BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8820
         (798 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY864733_1631083 Populus tomentosa auxin influx protein (AUX1...   318   6e-86   
gb:AY302061_1597330 Populus tomentosa auxin transporter protein ...   318   6e-86   
gb:AF115543_1769321 Populus tremula x Populus tremuloides AUX1-l...   316   3e-85   
gb:AB107919_1526752 Pisum sativum PsAUX1 mRNA for AUX1-like auxi...   316   4e-85   
gb:AJ862887_1814962 Prunus avium mRNA for putative auxin influx ...   311   9e-84   
gb:AY115844_1578934 Medicago truncatula auxin influx carrier pro...   311   9e-84   
gb:AY115843_1578933 Medicago truncatula auxin influx carrier pro...   310   2e-83   
pir|T01244|T01244 hypothetical protein At2g38120 [imported] - Ar...   310   2e-83   Arabidopsis thaliana [mouse-ear cress]
gb:AP003415_1829143 Oryza sativa (japonica cultivar-group) genom...   309   4e-83   
gb:AP003415_1829142 Oryza sativa (japonica cultivar-group) genom...   309   4e-83   
gb:AB085896_1524430 Cucumis sativus CS-AUX1 mRNA for AUX1-like a...   304   1e-81   
gb:AF190880_1775450 Populus tremula x Populus tremuloides putati...   302   4e-81   
gb:AY115841_1578931 Medicago truncatula auxin influx carrier pro...   302   4e-81   
pir|T45964|T45964 LAX1 / AUX1-like permease - Arabidopsis thalia...   299   4e-80   Arabidopsis thaliana [mouse-ear cress]
gb:AC135421_1742282 Oryza sativa (japonica cultivar-group) chrom...   288   1e-76   
gb:ZMA011794_1731433 Zea mays mRNA for AUX1 protein.                  273   3e-72   
gb:AY115845_1578935 Medicago truncatula auxin influx carrier pro...   270   2e-71   
pir|E84596|E84596 AUX1-like amino acid permease [imported] - Ara...   269   4e-71   Arabidopsis thaliana [mouse-ear cress]
gb:AY115842_1578932 Medicago truncatula auxin influx carrier pro...   266   3e-70   
gb:ATH249442_1552135 Arabidopsis thaliana mRNA for putative AUX1...   265   7e-70   
gb:AE016959_1020928 Oryza sativa (japonica cultivar-group) chrom...   263   3e-69   
gb:AF263100_1781658 Populus tremula x Populus tremuloides putati...   261   8e-69   
pir|F96806|F96806 probable AUX1-like permease, 10674-8589 [impor...   261   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb:AY319517_1598725 Populus tomentosa auxin influx carrier prote...   129   6e-29   
gb:AP003886_1834832 Oryza sativa (japonica cultivar-group) genom...    47   5e-04   
gb:OSA557777_1692713 Oryza sativa (indica cultivar-group) propla...    47   5e-04   
gb:OSJN00003_1693113 Oryza sativa genomic DNA, chromosome 4, BAC...    46   7e-04   
gb:CAA004959_1644703 Cicer arietinum mRNA for hypothetical prote...    44   0.003   
gb:AY099685_1576710 Arabidopsis thaliana amino acid permease-lik...    44   0.005   
gb:AY086027_1571088 Arabidopsis thaliana clone 20725 mRNA, compl...    44   0.005   
gb:AB016871_1512894 Arabidopsis thaliana genomic DNA, chromosome...    44   0.005   
gb:AC098598_1736777 Oryza sativa (japonica cultivar-group) chrom...    42   0.010   
gb:BT003319_1356830 Drosophila melanogaster AT27573 full insert ...    40   0.051   
gb:AY089387_1297043 Drosophila melanogaster AT21186 full insert ...    40   0.051   
gb:AY089341_1296997 Drosophila melanogaster AT16007 full insert ...    40   0.051   
gb:AE014296_1135748 Drosophila melanogaster chromosome 3L, compl...    40   0.051   
gb:AP005873_1859428 Oryza sativa (japonica cultivar-group) genom...    40   0.066   
gb:AP002843_1823103 Oryza sativa (japonica cultivar-group) genom...    40   0.066   
gb:AP003289_1827371 Oryza sativa (japonica cultivar-group) genom...    39   0.086   
gb:AC105768_1738191 Oryza sativa (japonica cultivar-group) chrom...    39   0.15    
gb:BC070857_2555826 Xenopus laevis hypothetical protein MGC84608...    38   0.19    
gb:AX085459_1460981 Sequence 4 from Patent WO0112801.                  38   0.19    
gb:AP003984_1835916 Oryza sativa (japonica cultivar-group) genom...    38   0.25    
pir|T50687|T50687 proline transport protein 3 [imported] - tomat...    38   0.25    Solanum lycopersicum
gb:BT003903_1637029 Arabidopsis thaliana clone RAFL15-11-F15 (R2...    37   0.33    
gb:CEY32F6A_1369594 Caenorhabditis elegans YAC Y32F6A, complete ...    37   0.33    
gb:BX640435_812318 Bordetella parapertussis strain 12822, comple...    37   0.33    
gb:BX640411_804492 Bordetella pertussis strain Tohama I, complet...    37   0.33    
pir|T21000|T21000 hypothetical protein F15H10.4 - Caenorhabditis...    37   0.33    Caenorhabditis elegans [roundworm]
pir|T04965|T04965 amino acid transport protein homolog T12J5.50 ...    37   0.33    Arabidopsis thaliana [mouse-ear cress]
gb:AC002294_1530161 Arabidopsis thaliana chromosome I BAC F11P17...    37   0.56    
gb:BC077500_2560209 Xenopus laevis hypothetical protein LOC44586...    36   0.95    
gb:AY087539_1572569 Arabidopsis thaliana clone 36461 mRNA, compl...    36   0.95    
gb:OSJN00004_1693140 Oryza sativa genomic DNA, chromosome 4, BAC...    35   1.2     
gb:AY050801_1562308 Arabidopsis thaliana unknown protein (At2g39...    35   1.2     
pir|T50688|T50688 proline transport protein 2 [imported] - tomat...    35   1.2     Solanum lycopersicum
gb:AY133550_1581373 Arabidopsis thaliana At5g40780/K1B16_3 mRNA,...    35   2.1     
gb:ATU39782_1556966 Arabidopsis thaliana lysine and histidine sp...    35   2.1     
gb:AK117421_1815455 Arabidopsis thaliana At5g02180 mRNA for unkn...    34   3.6     
pir|T48239|T48239 hypothetical protein T7H20.230 - Arabidopsis t...    34   3.6     Arabidopsis thaliana [mouse-ear cress]
pir|C86378|C86378 protein F21J9.6 [imported] - Arabidopsis thali...    34   3.6     Arabidopsis thaliana [mouse-ear cress]
gb:AP003509_1830088 Oryza sativa (japonica cultivar-group) genom...    33   4.7     
gb:BT000792_1635063 Arabidopsis thaliana clone RAFL05-20-J01 (R1...    33   4.7     
gb:AC004261_1531619 Arabidopsis thaliana chromosome 2 clone T3K9...    33   4.7     
gb:AB075902_1523339 Avicennia marina Bet/ProT1 mRNA for betaine/...    33   4.7     
gb:AE013536_293187 Methanosarcina mazei strain Goe1, section 318...    33   4.7     
gb:AY542687_1612770 Vitis vinifera merlot proline-rich protein 2...    22   7.9     
gb:AB025615_1516387 Arabidopsis thaliana genomic DNA, chromosome...    33   8.1     
gb:AY452060_618431 Metallosphaera sedula SoxM (soxM) gene, parti...    33   8.1     
pir|T50689|T50689 proline transport protein 1 [imported] - tomat...    33   8.1     Solanum lycopersicum


>gb:AY864733_1631083 Populus tomentosa auxin influx protein (AUX1)
           mRNA, complete cds.
          Length = 477

 Score =  318 bits (816), Expect = 6e-86
 Identities = 155/193 (80%), Positives = 167/193 (86%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSA A+YWA+GD LL+++NAFALLP+NGFRDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 275 VFTLTIPSATAVYWAFGDDLLNHSNAFALLPKNGFRDAAVILMLIHQFITFGFACTPLYF 334

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+L
Sbjct: 335 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSL 394

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYRK+SARQNAAEKPPFFLPSWT                       ASM NF++QV
Sbjct: 395 AHMLTYRKSSARQNAAEKPPFFLPSWTAMYVVNTFVVVWVLVVGFGFGGWASMTNFVRQV 454

Query: 258 DTFGLFAKCYQCK 220
           DTFGLFAKCYQCK
Sbjct: 455 DTFGLFAKCYQCK 467



>gb:AY302061_1597330 Populus tomentosa auxin transporter protein 1
           mRNA, partial cds.
          Length = 224

 Score =  318 bits (816), Expect = 6e-86
 Identities = 155/193 (80%), Positives = 167/193 (86%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSA A+YWA+GD LL+++NAFALLP+NGFRDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 22  VFTLTIPSATAVYWAFGDDLLNHSNAFALLPKNGFRDAAVILMLIHQFITFGFACTPLYF 81

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+L
Sbjct: 82  VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSL 141

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYRK+SARQNAAEKPPFFLPSWT                       ASM NF++QV
Sbjct: 142 AHMLTYRKSSARQNAAEKPPFFLPSWTAMYVVNTFVVVWVLVVGFGFGGWASMTNFVRQV 201

Query: 258 DTFGLFAKCYQCK 220
           DTFGLFAKCYQCK
Sbjct: 202 DTFGLFAKCYQCK 214



>gb:AF115543_1769321 Populus tremula x Populus tremuloides AUX1-like
           protein (LAX1) mRNA, complete cds.
          Length = 477

