC  + 
Sbjct: 5   ITVVNRCSYTVWPGALPGGGVRLDPGQSWALNM--------PAGTAGARVWPRTGCTFDG 56

Query: 686 HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH 507
            GR  C TGDC G L C    G  P TLA++ L QG A+   + LS++DGFN+PM+  P 
Sbjct: 57  SGRGRCITGDCGGALACRV-SGQQPTTLAEYTLGQG-ANKDFFDLSVIDGFNVPMSFEPV 114

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
                C    C  ++   C ++LQV            GC S C  F  D  CCR  + + 
Sbjct: 115 GAS--CRAARCATDITKECLKELQVP----------GGCASACGKFGGDTYCCRGQFEHN 162

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             C  + YS FFK  CP  ++YA D  +S    C A    +++FC
Sbjct: 163 --CPPTNYSKFFKGKCPDAYSYAKDDQTSTF-TCPAGTNYQLVFC 204



>gb:LES277064_1684530 Lycopersicon esculentum PR-5 gene for
           pathogenesis-related protein (PR-5 protein).
          Length = 249

 Score =  130 bits (328), Expect = 3e-29
 Identities = 89/249 (35%), Positives = 120/249 (48%), Gaps = 3/249 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  L   L AF T +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTCLVFFLLAFVTYTYGSG-VFEVHNNCPYTVWAAAVPVGGGRRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH 576
           F AP      RIW RT C  +  GR  C TGDC G L+C G  G  P TLA++ L+Q G+
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLDCKG-WGKPPNTLAEYALNQFGN 114

Query: 575 ADFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
            DF  + +S++DGFN+PM+  P   G   C  + C AN+   CP  L+V           
Sbjct: 115 LDF--WDISVIDGFNIPMSFGPTKPGPGKCHPIQCTANINGECPGSLRVP---------- 162

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN  C   +  + CC +       C  +  S FFK  CP  ++Y  D P+S     S 
Sbjct: 163 GGCNKPCTTSR-QQYCCNHG-----PCGPTELSRFFKQRCPDAYSYPQDDPTSTFTCQSW 216

Query: 218 ARELKIIFC 192
             + KI+FC
Sbjct: 217 TTDYKIMFC 225



>gb:LEPRPA_1684412 L.esculentum pr p23 mRNA for pathogenesis-related
           protein.
          Length = 233

 Score =  130 bits (328), Expect = 3e-29
 Identities = 85/240 (35%), Positives = 115/240 (47%), Gaps = 4/240 (1%)
 Frame = -1

Query: 899 AFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSG 720
           AF T +  A     + NNCP+T+W A  P  G   L+RG   +         APR     
Sbjct: 1   AFVTYTYAA--TFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTKMA 51

Query: 719 RIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV 543
           RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLV
Sbjct: 52  RIWGRTNCNFDGAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLV 109

Query: 542 DGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAA 372
           DGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GCN+ C  
Sbjct: 110 DGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGCNNPCTT 157

Query: 371 FKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +   +++FC
Sbjct: 158 FGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVFC 212



>pir|T04370|T04370 perm1 protein - barley (fragment)
          Length = 205

 Score =  130 bits (328), Expect = 3e-29
 Identities = 78/225 (34%), Positives = 106/225 (47%), Gaps = 1/225 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN- 687
           IT+VN C +T+WP   P  G  +     +AL          P      R+W RTGC  + 
Sbjct: 5   ITVVNRCSYTVWPGALPGGGVRLDPGQSWALNM--------PAGTAGARVWPRTGCTFDG 56

Query: 686 HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPH 507
            GR  C TGDC G L C    G  P TLA++ L QG A+   + LS++DGFN+PM+  P 
Sbjct: 57  SGRGRCITGDCGGALACRV-SGQQPTTLAEYTLGQG-ANKDFFDLSVIDGFNVPMSFEPV 114

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
                C    C  ++   C ++LQV            GC S C  F  D  CCR  + + 
Sbjct: 115 GAS--CRAARCATDITKECLKELQVP----------GGCASACGKFGGDTYCCRGQFEHN 162

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             C  + YS FFK  CP  ++YA D  +S    C A    +++FC
Sbjct: 163 --CPPTNYSKFFKGKCPDAYSYAKDDQTSTF-TCPAGTNYQLVFC 204



>pir|PQ0742|S31829 pathogenesis-related protein P23 precursor -
           tomato  (fragment)
          Length = 233

 Score =  130 bits (328), Expect = 3e-29
 Identities = 85/240 (35%), Positives = 115/240 (47%), Gaps = 4/240 (1%)
 Frame = -1

Query: 899 AFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSG 720
           AF T +  A     + NNCP+T+W A  P  G   L+RG   +         APR     
Sbjct: 1   AFVTYTYAA--TFEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTKMA 51

Query: 719 RIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLV 543
           RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLV
Sbjct: 52  RIWGRTNCNFDGAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLV 109

Query: 542 DGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAA 372
           DGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GCN+ C  
Sbjct: 110 DGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGCNNPCTT 157

Query: 371 FKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           F   + CC         C  +  S FFK  CP  ++Y  D P+S     S +   +++FC
Sbjct: 158 FGGQQYCCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVVFC 212



>gb:AJ853476_1814922 Nicotiana glauca mRNA for putative osmotin-like
           protein (o-L gene).
          Length = 251

 Score =  130 bits (327), Expect = 4e-29
 Identities = 84/248 (33%), Positives = 117/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L+  +   L AF   +  +G +  + NNCP+T+W A  P  G   LERG           
Sbjct: 4   LTTCVVFFLLAFVAYTCASG-VFEVHNNCPYTVWAAATPVGGGRRLERG-------QSWW 55

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
           F AP      RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  +
Sbjct: 56  FWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FS 113

Query: 572 DFSTYGLSLVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
           +   + +S++DGFN+PM+  P   G   C  + C AN+   CP  L+V            
Sbjct: 114 NLDFWDISVIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGSLRVP----------G 163

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  +  S +FK  CP  ++Y  D P+S     S  
Sbjct: 164 GCNNPCTTFGGQQYCCTQG-----PCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWT 218

Query: 215 RELKIIFC 192
            + K++FC
Sbjct: 219 TDYKVMFC 226



>gb:TOBNP5O_1725454 Nicotiana sylvestris DNA for neutral PR-5
           (osmotin-like protein, PR-5d), complete cds.
          Length = 251

 Score =  130 bits (327), Expect = 4e-29
 Identities = 84/240 (35%), Positives = 115/240 (47%), Gaps = 2/240 (0%)
 Frame = -1

Query: 905 LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
           L AF T +  +G +  + NNCP+T+W A  P  G   LERG           F AP    
Sbjct: 12  LLAFVTYTHASG-VFEVHNNCPYTVWAAATPVGGGRRLERG-------QSWWFWAPPGTK 63

Query: 725 SGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS 549
             RIW RT C  +  GR  C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S
Sbjct: 64  MARIWGRTNCNFDGAGRGWCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDIS 121

Query: 548 LVDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAA 372
           ++DGFN+PM+  P   G   C  + C AN+   CP  L+V            GCN+ C  
Sbjct: 122 VIDGFNIPMSFGPTKPGPGKCHGIQCTANINGECPGALRVP----------GGCNNPCTT 171

Query: 371 FKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           F   + CC         C  +  S +FK  CP  ++Y  D P+S     S   + K++FC
Sbjct: 172 FGGQQYCCTQG-----PCGPTELSRWFKQRCPDAYSYPQDDPTSTFTCTSWTTDYKVMFC 226



>gb:NTOSMOTIN_1691660 N.tabacum mRNA for osmotin.
          Length = 245

 Score =  130 bits (327), Expect = 4e-29
 Identities = 90/259 (34%), Positives = 122/259 (47%), Gaps = 9/259 (3%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V   ++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 9   VFFLLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 56

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     R+W RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +  
Sbjct: 57  APRGTNMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGL 114

Query: 566 STYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
             + +SLVDGFN+PMT  P +   GK  C  + C AN          +R  +R  R P  
Sbjct: 115 DFWDISLVDGFNIPMTFAPTNPSGGK--CHAIHCTAN----------IRRMSRELRVPG- 161

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F   + CC         C  + +S FFK  CP  ++Y  D P+S       +
Sbjct: 162 GCNNPCTTFGGQQYCCTQG-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGS 216

Query: 215 RELKIIFC-----H*EYPL 174
              ++IFC     H  +PL
Sbjct: 217 TNYRVIFCPNGQAHPNFPL 235



>gb:AY737315_1626062 Solanum tuberosum putative thaumatin-like
           protein (PR-5/319) gene, complete cds.
          Length = 227

 Score =  130 bits (327), Expect = 4e-29
 Identities = 86/224 (38%), Positives = 111/224 (49%), Gaps = 2/224 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           I N C + +W A  P  G   L+ G       T    V P      RIW RT C  +  G
Sbjct: 30  ITNRCTYPVWAAASPGGGRR-LDSGQ------TWNLNVNP-GTIQARIWGRTNCNFDGSG 81

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHD 504
           R  C TGDC+G LEC G G + P TLA+F L+Q  + DF    +SLVDGFN+PM  +P +
Sbjct: 82  RGKCETGDCNGLLECQGYG-SPPNTLAEFALNQPNNLDF--VDISLVDGFNIPMEFSPIN 138

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
           G   C  + C A +   CP +L+             GCN+ C  FKT+E CC N    P 
Sbjct: 139 GG--CRNLLCNAPINDQCPNELRTP----------GGCNNPCTVFKTNEFCCTNG---PG 183

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  +  S FFK  CP  ++Y  D P+SL   C A    K++FC
Sbjct: 184 SCGPTDLSRFFKQRCPDAYSYPQDDPTSLF-TCPAGTNYKVVFC 226



>gb:BT010137_1640203 Arabidopsis thaliana At4g11650 gene, complete
           cds.
          Length = 244

 Score =  129 bits (323), Expect = 1e-28
 Identities = 87/249 (34%), Positives = 127/249 (51%), Gaps = 2/249 (0%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           ++S  +F +L   +TA+        I+N C +T+W A  P  G   L+ G       + R
Sbjct: 5   LVSTFIFSALLLISTATAAT---FEILNQCSYTVWAAASPGGGRR-LDAGQ------SWR 54

Query: 752 SFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-G 579
             VA   + + RIW RT C  +  GR  C TGDC G L+C G  G  P TLA++ L+Q  
Sbjct: 55  LDVAAGTKMA-RIWGRTNCNFDSSGRGRCQTGDCSGGLQCTG-WGQPPNTLAEYALNQFN 112

Query: 578 HADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
           + DF  Y +SLVDGFN+PM  +P     +C  + C A++   CP  L         R P 
Sbjct: 113 NLDF--YDISLVDGFNIPMEFSPTSS--NCHRILCTADINGQCPNVL---------RAPG 159

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  F+T++ CC N   +   C  + YS FFK  CP  ++Y  D P+S+   C+ 
Sbjct: 160 -GCNNPCTVFQTNQYCCTNGQGS---CSDTEYSRFFKQRCPDAYSYPQDDPTSIF-TCTN 214

Query: 218 ARELKIIFC 192
               +++FC
Sbjct: 215 T-NYRVVFC 222



>gb:AY743928_1626548 Solanum phureja osmotin-like protein A13 mRNA,
           complete cds.
          Length = 246

 Score =  129 bits (323), Expect = 1e-28
 Identities = 86/242 (35%), Positives = 116/242 (47%), Gaps = 4/242 (1%)
 Frame = -1

Query: 905 LCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARW 726
           L AF T +  A   I + NNCP+T+W A  P  G   L+RG   +         APR   
Sbjct: 12  LLAFVTYTYAA--TIEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTK 62

Query: 725 SGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLS 549
             RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +S
Sbjct: 63  MARIWGRTNCNFDGAGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDIS 120

Query: 548 LVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGC 378
           LVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V            GCN+ C
Sbjct: 121 LVDGFNIPMTFAPTNPSGGK--CHAIHCTANINGECPGSLRVP----------GGCNNPC 168

Query: 377 AAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKII 198
             F   +  C         C  +  S FFK  CP  ++Y  D P+S     S +   +++
Sbjct: 169 TTFGGQQYRCTQG-----PCGPTDLSRFFKQRCPDAYSYPQDDPTSTFTCPSGSTNYRVV 223

Query: 197 FC 192
           FC
Sbjct: 224 FC 225



>gb:A15677_1447629 proprothaumatine and the coding stand of its
           structural gene.
          Length = 229

 Score =  128 bits (322), Expect = 2e-28
 Identities = 83/247 (33%), Positives = 114/247 (46%), Gaps = 2/247 (0%)
 Frame = -1

Query: 926 SVTLFISLCAFTTA-SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           + T F  L  F    +L       IVN C +T+W A   + G   L+ GG  L      +
Sbjct: 3   ATTCFFFLFPFLLLLTLSRAATFEIVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWT 60

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
                    G+IWART C  +  GR  C TGDC G L+C  R G  P TLA+F L+Q   
Sbjct: 61  INVEPGTKGGKIWARTDCYFDDSGRGICRTGDCGGLLQCK-RFGRPPTTLAEFSLNQYGK 119

