BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8738
         (833 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB022223_1515175 Arabidopsis thaliana genomic DNA, chromosome...   359   4e-98   
gb:AC120505_1739743 Oryza sativa chromosome 3 BAC OSJNBa0066H15 ...   354   1e-96   
gb:ATAC009325_1542880 Arabidopsis thaliana chromosome III BAC F4...   350   2e-95   
pir|G71410|G71410 probable protein kinase - Arabidopsis thaliana...   347   2e-94   Arabidopsis thaliana [mouse-ear cress]
gb:AP003855_1834345 Oryza sativa (japonica cultivar-group) genom...   343   2e-93   
gb:AB026650_1517245 Arabidopsis thaliana genomic DNA, chromosome...   343   2e-93   
gb:AC098571_1736752 Oryza sativa (japonica cultivar-group) chrom...   342   5e-93   
gb:AY085263_1570335 Arabidopsis thaliana clone 142106 mRNA, comp...   341   1e-92   
gb:AY224453_1590655 Oryza sativa (japonica cultivar-group) isola...   327   2e-88   
pir|T48115|T48115 protein kinase ATMRK1 (EC 2.7.1.-) [imported] ...   323   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb:AY086480_1571528 Arabidopsis thaliana clone 253505 mRNA, comp...   320   2e-86   
gb:AC087852_1734226 Oryza sativa chromosome 3 BAC OJ1124_H03 gen...   266   4e-70   
gb:AY738763_1626111 Carica papaya serine/threonine protein kinas...   182   5e-45   
gb:AY156510_1585390 Oryza sativa (japonica cultivar-group) serin...   172   7e-42   
gb:AY036609_1560054 Triticum aestivum serine/threonine protein k...   170   3e-41   
gb:AC006403_1534088 Arabidopsis thaliana chromosome 2 clone T28I...   167   2e-40   
pir|G84635|G84635 probable protein kinase [imported] - Arabidops...   167   2e-40   Arabidopsis thaliana [mouse-ear cress]
pir|T10671|T10671 protein kinase homolog F6E21.90 - Arabidopsis ...   167   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AY156511_1585391 Oryza sativa (japonica cultivar-group) serin...   166   7e-40   
gb:AP004744_1844236 Oryza sativa (japonica cultivar-group) genom...   163   4e-39   
gb:AY224431_1590633 Oryza sativa (japonica cultivar-group) isola...   163   4e-39   
gb:AB016885_1513121 Arabidopsis thaliana genomic DNA, chromosome...   162   7e-39   
gb:FSY298992_1679426 Fagus sylvatica partial mRNA for protein ki...   162   9e-39   
gb:AY206984_1589551 Oryza sativa (japonica cultivar-group) serin...   161   1e-38   
gb:AF462860_1801969 Arabidopsis thaliana AT5g58950/k19m22_150 mR...   160   2e-38   
gb:AY156512_1585392 Oryza sativa (japonica cultivar-group) serin...   159   8e-38   
gb:AE005173_893909 Arabidopsis thaliana chromosome 1, bottom arm...   157   2e-37   
pir|T01451|T01451 protein kinase homolog F24O1.13 - Arabidopsis ...   157   2e-37   Arabidopsis thaliana [mouse-ear cress]
pir|T12955|T12955 probable protein kinase (EC 2.7.1.-) T6H20.40 ...   157   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AP006548_1862367 Oryza sativa (japonica cultivar-group) genom...   156   4e-37   
pir|D84555|D84555 probable protein kinase [imported] - Arabidops...   155   7e-37   Arabidopsis thaliana [mouse-ear cress]
pir|S29851|S29851 protein kinase 6 (EC 2.7.1.-) - soybean>gb:SOY...   155   9e-37   Glycine max [soybeans]
gb:AP003076_1824632 Oryza sativa (japonica cultivar-group) genom...   155   1e-36   
gb:AP002845_1823134 Oryza sativa (japonica cultivar-group) genom...   154   2e-36   
gb:FSPKF1PRO_1679313 F.sylvatica mRNA for PKF1 protein.               154   2e-36   
gb:AP004078_1837343 Oryza sativa (japonica cultivar-group) genom...   153   3e-36   
gb:AY093017_1574971 Arabidopsis thaliana putative protein (At4g3...   153   3e-36   
gb:AP003685_1832011 Oryza sativa (japonica cultivar-group) genom...   152   6e-36   
pir|T04683|T04683 hypothetical protein F8D20.290 - Arabidopsis t...   151   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AP003573_1831084 Oryza sativa (japonica cultivar-group) genom...   149   6e-35   
gb:AY027437_1559041 Arachis hypogaea serine/threonine/tyrosine k...   147   2e-34   
gb:AC135502_1742480 Oryza sativa chromosome 3 BAC OSJNBb0085A04 ...   145   1e-33   
gb:AP004315_1840087 Oryza sativa (japonica cultivar-group) genom...   144   3e-33   
gb:AY653733_2371668 Mimivirus, complete genome.                       137   2e-31   
gb:AP003197_1824969 Oryza sativa (japonica cultivar-group) genom...   137   2e-31   
gb:AP004654_1842732 Oryza sativa (japonica cultivar-group) genom...   136   6e-31   
gb:AY653733_2371676 Mimivirus, complete genome.                       133   4e-30   
gb:OSJN00088_1694685 Oryza sativa genomic DNA, chromosome 4, BAC...   131   1e-29   
pir|T05675|T05675 hypothetical protein F20M13.30 - Arabidopsis t...   131   1e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T04688|T04688 hypothetical protein F4B14.50 - Arabidopsis th...   129   5e-29   Arabidopsis thaliana [mouse-ear cress]
gb:DDI297966_1376943 Dictyostelium discoideum mRNA for SHK1 prot...   129   7e-29   
gb:AY056257_1563575 Arabidopsis thaliana putative serine/threoni...   128   2e-28   
pir|T05137|T05137 protein kinase homolog F7H19.240 - Arabidopsis...   128   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AY099792_1576817 Arabidopsis thaliana MAP kinase, putative (A...   127   3e-28   
gb:AF265343_2483211 Danio rerio protein kinase Npk mRNA, complet...   126   4e-28   
gb:AP005797_1857950 Oryza sativa (japonica cultivar-group) genom...   126   4e-28   
pir|F86316|F86316 protein T10O22.13 [imported] - Arabidopsis tha...   126   6e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AB110951_1527048 Delphinium 'MagicFountains dark blue' EDR1 m...   125   1e-27   
gb:AY653733_2371681 Mimivirus, complete genome.                       124   2e-27   