 Score =  316 bits (810), Expect = 3e-85
 Identities = 154/193 (79%), Positives = 167/193 (86%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSA A+YWA+GD LL+++NAFALLP+NGFRDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 275 VFTLTIPSATAVYWAFGDLLLNHSNAFALLPRNGFRDAAVILMLIHQFITFGFACTPLYF 334

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+L
Sbjct: 335 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSL 394

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYRK+SARQNAAEKPPFFLPSWT                       AS+ NF++QV
Sbjct: 395 AHMLTYRKSSARQNAAEKPPFFLPSWTAMYVINTFVVVWVLVVGFGFGGWASVTNFVRQV 454

Query: 258 DTFGLFAKCYQCK 220
           DTFGLFAKCYQCK
Sbjct: 455 DTFGLFAKCYQCK 467



>gb:AB107919_1526752 Pisum sativum PsAUX1 mRNA for AUX1-like auxin
           influx carrier protein, complete cds.
          Length = 487

 Score =  316 bits (809), Expect = 4e-85
 Identities = 153/197 (77%), Positives = 168/197 (85%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSA+A+YWA+GD+LL+++NAF+LLP+NGFRD AVVLMLIHQFITFGFACTPLYF
Sbjct: 278 VFTLTIPSASAVYWAFGDELLNHSNAFSLLPKNGFRDGAVVLMLIHQFITFGFACTPLYF 337

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDT+SICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+ 
Sbjct: 338 VWEKVIGMHDTRSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSA 397

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYRKASARQNAAEKPPFF+PSWT                       ASM NFI+Q+
Sbjct: 398 AHMLTYRKASARQNAAEKPPFFMPSWTAMYILNAFIVVWVFVVGFGFGGWASMTNFIRQI 457

Query: 258 DTFGLFAKCYQCKHKSP 208
           DTFGLFAKCYQCK   P
Sbjct: 458 DTFGLFAKCYQCKPPPP 474



>gb:AJ862887_1814962 Prunus avium mRNA for putative auxin influx
           carrier protein (lax1 gene).
          Length = 483

 Score =  311 bits (797), Expect = 9e-84
 Identities = 151/192 (78%), Positives = 165/192 (85%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSA ++YWA+GD+LL++ANAF+LLP+N +RDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 279 VFTLTIPSATSVYWAFGDELLNHANAFSLLPKNAWRDAAVILMLIHQFITFGFACTPLYF 338

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+L
Sbjct: 339 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSL 398

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYRKASARQNAAEKPPFFLPSWT                       ASM NF++QV
Sbjct: 399 AHMLTYRKASARQNAAEKPPFFLPSWTAMYVINSFIVVWVLVIGFGFGGWASMTNFVRQV 458

Query: 258 DTFGLFAKCYQC 223
           D FGLFAKCYQC
Sbjct: 459 DNFGLFAKCYQC 470



>gb:AY115844_1578934 Medicago truncatula auxin influx carrier
           protein (LAX4) gene, complete cds.
          Length = 482

 Score =  311 bits (797), Expect = 9e-84
 Identities = 151/197 (76%), Positives = 166/197 (84%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSA A+YWA+GD+LL+++NAF+LLP+NGFRDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 276 VFTLTIPSAVAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILMLIHQFITFGFACTPLYF 335

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRAL RLPVVIPIWFLAIIFPFFGPINSAVGALLV+FTVYIIPAL
Sbjct: 336 VWEKVIGMHDTKSICLRALVRLPVVIPIWFLAIIFPFFGPINSAVGALLVTFTVYIIPAL 395

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYR ASAR+NA EKPP FLPSWT                       ASM NFI+Q+
Sbjct: 396 AHMLTYRTASARKNAVEKPPSFLPSWTAVYVLNAFIVVWVLVVGFGFGGWASMTNFIRQI 455

Query: 258 DTFGLFAKCYQCKHKSP 208
           DTFGLFAKCYQCK  +P
Sbjct: 456 DTFGLFAKCYQCKPPTP 472



>gb:AY115843_1578933 Medicago truncatula auxin influx carrier
           protein (LAX2) gene, complete cds.>gb:MTR299398_1687624
           Medicago truncatula mRNA for putative AUX1-like permease
           (lax2 gene).
          Length = 484

 Score =  310 bits (795), Expect = 2e-83
 Identities = 149/193 (77%), Positives = 166/193 (86%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSA A+YWA+GD+LL+++NAF+LLP+NG+RD AV+LMLIHQFITFGFACTPLYF
Sbjct: 276 VFTLTIPSATAVYWAFGDELLNHSNAFSLLPKNGWRDGAVILMLIHQFITFGFACTPLYF 335

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDT+SICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+ 
Sbjct: 336 VWEKVIGMHDTRSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSA 395

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYRKASAR+NAAEKPPFF+PSWT                       ASM NFI+Q+
Sbjct: 396 AHMLTYRKASARKNAAEKPPFFMPSWTAMYIFNAFIVIWVLVVGFGFGGWASMTNFIRQI 455

Query: 258 DTFGLFAKCYQCK 220
           DTFGLFAKCYQCK
Sbjct: 456 DTFGLFAKCYQCK 468



>pir|T01244|T01244 hypothetical protein At2g38120 [imported] -
           Arabidopsis thaliana>gb:AC003028_1530969 Arabidopsis
           thaliana chromosome 2 clone F16M14 map ve018, complete
           sequence.>gb:ATAUX1_1544123 A.thaliana AUX1
           gene.>gb:AY054488_1563142 Arabidopsis thaliana Unknown
           protein (At2g38120; F16M14.5) mRNA, complete
           cds.>gb:AY087092_1572128 Arabidopsis thaliana clone
           31586 mRNA, complete sequence.>gb:AY093300_1575254
           Arabidopsis thaliana unknown protein (At2g38120) mRNA,
           complete cds.
          Length = 485

 Score =  310 bits (794), Expect = 2e-83
 Identities = 150/193 (77%), Positives = 165/193 (85%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLTIPSAAA+YWA+GD LL ++NAF+L+P+N +RDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 276 VFTLTIPSAAAVYWAFGDALLDHSNAFSLMPKNAWRDAAVILMLIHQFITFGFACTPLYF 335

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+L
Sbjct: 336 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSL 395

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYR ASARQNAAEKPPFF+PSWT                       AS+ NF++QV
Sbjct: 396 AHMLTYRSASARQNAAEKPPFFMPSWTAMYVLNAFVVVWVLIVGFGFGGWASVTNFVRQV 455

Query: 258 DTFGLFAKCYQCK 220
           DTFGLFAKCYQCK
Sbjct: 456 DTFGLFAKCYQCK 468



>gb:AP003415_1829143 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1402_H07.
          Length = 282

 Score =  309 bits (791), Expect = 4e-83
 Identities = 149/197 (75%), Positives = 167/197 (84%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSA+AMYWA+GD+LL+++NAF+LLP+ G+RDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 74  VFTLTLPSASAMYWAFGDELLTHSNAFSLLPKTGWRDAAVILMLIHQFITFGFACTPLYF 133

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRALARLP+V+PIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL
Sbjct: 134 VWEKVIGMHDTKSICLRALARLPIVVPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 193

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AH++TYR ASAR NAAEKPPFFLPSWT                       ASM NFI+Q+
Sbjct: 194 AHILTYRTASARMNAAEKPPFFLPSWTGMFVLNMFIVVWVLVVGFGLGGWASMVNFIRQI 253

Query: 258 DTFGLFAKCYQCKHKSP 208
           DTFGLFAKCYQC   +P
Sbjct: 254 DTFGLFAKCYQCPKPAP 270



>gb:AP003415_1829142 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1402_H07.
          Length = 492

 Score =  309 bits (791), Expect = 4e-83
 Identities = 149/197 (75%), Positives = 167/197 (84%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSA+AMYWA+GD+LL+++NAF+LLP+ G+RDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 284 VFTLTLPSASAMYWAFGDELLTHSNAFSLLPKTGWRDAAVILMLIHQFITFGFACTPLYF 343

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSICLRALARLP+V+PIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL
Sbjct: 344 VWEKVIGMHDTKSICLRALARLPIVVPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 403

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AH++TYR ASAR NAAEKPPFFLPSWT                       ASM NFI+Q+
Sbjct: 404 AHILTYRTASARMNAAEKPPFFLPSWTGMFVLNMFIVVWVLVVGFGLGGWASMVNFIRQI 463

Query: 258 DTFGLFAKCYQCKHKSP 208
           DTFGLFAKCYQC   +P
Sbjct: 464 DTFGLFAKCYQCPKPAP 480



>gb:AB085896_1524430 Cucumis sativus CS-AUX1 mRNA for AUX1-like
           auxin transport protein, complete cds.
          Length = 489

 Score =  304 bits (778), Expect = 1e-81
 Identities = 144/197 (73%), Positives = 166/197 (84%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSA+A+YWA+GD+LL+++NAF+LLP+N FRDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 284 VFTLTLPSASAVYWAFGDELLNHSNAFSLLPKNRFRDAAVILMLIHQFITFGFACTPLYF 343

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKS+CLRAL RLPVV+PIWFLAIIFPF GPINSAVGALLVSFTVYIIPA 
Sbjct: 344 VWEKVIGMHDTKSLCLRALVRLPVVVPIWFLAIIFPFLGPINSAVGALLVSFTVYIIPAA 403

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYRKASA+QNAAEKPPFFLPSWT                       A++ NF++Q+
Sbjct: 404 AHMLTYRKASAKQNAAEKPPFFLPSWTAMYVLNSFIVVWIFVFGFGFGGWATITNFVRQI 463