Query: 572 DFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG 393
           D+    +S + GFN+PM  +P      C  V C A+++  CP +L         + P  G
Sbjct: 120 DY--IDISNIKGFNVPMDFSPTT--RGCRGVRCAADIVGQCPAKL---------KAPGGG 166

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           CN  C  F+T E CC         C  + YS FFK  CP  F+Y  D P+++   C  + 
Sbjct: 167 CNDACTVFQTSEYCCTTG-----KCGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSS 219

Query: 212 ELKIIFC 192
             ++ FC
Sbjct: 220 NYRVTFC 226



>sp|P02884|THM2_THADA Thaumatin II precursor.>pir|A03378|QTTC2
           thaumatin II precursor - miracle fruit>gb:A15671_1447626
           proprothaumatine.>gb:A15673_1447627 proprothaumatine and
           the coding strand of its structural
           gene.>gb:TDATHAU2_1724910 T.daniellii preprothaumatin-2
           mRNA, complete cds.
          Length = 235

 Score =  128 bits (322), Expect = 2e-28
 Identities = 83/247 (33%), Positives = 114/247 (46%), Gaps = 2/247 (0%)
 Frame = -1

Query: 926 SVTLFISLCAFTTA-SLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           + T F  L  F    +L       IVN C +T+W A   + G   L+ GG  L      +
Sbjct: 3   ATTCFFFLFPFLLLLTLSRAATFEIVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWT 60

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
                    G+IWART C  +  GR  C TGDC G L+C  R G  P TLA+F L+Q   
Sbjct: 61  INVEPGTKGGKIWARTDCYFDDSGRGICRTGDCGGLLQCK-RFGRPPTTLAEFSLNQYGK 119

Query: 572 DFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG 393
           D+    +S + GFN+PM  +P      C  V C A+++  CP +L         + P  G
Sbjct: 120 DY--IDISNIKGFNVPMDFSPTT--RGCRGVRCAADIVGQCPAKL---------KAPGGG 166

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           CN  C  F+T E CC         C  + YS FFK  CP  F+Y  D P+++   C  + 
Sbjct: 167 CNDACTVFQTSEYCCTTG-----KCGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSS 219

Query: 212 ELKIIFC 192
             ++ FC
Sbjct: 220 NYRVTFC 226



>gb:AF516207_1807491 Chenopodium quinoa osmotin-like protein 4
           (olp-4) mRNA, complete cds.
          Length = 228

 Score =  128 bits (321), Expect = 2e-28
 Identities = 81/246 (32%), Positives = 109/246 (44%), Gaps = 3/246 (1%)
 Frame = -1

Query: 920 TLFISLCAFTTASLPA-GLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           +L IS       S P      T+VNNC +T+W A  P     +   GG   + +   +  
Sbjct: 8   SLLISCILIVGISAPIHATTFTVVNNCGYTVWGAATPGGAKELPSNGGSWTFDVNPNTA- 66

Query: 743 APRARWSGRIWARTGCVLNHGR-FTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHAD 570
                  GR+W RTGC  +      C TGDC DG  +C    G  P T+A++ L      
Sbjct: 67  ------GGRVWGRTGCTSSGSNSLKCTTGDCGDGLFDCGTNSGKPPFTIAEYTLTNTQ-- 118

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGC 390
             +  +SLVDGFN+PM      G +  P   C AN+   CP  L+V            GC
Sbjct: 119 -DSIDVSLVDGFNVPMNFKAASGCDKIP--SCAANVNDECPSDLKVD----------GGC 165

Query: 389 NSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARE 210
            S C  + TDE CCRN Y N   C  + YS  FK+ CP  ++YA D  ++L   C     
Sbjct: 166 LSACNKYNTDEYCCRNQYEN--NCPPNNYSMIFKNLCPQAYSYAKDNINTL--SCPHGAN 221

Query: 209 LKIIFC 192
             + FC
Sbjct: 222 YVVTFC 227



>gb:CAN297410_1645073 Capsicum annuum mRNA for osmotin-like protein
           (pr5 p23 gene).>gb:AF297646_1784079 Capsicum annuum
           thaumatin-like protein (TLP) mRNA, complete cds.
          Length = 246

 Score =  128 bits (321), Expect = 2e-28
 Identities = 87/251 (34%), Positives = 119/251 (47%), Gaps = 5/251 (1%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L  +  + L AF T +  A     + NNCP+T+W A  P  G   L+RG          +
Sbjct: 4   LRSSFVLFLLAFVTYTYAA--TFEVRNNCPYTVWAASTPVGGGRRLDRG-------QTWT 54

Query: 749 FVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH 576
             AP      RIW RT C  +  GR +C TGDC G L+C G  G  P TLA++ L+Q  +
Sbjct: 55  INAPPGTAMARIWGRTNCNFDGSGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALNQFNN 113

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHD---GKEHCPVVGCRANLLPACPRQLQVRLRARRGRG 405
            DF  + +SLVDGFN+PMT  P +   GK  C  + C AN+   CP  L+V         
Sbjct: 114 LDF--WDISLVDGFNIPMTFAPTNPSGGK--CHAIQCTANINGECPGSLRVP-------- 161

Query: 404 PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHEC 225
              GCN+ C  F   + CC         C  +  S FFK  CP  ++Y  D  +S     
Sbjct: 162 --GGCNNPCTTFGGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDATSTFTCP 214

Query: 224 SAARELKIIFC 192
           S +   +++FC
Sbjct: 215 SGSTNYRVVFC 225



>gb:A15675_1447628 proprothaumatine and the coding strand of its
           structural gene.
          Length = 213

 Score =  128 bits (321), Expect = 2e-28
 Identities = 78/223 (34%), Positives = 107/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTKGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TGDC G L+C  R G  P TLA+F L+Q   D+    +S + GFN+PM  +P   
Sbjct: 63  RGICRTGDCGGLLQCK-RFGRPPTTLAEFSLNQYGKDY--IDISNIKGFNVPMDFSPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 -RGCRGVRCAADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +   ++ FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYRVTFC 204



>gb:A15660_1447625 Mature thaumatin.
          Length = 207

 Score =  128 bits (321), Expect = 2e-28
 Identities = 78/223 (34%), Positives = 107/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTKGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TGDC G L+C  R G  P TLA+F L+Q   D+    +S + GFN+PM  +P   
Sbjct: 63  RGICRTGDCGGLLQCK-RFGRPPTTLAEFSLNQYGKDY--IDISNIKGFNVPMDFSPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 -RGCRGVRCAADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +   ++ FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYRVTFC 204



>sp|P50700|OSL3_ARATH Osmotin-like protein OSM34
           precursor.>pir|T04212|T04212 osmotin precursor -
           Arabidopsis thaliana>gb:ATCHRIV32_1544930 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           32.>gb:ATT5C23_1556101 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T5C23 (ESSA project).
          Length = 244

 Score =  127 bits (320), Expect = 3e-28
 Identities = 87/249 (34%), Positives = 126/249 (50%), Gaps = 2/249 (0%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           ++S  +F +L   +TA+        I+N C +T+W A  P  G   L+ G       + R
Sbjct: 5   LVSTFIFSALLLISTATAAT---FEILNQCSYTVWAAASPGGGRR-LDAGQ------SWR 54

Query: 752 SFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-G 579
             VA   + + RIW RT C  +  GR  C TGDC G L+C G  G  P TLA++ L+Q  
Sbjct: 55  LDVAAGTKMA-RIWGRTNCNFDSSGRGRCQTGDCSGGLQCTG-WGQPPNTLAEYALNQFN 112

Query: 578 HADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
           + DF  Y +SLVDGFN+PM  +P     +C  + C A++   CP  L         R P 
Sbjct: 113 NLDF--YDISLVDGFNIPMEFSPTSS--NCHRILCTADINGQCPNVL---------RAPG 159

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  F+T++ CC N   +   C  + YS FFK  CP  ++Y  D P+S    C+ 
Sbjct: 160 -GCNNPCTVFQTNQYCCTNGQGS---CSDTEYSRFFKQRCPDAYSYPQDDPTSTF-TCTN 214

Query: 218 ARELKIIFC 192
               +++FC
Sbjct: 215 T-NYRVVFC 222



>gb:AF378574_1793403 Sambucus nigra clone VL88 thaumatin-like
           protein (TLPl2) mRNA, partial cds.
          Length = 224

 Score =  127 bits (319), Expect = 4e-28
 Identities = 85/247 (34%), Positives = 120/247 (48%), Gaps = 1/247 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L + L    C + T S   G    IVN C +T+W A  P         GG  L +    S
Sbjct: 7   LPILLSTLSCLYFTFS--HGATFDIVNRCSYTVWAAASPG--------GGRRLDQGQSWS 56

Query: 749 FVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA 573
                   + RIW RT C  +  GR  C TG+C+G LEC G G + P TLA+F L+Q + 
Sbjct: 57  LNVNPGTTNARIWGRTNCNFDASGRGQCQTGNCNGGLECQGYG-SPPNTLAEFALNQPN- 114

Query: 572 DFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG 393
           +     +SLVDGFN+PM  T  +    C  + C A +   CP +L         R P  G
Sbjct: 115 NLDYVDISLVDGFNIPMDFTGIN----CRSIVCSAPINQECPAEL---------RAPG-G 160

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           CN+ C  F  +E CC +    P  C+ + +S FFK  CP++++Y  D P+SL   C +  
Sbjct: 161 CNNPCTVFPRNEYCCTDG---PGSCQPTDFSRFFKTRCPTSYSYPQDDPTSLF-TCPSGT 216

Query: 212 ELKIIFC 192
             +++FC
Sbjct: 217 NYRVVFC 223



>gb:AF378571_1793400 Sambucus nigra clone VBL85 thaumatin-like
           protein (TLPl) mRNA, complete cds.
          Length = 226

 Score =  127 bits (319), Expect = 4e-28
 Identities = 83/248 (33%), Positives = 119/248 (47%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L +++F  +   ++++  A     I NNCP T+W A  P         GG  L +    S
Sbjct: 7   LPISIFFVIALISSSAYAANF--NIRNNCPFTVWAAAVPG--------GGRQLNRGQVWS 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH 576
              P      RIWART C  +  GR  C TGDC+G L C   G A P TLA++ L+Q  +
Sbjct: 57  LDVPAGTRGARIWARTNCNFDGAGRGRCQTGDCNGLLSCQAYG-APPNTLAEYALNQFNN 115

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
            DF  + +SLVDGFN+ M  +P  G      + C A++   CP +L         R P  
Sbjct: 116 LDF--FDISLVDGFNVAMDFSPTGGCARG--IQCTADINGQCPNEL---------RAPG- 161

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  ++T+E CC N       C  + +S FFK  C   ++Y  D P+S    C   
Sbjct: 162 GCNNPCTVYRTNEYCCTNGQGT---CGPTNFSRFFKERCRDAYSYPQDDPTSTF-TCPGG 217

Query: 215 RELKIIFC 192
              +++FC
Sbjct: 218 TNYRVVFC 225



>gb:A46806_1449315 Sequence 3 from Patent EP0684312.
          Length = 207

 Score =  127 bits (319), Expect = 4e-28
 Identities = 78/223 (34%), Positives = 106/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTKGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TGDC G L+C  R G  P TLA F L+Q   D+    +S + GFN+PM  +P   
Sbjct: 63  RGICRTGDCGGLLQCK-RFGRPPTTLADFSLNQYGKDY--IDISNIKGFNVPMDFSPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 -RGCRGVRCAADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +   ++ FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYRVTFC 204



>gb:AF003007_1760630 Vitis vinifera thaumatin-like protein VVTL1
           mRNA, complete cds.
          Length = 222

 Score =  127 bits (318), Expect = 5e-28
 Identities = 84/255 (32%), Positives = 120/255 (47%), Gaps = 2/255 (0%)
 Frame = -1

Query: 950 MAFPATI-LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFA 774
           M F  T+ + + L +SL   +T +        I+N C +T+W A  P         GG  
Sbjct: 1   MRFTTTLPILIPLLLSLLFTSTHAAT----FDILNKCTYTVWAAASPG--------GGRR 48

Query: 773 LYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQ 597
           L      +        + RIW RT C  + +GR  C TGDC+G LEC G  G+ P TLA+
Sbjct: 49  LDSGQSWTITVNPGTTNARIWGRTSCTFDANGRGKCETGDCNGLLECQGY-GSPPNTLAE 107

Query: 596 FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRAR 417
           F L+Q + +     +SLVDGFN+PM  +       C  + C  ++   CP +L+      
Sbjct: 108 FALNQPN-NLDYIDISLVDGFNIPMDFS------GCRGIQCSVDINGQCPSELKA----- 155

Query: 416 RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL 237
                  GCN+ C  FKT+E CC    + P  C  + YS FFK  CP  ++Y  D  +SL
Sbjct: 156 -----PGGCNNPCTVFKTNEYCCT---DGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSL 207

Query: 236 MHECSAARELKIIFC 192
              C +    K+ FC
Sbjct: 208 F-TCPSGTNYKVTFC 221



>gb:VVI237999_1727514 Vitis vinifera mRNA for thaumatin-like
           protein.
          Length = 222