pir|T08864|T08864 hypothetical protein A_TM017A05.2 - Arabidopsi...   124   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AC116989_1207576 Dictyostelium discoideum chromosome 2 map 45...   124   3e-27   
pir|T06576|T06576 probable protein kinase TCTR2 - tomato>gb:LEAJ...   124   3e-27   Solanum lycopersicum
gb:AY323913_1599368 Brassica juncea CTR1-like kinase kinase kina...   123   4e-27   
gb:AY140072_1582512 Arabidopsis thaliana protein kinase ATN1-lik...   123   4e-27   
gb:AY075641_1567782 Arabidopsis thaliana AT5g11850/F14F18_20 mRN...   123   4e-27   
gb:ATY14199_1557509 Arabidopsis thaliana mRNA for MAP3K delta-1 ...   123   4e-27   
pir|T52626|T52626 probable mitogen-activated protein kinase MAP3...   123   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AB049732_2046199 Mus musculus mRNA for MLTK-beta, complete cds.    123   5e-27   
gb:AB049731_2046198 Mus musculus mRNA for MLTK alpha, complete c...   123   5e-27   
gb:AF465843_1903498 Homo sapiens cervical cancer suppressor gene...   123   5e-27   
gb:AF238255_1892403 Homo sapiens mixed lineage kinase ZAK mRNA, ...   123   5e-27   
gb:AB049734_1867750 Homo sapiens mRNA for MLTK-beta, complete cd...   123   5e-27   
gb:AB049733_1867749 Homo sapiens mRNA for MLTK-alpha, complete cds.   123   5e-27   
gb:AB030034_1865937 Homo sapiens mlklak mRNA for plaucible mixed...   123   5e-27   
gb:AY099627_1576652 Arabidopsis thaliana putative protein kinase...   123   5e-27   
gb:CQ834626_1453979 Sequence 497 from Patent WO2004058805.>gb:AF...   123   5e-27   
gb:AK045444_1167417 Mus musculus adult male corpora quadrigemina...   123   5e-27   
pir|F96763|F96763 hypothetical protein F25P22.8 [imported] - Ara...   123   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY163574_1305768 Dictyostelium discoideum RGS-containing prot...   122   6e-27   
pir|T12956|T12956 hypothetical protein T6H20.50 - Arabidopsis th...   122   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY382677_1604093 Lycopersicon esculentum CTR1-like protein ki...   122   8e-27   
gb:AY032953_1559419 Rosa hybrid cultivar CTR1-like protein kinas...   122   8e-27   
gb:AB025626_1516491 Arabidopsis thaliana genomic DNA, chromosome...   122   8e-27   
gb:CQ834624_1453978 Sequence 495 from Patent WO2004058805.            122   8e-27   
pir|S61766|S61766 protein kinase ATN1 (EC 2.7.1.-) - Arabidopsis...   122   8e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AF305913_1784487 Arabidopsis thaliana EDR1 (EDR1) mRNA, compl...   122   1e-26   
gb:AY382676_1604092 Lycopersicon esculentum CTR1-like protein ki...   122   1e-26   
gb:AE005172_889877 Arabidopsis thaliana chromosome 1, top arm co...   122   1e-26   
pir|T00726|T00726 probable serine/threonine-specific protein kin...   122   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AF386508_1794704 Pyrus communis putative serine/threonine-spe...   121   1e-26   
gb:LES318955_1684578 Lycopersicon esculentum tctr2 gene, exons 1...   121   1e-26   
gb:AP005522_1853393 Oryza sativa (japonica cultivar-group) genom...   120   2e-26   
gb:AY059769_1564621 Arabidopsis thaliana putative protein kinase...   120   2e-26   
sp|Q05609|CTR1_ARATH|CTR1_ARATH Serine/threonine-protein kinase CTR1 (EC 2....   120   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:HVU495779_1682731 Hordeum vulgare partial mRNA for putative p...   120   3e-26   
gb:AY321500_1599131 Cucumis sativus protein kinase mRNA, complet...   120   3e-26   
gb:AP004777_1844923 Oryza sativa (japonica cultivar-group) genom...   120   4e-26   
gb:AC133007_1741305 Oryza sativa chromosome 3 BAC OSJNBa0094J08 ...   120   4e-26   
pir|T48206|T48206 protein kinase ATN1-like protein - Arabidopsis...   120   4e-26   Arabidopsis thaliana [mouse-ear cress]
sp|P83104|M3K7_DROME|M3K7_DROME Putative mitogen-activated protein kinase k...   120   4e-26   Drosophila melanogaster
gb:AB024031_1515752 Arabidopsis thaliana genomic DNA, chromosome...   119   7e-26   
pir|F86297|F86297 hypothetical protein F3O9.7 - Arabidopsis thal...   119   7e-26   Arabidopsis thaliana [mouse-ear cress]
gb:U01064_1401659 Dictyostelium discoideum AX2 protein tyrosine ...   118   1e-25   
gb:AE014296_1137022 Drosophila melanogaster chromosome 3L, compl...   118   1e-25   
pir|T18287|T18287 protein-tyrosine kinase (EC 2.7.1.112) - slime...   118   1e-25   Dictyostelium discoideum
gb:AP004057_1837030 Oryza sativa (japonica cultivar-group) genom...   118   2e-25   
gb:AC117072_1207665 Dictyostelium discoideum chromosome 2 map 38...   118   2e-25   
gb:S77473_2139484 VNK=nonreceptor protein-tyrosine kinase [mice,...   117   2e-25   
gb:AP005297_1850082 Oryza sativa (japonica cultivar-group) genom...   117   2e-25   
gb:AP005297_1850081 Oryza sativa (japonica cultivar-group) genom...   117   2e-25   
gb:AY738149_1626097 Zea mays salt-inducible protein kinase mRNA,...   117   2e-25   
gb:AY347832_1177991 Malus x domestica clone 17-4 protein kinase ...   117   3e-25   
gb:AF416233_1269265 Drosophila melanogaster mixed lineage kinase...   117   3e-25   
gb:AE014298_1124768 Drosophila melanogaster chromosome X, comple...   117   3e-25   
pir|B96827|B96827 hypothetical protein T8K14.1 [imported] - Arab...   117   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AB011482_1511484 Arabidopsis thaliana genomic DNA, chromosome...   116   5e-25   
gb:AB009052_1510657 Arabidopsis thaliana genomic DNA, chromosome...   116   5e-25   
gb:BC066441_2554331 Danio rerio zgc:77370, mRNA (cDNA clone MGC:...   116   6e-25   
gb:AP005558_1854032 Oryza sativa (japonica cultivar-group) genom...   116   6e-25   
gb:AC020580_1538529 Arabidopsis thaliana chromosome 3 BAC F5E6 g...   116   6e-25   