Query: 258 DTFGLFAKCYQCKHKSP 208
           ++FGLFAKCYQCK   P
Sbjct: 464 NSFGLFAKCYQCKPSHP 480



>gb:AF190880_1775450 Populus tremula x Populus tremuloides putative
           AUX1-like permease (lax2) mRNA, complete cds.
          Length = 473

 Score =  302 bits (774), Expect = 4e-81
 Identities = 151/202 (74%), Positives = 164/202 (81%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSAAA YWA+GDQLL+++NAF+LLP+ G+RDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 273 VFTLTLPSAAATYWAFGDQLLTHSNAFSLLPRTGWRDAAVILMLIHQFITFGFACTPLYF 332

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSI LRAL RLPVVIPIWF AIIFPFFGPINSAVGALLV+FTVYIIPAL
Sbjct: 333 VWEKVIGMHDTKSILLRALCRLPVVIPIWFFAIIFPFFGPINSAVGALLVTFTVYIIPAL 392

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYR ASARQNA EKPP FLPSWT                       ASM+NFIKQV
Sbjct: 393 AHMLTYRSASARQNAVEKPPVFLPSWTAMYVLNAFIVVWVLVVGFGLGGWASMSNFIKQV 452

Query: 258 DTFGLFAKCYQCKHKSPETNHH 193
           DTFGLFAKC QC  +S    HH
Sbjct: 453 DTFGLFAKCCQCP-RSAAAKHH 473



>gb:AY115841_1578931 Medicago truncatula auxin influx carrier
           protein (LAX1) gene, complete cds.>gb:MTR299397_1687623
           Medicago truncatula mRNA for putative AUX1-like permease
           (lax1 gene).
          Length = 479

 Score =  302 bits (774), Expect = 4e-81
 Identities = 150/201 (74%), Positives = 163/201 (81%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSA A+YWA+GDQLL ++NAF+LLP+N +RDA V+LMLIHQFITFGFACTPLYF
Sbjct: 275 VFTLTLPSAIAVYWAFGDQLLDHSNAFSLLPRNAWRDAGVILMLIHQFITFGFACTPLYF 334

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEKVIGMHDTKSI LRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVY+IPA 
Sbjct: 335 VWEKVIGMHDTKSIFLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYVIPAS 394

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYR ASARQNAAEK P  +PSWT                       ASM NFIKQV
Sbjct: 395 AHMLTYRSASARQNAAEKLPKVIPSWTLMYVINAFVVIWVTIVGFGFGGWASMTNFIKQV 454

Query: 258 DTFGLFAKCYQCKHKSPETNH 196
           DTFGLFAKCYQC  K P +NH
Sbjct: 455 DTFGLFAKCYQCPPKLPASNH 475



>pir|T45964|T45964 LAX1 / AUX1-like permease - Arabidopsis
           thaliana>gb:ATF7J8_1551003 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F7J8 (ESSA project).
          Length = 488

 Score =  299 bits (766), Expect = 4e-80
 Identities = 143/193 (74%), Positives = 161/193 (83%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSA+A+YWA+GDQLL+++NAF+LLP+  FRD AV+LMLIHQFITFGFACTPLYF
Sbjct: 282 VFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLYF 341

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK IGMH TKS+CLRAL RLPVV+PIWFLAIIFPFFGPINSAVGALLV+FTVYIIPAL
Sbjct: 342 VWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIPAL 401

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYR ASAR+NAAEKPPFF+PSW                        ASM NFI+Q+
Sbjct: 402 AHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFIRQI 461

Query: 258 DTFGLFAKCYQCK 220
           DTFGLFAKCYQCK
Sbjct: 462 DTFGLFAKCYQCK 474



>gb:AC135421_1742282 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0012G21, complete sequence.
          Length = 482

 Score =  288 bits (736), Expect = 1e-76
 Identities = 138/192 (71%), Positives = 160/192 (83%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSA+AMYWA+GD LL+++NAF+LLP++G+RDAAV+LMLIHQFITFGFACTPLYF
Sbjct: 275 VFTLTLPSASAMYWAFGDALLTHSNAFSLLPRSGWRDAAVILMLIHQFITFGFACTPLYF 334

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK IGMH T+S+  RALARLP+V+PIWFLAIIFPFFGPINSAVGALLVSFTVYIIP+L
Sbjct: 335 VWEKAIGMHGTRSVLTRALARLPIVVPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSL 394

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           +H++TYR ASAR NAAEKPP FLPSW+                       AS+ NFIKQ+
Sbjct: 395 SHILTYRSASARLNAAEKPPPFLPSWSGMFVVNVFVVAWVLVVGFGLGGWASVTNFIKQI 454

Query: 258 DTFGLFAKCYQC 223
           DTFGLFAKCYQC
Sbjct: 455 DTFGLFAKCYQC 466



>gb:ZMA011794_1731433 Zea mays mRNA for AUX1 protein.
          Length = 529

 Score =  273 bits (698), Expect = 3e-72
 Identities = 131/192 (68%), Positives = 152/192 (79%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           V TLT+PSAAA YWA+GD+LL+++NA ALLP+  FRDAAVVLMLIHQFITFGFACTPLYF
Sbjct: 285 VLTLTLPSAAASYWAFGDELLTHSNALALLPRTPFRDAAVVLMLIHQFITFGFACTPLYF 344

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK+IG+HD +S+C RA ARLPVV+PIWFLAIIFPFFGPINSAVG+LLVSFTVYIIPAL
Sbjct: 345 VWEKLIGLHDCRSLCKRAAARLPVVVPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPAL 404

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHMVT+R   +R+NA E+PP F   WT                       AS+ NF++QV
Sbjct: 405 AHMVTFRSPQSRENAVERPPRFAGGWTGAYVINSFVVAWVLVVGFGFGGWASITNFVQQV 464

Query: 258 DTFGLFAKCYQC 223
           +TFGLFAKCYQC
Sbjct: 465 NTFGLFAKCYQC 476



>gb:AY115845_1578935 Medicago truncatula auxin influx carrier
           protein (LAX5) gene, complete cds.
          Length = 490

 Score =  270 bits (691), Expect = 2e-71
 Identities = 130/197 (65%), Positives = 151/197 (76%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           V TLTIPSA A+YWA+GD LL+++NAFALLP++ FRD AV+LMLIHQFITFGFACTPLYF
Sbjct: 272 VLTLTIPSATAVYWAFGDMLLNHSNAFALLPKSPFRDMAVILMLIHQFITFGFACTPLYF 331

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK +GMH+ KS+C RAL RLPVVIPIWFLAIIFPFFGPINS VG+LLVSFTVYIIPAL
Sbjct: 332 VWEKTVGMHECKSLCKRALVRLPVVIPIWFLAIIFPFFGPINSTVGSLLVSFTVYIIPAL 391

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AH+ T++ +SARQNA E+PP F+  W                        ASM NF+ Q+
Sbjct: 392 AHIFTFKSSSARQNAVEQPPKFVGRWVGTFVINVFIVVWVLIVGFGFGGWASMVNFVHQI 451

Query: 258 DTFGLFAKCYQCKHKSP 208
           DTFGLF KCYQC   +P
Sbjct: 452 DTFGLFTKCYQCPPPTP 468



>pir|E84596|E84596 AUX1-like amino acid permease [imported] -
           Arabidopsis thaliana>gb:AC006264_1533917 Arabidopsis
           thaliana chromosome 2 clone F26H11 map mi148, complete
           sequence.>gb:ATH243221_1552090 Arabidopsis thaliana LAX2
           gene for putative AUX1-like permease, exons 1 to
           6.>gb:AY054684_1563338 Arabidopsis thaliana AUX1-like
           amino acid permease (At2g21050; F26H11.19) mRNA,
           complete cds.>gb:AY128714_1580794 Arabidopsis thaliana
           AUX1-like amino acid permease (At2g21050) mRNA, complete
           cds.
          Length = 483

 Score =  269 bits (688), Expect = 4e-71
 Identities = 130/192 (67%), Positives = 152/192 (79%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           V TLT+PSA+A+YWA+GD LL+++NAFALLP+N +RD AVVLMLIHQFITFGFACTPLYF
Sbjct: 270 VLTLTLPSASAVYWAFGDLLLNHSNAFALLPKNLYRDFAVVLMLIHQFITFGFACTPLYF 329

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK+IGMH+ +S+C RA ARLPVVIPIWFLAIIFPFFGPINS VG+LLVSFTVYIIPAL
Sbjct: 330 VWEKLIGMHECRSMCKRAAARLPVVIPIWFLAIIFPFFGPINSTVGSLLVSFTVYIIPAL 389

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AH+ T+R ++AR+NA E+PP FL  WT                       ASM NF+ Q+
Sbjct: 390 AHIFTFRSSAARENAVEQPPRFLGRWTGAFTINAFIVVWVFIVGFGFGGWASMINFVHQI 449

Query: 258 DTFGLFAKCYQC 223
           DTFGLF KCYQC
Sbjct: 450 DTFGLFTKCYQC 461



>gb:AY115842_1578932 Medicago truncatula auxin influx carrier
           protein (LAX3) gene, complete cds.>gb:MTR299399_1687625
           Medicago truncatula mRNA for putative AUX1-like permease
           (lax3 gene).
          Length = 465

 Score =  266 bits (680), Expect = 3e-70
 Identities = 130/197 (65%), Positives = 151/197 (76%), Gaps = 1/197 (0%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           V TLT+PSAAA+YWA+GD LL+++NA +LLP+ GFRD AV+LMLIHQFITFGFACTPLYF
Sbjct: 269 VMTLTLPSAAAVYWAFGDNLLTHSNALSLLPRTGFRDTAVILMLIHQFITFGFACTPLYF 328

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK +G+H+TKS+  RAL RLPVVIPIWFLAIIFPFFGPINS VG+LLVSFTVYIIPAL
Sbjct: 329 VWEKFLGVHETKSLLKRALVRLPVVIPIWFLAIIFPFFGPINSTVGSLLVSFTVYIIPAL 388