 Score =  127 bits (318), Expect = 5e-28
 Identities = 84/255 (32%), Positives = 120/255 (47%), Gaps = 2/255 (0%)
 Frame = -1

Query: 950 MAFPATI-LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFA 774
           M F  T+ + + L +SL   +T          I+N C +T+W A  P         GG  
Sbjct: 1   MRFTTTLPILIPLLLSLLFTSTHEAT----FDILNKCTYTVWAAASPG--------GGRR 48

Query: 773 LYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQ 597
           L      +        + RIW RT C  + +GR  C TGDC+G LEC G  G+ P TLA+
Sbjct: 49  LDSGQSWTITVNPGTTNARIWGRTSCTFDANGRGKCETGDCNGLLECQGY-GSPPNTLAE 107

Query: 596 FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRAR 417
           F L+Q + +     +SL DGFN+PM  +       C  + C A++   CP +L+      
Sbjct: 108 FALNQPN-NLDYIDISLFDGFNIPMDFS------GCRGIQCSADINGQCPSELKA----- 155

Query: 416 RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL 237
                  GCN+ C  FKT+E CC    + P  C  + YS FFK  CP  ++Y  D  +SL
Sbjct: 156 -----PGGCNNPCTVFKTNEYCCT---DGPGSCGPTTYSKFFKDRCPDAYSYPQDDKTSL 207

Query: 236 MHECSAARELKIIFC 192
              C++    K+ FC
Sbjct: 208 F-TCTSGTNYKVTFC 221



>sp|P25096|P21_SOYBN P21 protein.>pir|A33176|A33176 P21 protein -
           soybean
          Length = 202

 Score =  127 bits (318), Expect = 5e-28
 Identities = 79/224 (35%), Positives = 108/224 (48%), Gaps = 2/224 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           I N C +T+W A  P         GG  L      S   P      R+WARTGC  +  G
Sbjct: 5   ITNRCTYTVWAASVP-------VGGGVQLNPGQSWSVDVPAGTKGARVWARTGCNFDGSG 57

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TGDC G L+C   G A P TLA++ L+ G  +   + +SLVDGFN+PM  +P   
Sbjct: 58  RGGCQTGDCGGVLDCKAYG-APPNTLAEYGLN-GFNNLDFFDISLVDGFNVPMDFSPTSN 115

Query: 500 KEHCPV-VGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
              C   + C A++   CP +L+ +           GCN+ C  FKTD+ CC     N  
Sbjct: 116 G--CTRGISCTADINGQCPSELKTQ----------GGCNNPCTVFKTDQYCC-----NSG 158

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  + YS FFK  CP  ++Y  D P S    C+   + +++FC
Sbjct: 159 SCGPTDYSRFFKQRCPDAYSYPKDDPPSTF-TCNGGTDYRVVFC 201



>gb:AY085200_1570279 Arabidopsis thaliana clone 13796 mRNA, complete
           sequence.
          Length = 244

 Score =  126 bits (317), Expect = 6e-28
 Identities = 87/249 (34%), Positives = 126/249 (50%), Gaps = 2/249 (0%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           ++S  +F +L   +TA+        I+N C +T+W A  P  G   L+ G       + R
Sbjct: 5   LVSTFIFSALLLISTATAAT---FEILNQCSYTVWAAASPGGGRR-LDAGQ------SWR 54

Query: 752 SFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-G 579
             VA   + + RIW RT C  +  GR  C TGDC G L+C G  G  P TLA++ L+Q  
Sbjct: 55  LDVAAGTKMA-RIWGRTNCNFDSSGRGRCQTGDCSGGLQCTG-WGHPPNTLAEYALNQFN 112

Query: 578 HADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
           + DF  Y +SLVDGFN+PM  +P     +C  + C A++   CP  L         R P 
Sbjct: 113 NLDF--YDISLVDGFNIPMEFSPTSS--NCHRILCTADINGQCPNVL---------RAPG 159

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  F+T++ CC N   +   C  + YS FFK  CP  ++Y  D P+S    C+ 
Sbjct: 160 -GCNNPCTVFQTNQYCCTNGQGS---CSDTDYSRFFKQRCPDAYSYPQDDPTSTF-TCTN 214

Query: 218 ARELKIIFC 192
               +++FC
Sbjct: 215 T-NYRVVFC 222



>gb:ATRNAOSM_1554068 A.thaliana mRNA for osmotin protein.
          Length = 244

 Score =  126 bits (317), Expect = 6e-28
 Identities = 87/249 (34%), Positives = 126/249 (50%), Gaps = 2/249 (0%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHR 753
           ++S  +F +L   +TA+        I+N C +T+W A  P  G   L+ G       + R
Sbjct: 5   LVSTFIFSALLLISTATAAT---FEILNQCSYTVWAAASPGGGRR-LDAGQ------SWR 54

Query: 752 SFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-G 579
             VA   + + RIW RT C  +  GR  C TGDC G L+C G  G  P TLA++ L+Q  
Sbjct: 55  LDVAAGTKMA-RIWGRTNCNFDSSGRGRCQTGDCSGGLQCTG-WGQPPNTLAEYALNQFN 112

Query: 578 HADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
           + DF  Y +SLVDGFN+PM  +P     +C  + C A++   CP  L         R P 
Sbjct: 113 NLDF--YDISLVDGFNIPMEFSPTSS--NCHRILCTADINGQCPNVL---------RAPG 159

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  F+T++ CC N   +   C  + YS FFK  CP  ++Y  D P+S    C+ 
Sbjct: 160 -GCNNPCTVFQTNQYCCTNGQGS---CSDTVYSRFFKQRCPDAYSYPQDDPTSTF-TCTN 214

Query: 218 ARELKIIFC 192
               +++FC
Sbjct: 215 T-NYRVVFC 222



>gb:AY485229_1608448 Brassica juncea putative osmotin-like protein
           precursor mRNA, complete cds.
          Length = 228

 Score =  126 bits (316), Expect = 8e-28
 Identities = 79/222 (35%), Positives = 108/222 (48%), Gaps = 4/222 (1%)
 Frame = -1

Query: 845 CPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTC 669
           CP+T+W A  P  G   L+RG   +         APR     RIW RT C  +  GR +C
Sbjct: 11  CPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTSMARIWGRTNCNFDGAGRGSC 63

Query: 668 ATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD---GK 498
            TGDC G L+C G  G  P TLA++ L+Q  ++   + +SLVDGFN+PMT  P +   GK
Sbjct: 64  QTGDCGGVLQCTG-WGKPPNTLAEYALNQ-FSNLDFWDISLVDGFNIPMTFAPTNPSGGK 121

Query: 497 EHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMC 318
             C  + C AN+   CP  L+V            GCN+ C  F   + CC         C
Sbjct: 122 --CHSIQCTANINGECPAALRVP----------GGCNNPCTTFGGQQYCCTQG-----PC 164

Query: 317 KASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             +  S FFK  CP  ++Y  D P+S     S +   +++FC
Sbjct: 165 GPTELSKFFKQRCPDAYSYPQDDPTSTFTCPSDSTNYRVVFC 206



>pir|S34794|S34794 osmotin - common tobacco
          Length = 243

 Score =  126 bits (316), Expect = 8e-28
 Identities = 86/258 (33%), Positives = 117/258 (45%), Gaps = 8/258 (3%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V   ++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 9   VFFLLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 56

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     R+W RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +  
Sbjct: 57  APRGTKMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGL 114

Query: 566 STYGLSLVDGFNLPMTL--TPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG 393
             + +SL+DGFN+PMT    P  GK H             CP +L+V            G
Sbjct: 115 DFWDISLLDGFNIPMTFPTNPSGGKCHALCTAINGE----CPAELRVP----------GG 160

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           CN+ C  F   + CC         C  + +S FFK  CP  ++Y  D P+S       + 
Sbjct: 161 CNNPCTTFGGQQYCCTQR-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGST 215

Query: 212 ELKIIFC-----H*EYPL 174
             ++IFC     H  +PL
Sbjct: 216 NYRVIFCPNGQAHPNFPL 233



>gb:SYNTHAUMA_2153759 Synthetic thaumatin gene, complete cds.
          Length = 208

 Score =  125 bits (313), Expect = 2e-27
 Identities = 77/223 (34%), Positives = 105/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 6   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSG 63

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
              C TGDC G L C  R G  P TLA+F L+Q   D+    +S + GFN+PM  +P   
Sbjct: 64  SGICKTGDCGGLLRCK-RFGRPPTTLAEFSLNQYGKDY--IDISNIKGFNVPMNFSPTT- 119

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 120 -RGCRGVRCAADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 164

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +   ++ FC
Sbjct: 165 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYRVTFC 205



>gb:AF294847_1783921 Capsicum annuum clone GC167 PR5-like protein
           gene, partial cds.
          Length = 180

 Score =  125 bits (313), Expect = 2e-27
 Identities = 79/206 (38%), Positives = 100/206 (48%), Gaps = 4/206 (1%)
 Frame = -1

Query: 851 NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRF 675
           NNCP+T+W A  P  G   L RG   +         APR     RIW RTGC  N  GR 
Sbjct: 1   NNCPYTVWAASTPIGGGRRLNRGQTWVIN-------APRGTKMARIWGRTGCNFNAAGRG 53

Query: 674 TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP---HD 504
           +C TGDC G L+  G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P     
Sbjct: 54  SCQTGDCGGVLQWTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPTKPSG 111

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
           GK  C  + C AN+   CPR L+V            GCN  C  F   + CC        
Sbjct: 112 GK--CHAIHCTANINGECPRALKVP----------GGCNDPCTTFGGQQYCCTQG----- 154

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTP 246
            C  +  S FF+  CP+T++Y  D P
Sbjct: 155 PCGPTELSKFFRKRCPNTYSYPQDDP 180



>sp|P02883|THM1_THADA Thaumatin I.>pir|A03377|QTTC1 thaumatin I
           [validated] - miracle fruit
          Length = 207

 Score =  125 bits (313), Expect = 2e-27
 Identities = 77/223 (34%), Positives = 105/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
              C TGDC G L C  R G  P TLA+F L+Q   D+    +S + GFN+PM  +P   
Sbjct: 63  SGICKTGDCGGLLRCK-RFGRPPTTLAEFSLNQYGKDY--IDISNIKGFNVPMNFSPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 -RGCRGVRCAADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +   ++ FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYRVTFC 204



>gb:AF355098_1790696 Thaumatococcus daniellii thaumatin I mRNA,
           partial cds.
          Length = 207

 Score =  124 bits (312), Expect = 2e-27
 Identities = 77/223 (34%), Positives = 105/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
              C TGDC G L C  R G  P TLA+F L+Q   D+    +S + GFN+PM  +P   
Sbjct: 63  SGICKTGDCGGLLRCK-RFGRPPTTLAEFSLNQYGKDY--IDISNIKGFNVPMDFSPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 -RGCRGVRCAADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +   ++ FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYRVTFC 204



>gb:TOBOSM_1725473 N.tabacum osmotin mRNA, complete cds.
          Length = 243

 Score =  124 bits (312), Expect = 2e-27
 Identities = 85/258 (32%), Positives = 117/258 (45%), Gaps = 8/258 (3%)
 Frame = -1

Query: 923 VTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           V   ++L  +T A+      I + NNCP+T+W A  P  G   L+RG   +         
Sbjct: 9   VFFLLALVTYTYAAT-----IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN------- 56

Query: 743 APRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           APR     R+W RT C  N  GR TC TGDC G L+C G  G  P TLA++ L Q  +  
Sbjct: 57  APRGTKMARVWGRTNCNFNAAGRGTCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSGL 114

Query: 566 STYGLSLVDGFNLPMTL--TPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVG 393
             + +SL+DGFN+P+T    P  GK H             CP +L+V            G
Sbjct: 115 DFWDISLLDGFNIPITFPTNPSGGKCHALCTAINGE----CPAELRVP----------GG 160

Query: 392 CNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAR 213
           CN+ C  F   + CC         C  + +S FFK  CP  ++Y  D P+S       + 
Sbjct: 161 CNNPCTTFGGQQYCCTQR-----PCGPTFFSKFFKQRCPDAYSYPQDDPTSTFTCPGGST 215

Query: 212 ELKIIFC-----H*EYPL 174
             ++IFC     H  +PL
Sbjct: 216 NYRVIFCPNGQAHPNFPL 233



>gb:AY737312_1626058 Solanum tuberosum osmotin-like protein (OSM-1g)
           and osmotin-like protein (OSM-1h) genes, complete cds.
          Length = 226

 Score =  124 bits (311), Expect = 3e-27
 Identities = 81/225 (36%), Positives = 111/225 (49%), Gaps = 5/225 (2%)
 Frame = -1

Query: 851 NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRF 675
           NNCP+T+W A  P  G   L++G   +          PR     RIW RT C  +  GR 
Sbjct: 28  NNCPYTVWAASTPIGGGRRLDQGQTWVID-------TPRGTKMARIWGRTNCNFDGAGRG 80

Query: 674 TCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHD-- 504
           +C TGDC G L+C G  G  P TLA++ L+Q  + DF  + +SLVD FN+PMT TP +  
Sbjct: 81  SCQTGDCGGVLQCTG-WGKPPNTLAEYALNQFNNLDF--WDISLVDEFNIPMTFTPTNPS 137