pir|T00486|T00486 serine/threonine-specific protein kinase homol...   116   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AP004079_1837370 Oryza sativa (japonica cultivar-group) genom...   115   8e-25   
gb:AP003019_1824229 Oryza sativa (japonica cultivar-group) genom...   115   8e-25   
gb:AF305912_1784486 Hordeum vulgare EDR1 (EDR1) mRNA, complete cds.   115   8e-25   
gb:AF305911_1784485 Oryza sativa EDR1 (EDR1) mRNA, partial cds.       115   8e-25   
gb:AC084380_1733543 Oryza sativa chromosome 3 BAC OSJNBa0090P23 ...   115   8e-25   
gb:AY167575_1586291 Oryza sativa (japonica cultivar-group) EDR1 ...   115   8e-25   
gb:AB100686_1526266 Delphinium 'MagicFountains dark blue' CTR1 m...   115   8e-25   
gb:DDIDPYK1A_1377077 D.discoideum protein-tyrosine kinase-1 (DPY...   115   8e-25   
sp|P18160|KYK1_DICDI|KYK1_DICDI Non-receptor tyrosine kinase spore lysis A ...   115   8e-25   Dictyostelium discoideum
gb:AP004008_1836269 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP003264_1826694 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
pir|B35670|B35670 protein-tyrosine kinase (EC 2.7.1.112) 2 - sli...   115   1e-24   Dictyostelium discoideum
pir|T48544|T48544 MAP3K delta-1 protein kinase - Arabidopsis tha...   115   1e-24   Arabidopsis thaliana [mouse-ear cress]
sp|P18161|KYK2_DICDI|KYK2_DICDI Tyrosine-protein kinase 2 (EC 2.7.1.112) (F...   115   1e-24   Dictyostelium discoideum
gb:BC050050_1984251 Homo sapiens mitogen-activated protein kinas...   114   2e-24   
gb:AF283474S2_1894670 Homo sapiens zipper protein kinase (MAP3K1...   114   2e-24   
gb:AC036106_1539978 Arabidopsis thaliana chromosome 3 BAC T8E24 ...   114   2e-24   
gb:AC020580_1538527 Arabidopsis thaliana chromosome 3 BAC F5E6 g...   114   2e-24   
gb:CR858343_1182524 Pongo pygmaeus mRNA; cDNA DKFZp459K2433 (fro...   114   2e-24   
gb:AK029882_1161701 Mus musculus adult male testis cDNA, RIKEN f...   114   2e-24   
pir|JC2363|JC2363 protein kinase (EC 2.7.1.37) ZPK - human            114   2e-24   Homo sapiens [man]
sp|P41243|MATK_RAT|MATK_RAT Megakaryocyte-associated tyrosine-protein kin...   114   2e-24   Rattus norvegicus [brown rat]
sp|Q60700|M3KC_MOUSE|M3KC_MOUSE Mitogen-activated protein kinase kinase kin...   114   2e-24   Mus musculus [mouse]
sp|Q12852|M3KC_HUMAN|M3KC_HUMAN Mitogen-activated protein kinase kinase kin...   114   2e-24   Homo sapiens [man]
gb:MUSCTK_2125597 Mouse mRNA for ctk, complete cds.                   114   2e-24   
gb:MMU23789_2119365 Mus musculus zipper protein kinase (ZPK) mRN...   114   2e-24   
gb:MMHYLTK_2115419 M.musculus HYLTK gene.                             114   2e-24   
gb:AK034374_1163734 Mus musculus adult male diencephalon cDNA, R...   114   2e-24   
gb:AK013606_1157580 Mus musculus adult male hippocampus cDNA, RI...   114   2e-24   
pir|S52076|S49313 protein kinase - slime mold (Dictyostelium dis...   114   2e-24   
pir|I48926|I48926 protein-tyrosine kinase (EC 2.7.1.112) Ctk - m...   114   2e-24   Mus musculus [mouse]
pir|I59296|I59296 protein-tyrosine kinase (EC 2.7.1.112), megako...   114   2e-24   Mus musculus [mouse]
sp|P41242|MATK_MOUSE|MATK_MOUSE Megakaryocyte-associated tyrosine-protein k...   114   2e-24   Mus musculus [mouse]
pir|JC5399|JC5399 dual leucine zipper kinase (EC 2.7.-.-) - rat       114   3e-24   Rattus norvegicus [brown rat]
pir|T09911|T09911 probable serine/threonine-specific protein kin...   114   3e-24   Arabidopsis thaliana [mouse-ear cress]
sp|Q63796|M3KC_RAT|M3KC_RAT Mitogen-activated protein kinase kinase kinas...   114   3e-24   Rattus norvegicus [brown rat]
gb:AY119549_1301118 Drosophila melanogaster GH26507 full insert ...   113   4e-24   
gb:AC020580_1538528 Arabidopsis thaliana chromosome 3 BAC F5E6 g...   113   5e-24   
gb:AK176081_1818069 Arabidopsis thaliana mRNA for protein kinase...   112   7e-24   
gb:AB018119_1513893 Arabidopsis thaliana genomic DNA, chromosome...   112   7e-24   
gb:BC081976_2108214 Rattus norvegicus cDNA clone MGC:94134 IMAGE...   112   9e-24   
gb:AB001872_1863573 Homo sapiens mRNA for leucine zipper bearing...   112   9e-24   
gb:AK084850_1174343 Mus musculus 13 days embryo lung cDNA, RIKEN...   112   9e-24   
pir|JC1450|JC1450 fibroblast growth factor receptor 4 - rat>gb:R...   112   9e-24   Rattus sp. [rats]
gb:BC033313_2097437 Mus musculus fibroblast growth factor recept...   112   1e-23   
gb:AP005613_1854944 Oryza sativa (japonica cultivar-group) genom...   112   1e-23   
gb:AY029067_1559204 Rosa hybrid cultivar CTR2 protein kinase mRN...   112   1e-23   
pir|F96701|F96701 hypothetical protein T23K23.26 [imported] - Ar...   112   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb:HSFGFR4G_2013214 Homo sapiens FGFR-4 gene.                         111   1e-23   
gb:AF487555_1904814 Homo sapiens fibroblast growth factor recept...   111   1e-23   
gb:AF359246_1898884 Homo sapiens fibroblast growth factor recept...   111   1e-23   
gb:AF202063_1889830 Homo sapiens fibroblast growth factor recept...   111   1e-23   
gb:A27171_1448223 Tyrosine kinase receptor gene.                      111   1e-23   
pir|S15345|TVHUF4 fibroblast growth factor receptor 4 precursor ...   111   1e-23   
sp|P22455|FGR4_HUMAN|FGR4_HUMAN Fibroblast growth factor receptor 4 precurs...   111   1e-23   Homo sapiens [man]
gb:AF110519_1768823 Lycopersicon esculentum ethylene-inducible C...   111   2e-23   
gb:AF110518_1768822 Lycopersicon esculentum ethylene-inducible C...   111   2e-23   
gb:CR859621_1183728 Pongo pygmaeus mRNA; cDNA DKFZp459C184 (from...   111   2e-23   
pir|T46150|T46150 protein kinase ATN1-like protein - Arabidopsis...   111   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb:MMU76762_2123442 Mus musculus fps/fes-related tyrosine kinase...   110   3e-23   