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHMVT+  A AR+NA E+PP FL  W                        ASM NF+ Q+
Sbjct: 389 AHMVTFASAPARENAVERPPSFLGGWVGLYSVNVFVAVWVLVVGFGLGGWASMLNFVHQI 448

Query: 258 DTFGLFAKCYQC-KHKS 211
            TFGLFAKC+QC  HK+
Sbjct: 449 KTFGLFAKCFQCPPHKA 465



>gb:ATH249442_1552135 Arabidopsis thaliana mRNA for putative
           AUX1-like permease (LAX1 gene).
          Length = 485

 Score =  265 bits (677), Expect = 7e-70
 Identities = 134/193 (69%), Positives = 151/193 (78%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           VFTLT+PSA+A+YWA+GDQLL+++NAF+LLP+  FRD AV+LMLIHQFITFGFACTPLYF
Sbjct: 282 VFTLTLPSASALYWAFGDQLLNHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLYF 341

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK IGMH TKS+CLRAL RLP V PIWF  IIFP F  INSAVGALLV+FTVYIIPAL
Sbjct: 342 VWEKAIGMHHTKSLCLRALVRLPCV-PIWFWPIIFP-FSAINSAVGALLVTFTVYIIPAL 399

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+TYR ASA +  AEKPPFF+PSW                        ASM NFI+Q+
Sbjct: 400 AHMLTYRTASAAER-AEKPPFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFIRQI 458

Query: 258 DTFGLFAKCYQCK 220
           DTFGLFAKCYQCK
Sbjct: 459 DTFGLFAKCYQCK 471



>gb:AE016959_1020928 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091665_1734844
           Oryza sativa chromosome 10 clone OSJNBb0016M10, complete
           sequence.>gb:AE017056_1750747 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 10 of 77 of the
           complete sequence.
          Length = 547

 Score =  263 bits (672), Expect = 3e-69
 Identities = 127/192 (66%), Positives = 148/192 (77%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           V TLT+PSA+A YWA+GD LL+++NA ALLP+  +RDAAVVLMLIHQFITFGFACTPLYF
Sbjct: 291 VLTLTLPSASAAYWAFGDALLTHSNALALLPRTPWRDAAVVLMLIHQFITFGFACTPLYF 350

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK++G+H   S+C RA ARLPVV+PIWFLAIIFPFFGPINSAVG+LLVSFTVYIIP+L
Sbjct: 351 VWEKLVGLHGCPSLCKRAAARLPVVLPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPSL 410

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           A+MVT+R   +RQNA E+PP F   WT                       AS+ NF+ QV
Sbjct: 411 AYMVTFRSPQSRQNAVERPPRFAGGWTGAYVINSFVVAWVLVVGFGFGGWASITNFVHQV 470

Query: 258 DTFGLFAKCYQC 223
           DTFGLFAKCYQC
Sbjct: 471 DTFGLFAKCYQC 482



>gb:AF263100_1781658 Populus tremula x Populus tremuloides putative
           AUX1-like permease (lax3) mRNA, complete cds.
          Length = 491

 Score =  261 bits (668), Expect = 8e-69
 Identities = 124/192 (64%), Positives = 149/192 (77%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           V TLT+PSAAA+YWA+GD LL+++NAF+LLP++  RD AV+LMLIHQFITFGFACTPLYF
Sbjct: 269 VLTLTLPSAAAVYWAFGDMLLNHSNAFSLLPRSPSRDMAVILMLIHQFITFGFACTPLYF 328

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK IGMH+ KS+C RA ARLPVVIPIWFLAIIFPFFGPINS VG+LLVSFTVYIIPAL
Sbjct: 329 VWEKAIGMHECKSLCKRAAARLPVVIPIWFLAIIFPFFGPINSTVGSLLVSFTVYIIPAL 388

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           A+M T++ ++AR+NA E+PP ++  W                        AS+ NF+ Q+
Sbjct: 389 AYMFTFKSSAARENAVEQPPKYMGRWVGTYVMNSFVVVWVLIVGFGFGGWASVTNFVHQI 448

Query: 258 DTFGLFAKCYQC 223
           DTFGLF KCYQC
Sbjct: 449 DTFGLFTKCYQC 460



>pir|F96806|F96806 probable AUX1-like permease, 10674-8589
           [imported] - Arabidopsis thaliana>gb:AE005173_895291
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012193_1537550 Arabidopsis thaliana
           chromosome 1 BAC T32E8 genomic sequence, complete
           sequence.>gb:AY054266_1563086 Arabidopsis thaliana
           At1g77690/T32E8_2 mRNA, complete
           cds.>gb:AY127575_1580490 Arabidopsis thaliana putative
           AUX1-like permease (LAX3) gene, complete
           cds.>gb:BT008300_1639517 Arabidopsis thaliana
           At1g77690/T32E8_2 gene, complete cds.
          Length = 470

 Score =  261 bits (666), Expect = 1e-68
 Identities = 125/197 (63%), Positives = 152/197 (77%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYF 619
           V TLT+PSA+A+YWA+GD+LL+++NA +LLP+ GFRD AV+LMLIHQFITFGFA TPLYF
Sbjct: 274 VLTLTLPSASAVYWAFGDKLLTHSNALSLLPKTGFRDTAVILMLIHQFITFGFASTPLYF 333

Query: 618 VWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           VWEK+IG+H+TKS+  RA+ARLPVV+PIWFLAIIFPFFGPINSAVG+LLVSFTVYIIPAL
Sbjct: 334 VWEKLIGVHETKSMFKRAMARLPVVVPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPAL 393

Query: 438 AHMVTYRKASARQNAAEKPPFFLPSWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQV 259
           AHM+T+  A +R+NA E+PP  +  W                        ASM NF++Q+
Sbjct: 394 AHMLTFAPAPSRENAVERPPRVVGGWMGTYCINIFVVVWVFVVGFGFGGWASMVNFVRQI 453

Query: 258 DTFGLFAKCYQCKHKSP 208
           DTFGLF KCYQC    P
Sbjct: 454 DTFGLFTKCYQCPPHKP 470



>gb:AY319517_1598725 Populus tomentosa auxin influx carrier protein
           (AUX2) mRNA, partial cds.
          Length = 113

 Score =  129 bits (324), Expect = 6e-29
 Identities = 66/113 (58%), Positives = 77/113 (68%), Gaps = 1/113 (0%)
 Frame = -1

Query: 546 VIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTYRKASARQNAAEKPPFFLP 367
           ++ IWFLAIIFPFFGPINS VG+LLVSFTVYIIP+LAHMVT+  ASAR+NA E+PP FL 
Sbjct: 1   LVIIWFLAIIFPFFGPINSTVGSLLVSFTVYIIPSLAHMVTFSSASARENAVERPPPFLG 60

Query: 366 SWTXXXXXXXXXXXXXXXXXXXXXXXASMNNFIKQVDTFGLFAKCYQC-KHKS 211
            W                        ASM NFI+Q+D+FGLF KCYQC  HK+
Sbjct: 61  GWVGSYCVNFFVVVWVFVVGFGFGGWASMLNFIRQIDSFGLFTKCYQCPPHKA 113



>gb:AP003886_1834832 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1163_G08.
          Length = 447

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 2/123 (1%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVI 601
           P A   YWA+G+ +  N     L         A ++++IH   ++     P++ + E V+
Sbjct: 282 PVALVGYWAFGNHVDDNI-LITLSRPKWLIALANMMVVIHVIGSYQIYAMPVFDMIETVL 340

Query: 600 --GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMV 427
              +     + LR +AR   V    F+AI FPFFG +    G    + T Y +P +  + 
Sbjct: 341 VKKLRFPPGLTLRLIARTLYVAFTMFIAITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLA 400

Query: 426 TYR 418
            Y+
Sbjct: 401 IYK 403



>gb:OSA557777_1692713 Oryza sativa (indica cultivar-group)
           proplastid ht gene for histidine amino acid transporter.
          Length = 441

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 2/123 (1%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVI 601
           P A   YWA+G+ +  N     L         A ++++IH   ++     P++ + E V+
Sbjct: 276 PVALVGYWAFGNHVDDNI-LITLSRPKWLIALANMMVVIHVIGSYQIYAMPVFDMIETVL 334

Query: 600 --GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMV 427
              +     + LR +AR   V    F+AI FPFFG +    G    + T Y +P +  + 
Sbjct: 335 VKKLRFPPGLTLRLIARTLYVAFTMFIAITFPFFGGLLGFFGGFAFAPTTYFLPCIMWLA 394

Query: 426 TYR 418
            Y+
Sbjct: 395 IYK 397



>gb:OSJN00003_1693113 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0072F16, complete
           sequence.>gb:OSJN00299_1698199 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: B1358B12, complete sequence.
          Length = 478

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 2/142 (1%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVI 601
           P A A YWA+G  +  N    AL        AA +++++H   ++     P++   E ++
Sbjct: 313 PVAIAGYWAFGRDVSDNV-LVALRRPPWLVAAANMMVVVHVLGSYQVYAMPIFETLETIL 371

Query: 600 --GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMV 427
              +       LR +AR   V    F+A+ FPFFG +    G    + T Y +P +  + 
Sbjct: 372 ITRIRLPPGALLRLVARSAYVAFTLFVAVTFPFFGDLLGFFGGFGFTPTSYFLPCILWL- 430

Query: 426 TYRKASARQNAAEKPPFFLPSW 361
                       +KPP F  SW
Sbjct: 431 ----------KIKKPPRFSASW 442



>gb:CAA004959_1644703 Cicer arietinum mRNA for hypothetical protein
           homologous to EST B23019.
          Length = 154