Query: 503 -GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNP 327
            GK  C  + C AN+   CP QL+V            GCN+ C  F   + CC       
Sbjct: 138 GGK--CHSIQCTANINGECPGQLKVP----------GGCNNPCTTFGGQQHCCTQG---- 181

Query: 326 LMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             C  + +S FFK  CP  ++Y  D  +S     S +   +++FC
Sbjct: 182 -PCGPTDWSRFFKQRCPDAYSYPQDDATSTFTCPSDSTNYRVVFC 225



>gb:A46810_1449317 Sequence 7 from Patent EP0684312.
          Length = 207

 Score =  124 bits (311), Expect = 3e-27
 Identities = 77/223 (34%), Positives = 104/223 (46%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
              C TGDC G L C  R G  P TLA F L+Q   D+    +S + GFN+PM  +P   
Sbjct: 63  SGICKTGDCGGLLRCK-RFGRPPTTLADFSLNQYGKDY--IDISNIKGFNVPMNFSPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 -RGCRGVRCAADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +   ++ FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYRVTFC 204



>pir|T05973|T05973 permatin homolog PR5 -
           barley>gb:HVPATHPR5_1682485 Hordeum vulgare mRNA for
           basic pathogenesis-related protein, PR5.
          Length = 237

 Score =  123 bits (309), Expect = 5e-27
 Identities = 85/254 (33%), Positives = 119/254 (46%), Gaps = 1/254 (0%)
 Frame = -1

Query: 956 MAMAFPATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGF 777
           MA +    +L+  L  +L A T A+      IT+VN C +T+WP   P  G  +     +
Sbjct: 1   MASSRVVYLLAGLLLAALAATTDAAT-----ITVVNRCSYTVWPGALPGGGVRLDPGQSW 55

Query: 776 ALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLA 600
           AL          P      R+W RTGC  +  GR  C TGDC+G L C    G  P TLA
Sbjct: 56  ALNM--------PAGTAGARVWPRTGCTFDGSGRGRCITGDCNGVLACRV-SGQQPTTLA 106

Query: 599 QFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRA 420
           ++ L QG A+   + LS++DGFN+PM+  P  G   C    C  ++   C ++LQV    
Sbjct: 107 EYTLGQG-ANKDFFDLSVIDGFNVPMSFEPVGG---CRAARCATDITKDCLKELQVP--- 159

Query: 419 RRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
                   GC + C  F  D  CCR  + +   C  + YS FFK  CP  ++YA D  +S
Sbjct: 160 -------GGCAT-CGKFGGDTYCCRGQFEHN--CPPTNYSMFFKGKCPDAYSYAKDDQTS 209

Query: 239 LMHECSAARELKII 198
               C A    +I+
Sbjct: 210 TF-TCPAGTNYQIV 222



>gb:AF364864_1791606 Helianthus annuus pathogenesis-related protein
           5-1 (PR5-1) mRNA, complete cds.
          Length = 222

 Score =  123 bits (308), Expect = 7e-27
 Identities = 86/249 (34%), Positives = 115/249 (46%), Gaps = 15/249 (6%)
 Frame = -1

Query: 893 TTASLPAGLII------------TIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           TT++LP  L++            TI NNCP+T+W    P         GG  L      S
Sbjct: 2   TTSTLPTFLLLAILFHYTNAAVFTIRNNCPYTVWAGAVPG--------GGRQLNSGQTWS 53

Query: 749 FVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH 576
                     RIW RT C  +  GR  C TGDC+G L+C   G   P TLA++ L+Q  +
Sbjct: 54  LTVAAGTAGARIWPRTNCNFDGSGRGRCQTGDCNGLLQCQNYG-TPPNTLAEYALNQFNN 112

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPV-VGCRANLLPACPRQLQVRLRARRGRGPV 399
            DF  + +SLVDGFN+PM   P+     C   + C A++   CP +L         R P 
Sbjct: 113 LDF--FDISLVDGFNVPMVFRPNSNG--CTRGISCTADINGQCPGEL---------RAPG 159

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C  +KTD+ CC     N   C  +  S FFK  CP  ++Y  D P+S    C  
Sbjct: 160 -GCNNPCTVYKTDQYCC-----NSGNCGPTDLSRFFKTRCPDAYSYPKDDPTSTF-TCPG 212

Query: 218 ARELKIIFC 192
                +IFC
Sbjct: 213 GTNYDVIFC 221



>pir|E96725|E96725 hypothetical protein F20P5.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_894607 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F20P5_1677757 Sequence of BAC F20P5 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 676

 Score =  123 bits (308), Expect = 7e-27
 Identities = 81/230 (35%), Positives = 117/230 (50%), Gaps = 7/230 (3%)
 Frame = -1

Query: 860 TIVNNCPHTIWPAIQPNTGYP-VLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           TI N C +TIWPA     GY   LE  GF L K   R+  AP + W GR W RT C  N 
Sbjct: 36  TIENKCQYTIWPATY---GYRRSLETTGFVLEKGETRTIKAPSS-WIGRFWGRTLCSTNS 91

Query: 683 -GRFTCATGDC-DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
            G F+CATGDC  G+++C G     P T+ +F L     D+  Y +++ +G+NLP+ +TP
Sbjct: 92  TGGFSCATGDCTSGKIKCLGIP-IDPTTVVEFNLASYGVDY--YVVNVFNGYNLPLLVTP 148

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
            +  ++C  + C  ++   CP +L V         P+  C + C  ++  ELCC    + 
Sbjct: 149 EN--KNCRSIECVIDMNETCPSELMVNSSGLGSHHPIA-CMTTCQRYQLPELCCIGLSSG 205

Query: 329 ----PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
               P +CK + YS  F + CPS ++YA+D  +S    C       I FC
Sbjct: 206 VVVPPGICKRTIYSRTFNNVCPSAYSYAYDVDNS-SFTCPNFSNFVITFC 254



>gb:AF378572_1793401 Sambucus nigra clone VL79 thaumatin-like
           protein (TLP) mRNA, partial cds.
          Length = 200

 Score =  122 bits (305), Expect = 1e-26
 Identities = 79/223 (35%), Positives = 111/223 (49%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HG 681
           IVN   +T+W A  P         GG  L +    S        + RIW RT C  N  G
Sbjct: 5   IVNRRSYTVWAAASPG--------GGRRLDQGQSWSLNVNPGTTNARIWGRTNCNFNPSG 56

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TG+C+G LEC G G + P TLA+F L+Q + +     +SLVDGFN+PM  T  + 
Sbjct: 57  RGQCETGNCNGGLECQGYG-SPPNTLAKFALNQPN-NLDYVDISLVDGFNIPMDFTGIN- 113

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
              C  + C A +   CP +L         R P  GCN+ C  F  +E CC +    P  
Sbjct: 114 ---CRSIVCSAPINQECPAEL---------RAPG-GCNNPCTVFPRNEYCCTDG---PGS 157

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C+ + +S FFK  CP++++Y  D P+SL   C +    +++FC
Sbjct: 158 CQPTDFSRFFKTRCPTSYSYPQDDPTSLF-TCPSGTNYRVVFC 199



>gb:A46804_1449314 Sequence 1 from Patent EP0684312.
          Length = 207

 Score =  122 bits (305), Expect = 1e-26
 Identities = 78/223 (34%), Positives = 105/223 (47%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTKGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
           R  C TGDC G L+C  R G  P TLA F L+Q   D+    +S + GFN+PM   P   
Sbjct: 63  RGICRTGDCGGLLQCK-RFGRPPTTLADFSLNQYGKDY--IDISNIKGFNVPMDFCPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
           +  C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 RGGCRGVRC-ADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +    + FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYSVTFC 204



>gb:AY256429_1593154 Solanum tuberosum cultivar Yellow Finn osmotin
           81 gene, partial cds.
          Length = 198

 Score =  121 bits (304), Expect = 2e-26
 Identities = 76/199 (38%), Positives = 96/199 (48%), Gaps = 2/199 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 7   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 59

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 60  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 117

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC      
Sbjct: 118 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCCTQG--- 164

Query: 329 PLMCKASRYSDFFKHACPS 273
              C  +  S FFK  CPS
Sbjct: 165 --PCGPTELSKFFKKRCPS 181



>gb:AF378573_1793402 Sambucus nigra clone VL85 thaumatin-like
           protein (TLPl1) mRNA, complete cds.
          Length = 226

 Score =  120 bits (302), Expect = 3e-26
 Identities = 83/248 (33%), Positives = 116/248 (46%), Gaps = 2/248 (0%)
 Frame = -1

Query: 929 LSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRS 750
           L +++F  +    +++  A     I NNCP T+W A  P         GG  L +    S
Sbjct: 7   LPISIFFVISLIFSSAHAANF--NIRNNCPFTVWAAAVPG--------GGRQLNRGQVWS 56

Query: 749 FVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GH 576
              P      RIWART C  +  GR  C TGDC+G L C   G   P TLA++ L+Q  +
Sbjct: 57  LDVPARTAGARIWARTNCNFDGAGRGRCQTGDCNGLLACQAYG-TPPNTLAEYALNQFNN 115

Query: 575 ADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVV 396
            DF  + +SLVDGFN+ M  +P  G      + C A++   CP  L         R P  
Sbjct: 116 LDF--FDISLVDGFNVAMDFSPTGGCARG--IQCTADINGQCPNVL---------RAPG- 161

Query: 395 GCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAA 216
           GCN+ C  F+T+E CC N   +   C A+  S FFK  C   ++Y  D  +S    C   
Sbjct: 162 GCNNPCTVFRTNEYCCTNGQGS---CSATNLSRFFKERCRDAYSYPQDDATSTF-TCPGG 217

Query: 215 RELKIIFC 192
              +++FC
Sbjct: 218 TNYRVVFC 225



>gb:AY256439_1593164 Solanum tuberosum cultivar Atlantic osmotin 81
           gene, partial cds.
          Length = 188

 Score =  120 bits (302), Expect = 3e-26
 Identities = 74/203 (36%), Positives = 97/203 (47%), Gaps = 2/203 (0%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+P+   P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPIAFAPT 118

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC      
Sbjct: 119 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCCTQG--- 165

Query: 329 PLMCKASRYSDFFKHACPSTFTY 261
              C  +  S FFK  CP  ++Y
Sbjct: 166 --PCGPTELSKFFKKRCPDAYSY 186



>gb:AY737314_1626061 Solanum tuberosum osmotin-like protein (OSM-8e)
           gene, complete cds.
          Length = 220

 Score =  120 bits (301), Expect = 4e-26
 Identities = 79/224 (35%), Positives = 109/224 (48%), Gaps = 4/224 (1%)
 Frame = -1

Query: 851 NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRF 675
           NNCP+TIW A  P  G   L+ G   +         APR     RIW RT C  +  GR 
Sbjct: 33  NNCPYTIWAASTPIGGGRRLDSGQTWVID-------APRGTKMARIWGRTNCNFDGAGRG 85

Query: 674 TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHD--- 504
           +C TGDC G L+C G  G +P TLA++ L+Q  ++   + +SL++GFN+PMT  P +   
Sbjct: 86  SCQTGDCGGVLQCTG-WGKSPNTLAEYALNQ-FSNLDFWDISLIEGFNIPMTFAPTNPSG 143

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
           GK  C  V C AN+   CP QL+V            GCN+ C   +              
Sbjct: 144 GK--CHAVQCTANINGECPNQLKVS----------GGCNNPCTIGQ-------------- 177

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            C  +  S FFK  CP  ++Y  D P+SL    S +   +++FC
Sbjct: 178 -CGPNDLSRFFKQRCPDAYSYPQDDPTSLFACPSDSTNYRVVFC 220



>gb:AJ871175_1815102 Actinidia deliciosa partial mRNA for
           thaumatin-like protein (tlp gene), allergen Act c 2.
          Length = 193

 Score =  120 bits (300), Expect = 6e-26
 Identities = 82/222 (36%), Positives = 110/222 (49%), Gaps = 4/222 (1%)
 Frame = -1

Query: 845 CPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSG-RIWARTGCVLNH-GRFT 672
           CP T+W A  P  G   L+RG            + P A   G R+W RTGC  +  GR  
Sbjct: 1   CPFTVWAAAVPGGGKR-LDRG--------QNWIINPGAGTKGARVWPRTGCNFDGAGRGK 51

Query: 671 CATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKE 495
           C TGDC+G L+C   G   P TLA++ L+Q  + DF  + +SLVDGFN+ M  +P  G  
Sbjct: 52  CQTGDCNGLLQCQAFG-QPPNTLAEYALNQFNNLDF--FDISLVDGFNVAMEFSPTSGG- 107

Query: 494 HCPV-VGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMC 318
            C   + C A++   CP +L         R P  GCN+ C  FKTD+ CC     N   C
Sbjct: 108 -CTRGIKCTADINGQCPNEL---------RAPG-GCNNPCTVFKTDQYCC-----NSGNC 151

Query: 317 KASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
             + +S FFK  CP  ++Y  D  +S    C A    K++FC
Sbjct: 152 GLTNFSKFFKDRCPDAYSYPKDDQTSTF-TCPAGTNYKVVFC 192