gb:BC058100_2103032 Mus musculus fer (fms/fps related) protein k...   110   3e-23   
gb:BC051249_2100695 Mus musculus fer (fms/fps related) protein k...   110   3e-23   
gb:AY526095_2085955 Mus musculus cardiac ankyrin repeat kinase i...   110   3e-23   
gb:AF187884_1415790 Canis familiaris protein tyrosine kinase fer...   110   3e-23   
gb:AB006566_1193036 Ephydatia fluviatilis EfPTK62 mRNA for prote...   110   3e-23   
gb:AK082799_1173677 Mus musculus ES cells cDNA, RIKEN full-lengt...   110   3e-23   
pir|S04328|S04328 protein-tyrosine kinase (EC 2.7.1.112) flk - r...   110   3e-23   Rattus norvegicus [brown rat]
sp|P09760|FLK_RAT|FLK_RAT Tyrosine-protein kinase FLK (EC 2.7.1.112) (Fr...   110   3e-23   Rattus norvegicus [brown rat]
gb:BT019655_1991169 Homo sapiens mitogen-activated protein kinas...   110   3e-23   
gb:AY743662_1626536 Triticum aestivum EDR1 (EDR1) mRNA, partial ...   110   3e-23   
gb:AY232270_1311379 Dictyostelium discoideum putative protein Ro...   110   3e-23   
gb:BC078445_2106828 Mus musculus mitogen activated protein kinas...   110   4e-23   
gb:HSMSTMR_2018915 H.sapiens MST mRNA for serine/threonine kinase.    110   4e-23   
gb:AP005419_1851497 Oryza sativa (japonica cultivar-group) genom...   110   4e-23   
pir|T07406|T07406 probable protein kinase - tomato>gb:AY079048_1...   110   4e-23   Solanum lycopersicum
sp|Q02779|M3KA_HUMAN|M3KA_HUMAN Mitogen-activated protein kinase kinase kin...   110   4e-23   Homo sapiens [man]
gb:AB025535_2461107 Eptatretus burgeri mRNA for FGFR3/4b, partia...   109   6e-23   
sp|P16591|FER_HUMAN|FER_HUMAN Proto-oncogene tyrosine-protein kinase FER (...   109   6e-23   Homo sapiens [man]
gb:BX119992_2567065 Zebrafish DNA sequence from clone CH211-225H...   109   7e-23   
gb:AB065372_2463044 Gallus gallus mRNA for vascular endothelial ...   109   7e-23   
pir|S18209|S18209 fibroblast growth factor receptor 4 precursor ...   109   7e-23   Mus musculus [mouse]
sp|Q03142|FGR4_MOUSE|FGR4_MOUSE Fibroblast growth factor receptor 4 precurs...   109   7e-23   Mus musculus [mouse]
gb:AY335653_2144871 Synthetic construct Homo sapiens megakaryocy...   108   1e-22   
gb:AY075653_1567792 Arabidopsis thaliana At1g14000/F7A19_9 mRNA,...   108   1e-22   
gb:AC068197_1540360 Genomic sequence for Arabidopsis thaliana BA...   108   1e-22   
gb:HSM802388_1186692 Homo sapiens mRNA; cDNA DKFZp434N1212 (from...   108   1e-22   
pir|C86273|C86273 protein kinases homolog F7A19.9 - Arabidopsis ...   108   1e-22   Arabidopsis thaliana [mouse-ear cress]
sp|P42679|MATK_HUMAN|MATK_HUMAN Megakaryocyte-associated tyrosine-protein k...   108   1e-22   Homo sapiens [man]
gb:BT019653_2151472 Synthetic construct Homo sapiens mitogen-act...   108   1e-22   
gb:AY335698_2144916 Synthetic construct Homo sapiens mitogen-act...   108   1e-22   
gb:BC006665_2090293 Mus musculus mitogen activated protein kinas...   108   1e-22   
gb:BT019654_1991168 Homo sapiens mitogen-activated protein kinas...   108   1e-22   
gb:AF218074_1890646 Homo sapiens TGF beta-activated kinase splic...   108   1e-22   
gb:AB009358_1864123 Homo sapiens mRNA for TGF-beta activated kin...   108   1e-22   
gb:AY349915_1322030 Drosophila simulans strain Sim7 Tak1 gene, p...   108   1e-22   
gb:AY349910_1322025 Drosophila simulans strain Sim2 Tak1 gene, p...   108   1e-22   
gb:AY349909_1322024 Drosophila simulans strain Sim1 Tak1 gene, p...   108   1e-22   
gb:AF200688_1250239 Dictyostelium discoideum tyrosine kinase ZAK...   108   1e-22   
gb:AC116979_1207093 Dictyostelium discoideum chromosome 2 map 64...   108   1e-22   
gb:CR857142_1181392 Pongo pygmaeus mRNA; cDNA DKFZp469K1121 (fro...   108   1e-22   
gb:AE014298_1126609 Drosophila melanogaster chromosome X, comple...   108   1e-22   
pir|JC5955|JC5955 transforming growth factor-beta activated kina...   108   1e-22   Homo sapiens [man]
pir|JC5957|JC5957 transforming growth factor-beta activated kina...   108   1e-22   Homo sapiens [man]
sp|Q62073|M3K7_MOUSE|M3K7_MOUSE Mitogen-activated protein kinase kinase kin...   108   1e-22   Mus musculus [mouse]
sp|O43318|M3K7_HUMAN|M3K7_HUMAN Mitogen-activated protein kinase kinase kin...   108   1e-22   Homo sapiens [man]
gb:AY335606_2144824 Synthetic construct Homo sapiens mitogen-act...   108   2e-22   
gb:BC081952_2108191 Rattus norvegicus cDNA clone MGC:94039 IMAGE...   108   2e-22   
gb:BC047152_2099469 Mus musculus mitogen activated protein kinas...   108   2e-22   
gb:AF155142_2056858 Mus musculus mixed lineage kinase 3 (Mlk3) a...   108   2e-22   
gb:S71669_2041213 lsk=leukocyte carboxyl-terminal src kinase rel...   108   2e-22   
gb:BC064543_1986544 Homo sapiens mitogen-activated protein kinas...   108   2e-22   
pir|A39752|A39752 fibroblast growth factor receptor A1 precursor...   108   2e-22   Xenopus laevis [clawed frog]
pir|A53800|A53800 mixed-lineage protein kinase (EC 2.7.1.-) 3 - ...   108   2e-22   Homo sapiens [man]
sp|P22182|FGR1_XENLA|FGR1_XENLA Fibroblast growth factor receptor 1 precurs...   108   2e-22   Xenopus laevis [clawed frog]
gb:PWFGFR3_2578609 P.waltlii mRNA for fibroblast growth factor r...   107   2e-22   
gb:AY303692_2081904 Rattus norvegicus cardiac ankyrin repeat kin...   107   2e-22   
gb:HUMFGFLR_2031105 Human novel growth factor receptor mRNA, 3' ...   107   2e-22   
gb:AL138712_1919781 Human DNA sequence from clone RP11-502P18 on...   107   2e-22   
gb:AF487554_1904813 Homo sapiens fibroblast growth factor recept...   107   2e-22   
gb:AF487554_1904812 Homo sapiens fibroblast growth factor recept...   107   2e-22   
gb:AF245114_1892639 Homo sapiens fibroblast growth factor recept...   107   2e-22   
gb:AF063657_1880236 Homo sapiens vascular endothelial growth fac...   107   2e-22   