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 41/122 (33%), Positives = 58/122 (47%), Gaps = 14/122 (11%)
 Frame = -1

Query: 798 VFTLTIPSAAAM-YWAYGDQLLSNANAF-ALLPQNGFRDA-------AVVLMLIHQFITF 646
           V  +T  SAA   YW +G++  SN+N   +LLP +G   A       AV+ +L+  F   
Sbjct: 10  VILVTFYSAAVSGYWVFGNK--SNSNILKSLLPDSGPTLAPTWVLGLAVIFVLLQLFAIG 67

Query: 645 GFACTPLYFVWEKVI-----GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVG 481
                  Y V EK       GM   +++  R + R   +I   FLA + PFFG IN  VG
Sbjct: 68  LVYSQVAYEVMEKKSADVKQGMFSKRNLIPRLILRTIYMIFCGFLAAMLPFFGDINGVVG 127

Query: 480 AL 475
           A+
Sbjct: 128 AV 129



>gb:AY099685_1576710 Arabidopsis thaliana amino acid permease-like
           protein (At5g41800) mRNA, complete
           cds.>gb:AY128864_1580944 Arabidopsis thaliana amino acid
           permease-like protein (At5g41800) mRNA, complete cds.
          Length = 452

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 12/139 (8%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLM------LIHQFITFGFA 637
           +F     +A + YW +G+   SN     L+P  G   A +V++      ++ Q    G  
Sbjct: 266 IFFTFYSAAISGYWVFGNNSSSNILK-NLMPDEGPTLAPIVVIGLAVIFVLLQLFAIGLV 324

Query: 636 CTPL-YFVWEK-----VIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGAL 475
            + + Y + EK       G+   +++  R + R   +    F+A + PFFG IN+ VGA 
Sbjct: 325 YSQVAYEIMEKKSADTTKGIFSKRNLVPRLILRTLYMAFCGFMAAMLPFFGDINAVVGAF 384

Query: 474 LVSFTVYIIPALAHMVTYR 418
                 +++P L + +TY+
Sbjct: 385 GFIPLDFVLPMLLYNMTYK 403



>gb:AY086027_1571088 Arabidopsis thaliana clone 20725 mRNA, complete
           sequence.
          Length = 452

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 12/139 (8%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLM------LIHQFITFGFA 637
           +F     +A + YW +G+   SN     L+P  G   A +V++      ++ Q    G  
Sbjct: 266 IFFTFYSAAISGYWVFGNNSSSNILK-NLMPDEGPTLAPIVVIGLAVIFVLLQLFAIGLV 324

Query: 636 CTPL-YFVWEK-----VIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGAL 475
            + + Y + EK       G+   +++  R + R   +    F+A + PFFG IN+ VGA 
Sbjct: 325 YSQVAYEIMEKKSADTTKGIFSKRNLVPRLILRTLYMAFCGFMAAMLPFFGDINAVVGAF 384

Query: 474 LVSFTVYIIPALAHMVTYR 418
                 +++P L + +TY+
Sbjct: 385 GFIPLDFVLPMLLYNMTYK 403



>gb:AB016871_1512894 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K16L22.
          Length = 423

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 12/139 (8%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLM------LIHQFITFGFA 637
           +F     +A + YW +G+   SN     L+P  G   A +V++      ++ Q    G  
Sbjct: 237 IFFTFYSAAISGYWVFGNNSSSNILK-NLMPDEGPTLAPIVVIGLAVIFVLLQLFAIGLV 295

Query: 636 CTPL-YFVWEK-----VIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGAL 475
            + + Y + EK       G+   +++  R + R   +    F+A + PFFG IN+ VGA 
Sbjct: 296 YSQVAYEIMEKKSADTTKGIFSKRNLVPRLILRTLYMAFCGFMAAMLPFFGDINAVVGAF 355

Query: 474 LVSFTVYIIPALAHMVTYR 418
                 +++P L + +TY+
Sbjct: 356 GFIPLDFVLPMLLYNMTYK 374



>gb:AC098598_1736777 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1007_H05, complete sequence.
          Length = 481

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 12/134 (8%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNG-------FRDAAVVLMLIHQFITFGF 640
           +FT  +P+    YWA+G Q+ SN    +L+P  G           AVVL+L+        
Sbjct: 296 LFTFYLPAITG-YWAFGSQVQSNVLQ-SLMPDKGPSLAPTWLLGLAVVLVLLQLLAIALV 353

Query: 639 ACTPLYFVWEK-----VIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGAL 475
                Y + EK       G    +++  R   R   V    F+A + PFFG I   VGA+
Sbjct: 354 YSQVAYEIMEKSSADAARGRFSRRNVAPRVALRTAYVAACAFVAAMLPFFGDIVGVVGAV 413

Query: 474 LVSFTVYIIPALAH 433
                 +++P + +
Sbjct: 414 GFIPLDFVLPVVMY 427



>gb:BT003319_1356830 Drosophila melanogaster AT27573 full insert
           cDNA.
          Length = 470

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 34/119 (28%), Positives = 48/119 (40%), Gaps = 5/119 (4%)
 Frame = -1

Query: 762 YWAYGDQLLS----NANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVIGM 595
           YW YGD+       N     +L Q      A  + L +    F      +   W K    
Sbjct: 271 YWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGFVIIDIIMNHFWNK---N 327

Query: 594 HDTKSICLR-ALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTY 421
            D  +  L+ ++ R   V+ I   AII P  GP+ S VGAL +S    + PAL  +  Y
Sbjct: 328 GDLPNAALKESILRACTVVLICITAIIAPNLGPLLSLVGALTISLLNLVFPALIEICLY 386



>gb:AY089387_1297043 Drosophila melanogaster AT21186 full insert
           cDNA.
          Length = 426

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 34/119 (28%), Positives = 48/119 (40%), Gaps = 5/119 (4%)
 Frame = -1

Query: 762 YWAYGDQLLS----NANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVIGM 595
           YW YGD+       N     +L Q      A  + L +    F      +   W K    
Sbjct: 257 YWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGFVIIDIIMNHFWNK---N 313

Query: 594 HDTKSICLR-ALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTY 421
            D  +  L+ ++ R   V+ I   AII P  GP+ S VGAL +S    + PAL  +  Y
Sbjct: 314 GDLPNAALKESILRACTVVLICITAIIAPNLGPLLSLVGALTISLLNLVFPALIEICLY 372



>gb:AY089341_1296997 Drosophila melanogaster AT16007 full insert
           cDNA.
          Length = 434

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 34/119 (28%), Positives = 48/119 (40%), Gaps = 5/119 (4%)
 Frame = -1

Query: 762 YWAYGDQLLS----NANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVIGM 595
           YW YGD+       N     +L Q      A  + L +    F      +   W K    
Sbjct: 234 YWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGFVIIDIIMNHFWNK---N 290

Query: 594 HDTKSICLR-ALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTY 421
            D  +  L+ ++ R   V+ I   AII P  GP+ S VGAL +S    + PAL  +  Y
Sbjct: 291 GDLPNAALKESILRACTVVLICITAIIAPNLGPLLSLVGALTISLLNLVFPALIEICLY 349



>gb:AE014296_1135748 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003546_1214908 Drosophila melanogaster
           chromosome 3L, section 39 of 83 of the complete
           sequence.
          Length = 471

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 34/119 (28%), Positives = 48/119 (40%), Gaps = 5/119 (4%)
 Frame = -1

Query: 762 YWAYGDQLLS----NANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVIGM 595
           YW YGD+       N     +L Q      A  + L +    F      +   W K    
Sbjct: 271 YWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGFVIIDIIMNHFWNK---N 327

Query: 594 HDTKSICLR-ALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTY 421
            D  +  L+ ++ R   V+ I   AII P  GP+ S VGAL +S    + PAL  +  Y
Sbjct: 328 GDLPNAALKESILRACTVVLICITAIIAPNLGPLLSLVGALTISLLNLVFPALIEICLY 386



>gb:AP005873_1859428 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1370C05.
          Length = 571

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 4/138 (2%)
 Frame = -1

Query: 792 TLTIPSAAAM-YWAYGDQLLSNANAFAL-LPQNGFRDAAVVLMLIHQFIT-FGFACTPLY 622
           ++    AA M Y  +G+   S  + F L LP+N       V   +   IT +    TPL 
Sbjct: 410 SILFAGAAVMGYKMFGE---STESQFTLNLPENLVVSKVAVWTTVANPITKYALTITPLA 466

Query: 621 FVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPA 442
              E+++  +  K   +  L R  +V+    +A+  PFFG + + VG+LL     YI+P 
Sbjct: 467 MSLEELLPPNQQKYANIIML-RSSLVVSTLLIALSVPFFGLVMALVGSLLTMLVTYILPC 525

Query: 441 LAHM-VTYRKASARQNAA 391
              + +  RK +  Q AA
Sbjct: 526 ACFLAILKRKVTWHQIAA 543



>gb:AP002843_1823103 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0407B12.
          Length = 516

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 12/135 (8%)
 Frame = -1

Query: 795 FTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAV------VLMLIHQFITFGFAC 634
           F   IPS    YWA+G  + SN    +L+P  G   A        VL ++ Q +  G   
Sbjct: 332 FAFYIPSITG-YWAFGSHVQSNVLK-SLMPDTGPALAPTWLLGLAVLFVLLQLLAIGLVY 389

Query: 633 TPL-YFVWEK-----VIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALL 472
           + + Y + EK       G    +++  R L R   +    F+A + PFFG I   VGA+ 
Sbjct: 390 SQVAYEIMEKSSADATRGKFSRRNVVPRLLLRTLYLAFCAFMAAMLPFFGDIVGVVGAVG 449