>gb:AF294846_1783920 Capsicum annuum clone GC168 PR5-like protein
           gene, partial cds.
          Length = 180

 Score =  119 bits (299), Expect = 7e-26
 Identities = 75/204 (36%), Positives = 97/204 (47%), Gaps = 2/204 (0%)
 Frame = -1

Query: 851 NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN-HGRF 675
           NNCP+T+W A  P  G   LERG           F AP      RIW RT C  +  GR 
Sbjct: 1   NNCPYTVWAAATPVGGGKRLERG-------QSWWFWAPPGTKMARIWGRTNCNFDGAGRG 53

Query: 674 TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP-HDGK 498
            C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S++DGFN+PM+  P   G 
Sbjct: 54  WCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTKPGP 111

Query: 497 EHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMC 318
             C  + C AN+   CP  L+V            GCN+ C  F   + CC         C
Sbjct: 112 GKCHPIQCVANINGECPGSLRV----------PGGCNNPCTTFGGQQYCCTQG-----PC 156

Query: 317 KASRYSDFFKHACPSTFTYAHDTP 246
             +  S FFK  CP  ++Y  D P
Sbjct: 157 GPTDLSRFFKQRCPDAYSYPQDDP 180



>gb:AF548358_1810722 Solanum gilo osmotin-like protein precursor
           (OSML) gene, partial cds.
          Length = 184

 Score =  119 bits (297), Expect = 1e-25
 Identities = 70/179 (39%), Positives = 90/179 (50%), Gaps = 3/179 (1%)
 Frame = -1

Query: 719 RIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSL 546
           RIW RTGC  N  GR +C TGDC G L C G  G  P TLA++ L Q G+ DF  + +SL
Sbjct: 2   RIWGRTGCNFNAAGRGSCQTGDCGGVLHCTG-WGKPPNTLAEYALDQFGNLDF--WDISL 58

Query: 545 VDGFNLPMTLTP-HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAF 369
           VDGFN+PMT  P       C  + C AN+   CPR L+V            GCN+ C  F
Sbjct: 59  VDGFNIPMTFAPTKPSAGKCHAIHCTANINGECPRTLKVP----------GGCNNPCTTF 108

Query: 368 KTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
              + CC         C  +  S FFK  CP  ++Y  D P+S     S +   +++FC
Sbjct: 109 GGQQYCCTQG-----PCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPSGSTNYRVVFC 162



>gb:AF548357_1810721 Solanum gilo thaumatin-like protein (TLP) gene,
           partial cds.
          Length = 186

 Score =  119 bits (297), Expect = 1e-25
 Identities = 76/208 (36%), Positives = 104/208 (50%), Gaps = 5/208 (2%)
 Frame = -1

Query: 848 NCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV--APRARWSGRIWARTGCVLNH-GR 678
           NCP+T+W A  P  G   L++G         +S++  APR     RIW RT C  +  GR
Sbjct: 1   NCPYTVWAASTPIGGGQRLDQG---------QSWIIDAPRGTSMARIWGRTNCNFDGAGR 51

Query: 677 FTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTP-HD 504
            +C TGDC G L+C G  G  P TLA++ L+Q  + DF  + +SLVDGFN+PMT  P + 
Sbjct: 52  GSCQTGDCGGVLQCTG-WGKPPNTLAEYALNQFNNLDF--WDISLVDGFNIPMTFAPTNP 108

Query: 503 GKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPL 324
               C  + C AN+   CP +L+V            GCN+ C  F   + CC        
Sbjct: 109 SGGKCHSIQCTANINGECPAELRV----------PGGCNNPCTRFGGQQYCCTQG----- 153

Query: 323 MCKASRYSDFFKHACPSTFTYAHDTPSS 240
            C  +  S FFK  CP  ++Y  D  +S
Sbjct: 154 PCDPTDLSRFFKQRCPDAYSYPKDDATS 181



>gb:AF199508_1776448 Fragaria x ananassa osmotin-like protein (olp)
           gene, complete cds.
          Length = 226

 Score =  119 bits (297), Expect = 1e-25
 Identities = 82/251 (32%), Positives = 113/251 (45%), Gaps = 3/251 (1%)
 Frame = -1

Query: 935 TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH 756
           T+LS+  F        AS          NNCP T+W    P         GG  L     
Sbjct: 9   TVLSILYF-------AASTVNAATFNKKNNCPFTVWAGAVPG--------GGKQLGTGQT 53

Query: 755 RSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG 579
            +          RIW RT C  +  GR  C TGDC G L+C G G   P TLA++ L+Q 
Sbjct: 54  WTINVAAGTKGARIWPRTNCNFDGAGRGRCQTGDCGGLLQCQGYG-QPPNTLAEYALNQ- 111

Query: 578 HADFSTYGLSLVDGFNLPMTLTPHDGKEHCPV-VGCRANLLPACPRQLQVRLRARRGRGP 402
           + +   Y +SL+DGFN+PM  +P      C   + C A++   CP QL         R P
Sbjct: 112 YMNRDFYDISLIDGFNVPMDFSPVSNG--CTRGIRCTADINGQCPAQL---------RAP 160

Query: 401 VVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTY-AHDTPSSLMHEC 225
             GCN+ C   KTD+ CC + +     C  + YS FFK  CP  ++Y   D  S+++  C
Sbjct: 161 G-GCNNACTVSKTDQYCCNSGH-----CGPTDYSRFFKSRCPDAYSYPKDDATSTVLFTC 214

Query: 224 SAARELKIIFC 192
                 +++FC
Sbjct: 215 PGGTNYRVVFC 225



>gb:A46808_1449316 Sequence 5 from Patent EP0684312.
          Length = 207

 Score =  119 bits (297), Expect = 1e-25
 Identities = 77/223 (34%), Positives = 103/223 (46%), Gaps = 1/223 (0%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-G 681
           IVN C +T+W A   + G   L+ GG  L      +         G+IWART C  +  G
Sbjct: 5   IVNRCSYTVWAAA--SKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSG 62

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDG 501
              C TGDC G L C  R G  P TLA F L+Q   D+    +S + GFN+PM   P   
Sbjct: 63  SGICKTGDCGGLLRCK-RFGRPPTTLADFSLNQYGKDY--IDISNIKGFNVPMNFCPTT- 118

Query: 500 KEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLM 321
           +  C  V C A+++  CP +L         + P  GCN  C  F+T E CC         
Sbjct: 119 RGGCRGVRC-ADIVGQCPAKL---------KAPGGGCNDACTVFQTSEYCCTTG-----K 163

Query: 320 CKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           C  + YS FFK  CP  F+Y  D P+++   C  +    + FC
Sbjct: 164 CGPTEYSRFFKRLCPDAFSYVLDKPTTV--TCPGSSNYSVTFC 204



>gb:RIC14B_1703498 Oryza sativa (clone 14b) osmotin protein (14b)
           gene, 3' complete cds.
          Length = 218

 Score =  118 bits (296), Expect = 2e-25
 Identities = 82/249 (32%), Positives = 111/249 (44%), Gaps = 6/249 (2%)
 Frame = -1

Query: 920 TLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG-GFALYKLTHRSFV 744
           ++ + L     A+    +  TIVN C +T+WPA  P+     L+ G  +A+Y        
Sbjct: 4   SVHLLLLVVVLAAAADAVTFTIVNKCGYTVWPAALPSGDGNQLDPGQSWAVY-------- 55

Query: 743 APRARWSGRIWARTGCVLNHGRFT--CATGDCDGRLECNGRGGAAPATLAQFELHQGHAD 570
            P      R+W RTGC    G     C TGDC G L C    GA P T+A+F L Q   D
Sbjct: 56  VPAGTKGARVWGRTGCGFISGGSLGQCQTGDCGGTLRC-AAVGAPPVTVAEFSLGQASKD 114

Query: 569 FSTYGLSLVDGFNLPMTLTPHD-GKEHCPVVG--CRANLLPACPRQLQVRLRARRGRGPV 399
              + +SLVDGFN PM + P   G   CP  G  C A +   CP +L+ +          
Sbjct: 115 -DYFDISLVDGFNAPMAIVPAAAGGRRCPRGGPRCAAEITLQCPGELRAK---------- 163

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C    T              C  ++ ++FFK  CP T TYA D   +    C A
Sbjct: 164 AGCNNPCRGNST--------------CGPTKDTEFFKKLCPETVTYARDGQGTTF-TCPA 208

Query: 218 ARELKIIFC 192
             E +I+FC
Sbjct: 209 GTEYQIVFC 217



>pir|T03287|T03287 osmotin protein homolog - rice (fragment)
          Length = 218

 Score =  118 bits (296), Expect = 2e-25
 Identities = 82/249 (32%), Positives = 111/249 (44%), Gaps = 6/249 (2%)
 Frame = -1

Query: 920 TLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG-GFALYKLTHRSFV 744
           ++ + L     A+    +  TIVN C +T+WPA  P+     L+ G  +A+Y        
Sbjct: 4   SVHLLLLVVVLAAAADAVTFTIVNKCGYTVWPAALPSGDGNQLDPGQSWAVY-------- 55

Query: 743 APRARWSGRIWARTGCVLNHGRFT--CATGDCDGRLECNGRGGAAPATLAQFELHQGHAD 570
            P      R+W RTGC    G     C TGDC G L C    GA P T+A+F L Q   D
Sbjct: 56  VPAGTKGARVWGRTGCGFISGGSLGQCQTGDCGGTLRC-AAVGAPPVTVAEFSLGQASKD 114

Query: 569 FSTYGLSLVDGFNLPMTLTPHD-GKEHCPVVG--CRANLLPACPRQLQVRLRARRGRGPV 399
              + +SLVDGFN PM + P   G   CP  G  C A +   CP +L+ +          
Sbjct: 115 -DYFDISLVDGFNAPMAIVPAAAGGRRCPRGGPRCAAEITLQCPGELRAK---------- 163

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GCN+ C    T              C  ++ ++FFK  CP T TYA D   +    C A
Sbjct: 164 AGCNNPCRGNST--------------CGPTKDTEFFKKLCPETVTYARDGQGTTF-TCPA 208

Query: 218 ARELKIIFC 192
             E +I+FC
Sbjct: 209 GTEYQIVFC 217



>gb:AC137991_1743852 Oryza sativa chromosome 3 BAC OSJNBa0034D21
           genomic sequence, complete sequence.
          Length = 222

 Score =  117 bits (293), Expect = 4e-25
 Identities = 81/255 (31%), Positives = 115/255 (45%), Gaps = 6/255 (2%)
 Frame = -1

Query: 938 ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERG-GFALYKL 762
           A++ + ++ + L     A+    +  TIVN C +T+WPA  P+     L+ G  +A+Y  
Sbjct: 2   ASLANSSVHLLLLVVVLAAAADAVTFTIVNKCGYTVWPAALPSGDGNQLDPGQSWAVY-- 59

Query: 761 THRSFVAPRARWSGRIWARTGCVLNHGRFT--CATGDCDGRLECNGRGGAAPATLAQFEL 588
                  P      R+W RTGC    G     C TGDC G L C    GA P T+A+F L
Sbjct: 60  ------VPAGTKGARVWGRTGCGFISGGSLGQCQTGDCGGTLRC-AAVGAPPVTVAEFSL 112

Query: 587 HQGHADFSTYGLSLVDGFNLPMTLTPHD-GKEHCPVVG--CRANLLPACPRQLQVRLRAR 417
            Q   D   + +SLVDGFN PM + P   G   CP  G  C A +   CP +L+ +    
Sbjct: 113 GQASKD-DYFDISLVDGFNAPMAIVPAAAGGRRCPRGGPRCAAEITLQCPGELRAK---- 167

Query: 416 RGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSL 237
                  GC++ C    T              C  ++ ++FFK  CP T TYA D   + 
Sbjct: 168 ------AGCSNPCRGNST--------------CGPTKDTEFFKKLCPETVTYARDGQGTT 207

Query: 236 MHECSAARELKIIFC 192
              C A  + +I+FC
Sbjct: 208 F-TCPAGTDYQIVFC 221



>gb:AY256441_1593166 Solanum tuberosum cultivar 24-3 osmotin 81
           gene, partial cds.
          Length = 180

 Score =  117 bits (293), Expect = 4e-25
 Identities = 74/197 (37%), Positives = 94/197 (47%), Gaps = 2/197 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 118

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC      
Sbjct: 119 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCCTQG--- 165

Query: 329 PLMCKASRYSDFFKHAC 279
              C  +  S FFK  C
Sbjct: 166 --PCGPTELSKFFKKRC 180



>gb:OSU77656_1698517 Oryza sativa pathogenesis-related
           thaumatin-like protein mRNA, complete cds.
          Length = 181

 Score =  116 bits (291), Expect = 6e-25
 Identities = 67/184 (36%), Positives = 91/184 (49%), Gaps = 1/184 (0%)
 Frame = -1

Query: 740 PRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFS 564
           P     GR+WARTGC  +  G   C TGDC G L C   G   P TLA+F L+Q  ++  
Sbjct: 12  PAGTTGGRVWARTGCSFDGSGNGRCQTGDCGGVLRCAAYG-QPPNTLAEFALNQ-FSNLD 69