pir|I49663|I49663 tyrosine kinase (ferT) - mouse>gb:MUSFERT_2125...   107   2e-22   Mus musculus [mouse]
pir|S38579|S38579 fibroblast growth factor receptor 3 - Iberian ...   107   2e-22   Pleurodeles waltl [Spanish newt]
sp|P17948|VGR1_HUMAN|VGR1_HUMAN Vascular endothelial growth factor receptor...   107   2e-22   Homo sapiens [man]
sp|P22607|FGR3_HUMAN|FGR3_HUMAN Fibroblast growth factor receptor 3 precurs...   107   2e-22   Homo sapiens [man]
sp|P18460|CEK2_CHICK|CEK2_CHICK Tyrosine kinase receptor CEK2 precursor (EC...   107   2e-22   Gallus gallus [bantam]
gb:AC091727_2467647 Takifugu rubripes clone 250A8, complete sequ...   107   3e-22   
gb:AF116826_1884597 Homo sapiens clone HH498 putative protein-ty...   107   3e-22   
gb:AY139976_1582418 Arabidopsis thaliana unknown protein mRNA, c...   107   3e-22   
gb:AY049228_1561872 Arabidopsis thaliana AT3g58640/F14P22_230 mR...   107   3e-22   
gb:AY737276_1433582 Ovis aries fibroblast growth factor receptor...   107   3e-22   
gb:AB059430_1408739 Bos taurus fgfr3 mRNA for fibroblast growth ...   107   3e-22   
gb:AE017192_1054010 Tetraodon nigroviridis target 1 genomic scaf...   107   3e-22   
pir|T45684|T45684 hypothetical protein F14P22.230 - Arabidopsis ...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
pir|H86179|H86179 hypothetical protein [imported] - Arabidopsis ...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
pir|T30811|T30811 hepatocyte growth factor receptor - Fugu rubri...   107   3e-22   Takifugu rubripes [tiger puffer]
gb:BC077258_2559974 Xenopus laevis TAK1, mRNA (cDNA clone MGC:79...   107   4e-22   
gb:BC049005_2550079 Xenopus laevis similar to mitogen-activated ...   107   4e-22   
gb:BC021891_2093691 Mus musculus cDNA sequence BC021891, mRNA (c...   107   4e-22   
gb:AL133380_1918443 Human DNA sequence from clone RP5-862P8 on c...   107   4e-22   
gb:AL133380_1918442 Human DNA sequence from clone RP5-862P8 on c...   107   4e-22   
gb:T10F20_1723319 Sequence of BAC T10F20 from Arabidopsis thalia...   107   4e-22   
sp|P80192|M3K9_HUMAN|M3K9_HUMAN Mitogen-activated protein kinase kinase kin...   107   4e-22   Homo sapiens [man]
gb:AY327900_1943984 Homo sapiens mixed-lineage protein kinase 1 ...   106   5e-22   
gb:AF251442_1893025 Homo sapiens mixed lineage kinase MLK1 mRNA,...   106   5e-22   
gb:AK053843_1170600 Mus musculus 0 day neonate eyeball cDNA, RIK...   106   5e-22   
pir|A49120|A49120 fibroblast growth factor receptor homolog DFR1...   106   5e-22   Drosophila melanogaster
pir|A41345|TVCHFG fibroblast growth factor receptor 1 precursor ...   106   5e-22   
sp|P21804|FGR1_CHICK|FGR1_CHICK Basic fibroblast growth factor receptor 1 p...   106   5e-22   Gallus gallus [bantam]
gb:NVI1FGFR_2576619 Notophtalmus viridescens fibroblast growth f...   106   6e-22   
gb:AY352259_1322403 Drosophila yakuba Tak1 gene, partial cds.         106   6e-22   
gb:AE014297_1140109 Drosophila melanogaster chromosome 3R, compl...   106   6e-22   
pir|JC4583|JC4583 fibroblast growth factor receptor 4B precursor...   106   6e-22   Xenopus laevis [clawed frog]
pir|I51023|I51023 fibroblast growth factor receptor 1 - eastern ...   106   6e-22   Notophthalmus viridescens [red-spotted newt]
sp|Q07407|FGR1_DROME|FGR1_DROME Fibroblast growth factor receptor homolog 1...   106   6e-22   Drosophila melanogaster
gb:XLU77681_2583527 Xenopus laevis tyrosine kinase receptor mRNA...   105   8e-22   
gb:PWFGFR_2578607 P.waltlii mRNA for fibroblast growth factor re...   105   8e-22   
gb:AY056151_1563482 Arabidopsis thaliana unknown protein (At2g40...   105   8e-22   
pir|A49151|A49151 fibroblast growth factor receptor 1 - Iberian ...   105   8e-22   
gb:GGRNACMET_2573387 G.gallus mRNA for c-met.                         105   1e-21   
gb:DRU23839_2571266 Danio rerio fibroblast growth factor recepto...   105   1e-21   
gb:BC077761_2560415 Xenopus laevis FGF receptor 4a, mRNA (cDNA c...   105   1e-21   
gb:AF510499_2498610 Xenopus laevis mixed lineage kinase 2 (mlk2)...   105   1e-21   
gb:AF288453_2484996 Xenopus laevis fibroblast growth factor rece...   105   1e-21   
gb:AB007037_2460438 Xenopus laevis mRNA for FGF receptor 4b, com...   105   1e-21   
gb:AB007036_2460437 Xenopus laevis mRNA for FGF receptor 4a, com...   105   1e-21   
gb:D88689_2112653 Mus musculus mRNA for flt-1, complete cds.          105   1e-21   
gb:AF176552_2057851 Mus musculus fibroblast growth factor recept...   105   1e-21   
gb:AE017184_1053942 Gallus gallus target 1 genomic scaffold.          105   1e-21   
pir|JC4058|JC4058 fibroblast growth factor receptor-4 precursor ...   105   1e-21   
pir|B49151|B49151 fibroblast growth factor receptor 4 - Iberian ...   105   1e-21   
pir|S19947|S19947 fibroblast growth factor receptor - Iberian ri...   105   1e-21   
pir|JC5148|JC5148 hepatocyte growth factor receptor precursor - ...   105   1e-21   
sp|P53767|VGR1_RAT|VGR1_RAT Vascular endothelial growth factor receptor 1...   105   1e-21   
sp|P35969|VGR1_MOUSE|VGR1_MOUSE Vascular endothelial growth factor receptor...   105   1e-21   
gb:XELXFGFRA2_2582283 Xenopus laevis fibroblast growth factor re...   105   1e-21   
gb:AF024638_2051266 Mus musculus fibroblast growth factor recept...   105   1e-21   
gb:HSA311798_2003901 Homo sapiens mRNA for mixed lineage kinase ...   105   1e-21   
gb:HSA311797_2003900 Homo sapiens mRNA for mixed lineage kinase ...   105   1e-21   
gb:AY233383_1939912 Homo sapiens VEGFR3 long form mRNA, complete...   105   1e-21   
gb:AY233382_1939911 Homo sapiens VEGFR3 short form mRNA, complet...   105   1e-21   
gb:AP004339_1840446 Oryza sativa (japonica cultivar-group) genom...   105   1e-21   
gb:AJ585374_1282434 Dictyostelium discoideum phg2 mRNA for Phago...   105   1e-21   