Query: 471 VSFTVYIIPALAHMV 427
                +++P + + +
Sbjct: 450 FIPLDFVLPVVMYNI 464



>gb:AP003289_1827371 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0683F02.>gb:AP003415_1829150 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OJ1402_H07.
          Length = 457

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 34/144 (23%), Positives = 64/144 (44%), Gaps = 17/144 (11%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQ----LLSN--ANAFALLPQNGFRDAAVVLMLIHQFITFGFA 637
           V T     A + YWA+G+Q    LLSN      A++P+        +L++I  F     +
Sbjct: 275 VVTTFFSVAISGYWAFGNQSQGTLLSNFMVGGRAVIPE-------WLLLIIELFTLLQLS 327

Query: 636 CTPLYFVW-----------EKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS 490
              + ++            +   G +  +++  R L+R   V     +A + PFFG +N+
Sbjct: 328 AVAVVYLQPTNEVLEGLLSDPKAGQYAARNVAPRVLSRTAAVALGTTIAAMVPFFGDMNA 387

Query: 489 AVGALLVSFTVYIIPALAHMVTYR 418
            +GA       + +PA+ + VT++
Sbjct: 388 LIGAFGFLPLDFAVPAVFYNVTFK 411



>gb:AC105768_1738191 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1122_B08, complete sequence.
          Length = 456

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 2/119 (1%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVIG--MHD 589
           Y A+G+ +  N    +L        AA +++++H    +     P++ + E V+   +H 
Sbjct: 297 YHAFGNAVAPNV-LISLEKPRWLVAAANLMVVVHVIGAYQVYAMPVFDMIETVLAKKLHL 355

Query: 588 TKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTYRKA 412
              + LR  AR   V    F+ I FPFF  +    G    + T Y IP +  ++  + A
Sbjct: 356 RPGLPLRVTARSAYVALTMFIGITFPFFDGLLGFFGGFGFAPTTYFIPCIIWLIMRKPA 414



>gb:BC070857_2555826 Xenopus laevis hypothetical protein MGC84608,
           mRNA (cDNA clone MGC:84608 IMAGE:6641099), complete cds.
          Length = 479

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 30/99 (30%), Positives = 42/99 (42%), Gaps = 2/99 (2%)
 Frame = -1

Query: 711 LPQNGFRDAAVVLMLIHQFITFG--FACTPLYFVWEKVIGMHDTKSICLRALARLPVVIP 538
           LP   F  +  +L     FITF   F       V    + +HD    C+    R  +V  
Sbjct: 328 LPNCWFYQSVKLLYSFGIFITFALQFYVAAEIIVPTVTLHVHDRWVRCMDLTVRAALVCL 387

Query: 537 IWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTY 421
              LAI+ P  G + S VG++  S    IIP L  ++TY
Sbjct: 388 TCVLAILIPHLGLVISLVGSVSSSALALIIPPLLEILTY 426



>gb:AX085459_1460981 Sequence 4 from Patent WO0112801.
          Length = 452

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 2/116 (1%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVI 601
           P A   YW +G+ +  N     L         A + +++H   ++     P++ + E ++
Sbjct: 287 PVAFIGYWVFGNGVDDNI-LITLEKPTWLIAMANMFVVVHVIGSYQLYAMPVFDMMETLL 345

Query: 600 --GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
              ++   S  LR + R   V    F+ I FPFFG +    G L  + T Y +P +
Sbjct: 346 VKKLNFAPSFMLRFITRNVYVAFTMFVGICFPFFGGLLGFFGGLAFAPTTYFLPCI 401



>gb:AP003984_1835916 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1046_F07.>gb:AP005535_1853681 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0054K20.
          Length = 287

 Score = 37.7 bits (86), Expect = 0.25
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 2/126 (1%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNGFRD-AAVVLMLIHQFITFGFACTPLYFVWEKVIGMHDT 586
           Y  +GD+ LS       LP++ F    A+   +I+ F  +     PL    E++      
Sbjct: 137 YLMFGDKTLSQITLN--LPKHSFASKVALWTTVINPFTKYALLLNPLARSLEELRPEGFL 194

Query: 585 KSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHM-VTYRKAS 409
                  + R  +V     +A + PFFG + + +G+LL      I+PAL  + +   KA+
Sbjct: 195 NETICSIILRTALVASTVCIAFLMPFFGLVMALIGSLLSILVAVIMPALCFLKIRQNKAT 254

Query: 408 ARQNAA 391
             Q  A
Sbjct: 255 TAQVVA 260



>pir|T50687|T50687 proline transport protein 3 [imported] -
           tomato>gb:AF014810_1761361 Lycopersicon esculentum
           proline transporter 3 (LeProT3) mRNA, complete cds.
          Length = 442

 Score = 37.7 bits (86), Expect = 0.25
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 7/123 (5%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNG---FRDAAVVLMLIHQFITFGFACTPLYFVWEKVIGMH 592
           YWAYG    S+A+++ L   +G    +  A +   +   I      +P Y   +   G+ 
Sbjct: 279 YWAYG----SSASSYLLNNVSGPIWLKGMANIAAFLQSIIALHIFASPTYEFLDTKYGVT 334

Query: 591 DT----KSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVT 424
            +    K++  R + R   +    FL+ + PF G   +  GA+      +I+P   ++V 
Sbjct: 335 GSALACKNLAFRIIVRGGYIAITAFLSALLPFLGDFMNLAGAISTFPLTFILPNHMYIVA 394

Query: 423 YRK 415
            RK
Sbjct: 395 KRK 397



>gb:BT003903_1637029 Arabidopsis thaliana clone RAFL15-11-F15
           (R20652) putative amino acid permease (At4g35180) mRNA,
           complete cds.
          Length = 456

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 16/123 (13%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSN----ANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFV- 616
           P   A+YWAYGD++ +      N   L  Q   + AA     IH  +TF F+C   Y + 
Sbjct: 283 PLTFAVYWAYGDKIPATGGPVGNYLKLYTQEHSKRAA---CFIH--LTFIFSCLCSYPIN 337

Query: 615 ----WEKVIGMHDTK-----SICLRALARLPVVIPIWFLAIIFPFFGPINSAVG--ALLV 469
                + +  ++ TK     SI +R + R+ + +  + +A+ FPF   +   +G  ALLV
Sbjct: 338 LMPACDNIEMVYITKKKKPASIIVRMMLRVFLSLVCFTIAVGFPFLPYLAVLIGAIALLV 397

Query: 468 SFT 460
           +FT
Sbjct: 398 TFT 400



>gb:CEY32F6A_1369594 Caenorhabditis elegans YAC Y32F6A, complete
           sequence.
          Length = 519

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 28/118 (23%), Positives = 51/118 (43%)
 Frame = -1

Query: 783 IPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKV 604
           IP     Y  YGD L  +      +     + A  +++ +H  +T      PL    E++
Sbjct: 293 IPVCIMGYLVYGDSLRDSI--IPSIQTVWIQQAINIMITVHCILTLTIVFNPLMQEVEEL 350

Query: 603 IGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHM 430
             +        RA+ R  +++ + F+A   P FGP+   VG   ++ T  I+P L ++
Sbjct: 351 FHVPQRFGP-KRAIVRTGIMVAVVFVAESVPTFGPLLDLVGGSTLTLTSVIMPCLFYI 407



>gb:BX640435_812318 Bordetella parapertussis strain 12822, complete
           genome; segment 13/14.
          Length = 296

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 35/104 (33%), Positives = 52/104 (50%), Gaps = 3/104 (2%)
 Frame = -1

Query: 741 LLSNANAFALLPQNGFRDAAVVLML-IHQFITFGFACTPLYFVWEKVIGMHDTKSICLRA 565
           LLS  +A AL+P NG R  AVV  L +   +  G+A      VW  ++G+ D  +  L  
Sbjct: 196 LLSLGHALALIPANGMRAGAVVAALRLAVGLAAGYA-----VVW--LLGLPDLLAGALAL 248

Query: 564 LARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYII--PAL 439
              +P  +  +  A  +   G I  A GA+LVS  V+++  PAL
Sbjct: 249 QMAMPCAVVSYMYARRYTDVGDI--AAGAVLVSTVVFLLLAPAL 290



>gb:BX640411_804492 Bordetella pertussis strain Tohama I, complete
           genome; segment 1/12.>gb:BX640450_817204 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           14/16.
          Length = 297

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 35/104 (33%), Positives = 52/104 (50%), Gaps = 3/104 (2%)
 Frame = -1

Query: 741 LLSNANAFALLPQNGFRDAAVVLML-IHQFITFGFACTPLYFVWEKVIGMHDTKSICLRA 565
           LLS  +A AL+P NG R  AVV  L +   +  G+A      VW  ++G+ D  +  L  
Sbjct: 197 LLSLGHALALIPANGMRAGAVVAALRLAVGLAAGYA-----VVW--LLGLPDLLAGALAL 249

Query: 564 LARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYII--PAL 439
              +P  +  +  A  +   G I  A GA+LVS  V+++  PAL
Sbjct: 250 QMAMPCAVVSYMYARRYTDVGDI--AAGAVLVSTVVFLLLAPAL 291



>pir|T21000|T21000 hypothetical protein F15H10.4 - Caenorhabditis
           elegans
          Length = 890

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 28/118 (23%), Positives = 51/118 (43%)
 Frame = -1

Query: 783 IPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKV 604
           IP     Y  YGD L  +      +     + A  +++ +H  +T      PL    E++
Sbjct: 280 IPVCIMGYLVYGDSLRDSI--IPSIQTVWIQQAINIMITVHCILTLTIVFNPLMQEVEEL 337

Query: 603 IGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHM 430
             +        RA+ R  +++ + F+A   P FGP+   VG   ++ T  I+P L ++
Sbjct: 338 FHVPQRFGP-KRAIVRTGIMVAVVFVAESVPTFGPLLDLVGGSTLTLTSVIMPCLFYI 394