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            + +SL+DGFN+PM   P   +       C A++   CP +L         R P  GCN+
Sbjct: 70  FFDISLIDGFNVPMDFLPAGDRVRKGGPRCEADVAGQCPSEL---------RAPG-GCNN 119

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C  FK D+ CC  +  N   C  + YS FFK  CP  ++Y  D  +S    C A    +
Sbjct: 120 ACTVFKQDQYCCTGSAAN--NCGPTNYSQFFKGLCPDAYSYPKDDQTSTF-TCPAGTNYQ 176

Query: 203 IIFC 192
           ++FC
Sbjct: 177 VVFC 180



>pir|T04165|T04165 pathogenesis-related thaumatin-like protein -
           rice
          Length = 181

 Score =  116 bits (291), Expect = 6e-25
 Identities = 67/184 (36%), Positives = 91/184 (49%), Gaps = 1/184 (0%)
 Frame = -1

Query: 740 PRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFS 564
           P     GR+WARTGC  +  G   C TGDC G L C   G   P TLA+F L+Q  ++  
Sbjct: 12  PAGTTGGRVWARTGCSFDGSGNGRCQTGDCGGVLRCAAYG-QPPNTLAEFALNQ-FSNLD 69

Query: 563 TYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNS 384
            + +SL+DGFN+PM   P   +       C A++   CP +L         R P  GCN+
Sbjct: 70  FFDISLIDGFNVPMDFLPAGDRVRKGGPRCEADVAGQCPSEL---------RAPG-GCNN 119

Query: 383 GCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELK 204
            C  FK D+ CC  +  N   C  + YS FFK  CP  ++Y  D  +S    C A    +
Sbjct: 120 ACTVFKQDQYCCTGSAAN--NCGPTNYSQFFKGLCPDAYSYPKDDQTSTF-TCPAGTNYQ 176

Query: 203 IIFC 192
           ++FC
Sbjct: 177 VVFC 180



>gb:ATPPA9A_1553877 Atriplex nummularia osmotin-like protein (pA9)
           mRNA, complete cds.
          Length = 224

 Score =  115 bits (287), Expect = 2e-24
 Identities = 79/249 (31%), Positives = 110/249 (44%), Gaps = 1/249 (0%)
 Frame = -1

Query: 935 TILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTH 756
           ++L  +L + + +  T    A    T+ NNC +T+W A           R    L    H
Sbjct: 8   SLLISSLLLMIASLITTPTHA-TTFTVKNNCGYTVWGA---------RHRWAKELPANAH 57

Query: 755 RSFVAPRARWSGRIWARTGCVLNHGR-FTCATGDCDGRLECNGRGGAAPATLAQFELHQG 579
              ++  AR    +W RTGC  N G    C TG C    +C    GA P T+A++ L   
Sbjct: 58  GLSMSLPAR--AGVWGRTGCTSNGGNNLQCTTGGCGTLFDCGMNSGAPPLTIAEYTLTN- 114

Query: 578 HADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPV 399
                T  +SLVDGFN+PM+     G  + P   C +N+L +CP  L+V           
Sbjct: 115 --TLDTIDISLVDGFNVPMSF---GGCPNSP--SCASNILDSCPSDLKVN---------- 157

Query: 398 VGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSA 219
            GC S C  + TDE CCR  Y     C  ++YS  FK  CP  ++YA D  SS    C +
Sbjct: 158 GGCLSACNKYSTDEYCCRGQYEK--NCPPNKYSMIFKGLCPQAYSYAKDDQSSTF-TCPS 214

Query: 218 ARELKIIFC 192
                + FC
Sbjct: 215 GTNYVVTFC 223



>gb:F25A4_1678011 Arabidopsis thaliana chromosome 1 BAC F25A4
           sequence, complete sequence.
          Length = 172

 Score =  114 bits (286), Expect = 2e-24
 Identities = 60/155 (38%), Positives = 83/155 (53%), Gaps = 1/155 (0%)
 Frame = -1

Query: 893 TTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRI 714
           T+    +  + T+ N+C +T+WP          L  GGF L         AP   WSGR 
Sbjct: 16  TSGIADSATVFTLQNSCAYTVWPGTLSGNSI-TLGDGGFPLTPGASVQLTAPTG-WSGRF 73

Query: 713 WARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDG 537
           WARTGC  +  G  TC TGDC G L+C G GG  PATLA+F +   +A    Y +SLVDG
Sbjct: 74  WARTGCNFDASGHGTCVTGDCGGVLKCTG-GGVPPATLAEFTVGSSNAGMDFYDVSLVDG 132

Query: 536 FNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQV 432
           +N+ M + P  G  +C   GC +++   CP +L++
Sbjct: 133 YNVKMGIKPQGGFGNCKYAGCVSDINEICPSELRI 167



>gb:AY256437_1593162 Solanum tuberosum cultivar Snowchip osmotin 81
           gene, partial cds.
          Length = 180

 Score =  114 bits (285), Expect = 3e-24
 Identities = 70/184 (38%), Positives = 89/184 (48%), Gaps = 2/184 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 4   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 56

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 57  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 114

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC      
Sbjct: 115 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCCTQGPCG 164

Query: 329 PLMC 318
           P  C
Sbjct: 165 PTEC 168



>gb:AY766059_1627605 Theobroma cacao osmotin-like (osm1) gene,
           partial cds.
          Length = 188

 Score =  114 bits (284), Expect = 4e-24
 Identities = 78/216 (36%), Positives = 109/216 (50%), Gaps = 3/216 (1%)
 Frame = -1

Query: 830 WPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFTCATGDC 654
           W A  P  G   L+RGG  ++ L     V P      R+WART C  +  GR  C TGDC
Sbjct: 1   WAAAVPGGGRR-LDRGG--VWNLN----VNPGTT-GARVWARTKCQFDGAGRGRCETGDC 52

Query: 653 DGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPV-V 480
            G L+C   G A P TLA++ L+Q  + DF  + +SLVDGFN+PM  +P  G   C   +
Sbjct: 53  GGLLQCQAYG-APPNTLAEYALNQFNNKDF--FDISLVDGFNVPMDFSPTSGG--CTRGI 107

Query: 479 GCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYS 300
            C A+++  CP QL+             GCN+ C  F+TD+ CC     N   C+ + +S
Sbjct: 108 RCTADIIGQCPNQLKAP----------GGCNNPCTVFRTDQYCC-----NSGNCRPTDFS 152

Query: 299 DFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
            FFK  CP  ++Y  D  +S    C      +++FC
Sbjct: 153 RFFKTRCPDAYSYPKDDQTSTF-TCPGGTNYRVVFC 187



>gb:AY256440_1593165 Solanum tuberosum cultivar Iditared osmotin 81
           gene, partial cds.
          Length = 180

 Score =  114 bits (284), Expect = 4e-24
 Identities = 72/198 (36%), Positives = 95/198 (47%), Gaps = 2/198 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 4   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 56

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 57  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 114

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
           +     C  + C AN+   CPR L+V            GCN+ C  F   + CC      
Sbjct: 115 NPSGGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCCTQG--- 161

Query: 329 PLMCKASRYSDFFKHACP 276
              C  +  S F + + P
Sbjct: 162 --PCGPTELSKFSRQSAP 177



>gb:AY256436_1593161 Solanum tuberosum cultivar Peanut osmotin 81
           gene, partial cds.
          Length = 175

 Score =  113 bits (283), Expect = 5e-24
 Identities = 70/184 (38%), Positives = 89/184 (48%), Gaps = 2/184 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L RG   +         APR     RIW RTGC  N 
Sbjct: 4   IEVRNNCPYTVWAASTPIGGGRRLNRGQTWVIN-------APRGTKMARIWGRTGCNFNA 56

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 57  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 114

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
           +     C  + C AN+   CP  L+V            GCN+ C  F   + CC      
Sbjct: 115 NPSGGKCHAIHCTANINGECPGSLKV----------PGGCNNPCTTFGGQQYCCTQGPCG 164

Query: 329 PLMC 318
           P  C
Sbjct: 165 PTEC 168



>gb:BVU309172_1643193 Beta vulgaris mRNA for thaumatin like protein.
          Length = 210

 Score =  113 bits (282), Expect = 7e-24
 Identities = 83/245 (33%), Positives = 110/245 (44%), Gaps = 3/245 (1%)
 Frame = -1

Query: 917 LFISLCAFTTA-SLPAGLIITIV-NNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFV 744
           +F  L A T+  S P    + +V NNCP+T+W A  P  G  +     + +Y        
Sbjct: 9   IFSLLLALTSLFSTPTNAAMFVVKNNCPYTVWGAAVPGGGQQMNPGATWIVY-------- 60

Query: 743 APRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADF 567
           A   + + RIWARTGC  N      C TGDC G+  C G G   P TLA++ L Q + D 
Sbjct: 61  ANPGQTAARIWARTGCRYNGQNGLICNTGDCGGQFHCTGYG-RGPNTLAEYALKQWN-DL 118

Query: 566 STYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCN 387
             + +SLVDGFN+PM+  P +G    P   C A+L   CP      LRA  G        
Sbjct: 119 DFFDISLVDGFNVPMSFLPTNGCNRGPT--CAADLNGPCPGP----LRANGG-------- 164

Query: 386 SGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAAREL 207
                       C N YN         YS FFK  CP  ++Y  D  +S M+ C +    
Sbjct: 165 ------------CNNAYN-------YSYSRFFKGRCPDAYSYPQDDATS-MYSCPSGTNY 204

Query: 206 KIIFC 192
           K+ FC
Sbjct: 205 KVTFC 209



>gb:AY256431_1593156 Solanum tuberosum cultivar Idarose osmotin 81
           gene, partial cds.
          Length = 179

 Score =  113 bits (282), Expect = 7e-24
 Identities = 69/190 (36%), Positives = 91/190 (47%), Gaps = 2/190 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L+RG   +         APR     RIW RT C  + 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLDRGQTWVIN-------APRGTKMARIWGRTNCNFDG 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G G A   TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTGWGKATKPTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 119

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
           +     C  + C AN+   CP  L+V            GCN+ C  F   + CC      
Sbjct: 120 NPSGGKCHAIHCTANINGECPGSLRV----------PGGCNNPCTTFGGQQYCCTQGPCG 169

Query: 329 PLMCKASRYS 300
           P  C   + S
Sbjct: 170 PTDCHRFKQS 179



>gb:AY256428_1593153 Solanum tuberosum cultivar Yellow Finn osmotin
           81 gene, partial cds.
          Length = 180

 Score =  113 bits (282), Expect = 7e-24
 Identities = 69/174 (39%), Positives = 88/174 (50%), Gaps = 2/174 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 118

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
                 C  + C AN+   CPR L+V            GCN+ C AF   + CC
Sbjct: 119 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTAFGGQQKCC 162



>gb:VVI237998_1727513 Vitis vinifera mRNA for putative
           thaumatin-like protein, partial.
          Length = 190

 Score =  112 bits (279), Expect = 2e-23
 Identities = 66/179 (36%), Positives = 89/179 (49%), Gaps = 2/179 (1%)
 Frame = -1

Query: 722 GRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSL 546
           GR+WART C  +  G   C T DC G L+C   G   P TLA+F L+Q  ++   + +SL
Sbjct: 31  GRVWARTNCNFDASGNGKCETRDCGGLLQCTAYG-TPPNTLAEFALNQ-FSNLDFFDISL 88

Query: 545 VDGFNLPMTLTPHDGKEHCPV-VGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAF 369
           VDGFN+PM   P      C   + C A+++  CP  L+             GCN+ C  F
Sbjct: 89  VDGFNVPMAFNPTSNG--CTRGISCTADIVGECPAALKT----------TGGCNNPCTVF 136

Query: 368 KTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
           KTDE CC     N   C A+ YS FFK  CP  ++Y  D  +S    C      +++FC
Sbjct: 137 KTDEYCC-----NSGSCNATDYSRFFKTRCPDAYSYPKDDQTSTF-TCPTGTNYEVVFC 189



>gb:AY256434_1593159 Solanum tuberosum cultivar Andover osmotin 81
           gene, partial cds.
          Length = 178

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/174 (39%), Positives = 87/174 (50%), Gaps = 2/174 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 118

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC
Sbjct: 119 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCC 162



>gb:AY256430_1593155 Solanum tuberosum cultivar Norkotah osmotin 81
           gene, partial cds.
          Length = 179

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/174 (39%), Positives = 87/174 (50%), Gaps = 2/174 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 118

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC
Sbjct: 119 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCC 162



>gb:AY256427_1593152 Solanum tuberosum cultivar All Blue osmotin 81
           gene, partial cds.
          Length = 179

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/174 (39%), Positives = 87/174 (50%), Gaps = 2/174 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 118

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC
Sbjct: 119 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCC 162



>gb:AY256426_1593151 Solanum tuberosum cultivar German Butterball
           osmotin 81 gene, partial cds.
          Length = 173

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/174 (39%), Positives = 87/174 (50%), Gaps = 2/174 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 4   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 56

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 57  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 114

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC
Sbjct: 115 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCC 158