gb:AB025537_1194310 Branchiostoma belcheri mRNA for FGFR, partia...   105   1e-21   
pir|A48991|A48991 heparin-binding growth factor receptor - mouse...   105   1e-21   
pir|A60350|TVHU2F fibroblast growth factor receptor flg-2 precur...   105   1e-21   
gb:XLFGFREC4_2582790 X.laevis mRNA for FGF receptor 4.                104   2e-21   
gb:AE016959_1022714 Oryza sativa (japonica cultivar-group) chrom...   104   2e-21   
pir|JC4860|JC4860 protein-tyrosine kinase (EC 2.7.1.112) recepto...   104   2e-21   
sp|P18461|CEK3_CHICK|CEK3_CHICK Tyrosine kinase receptor CEK3 precursor (EC...   104   2e-21   
gb:AF157560_2477672 Danio rerio fibroblast growth factor recepto...   104   2e-21   
gb:AB007035_2460436 Xenopus laevis mRNA for FGF receptor 3, comp...   104   2e-21   
gb:RRFIBGFC_2138139 R.rattus mRNA for fibroblast growth factor r...   104   2e-21   
gb:RATHBFGFRF_2132450 Rattus norvegicus (clone R2(CT1)) heparin-...   104   2e-21   
gb:AF277717_2061272 Rattus norvegicus fibroblast growth factor r...   104   2e-21   
gb:HUMTK14_2037778 Human fibroblast growth factor receptor mRNA,...   104   2e-21   
gb:HUMKSAMIII_2033946 Human secreted fibroblast growth factor re...   104   2e-21   
gb:HSU19348_2022660 Human (tpr-met fusion) oncogene mRNA, comple...   104   2e-21   
gb:HSU08818_2021906 Human activated met oncogene mRNA, partial cds.   104   2e-21   
gb:HSFGFR2A18_2013207 Homo sapiens fibroblast growth factor rece...   104   2e-21   
gb:HSFGFR2A18_2013206 Homo sapiens fibroblast growth factor rece...   104   2e-21   
gb:BC039243_1982514 Homo sapiens fibroblast growth factor recept...   104   2e-21   
gb:AF410480S2_1901297 Homo sapiens keratinocyte growth factor re...   104   2e-21   
gb:AF410480S2_1901296 Homo sapiens keratinocyte growth factor re...   104   2e-21   
gb:AF410480S2_1901295 Homo sapiens keratinocyte growth factor re...   104   2e-21   
gb:AF410480S2_1901294 Homo sapiens keratinocyte growth factor re...   104   2e-21   
gb:AB084153_1871956 Homo sapiens mRNA for isoform of FGFR2, comp...   104   2e-21   
gb:AY058189_1564324 Arabidopsis thaliana AT4g18950/F13C5_120 mRN...   104   2e-21   
gb:CQ812540_1453467 Sequence 13 from Patent WO2004039837.>gb:MUS...   104   2e-21   
gb:AF211257_1416169 Canis familiaris fibroblast growth factor re...   104   2e-21   
gb:AF184968_1415635 Oryctolagus cuniculus fibroblast growth fact...   104   2e-21   
gb:CR857280_1181524 Pongo pygmaeus mRNA; cDNA DKFZp469H1521 (fro...   104   2e-21   
gb:AE017185_1053947 Pan troglodytes target 1 genomic scaffold.        104   2e-21   
gb:AE017182_1053921 Papio anubis target 1 genomic scaffold.           104   2e-21   
pir|I65223|I65223 heparin-binding fibroblast growth factor recep...   104   2e-21   
pir|S17295|S17295 fibroblast growth factor receptor - mouse>gb:M...   104   2e-21   
pir|A45081|A45081 fibroblast growth factor receptor 2 IIIb, FGFR...   104   2e-21   
pir|S16236|S16236 fibroblast growth factor receptor precursor - ...   104   2e-21   
pir|S24108|S24108 protein-tyrosine kinase (EC 2.7.1.112) bek - c...   104   2e-21   
pir|S51635|S51635 fibroblast growth factor receptor 2b, keratino...   104   2e-21   
pir|A54846|A54846 fibroblast growth factor receptor a precursor ...   104   2e-21   
pir|B54846|B54846 fibroblast growth factor receptor b precursor ...   104   2e-21   
pir|A38429|A38429 keratinocyte growth factor receptor precursor ...   104   2e-21   
pir|A44142|TVMSBK fibroblast growth factor receptor bek precurso...   104   2e-21   
sp|P08581|MET_HUMAN|MET_HUMAN Hepatocyte growth factor receptor precursor ...   104   2e-21   
sp|P21803|FGR2_MOUSE|FGR2_MOUSE Fibroblast growth factor receptor 2 precurs...   104   2e-21   
sp|P21802|FGR2_HUMAN|FGR2_HUMAN Fibroblast growth factor receptor 2 precurs...   104   2e-21   
gb:BC073428_2557268 Xenopus laevis cDNA clone MGC:80912 IMAGE:55...   103   3e-21   
gb:RNU65007_2137580 Rattus norvegicus hepatocyte growth factor r...   103   3e-21   
gb:HSFLT4_2013257 H.sapiens mRNA for FLT4, class III receptor ty...   103   3e-21   
gb:AY547497_1612996 Nicotiana benthamiana CTR1 mRNA, partial cds.     103   3e-21   
gb:AX671078_1473007 Sequence 33 from Patent WO03004529.>gb:HSFLT...   103   3e-21   
gb:DROFGFR1_1382015 Drosophila melanogaster mRNA for fibroblast ...   103   3e-21   
gb:CEF33E2_1363336 Caenorhabditis elegans cosmid F33E2, complete...   103   3e-21   
gb:CEC49G9_1361439 Caenorhabditis elegans cosmid C49G9, complete...   103   3e-21   
gb:CEC49G9_1361438 Caenorhabditis elegans cosmid C49G9, complete...   103   3e-21   
gb:BT011103_1357710 Drosophila melanogaster LP09923 full insert ...   103   3e-21   
gb:AE014297_1139042 Drosophila melanogaster chromosome 3R, compl...   103   3e-21   
gb:AE014297_1139041 Drosophila melanogaster chromosome 3R, compl...   103   3e-21   
gb:AE017191_1053994 Rattus norvegicus target 1 genomic scaffold.      103   3e-21   
gb:AE017190_1053986 Sus scrofa target 1 genomic scaffold.             103   3e-21   
gb:AE017189_1053976 Mus musculus target 1 genomic scaffold.           103   3e-21   
gb:AE017187_1053967 Canis familiaris target 1 genomic scaffold.>...   103   3e-21   
gb:AE017183_1053931 Felis catus target 1 genomic scaffold.            103   3e-21   
pir|T20082|T20082 hypothetical protein F33E2.2 - Caenorhabditis ...   103   3e-21   
pir|B87950|B87950 protein F33E2.2 [imported] - Caenorhabditis el...   103   3e-21   
pir|A35969|A35969 heparin-binding growth factor receptor K-sam p...   103   3e-21   
pir|T30813|T30813 plasminogen related growth factor receptor 2 -...   103   3e-21   
sp|P35916|VGR3_HUMAN|VGR3_HUMAN Vascular endothelial growth factor receptor...   103   3e-21   