>pir|T04965|T04965 amino acid transport protein homolog T12J5.50 -
           Arabidopsis thaliana>gb:ATCHRIV82_1547479 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           82.>gb:ATT12J5_1554375 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12J5 (ESSAII project).
          Length = 473

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 37/123 (30%), Positives = 60/123 (48%), Gaps = 16/123 (13%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSN----ANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFV- 616
           P   A+YWAYGD++ +      N   L  Q   + AA     IH  +TF F+C   Y + 
Sbjct: 300 PLTFAVYWAYGDKIPATGGPVGNYLKLYTQEHSKRAA---CFIH--LTFIFSCLCSYPIN 354

Query: 615 ----WEKVIGMHDTK-----SICLRALARLPVVIPIWFLAIIFPFFGPINSAVG--ALLV 469
                + +  ++ TK     SI +R + R+ + +  + +A+ FPF   +   +G  ALLV
Sbjct: 355 LMPACDNIEMVYITKKKKPASIIVRMMLRVFLSLVCFTIAVGFPFLPYLAVLIGAIALLV 414

Query: 468 SFT 460
           +FT
Sbjct: 415 TFT 417



>gb:AC002294_1530161 Arabidopsis thaliana chromosome I BAC F11P17
           genomic sequence, complete sequence.
          Length = 418

 Score = 36.6 bits (83), Expect = 0.56
 Identities = 32/142 (22%), Positives = 57/142 (40%), Gaps = 2/142 (1%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVI 601
           P A   +W +G+ +  N       P+ G    A + ++IH   ++     P++ + E V+
Sbjct: 273 PVALVGFWTFGNNVEENILKTLRGPK-GLIIVANIFVIIHLMGSYQVYAMPVFDMIESVM 331

Query: 600 --GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMV 427
               H + +  LR   R   V     +A+  P F  + S  G  + + T Y IP +  ++
Sbjct: 332 IKKWHFSPTRVLRFTIRWTFVAATMGIAVALPHFSALLSFFGGFIFAPTTYFIPCIIWLI 391

Query: 426 TYRKASARQNAAEKPPFFLPSW 361
                       +KP  F  SW
Sbjct: 392 -----------LKKPKRFSLSW 402



>gb:BC077500_2560209 Xenopus laevis hypothetical protein LOC445866,
           mRNA (cDNA clone IMAGE:5047796), partial cds.
          Length = 510

 Score = 35.8 bits (81), Expect = 0.95
 Identities = 35/136 (25%), Positives = 59/136 (43%), Gaps = 8/136 (5%)
 Frame = -1

Query: 798 VFTLTIPSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPL-- 625
           V TL I  A   Y+ +GDQ+  +      LPQ+ +     +  L+    +FG   T    
Sbjct: 322 VTTLYISLATLGYFCFGDQIKGSITLN--LPQDSW-----LYQLVKILYSFGIYVTYAIQ 374

Query: 624 YFVWEKVI------GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSF 463
           Y+V  ++I       +  T+ +      R  +V     +A++ P    + S VGA+  S 
Sbjct: 375 YYVPAEIILPAVTSRVQKTRKLLCEFTMRFFLVCLTCAVAVLIPRLDLVISFVGAVSSST 434

Query: 462 TVYIIPALAHMVTYRK 415
              I+P L  ++TY K
Sbjct: 435 LALILPPLVEIITYHK 450



>gb:AY087539_1572569 Arabidopsis thaliana clone 36461 mRNA, complete
           sequence.
          Length = 456

 Score = 35.8 bits (81), Expect = 0.95
 Identities = 36/123 (29%), Positives = 59/123 (47%), Gaps = 16/123 (13%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSN----ANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFV- 616
           P    +YWAYGD++ +      N   L  Q   + AA     IH  +TF F+C   Y + 
Sbjct: 283 PLTFVVYWAYGDKIPATGGPVGNYLKLYTQEHSKRAA---CFIH--LTFIFSCLCSYPIN 337

Query: 615 ----WEKVIGMHDTK-----SICLRALARLPVVIPIWFLAIIFPFFGPINSAVG--ALLV 469
                + +  ++ TK     SI +R + R+ + +  + +A+ FPF   +   +G  ALLV
Sbjct: 338 LMPACDNIEMVYITKKKKPASIIVRMMLRVFLSLVCFTIAVGFPFLPYLAVLIGAIALLV 397

Query: 468 SFT 460
           +FT
Sbjct: 398 TFT 400



>gb:OSJN00004_1693140 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0014F04, complete sequence.
          Length = 110

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = -1

Query: 564 LARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVTYRK 415
           + R  +V+    +A+  PFFG + S VG+ L  F  YI+P    +   R+
Sbjct: 24  MLRSALVLSSLIVALSVPFFGLVMSLVGSFLTMFVAYILPCACFLAILRR 73



>gb:AY050801_1562308 Arabidopsis thaliana unknown protein
           (At2g39130) mRNA, complete cds.
          Length = 550

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 3/131 (2%)
 Frame = -1

Query: 798 VFTLTIPSAAAM-YWAYGDQLLSNANAFAL-LPQNGFRDA-AVVLMLIHQFITFGFACTP 628
           + TL     A M Y  +G+   S  + F L LPQ+      AV   +++ F  +    +P
Sbjct: 385 ICTLMYAGVAVMGYTMFGE---STQSQFTLNLPQDLIATKIAVWTTVVNPFTKYALTISP 441

Query: 627 LYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYII 448
           +    E++I     +S       R  +V     + +  PFFG + S +G+LL      I+
Sbjct: 442 VAMSLEELIPSRHIRSHWYAIGIRTLLVFSTLLVGLAIPFFGLVMSLIGSLLTMLVTLIL 501

Query: 447 PALAHMVTYRK 415
           P    +   R+
Sbjct: 502 PPACFLSIVRR 512



>pir|T50688|T50688 proline transport protein 2 [imported] -
           tomato>gb:AF014809_1761360 Lycopersicon esculentum
           proline transporter 2 (LeProT2) mRNA, complete cds.
          Length = 439

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 7/123 (5%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNG---FRDAAVVLMLIHQFITFGFACTPLYFVWEKVIGMH 592
           YWAYG    S ++++ L   +G    R  A +       IT     +P Y   +    + 
Sbjct: 276 YWAYG----SKSSSYLLYNVSGPVWLRGLANIAAFFQSIITLHIFASPTYEYLDTKYRIS 331

Query: 591 DT----KSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMVT 424
            +    +++  R + R   +    FL+ + PF G   S  GA+      +I+P   ++V 
Sbjct: 332 GSVLAFRNLSFRTVVRGGYLAITIFLSALLPFLGDFMSFTGAISTIPLTFILPNHMYIVA 391

Query: 423 YRK 415
            RK
Sbjct: 392 MRK 394



>gb:AY133550_1581373 Arabidopsis thaliana At5g40780/K1B16_3 mRNA,
           complete cds.>gb:AF367281_1791734 Arabidopsis thaliana
           AT5g40780/K1B16_3 mRNA, complete cds.
          Length = 446

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 26/123 (21%), Positives = 53/123 (43%), Gaps = 2/123 (1%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVI 601
           P A   Y+ +G+ +  N    +L         A + ++IH   ++     P++ + E ++
Sbjct: 281 PVALVGYYIFGNGVEDNI-LMSLKKPAWLIATANIFVVIHVIGSYQIYAMPVFDMMETLL 339

Query: 600 --GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMV 427
              ++   +  LR   R   V    F+ + FPFFG + +  G    + T Y +P +  + 
Sbjct: 340 VKKLNFRPTTTLRFFVRNFYVAATMFVGMTFPFFGGLLAFFGGFAFAPTTYFLPCVIWLA 399

Query: 426 TYR 418
            Y+
Sbjct: 400 IYK 402



>gb:ATU39782_1556966 Arabidopsis thaliana lysine and histidine
           specific transporter mRNA, complete cds.
          Length = 446

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 26/123 (21%), Positives = 53/123 (43%), Gaps = 2/123 (1%)
 Frame = -1

Query: 780 PSAAAMYWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVI 601
           P A   Y+ +G+ +  N    +L         A + ++IH   ++     P++ + E ++
Sbjct: 281 PVALVGYYIFGNGVEDNI-LMSLKKPAWLIATANIFVVIHVIGSYQIYAMPVFDMMETLL 339

Query: 600 --GMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMV 427
              ++   +  LR   R   V    F+ + FPFFG + +  G    + T Y +P +  + 
Sbjct: 340 VKKLNFRPTTTLRFFVRNFYVAATMFVGMTFPFFGGLLAFFGGFAFAPTTYFLPCVIWLA 399

Query: 426 TYR 418
            Y+
Sbjct: 400 IYK 402



>gb:AK117421_1815455 Arabidopsis thaliana At5g02180 mRNA for unknown
           protein, complete cds, clone: RAFL17-02-L16.
          Length = 550

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 2/122 (1%)
 Frame = -1

Query: 789 LTIPSAAAMYWAYGDQLLSNANAFAL-LPQNGFRD-AAVVLMLIHQFITFGFACTPLYFV 616
           L I  A   Y  +G+ + S    F L +P++ F    AV   +I     +    TP+   
Sbjct: 389 LYIAVAVCGYTMFGEAVESQ---FTLNMPKHFFPSKVAVWTAVITPMTKYALTITPIVMS 445

Query: 615 WEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALA 436
            E++I     +S  +  L R  +V     +A+  PFF  + + +G+ L      I P L 
Sbjct: 446 LEELIPTAKMRSRGVSILFRTMLVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLC 505