>gb:AY256425_1593150 Solanum tuberosum cultivar Kennebec osmotin 81
           gene, partial cds.
          Length = 169

 Score =  112 bits (279), Expect = 2e-23
 Identities = 69/184 (37%), Positives = 89/184 (48%), Gaps = 2/184 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 4   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNG 56

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 57  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 114

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
           +     C  + C AN+   CP  L+V            GCN+ C  F   + CC      
Sbjct: 115 NPSGGKCHAIHCTANINGECPGPLKV----------PGGCNNPCTTFGGQQYCCTQGPCG 164

Query: 329 PLMC 318
           P  C
Sbjct: 165 PTEC 168



>gb:AY256435_1593160 Solanum tuberosum cultivar AK 114 osmotin 81
           gene, partial cds.
          Length = 175

 Score =  109 bits (273), Expect = 8e-23
 Identities = 70/185 (37%), Positives = 89/185 (48%), Gaps = 3/185 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 4   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 56

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 57  AGRGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 114

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAF-KTDELCCRNNYN 333
                 C  + C AN+   CPR L+V            GCN+ C  F    + CC     
Sbjct: 115 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGGQQYCCTQGPC 164

Query: 332 NPLMC 318
            P  C
Sbjct: 165 GPTEC 169



>gb:AJ586518_1811834 Fagus sylvatica partial tau1 mRNA for taumatin.
          Length = 156

 Score =  109 bits (272), Expect = 1e-22
 Identities = 63/166 (37%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -1

Query: 683 GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTPH 507
           GR  C TGDC G L+C    G  P TLA++ L+Q G+ DF  + +SLVDGFN+PM  +P 
Sbjct: 1   GRGKCQTGDCGGLLQCTA-WGVPPNTLAEYALNQFGNKDF--FDISLVDGFNVPMEFSPT 57

Query: 506 DGKEHCPV-VGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNN 330
                C   + C A++   CPR+L+             GCN+ C  FKTD+ CC +    
Sbjct: 58  SNG--CTRGIKCTADINGQCPRELKAP----------GGCNNPCTVFKTDQYCCNSG--- 102

Query: 329 PLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHECSAARELKIIFC 192
              C+ + YS FFK  CP  ++Y  D P+S    C+     K++FC
Sbjct: 103 --SCRPTNYSRFFKVRCPDAYSYPKDDPTSTF-TCNGGTNYKVVFC 145



>gb:AY256433_1593158 Solanum tuberosum cultivar Gold Rush osmotin 81
           gene, partial cds.
          Length = 178

 Score =  108 bits (271), Expect = 1e-22
 Identities = 67/174 (38%), Positives = 86/174 (49%), Gaps = 2/174 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP- 510
            GR +C TGDC G L+C G G   P T A++ L Q  ++   + +SLVDGFN+PMT  P 
Sbjct: 61  AGRGSCQTGDCGGVLQCTGWGN--PQTPAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPT 117

Query: 509 HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
                 C  + C AN+   CPR L+V            GCN+ C  F   + CC
Sbjct: 118 KPSAGKCHAIHCTANINGECPRALKV----------PGGCNNPCPQFGGQQYCC 161



>gb:AP003219_1825464 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBb0032H19.>gb:AP003338_1828225 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OJ1212_B09.
          Length = 601

 Score =  108 bits (270), Expect = 2e-22
 Identities = 68/192 (35%), Positives = 91/192 (47%), Gaps = 9/192 (4%)
 Frame = -1

Query: 740 PRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA-DF 567
           P    +GR+WARTGC  + +G  +C TGDC G L+C    G  P TLA+F + Q    DF
Sbjct: 14  PANSGAGRVWARTGCSFDANGNGSCQTGDCGGVLKCKN-SGKPPQTLAEFTVDQTSVQDF 72

Query: 566 STYGLSLVDGFNLPMTLTPHDGKEH---CPVVG----CRANLLPACPRQLQVRLRARRGR 408
             + +SL DGFN+PM   P    E     P       C AN+   CP +L+         
Sbjct: 73  --FDISLTDGFNVPMDFLPVPAPEQRHGAPPCSKGPRCPANITSQCPSELKAP------- 123

Query: 407 GPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSSLMHE 228
               GCNS C  FK D+ CC         C+ + +S  F   CP  ++Y+ D  SS    
Sbjct: 124 ---GGCNSACNVFKQDKYCCTGTTGTKT-CEPTTFSLPFVRMCPDAYSYSLDDSSSTTFT 179

Query: 227 CSAARELKIIFC 192
           C +    +IIFC
Sbjct: 180 CPSGTNYQIIFC 191



>gb:AE017345_1756672 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 536

 Score =  108 bits (270), Expect = 2e-22
 Identities = 74/229 (32%), Positives = 105/229 (45%), Gaps = 5/229 (2%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           IT+ N+C  TIWP +     +   +  G+ L       F  P    +GRIWARTGCV+  
Sbjct: 23  ITVKNSCSSTIWPGMHTGGSFIPDQATGWELAAGGQTEFTVPEDWTAGRIWARTGCVVQD 82

Query: 683 GRFTCATGDC----DGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTL 516
           G F C TG C    +G + C       PATLA+F L  G  D   Y +SLVDGFN+P+ +
Sbjct: 83  GVFQCLTGQCGSGENGDITCE-NSDQPPATLAEFTLIPGKED--NYDISLVDGFNIPLNI 139

Query: 515 TPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNY 336
            P      CP   C+ N+   CP  L+  L     +G  +GC + C      EL     Y
Sbjct: 140 IP--SISTCPQPQCQVNINVLCPPLLRTSLDQ---KGVNLGCIAPCNRGFGQEL-----Y 189

Query: 335 NNPLMCKASRYSDFFKHACPSTFTYAHDTPS-SLMHECSAARELKIIFC 192
            N   C  +         C +++ YA+D  S + +  C  + +  + FC
Sbjct: 190 GNRACCTDN---------CNTSYAYAYDEKSHTALWTCGGSPDYIVEFC 229



>gb:BX842641_1644205 Neurospora crassa DNA linkage group I BAC
           contig B22I21.
          Length = 494

 Score =  108 bits (269), Expect = 2e-22
 Identities = 89/282 (31%), Positives = 114/282 (40%), Gaps = 64/282 (22%)
 Frame = -1

Query: 893 TTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYK-LTHRSFVAPRARWSGR 717
           +T   P  + + I N+CP TIWP I    G    E GGF L    T   FV+P   W GR
Sbjct: 127 STPPNPTPIPLVITNSCPDTIWPGIGTQNGIGP-EVGGFELAPGETKPLFVSP--DWQGR 183

Query: 716 IWARTGCV-------------LNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQG- 579
           +W RT C              +N     C TGDC GRL C    G  P TLA+F L  G 
Sbjct: 184 VWGRTNCSFNADGTGPSNLNGVNGNGAACMTGDCFGRLNCEFT-GQVPVTLAEFNLLGGI 242

Query: 578 HADFSTYGLSLVDGFNLPM---------TLTPHDGKEHCPVVGCRANLLPA--------- 453
           ++D + Y +SLVDG+NLP+         T        +C  +     L P          
Sbjct: 243 NSDQTFYDISLVDGYNLPLGIIYIPAANTTWIPPNLTNCVCIASAGFLDPPSRSGLYYTN 302

Query: 452 -------------------CPRQLQVRLRARRGRG-----------PVVG-CNSGCAAFK 366
                              CP  LQ    ++ G G           PV   C S CAA  
Sbjct: 303 KTFPIPWESDQTNPSVGGWCPWDLQEYPPSKPGDGIYPYPDDSIQRPVFDPCLSACAATG 362

Query: 365 TDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
             E CC   Y++P +C  S YS+  K  CP  ++YA D  +S
Sbjct: 363 NPEDCCTGKYDDPSVCTPSLYSENAKTVCPDAYSYAFDDQTS 404



>gb:AY256438_1593163 Solanum tuberosum cultivar Highlat Russet
           osmotin 81 gene, partial cds.
          Length = 177

 Score =  107 bits (268), Expect = 3e-22
 Identities = 68/175 (38%), Positives = 88/175 (50%), Gaps = 3/175 (1%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+W A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 4   IEVRNNCPYTVWAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 56

Query: 683 -GRF-TCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
            GR  +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT  P
Sbjct: 57  AGRGGSCQTGDCGGVLQCTG-WGKPPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAP 114

Query: 509 -HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
            +     C  + C AN+   CPR L+V            GCN+ C  F   + CC
Sbjct: 115 TNPSGGKCHAIHCTANINGECPRALKV----------PGGCNNPCTTFGGQQYCC 159



>gb:AC024839_1204919 Caenorhabditis elegans cosmid Y59E9AR, complete
           sequence.
          Length = 246

 Score =  107 bits (268), Expect = 3e-22
 Identities = 59/161 (36%), Positives = 82/161 (50%), Gaps = 22/161 (13%)
 Frame = -1

Query: 656 CDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVG 477
           C+ R +CNG GG  PA+LA+F L +G      Y +SLVDG+N+P+ + P+ G+  C   G
Sbjct: 73  CNRREQCNGAGGEPPASLAEFTL-RGADGKDFYDVSLVDGYNIPVLIDPYGGEGDCRRAG 131

Query: 476 -CRANLLPACPRQLQVRLRARRGR---------------------GPVVGCNSGCAAFKT 363
            C  N+   CP  L VR    R                       G  VGC SGC A+  
Sbjct: 132 GCFKNINDFCPGDLAVRKGKWRNNHILKQNKFLKTKISPTVSISDGRTVGCKSGCVAYNN 191

Query: 362 DELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTPSS 240
           D+ CCR  +  P  C+ SR +  FK ACP+ ++YA+D  +S
Sbjct: 192 DQECCRGAFGTPDKCRQSRTAMLFKDACPTAYSYAYDDATS 232



>gb:AY256432_1593157 Solanum tuberosum cultivar Yukon Gold osmotin
           81 gene, partial cds.
          Length = 179

 Score =  106 bits (265), Expect = 6e-22
 Identities = 69/177 (38%), Positives = 88/177 (49%), Gaps = 5/177 (2%)
 Frame = -1

Query: 863 ITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH 684
           I + NNCP+T+  A  P  G   L +G   +         APR     RIW RTGC  N 
Sbjct: 8   IEVRNNCPYTVGAASTPIGGGRRLNKGQTWVIN-------APRGTKMARIWGRTGCNFNA 60

Query: 683 -GRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLT-- 513
            GR +C TGDC G L+C G  G  P TLA++ L Q  ++   + +SLVDGFN+PMT    
Sbjct: 61  AGRGSCQTGDCGGVLQCTG-WGKHPNTLAEYALDQ-FSNLDFWDISLVDGFNIPMTFAPP 118

Query: 512 --PHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
             P  GK  C  + C AN+   CPR L+V            GCN+ C  F   + CC
Sbjct: 119 TKPSGGK--CHAIHCTANINGECPRSLKV----------PGGCNNPCTTFGGQQYCC 163



>gb:AY589699_1616579 Mirabilis jalapa clone FS-87 thaumatin-like
           protein mRNA, partial cds.
          Length = 165

 Score =  105 bits (261), Expect = 2e-21
 Identities = 67/175 (38%), Positives = 88/175 (50%), Gaps = 3/175 (1%)
 Frame = -1

Query: 857 IVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGC-VLNHG 681
           + NNCP+T+W A  P         GG  +      +  A   +   RIWARTGC V    
Sbjct: 9   VKNNCPYTVWGAAVPG--------GGRQMNSGDTWTVTANPGQTGARIWARTGCRVTGSN 60

Query: 680 RFTCATGDCDGRLECNGRGGAAPATLAQFELHQ-GHADFSTYGLSLVDGFNLPMTLTP-H 507
              C TGDC G L+C G G   P TLA++ L Q  + DF  + +SLVDGFN+PMT  P  
Sbjct: 61  GLQCNTGDCGGVLQCTGYG-QPPNTLAEYALKQFNNLDF--FDISLVDGFNVPMTFLPIS 117

Query: 506 DGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRN 342
           +G    PV  C+A++   CP QL+             GCN+ C  +KTD  CC +
Sbjct: 118 NGCTRGPV--CKADVNAQCPAQLRTN----------GGCNNPCTVYKTDNYCCNS 160



>gb:AY398665_1605115 Solanum tuberosum cultivar Green Mountain
           osmotin-like protein (osm35) gene, partial cds.
          Length = 177

 Score =  105 bits (261), Expect = 2e-21
 Identities = 65/175 (37%), Positives = 87/175 (49%), Gaps = 2/175 (1%)
 Frame = -1

Query: 866 IITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLN 687
           +  + NNCP+T+W A  P  G   LERG           F AP      RIW RT C  +
Sbjct: 8   VFEVHNNCPYTVWAAATPIGGGRRLERG-------QSWWFWAPPGTKMARIWGRTNCNFD 60

Query: 686 -HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP 510
             GR  C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S++DGFN+PM+  P
Sbjct: 61  GAGRGGCQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGP 118

Query: 509 -HDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
            + G   C  + C AN+   CP  L+V            GCN+ C  F   + CC
Sbjct: 119 TNPGPGKCHPIQCVANINGECPDSLRV----------PGGCNNPCTTFGGQQYCC 163