sp|P42687|SPK1_DUGTI|SPK1_DUGTI Tyrosine-protein kinase SPK-1 (EC 2.7.1.112...   103   3e-21   
sp|P97523|MET_RAT|MET_RAT Hepatocyte growth factor receptor precursor (E...   103   3e-21   
sp|P16056|MET_MOUSE|MET_MOUSE Hepatocyte growth factor receptor precursor ...   103   3e-21   
sp|Q61851|FGR3_MOUSE|FGR3_MOUSE Fibroblast growth factor receptor 3 precurs...   103   3e-21   
gb:MUSFGFR_2125868 Mouse FGF receptor mRNA, complete cds.             103   4e-21   
gb:MMFGF_2114910 Mouse fms-like gene (mflg) mRNA for fibroblast ...   103   4e-21   
gb:BC033447_2097471 Mus musculus fibroblast growth factor recept...   103   4e-21   
gb:BC010200_2090885 Mus musculus fibroblast growth factor recept...   103   4e-21   
gb:HUMHBGFA_2031831 Human heparin-binding growth factor receptor...   103   4e-21   
gb:HUMFGF3H_2031096 Human fibroblast growth factor receptor (FGF...   103   4e-21   
gb:HUMFGF1A_2031088 Human fibroblast growth factor (FGF) recepto...   103   4e-21   
gb:HUMBFGFS_2029582 Human shorter form basic fibroblast growth f...   103   4e-21   
gb:HSFLGMR_2013253 Human flg (fms-like gene) mRNA for putative p...   103   4e-21   
gb:HSFGR3IG_2013220 Human mRNA for fibroblast growth receptor 3-...   103   4e-21   
gb:HSFGR2IGA_2013219 Human mRNA for fibroblast growth receptor 2...   103   4e-21   
gb:HSFGR2IG_2013218 Human mRNA for fibroblast growth receptor 2-...   103   4e-21   
gb:BC018128_1976431 Homo sapiens fibroblast growth factor recept...   103   4e-21   
gb:BC015035_1974917 Homo sapiens fibroblast growth factor recept...   103   4e-21   
gb:A29216_1448326 H.sapiens DNA for bFGF receptor from patent WO...   103   4e-21   
gb:AC116330_1206268 Dictyostelium discoideum chromosome 2 map 31...   103   4e-21   
gb:CR859698_1183802 Pongo pygmaeus mRNA; cDNA DKFZp469L2025 (fro...   103   4e-21   
gb:AK034295_1163707 Mus musculus adult male diencephalon cDNA, R...   103   4e-21   
gb:AK028354_1160942 Mus musculus 18 days pregnant adult female p...   103   4e-21   
pir|A56795|A56795 fibroblast growth factor receptor 1 beta-isofo...   103   4e-21   
pir|I49293|I49293 fibroblast growth factor receptor-1, short iso...   103   4e-21   
pir|I49289|I49289 fibroblast growth factor receptor-1, long isof...   103   4e-21   
pir|JH0393|JH0393 fibroblast growth factor receptor precursor - ...   103   4e-21   
sp|P16092|FGR1_MOUSE|FGR1_MOUSE Basic fibroblast growth factor receptor 1 p...   103   4e-21   
sp|P11362|FGR1_HUMAN|FGR1_HUMAN Basic fibroblast growth factor receptor 1 p...   103   4e-21   
gb:NVIKGFR_2576624 Notophthalmus viridescens keratinocyte growth...   103   5e-21   
gb:NVI2FGFR_2576621 Notophthalmus viridescens fibroblast growth ...   103   5e-21   
gb:AY518776_1332618 Asterina miniata Src family kinase (SFK3) mR...   103   5e-21   
pir|S41050|S41050 fibroblast growth factor receptor-2 - eastern ...   103   5e-21   
pir|S41051|S41051 fibroblast growth factor receptor-2 - eastern ...   103   5e-21   
pir|A34849|TVMSFG fibroblast growth factor receptor 1 precursor ...   103   5e-21   
gb:AB025536_2461108 Lampetra reissneri mRNA for FGFR3/4, partial...   102   7e-21   
gb:AY208851_2079478 Rattus norvegicus dusty protein kinase mRNA,...   102   7e-21   
gb:AF402785_2065118 Rattus norvegicus receptor tyrosine kinase V...   102   7e-21   
gb:AY144487_1303443 Lytechinus variegatus focal adhesion kinase ...   102   7e-21   
gb:AJ620110_1283275 Suberites domuncula mRNA for receptor tyrosi...   102   7e-21   
gb:AF067775_1238110 Hydra vulgaris non-receptor protein-tyrosine...   102   7e-21   
gb:AB006558_1193028 Ephydatia fluviatilis EfPTK11 mRNA for prote...   102   7e-21   
sp|P35917|VGR3_MOUSE|VGR3_MOUSE Vascular endothelial growth factor receptor...   102   7e-21   
sp|Q08156|KIT_CHICK|KIT_CHICK Mast/stem cell growth factor receptor precur...   102   7e-21   
gb:AY364646_1602842 Chlamydomonas reinhardtii NIMA-related kinas...   102   9e-21   
gb:AB112434_1410689 Bos taurus c-met mRNA for HGF receptor c-Met...   102   9e-21   
gb:AF143242_1244398 Caenorhabditis elegans protein kinase MOM-4 ...   102   9e-21   
gb:AE017186_1053957 Bos taurus target 1 genomic scaffold.             102   9e-21   
pir|S49010|S49010 embryonic receptor kinase - mouse>gb:MMEMRK2_2...   102   9e-21   
pir|I51127|S36439 fibroblast growth factor receptor 2 - Iberian ...   102   9e-21   
pir|T22511|T22511 hypothetical protein F52F12.3 - Caenorhabditis...   102   9e-21   
gb:AB025534_2461106 Eptatretus burgeri mRNA for FGFR3/4a, partia...   102   1e-20   
gb:HUMMETPOA_2034285 Human MET proto-oncogene mRNA, complete cds.     102   1e-20   
gb:AF024491_1233811 Caenorhabditis elegans cosmid C24A1, complet...   102   1e-20   
gb:AB096875_1199231 Caenorhabditis elegans mRNA for CSK-1, compl...   102   1e-20   
gb:AB006563_1193033 Ephydatia fluviatilis EfPTK28 mRNA for prote...   102   1e-20   
gb:AK004721_1152536 Mus musculus adult male lung cDNA, RIKEN ful...   102   1e-20   
pir|T32258|T32258 hypothetical protein C24A1.3 - Caenorhabditis ...   102   1e-20   
pir|T24437|T24437 hypothetical protein T04B2.2 - Caenorhabditis ...   102   1e-20   
pir|I50128|I50128 fibroblast growth factor receptor - quail>gb:C...   102   1e-20   
gb:DRE309303_2571075 Danio rerio mRNA for fibroblast growth fact...   101   2e-20   
gb:BC073456_2557295 Xenopus laevis fibroblast growth factor rece...   101   2e-20   
gb:AY197500_2518461 Danio rerio fibroblast growth factor recepto...   101   2e-20   
gb:AY197499_2518460 Danio rerio fibroblast growth factor recepto...   101   2e-20   
gb:AY197498_2518459 Danio rerio fibroblast growth factor recepto...   101   2e-20   
gb:AF389400_2491102 Danio rerio fibroblast growth factor recepto...   101   2e-20   