Query: 435 HM 430
           ++
Sbjct: 506 YL 507



>pir|T48239|T48239 hypothetical protein T7H20.230 - Arabidopsis
           thaliana>gb:ATT7H20_1556433 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T7H20 (ESSA project).
          Length = 543

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 2/122 (1%)
 Frame = -1

Query: 789 LTIPSAAAMYWAYGDQLLSNANAFAL-LPQNGFRD-AAVVLMLIHQFITFGFACTPLYFV 616
           L I  A   Y  +G+ + S    F L +P++ F    AV   +I     +    TP+   
Sbjct: 382 LYIAVAVCGYTMFGEAVESQ---FTLNMPKHFFPSKVAVWTAVITPMTKYALTITPIVMS 438

Query: 615 WEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALA 436
            E++I     +S  +  L R  +V     +A+  PFF  + + +G+ L      I P L 
Sbjct: 439 LEELIPTAKMRSRGVSILFRTMLVTSTLVVALSVPFFAIVAALIGSFLAMLVALIFPCLC 498

Query: 435 HM 430
           ++
Sbjct: 499 YL 500



>pir|C86378|C86378 protein F21J9.6 [imported] - Arabidopsis
           thaliana>gb:AE005172_891393 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AB046210_1520480 Arabidopsis thaliana AATL2
           mRNA for amino acid transporter-like protein 2, complete
           cds.>gb:AC000103_1529999 Genomic sequence for
           Arabidopsis thaliana BAC F21J9 from chromosome I,
           complete sequence.
          Length = 441

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 2/111 (1%)
 Frame = -1

Query: 684 AVVLMLIHQFITFGFACTPLYFVWEKVI--GMHDTKSICLRALARLPVVIPIWFLAIIFP 511
           A + ++IH   ++     P++ + E V+   M+   S  LR + R   V     +AI  P
Sbjct: 307 ANMFVVIHVIGSYQIFAMPVFDMLETVLVKKMNFNPSFKLRFITRSLYVAFTMIVAICVP 366

Query: 510 FFGPINSAVGALLVSFTVYIIPALAHMVTYRKASARQNAAEKPPFFLPSWT 358
           FFG +    G    + T Y +P +  +V            +KP  F  SWT
Sbjct: 367 FFGGLLGFFGGFAFAPTTYYLPCIMWLV-----------LKKPKRFGLSWT 406



>gb:AP003509_1830088 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0525F01.>gb:AP003569_1831003 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0425F05.
          Length = 413

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 29/135 (21%), Positives = 52/135 (38%), Gaps = 10/135 (7%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNGFRDA-AVVLMLIHQFITFGFACTPLYFVWEKVIGMHDT 586
           Y  YG  L S       LP      + A+   LI+ F  F    TP+    E V+G+   
Sbjct: 251 YLMYGGSLRSQVTLN--LPARKLSSSIAIYTTLINPFTKFALLITPIAEAIEGVLGLGTA 308

Query: 585 ---------KSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAH 433
                    ++  +    R  +V+    +A+  PFF  + +  G+ L +    ++P   +
Sbjct: 309 TTGGKPAQYRAAAVSVSVRTALVVSTTAVALAVPFFAYVVALTGSFLSATATMLLPCACY 368

Query: 432 MVTYRKASARQNAAE 388
           +    +AS +    E
Sbjct: 369 LRISSRASGKLGVLE 383



>gb:BT000792_1635063 Arabidopsis thaliana clone RAFL05-20-J01
           (R10342) unknown protein (At2g41190) mRNA, partial cds.
          Length = 407

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 1/109 (0%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNGF-RDAAVVLMLIHQFITFGFACTPLYFVWEKVIGMHDT 586
           Y  +G+  LS       +PQ+ F    A    ++  F  +     PL    E+++    +
Sbjct: 256 YLMFGEATLSQITLN--MPQDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERMS 313

Query: 585 KSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           ++I    L R  +V      A + PFFG + + +G+LL      I+PAL
Sbjct: 314 ENIWCFLLLRTALVASSVCSAFLIPFFGLMMALIGSLLSILVAIIMPAL 362



>gb:AC004261_1531619 Arabidopsis thaliana chromosome 2 clone T3K9
           map CIC11C08, complete sequence.>gb:AY039978_1560482
           Arabidopsis thaliana unknown protein (At2g41190) mRNA,
           complete cds.>gb:AY079364_1568254 Arabidopsis thaliana
           unknown protein (At2g41190) mRNA, complete cds.
          Length = 536

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 1/109 (0%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNGF-RDAAVVLMLIHQFITFGFACTPLYFVWEKVIGMHDT 586
           Y  +G+  LS       +PQ+ F    A    ++  F  +     PL    E+++    +
Sbjct: 385 YLMFGEATLSQITLN--MPQDQFFSKVAQWTTVVSPFTKYALLMNPLARSIEELLPERMS 442

Query: 585 KSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPAL 439
           ++I    L R  +V      A + PFFG + + +G+LL      I+PAL
Sbjct: 443 ENIWCFLLLRTALVASSVCSAFLIPFFGLMMALIGSLLSILVAIIMPAL 491



>gb:AB075902_1523339 Avicennia marina Bet/ProT1 mRNA for
           betaine/proline transporter, complete cds.
          Length = 446

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 27/120 (22%), Positives = 49/120 (40%), Gaps = 8/120 (6%)
 Frame = -1

Query: 762 YWAYGDQ----LLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVW----EK 607
           YWAYG +    LL+N +    L        A +   +   I+     +P+Y +W    E 
Sbjct: 283 YWAYGSKTTSYLLNNVHGPIWL-----MTVANIAAFLQSVISLHIFASPMYEIWIPDLES 337

Query: 606 VIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHMV 427
              +   +++  R + R   V    F++ + PF G   S  GA+      +I+    ++V
Sbjct: 338 KEVLWPIRNLSFRVVVRGGYVATTAFVSALLPFLGDFMSLTGAISTFPLTFILANHMYLV 397



>gb:AE013536_293187 Methanosarcina mazei strain Goe1, section 318 of
           379 of the complete genome.>gb:AE008384_967296
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 480

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = -1

Query: 597 MHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYII 448
           +++ K+  L  L+    V+P+  L I+   FGP  S V  LLV F +Y++
Sbjct: 420 LYNAKTFALYTLS----VVPLLMLNIVLSMFGPYYSLVDLLLVPFALYLL 465



>gb:AY542687_1612770 Vitis vinifera merlot proline-rich protein 2
           (MPRP2) gene, promoter region and complete cds; and
           merlot ripening induced protein 1 (mrip1) gene, promoter
           region.
          Length = 341

 Score = 21.6 bits (44), Expect(5) = 7.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 289 PPPESKPDD 315
           PPPE KP D
Sbjct: 247 PPPEQKPSD 255



 Score = 21.6 bits (44), Expect(5) = 7.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 289 PPPESKPDD 315
           PPPE KP D
Sbjct: 133 PPPEQKPSD 141



 Score = 21.2 bits (43), Expect(5) = 7.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 289 PPPESKPDD 315
           PPPE KP D
Sbjct: 285 PPPEHKPSD 293



 Score = 21.2 bits (43), Expect(5) = 7.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 289 PPPESKPDD 315
           PPPE KP D
Sbjct: 171 PPPEHKPSD 179



 Score = 20.4 bits (41), Expect(5) = 7.9
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +1

Query: 289 PPPESKPDD 315
           PPPE KP D
Sbjct: 209 PPPEQKPYD 217



>gb:AB025615_1516387 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K5K13.
          Length = 429

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 27/111 (24%), Positives = 43/111 (38%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIHQFITFGFACTPLYFVWEKVIGMHDTK 583
           Y  YG Q LS       + +   +  A+   L++    +    TP     +       +K
Sbjct: 254 YLMYGSQTLSQITLNLPIHKTSSK-VAIYTTLVNPVAKYALMITPTVNTIKDWFPSRYSK 312

Query: 582 SICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHM 430
              L  L     +I    +A   PFFG + S VGALL      ++P L ++
Sbjct: 313 KAYLHLLISTFFIISSVVIAETLPFFGYMMSLVGALLSVTVSILLPCLCYL 363



>gb:AY452060_618431 Metallosphaera sedula SoxM (soxM) gene, partial
           cds.
          Length = 643

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = -1

Query: 654 ITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINS 490
           I+ GFA     ++  ++IG HD     + AL+   +++P  F++II P FGPIN+
Sbjct: 81  ISTGFA----NYLVPRMIGAHDLYWPKINALS-FWILVPAVFMSIIAPLFGPINT 130



>pir|T50689|T50689 proline transport protein 1 [imported] -
           tomato>gb:AF014808_1761359 Lycopersicon esculentum
           proline transporter 1 (LeProT1) mRNA, complete cds.
          Length = 441

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 30/116 (25%), Positives = 48/116 (41%), Gaps = 10/116 (8%)
 Frame = -1

Query: 762 YWAYGDQLLSNANAFALLPQNGFRDAAVVLMLIH------QFITFGFACTPLYFVWEKVI 601
           YWAYG    S  +++ L   N     A VL + H        IT     +P Y   +   
Sbjct: 278 YWAYG----SVVSSYLL---NNVHGPAWVLGVAHLSAFFQAIITLHIFASPTYEYLDTKY 330

Query: 600 GMHDT----KSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIP 445
           G+  +    ++I  R + R   ++   FL+ + PF G   S  GA+      +I+P
Sbjct: 331 GVKGSALAPRNILFRLVVRGGYLVMTTFLSALLPFLGNFMSLTGAISTIPLTFILP 386


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 822,649,201
Number of Sequences: 1806583
Number of extensions: 17645718
Number of successful extensions: 46927
Number of sequences better than 10.0: 70
Number of HSP's better than 10.0 without gapping: 45360
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46870
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51696623407
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)