>gb:AY204864_1589118 Solanum tuberosum cultivar Alaska Frostless
           osmotin-like protein (osm) gene, partial cds.
          Length = 171

 Score =  104 bits (260), Expect = 2e-21
 Identities = 69/193 (35%), Positives = 90/193 (46%), Gaps = 2/193 (1%)
 Frame = -1

Query: 848 NCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFT 672
           NCP+T+W A  P  G   LERG           F AP      RIW RT C  +  GR  
Sbjct: 1   NCPYTVWAAATPIGGGRRLERG-------QSWWFWAPPGTKMARIWGRTNCNFDGAGRGW 53

Query: 671 CATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP-HDGKE 495
           C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S++DGFN+PM+  P + G  
Sbjct: 54  CQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTNPGPG 111

Query: 494 HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCK 315
            C  + C AN+   CP  L+V            GCN+ C  F   + CC         C 
Sbjct: 112 KCHPIQCVANINGECPGSLRV----------PGGCNNPCTTFGGQQYCCTQG-----PCG 156

Query: 314 ASRYSDFFKHACP 276
            +  S   K  CP
Sbjct: 157 PTDLSRLLKERCP 169



>gb:AF001528_1760548 Musa acuminata ripening-associated protein
           mRNA, partial cds.
          Length = 193

 Score =  103 bits (257), Expect = 5e-21
 Identities = 74/218 (33%), Positives = 96/218 (44%), Gaps = 2/218 (0%)
 Frame = -1

Query: 938 ATILSVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLT 759
           ++ LS++ F         +L       IVN C +T+W A  P         GG  L +  
Sbjct: 4   SSXLSLSFFFFFFFSLLVTLSHAATFXIVNRCSYTVWAAAVPG--------GGRQLNQGQ 55

Query: 758 HRSFVAPRARWSGRIWARTGCVLN-HGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQ 582
             +         GRIW RTGC  +  GR  C TGDC G L C   G   P TLA+F L+Q
Sbjct: 56  SWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQTGDCGGVLSCTAYGNP-PNTLAEFALNQ 114

Query: 581 -GHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACPRQLQVRLRARRGRG 405
             + DF  + +SLVDGFN+PM  +P  G   C  + C A++   CP  L           
Sbjct: 115 FNNLDF--FDISLVDGFNVPMDFSPTSG--GCRGIRCAADINGQCPGALXA--------- 161

Query: 404 PVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFF 291
              GC + C  F TD  CC     N   C  + YS FF
Sbjct: 162 -PGGCXNPCTVFXTDXYCC-----NSGSCSPTDYSRFF 193



>gb:AY204870_1589124 Solanum tuberosum cultivar 24-3 osmotin-like
           protein (osm) gene, partial cds.
          Length = 158

 Score =  102 bits (254), Expect = 1e-20
 Identities = 64/169 (37%), Positives = 84/169 (49%), Gaps = 2/169 (1%)
 Frame = -1

Query: 848 NCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFT 672
           NCP+T+W A  P  G   LERG           F AP      RIW RT C  +  GR  
Sbjct: 1   NCPYTVWAAATPIGGGRRLERG-------QSWWFWAPPGTKMARIWGRTNCNFDGAGRGG 53

Query: 671 CATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP-HDGKE 495
           C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S++DGFN+PM+  P + G  
Sbjct: 54  CQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTNPGPG 111

Query: 494 HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
            C  + C AN+   CP  L+V            GCN+ C  F   + CC
Sbjct: 112 KCHPIQCVANINGECPXSLRV----------PGGCNNPCTTFGGQQYCC 150



>gb:AY204872_1589126 Solanum tuberosum cultivar German Butterball
           osmotin-like protein (osm) gene, partial cds.
          Length = 166

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/169 (37%), Positives = 84/169 (49%), Gaps = 2/169 (1%)
 Frame = -1

Query: 848 NCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFT 672
           NCP+T+W A  P  G   LERG           F AP      RIW RT C  +  GR  
Sbjct: 1   NCPYTVWAAATPIGGGRRLERG-------QSWWFWAPPGTKMARIWGRTNCNFDGAGRGW 53

Query: 671 CATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP-HDGKE 495
           C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S++DGFN+PM+  P + G  
Sbjct: 54  CQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTNPGPG 111

Query: 494 HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
            C  + C AN+   CP  L+V            GCN+ C  F   + CC
Sbjct: 112 KCHPIQCVANINGECPGSLRV----------PGGCNNPCTTFGGQQYCC 150



>gb:AY204871_1589125 Solanum tuberosum cultivar All Blue
           osmotin-like protein (osm) gene, partial cds.
          Length = 167

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/169 (37%), Positives = 84/169 (49%), Gaps = 2/169 (1%)
 Frame = -1

Query: 848 NCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFT 672
           NCP+T+W A  P  G   LERG           F AP      RIW RT C  +  GR  
Sbjct: 1   NCPYTVWAAATPIGGGRRLERG-------QSWWFWAPPGTKMARIWGRTNCNFDGAGRGG 53

Query: 671 CATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP-HDGKE 495
           C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S++DGFN+PM+  P + G  
Sbjct: 54  CQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTNPGPG 111

Query: 494 HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELCC 348
            C  + C AN+   CP  L+V            GCN+ C  F   + CC
Sbjct: 112 KCHPIQCVANINGECPDSLRV----------PGGCNNPCTTFGGQQYCC 150



>gb:CQ827170_1453682 Sequence 1 from Patent WO2004050696.
          Length = 225

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 80/258 (31%), Positives = 119/258 (46%), Gaps = 11/258 (4%)
 Frame = -1

Query: 932 ILSVTLFISLCAFTTASLPAG------LIITIVNNCPH--TIWPAIQPNTGYPVLERGGF 777
           I S  L +++ A   AS P          I + NNC +  T+  +   N     +E    
Sbjct: 2   IFSTLLLLAIFAGLAASAPVNGTSNGNPYILVKNNCDYKLTVGESQNGNMYGTSVEVDAG 61

Query: 776 ALYKLTHRSFVAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQ 597
           A +  T +      A W+GR+W R  C               G+  C   G  APATLA+
Sbjct: 62  ASHTFTFQ------ANWAGRVWGRRSC--------------SGKT-CKYAGMWAPATLAE 100

Query: 596 FELHQGHADFSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRA---NLLPACPRQLQVRL 426
               +G+AD+  Y +SLVDG+N PMTL P + +       C A   +  P CP +L ++ 
Sbjct: 101 VFFEKGNADW--YDISLVDGYNEPMTLEPINPEMSVSGSQCGAPTCSKSPDCPSELVLK- 157

Query: 425 RARRGRGPVVGCNSGCAAFKTDELCCRNNYNNPLMCKASRYSDFFKHACPSTFTYAHDTP 246
                 G V+GC S C+ F++ E CC   Y    +C+ S+YS      CP  ++YA+D  
Sbjct: 158 ---DDNGNVIGCESACSKFQSPEYCCTGKYTEG-VCEPSQYS-----KCPDAYSYAYDDA 208

Query: 245 SSLMHECSAARELKIIFC 192
           +S M+ C  A+  K+ FC
Sbjct: 209 TS-MYTCK-AQGYKVTFC 224



>gb:AY204863_1589117 Solanum tuberosum cultivar Gold Rush
           osmotin-like protein (osm) gene, partial cds.
          Length = 154

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 63/168 (37%), Positives = 82/168 (48%), Gaps = 2/168 (1%)
 Frame = -1

Query: 848 NCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSFVAPRARWSGRIWARTGCVLNH-GRFT 672
           NCP+T+W A  P  G   LERG           F AP      RIW RT C  +  GR  
Sbjct: 1   NCPYTVWAAATPIGGGRRLERG-------QSWWFWAPPGTKMARIWGRTNCNFDGAGRGG 53

Query: 671 CATGDCDGRLECNGRGGAAPATLAQFELHQGHADFSTYGLSLVDGFNLPMTLTP-HDGKE 495
           C TGDC G LEC G  G  P TLA++ L+Q  ++   + +S++DGFN+PM+  P + G  
Sbjct: 54  CQTGDCGGVLECKG-WGKPPNTLAEYALNQ-FSNLDFWDISVIDGFNIPMSFGPTNPGPG 111

Query: 494 HCPVVGCRANLLPACPRQLQVRLRARRGRGPVVGCNSGCAAFKTDELC 351
            C  + C AN+   CP  L+V            GCN+ C  F     C
Sbjct: 112 KCHPIQCVANINGECPXSLRV----------PGGCNNPCTTFGGQXYC 149



>sp|P27357|TLP_WHEAT Thaumatin-like protein PWIR2
           precursor.>pir|S16524|S16524 thaumatin-like protein
           precursor - wheat>gb:TATHAU_1724670 T.aestivum mRNA for
           a thaumatin-like protein.
          Length = 173

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 67/161 (41%), Positives = 82/161 (50%), Gaps = 1/161 (0%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF 747
           S  LF+ L  F   +  A     I NNC  TIWPA     G PV   GGFAL      S 
Sbjct: 4   SPVLFLLLAVFAAGASAA--TFNIKNNCGFTIWPA-----GIPV--GGGFALGSGQTSSI 54

Query: 746 VAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA-D 570
             P    +GRIWARTGC  N G  +C TGDC G+L C+   G  PATLA++ +  G   D
Sbjct: 55  NVPAGTQAGRIWARTGCSFNGGSGSCQTGDCGGQLSCS-LSGRPPATLAEYTIGGGSTQD 113

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACP 447
           F  Y +S++DGFNL M  +   G      + CR    P+CP
Sbjct: 114 F--YDISVIDGFNLAMDFSCSTG----DALQCRD---PSCP 145



>sp|P32938|PR1C_HORVU Pathogenesis-related protein 1C
           precursor.>pir|S18035|S18035 pathogenesis-related
           protein 1c precursor - barley>gb:AY839293_1630497
           Hordeum vulgare thaumatin-like protein TLP2 mRNA,
           complete cds.>gb:HVPRP1C_1682507 H.vulgare mRNA for a
           pathogenesis-related protein (Hv-1c).
          Length = 173

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 67/161 (41%), Positives = 81/161 (50%), Gaps = 1/161 (0%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF 747
           S  LF+ L  F   +  A     I NNC  TIWPA     G PV   GGF L      S 
Sbjct: 4   SAVLFLLLAVFAAGASAA--TFNIKNNCGSTIWPA-----GIPV--GGGFELGSGQTSSI 54

Query: 746 VAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA-D 570
             P    +GRIWARTGC  N G  +C TGDC G+L C+   G  PATLA+F +  G   D
Sbjct: 55  NVPAGTQAGRIWARTGCSFNGGSGSCQTGDCGGQLSCS-LSGRPPATLAEFTIGGGSTQD 113

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACP 447
           F  Y +S++DGFNL M  +   G      + CR    P+CP
Sbjct: 114 F--YDISVIDGFNLAMDFSCSTG----DALQCRD---PSCP 145



>sp|P32937|PR1A_HORVU Pathogenesis-related protein 1A/1B
           precursor.>pir|S18034|S18034 pathogenesis-related
           protein 1 (a and b) precursor -
           barley>gb:AY839292_1630496 Hordeum vulgare
           thaumatin-like protein TLP1 mRNA, complete
           cds.>gb:HVPRP1A_1682505 H.vulgare mRNA for a
           pathogenesis-related protein (Hv-1a).>gb:HVPRP1B_1682506
           H.vulgare mRNA for a pathogenesis-related protein
           (Hv-1b).>gb:HVU276225_1682616 Hordeum vulgare mRNA for
           pathogenesis protein 5 (pr-5 gene).
          Length = 173

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 67/161 (41%), Positives = 81/161 (50%), Gaps = 1/161 (0%)
 Frame = -1

Query: 926 SVTLFISLCAFTTASLPAGLIITIVNNCPHTIWPAIQPNTGYPVLERGGFALYKLTHRSF 747
           S  LF+ L  F   +  A     I NNC  TIWPA     G PV   GGF L      S 
Sbjct: 4   SAVLFLLLAVFAAGASAA--TFNIKNNCGSTIWPA-----GIPV--GGGFELGSGQTSSI 54

Query: 746 VAPRARWSGRIWARTGCVLNHGRFTCATGDCDGRLECNGRGGAAPATLAQFELHQGHA-D 570
             P    +GRIWARTGC  N G  +C TGDC G+L C+   G  PATLA+F +  G   D
Sbjct: 55  NVPAGTQAGRIWARTGCSFNGGSGSCQTGDCGGQLSCS-LSGQPPATLAEFTIGGGSTQD 113

Query: 569 FSTYGLSLVDGFNLPMTLTPHDGKEHCPVVGCRANLLPACP 447
           F  Y +S++DGFNL M  +   G      + CR    P+CP
Sbjct: 114 F--YDISVIDGFNLAMDFSCSTG----DALQCRD---PSCP 145


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,033,701,793
Number of Sequences: 1806583
Number of extensions: 21964122
Number of successful extensions: 72867
Number of sequences better than 10.0: 309
Number of HSP's better than 10.0 without gapping: 66229
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 71388
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 75492161200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)