gb:ACF_2175676 Fujinami sarcoma virus (unintegrated circular), c...   101   2e-20   
gb:AY682848_1958756 Homo sapiens receptor (TNFRSF)-interacting s...   101   2e-20   
gb:GCY18562_1385229 Geodia cydonium mRNA for scavenger receptor ...   101   2e-20   
gb:AK030959_1162237 Mus musculus adult male thymus cDNA, RIKEN f...   101   2e-20   
pir|T30809|T30809 plasminogen related growth factor receptor 3 -...   101   2e-20   
pir|S27396|S27396 phytochrome / protein kinase (EC 2.7.1.-) - mo...   101   2e-20   
sp|Q19238|YS3J_CAEEL|YS3J_CAEEL Putative tyrosine-protein kinase F09A5.2 in...   101   2e-20   
sp|Q60855|RIK1_MOUSE|RIK1_MOUSE Receptor-interacting serine/threonine-prote...   101   2e-20   
sp|Q13546|RIK1_HUMAN|RIK1_HUMAN Receptor-interacting serine/threonine-prote...   101   2e-20   
sp|P25848|PHY1_CERPU|PHY1_CERPU Light-sensor Protein kinase [Includes: Phyt...   101   2e-20   
sp|P00530|FPS_FUJSV|FPS_FUJSV Tyrosine-protein kinase transforming protein...   101   2e-20   
sp|Q03364|FGR2_XENLA|FGR2_XENLA Fibroblast growth factor receptor 2 precurs...   101   2e-20   
gb:ACFTS140A_2175677 Fujinami sarcoma virus temperature sensitiv...   101   2e-20   
gb:AB030078_1865945 Homo sapiens mRNA for K-sam-IIO3, complete cds.   101   2e-20   
gb:AB030077_1865944 Homo sapiens mRNA for K-sam-IIO2, complete cds.   101   2e-20   
gb:AB030076_1865943 Homo sapiens mRNA for K-sam-IIO1, complete cds.   101   2e-20   
gb:AB030075_1865942 Homo sapiens mRNA for K-sam-IIH3, complete cds.   101   2e-20   
gb:AB030074_1865941 Homo sapiens mRNA for K-sam-IIH2, partial cds.    101   2e-20   
gb:AB030073_1865940 Homo sapiens mRNA for K-sam-IIH1, complete cds.   101   2e-20   
pir|A41794|A41794 keratinocyte growth factor receptor precursor ...   101   2e-20   
pir|A26898|TVFVFS protein-tyrosine kinase (EC 2.7.1.112) fps (cl...   101   2e-20   
gb:DRU82383_2571388 Danio rerio receptor tyrosine kinase (flk) m...   100   3e-20   
gb:CHKPFPS2_2569430 Chicken fps proto-oncogene, 3' end.               100   3e-20   
gb:AY056466_2510038 Danio rerio receptor tyrosine kinase flk-1/V...   100   3e-20   
gb:AF487829_2497336 Danio rerio flk1 mRNA, complete cds.              100   3e-20   
gb:AF180354_2478777 Danio rerio flk1 protein mRNA, partial cds.       100   3e-20   
gb:ACSGAGFPS_2175716 Avian sarcoma virus retroviral oncogene v-f...   100   3e-20   
gb:BC089380_2110820 Mus musculus cDNA clone IMAGE:30626146, part...   100   3e-20   
gb:AY208852_2079479 Mus musculus dusty protein kinase mRNA, comp...   100   3e-20   
gb:AK172954_2069888 Mus musculus mRNA for mKIAA0472 protein.          100   3e-20   
gb:BC072406_1988979 Homo sapiens receptor interacting protein ki...   100   3e-20   
gb:AY208850_1939225 Homo sapiens dusty protein kinase mRNA, comp...   100   3e-20   
gb:AB007941_1864058 Homo sapiens mRNA for KIAA0472 protein, part...   100   3e-20   
gb:CEF49B2_1364142 Caenorhabditis elegans cosmid F49B2, complete...   100   3e-20   
gb:AB074426_1197538 Dugesia japonica mRNA for DjFGFR2, complete ...   100   3e-20   
gb:AK050542_1169364 Mus musculus adult pancreas islet cells cDNA...   100   3e-20   
pir|I50618|I50618 c-fps proto oncogene - chicken>gb:GGCFPSE2_257...   100   3e-20   
pir|I50406|I50406 proto-fps protein - chicken (fragment)              100   3e-20   
pir|I51703|I51703 c-kit-related kinase 1 (XKrk1) - African clawe...   100   3e-20   
pir|T22405|T22405 protein-tyrosine kinase (EC 2.7.1.112) F49B2.5...   100   3e-20   
pir|JE0201|JE0201 protein-tyrosine kinase (EC 2.7.1.112), recept...   100   3e-20   
sp|P00541|FPS_AVISP|FPS_AVISP Tyrosine-protein kinase transforming protein...   100   3e-20   
sp|Q04589|FGR1_RAT|FGR1_RAT Basic fibroblast growth factor receptor 1 pre...   100   3e-20   
sp|P07332|FES_HUMAN|FES_HUMAN Proto-oncogene tyrosine-protein kinase FES/F...   100   3e-20   
gb:BC073445_2557285 Xenopus laevis MGC80946 protein, mRNA (cDNA ...   100   3e-20   
gb:AY390224_2531467 Danio rerio lymphocyte protein tyrosine kina...   100   3e-20   
gb:AY364232_2529867 Xenopus laevis dusty protein kinase mRNA, co...   100   3e-20   
gb:AB003358_2460238 Xenopus laevis mRNA for Lyn protein tyrosine...   100   3e-20   
gb:REAMLV_2448607 Abelson murine leukemia virus genome with v-ab...   100   3e-20   
gb:REABMLVA_2448600 Abelson (P160) murine leukemia virus (Ab-MLV...   100   3e-20   
gb:BC059260_2103731 Mus musculus v-abl Abelson murine leukemia o...   100   3e-20   
gb:A06935_1446986 fes/fps-related mRNA.                               100   3e-20   
gb:AK090095_1176139 Mus musculus embryo RCB-0545 OHTA cDNA, RIKE...   100   3e-20   
pir|T27938|T27938 hypothetical protein ZK622.1 - Caenorhabditis ...   100   3e-20   
pir|D84715|D84715 probable protein kinase [imported] - Arabidops...   100   3e-20   
pir|A49865|A49865 protein-tyrosine kinase (EC 2.7.1.112) matk, l...   100   3e-20   
pir|A03931|FOMVGM gag-abl polyprotein - Abelson murine leukemia ...   100   3e-20   
pir|A24673|TVHUFF protein-tyrosine kinase (EC 2.7.1.112) fes/fps...   100   3e-20   
pir|A27824|TVCTFF protein-tyrosine kinase (EC 2.7.1.112) fes/fps...   100   3e-20   
sp|P14238|FES_FELCA|FES_FELCA Proto-oncogene tyrosine-protein kinase FES/F...   100   3e-20   
sp|P00521|ABL_MLVAB|ABL_MLVAB Tyrosine-protein kinase transforming protein...   100   3e-20   
sp|P00520|ABL1_MOUSE|ABL1_MOUSE Proto-oncogene tyrosine-protein kinase ABL1...   100   3e-20   
gb:AY364233_2529868 Xenopus tropicalis dev-stage adult dusty pro...   100   4e-20   


>gb:AB022223_1515175 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MWI23.>gb:AY035004_1559783 Arabidopsis
           thaliana unknown protein (At3g22750) mRNA, complete
           cds.>gb:AY063013_1565597 Arabidopsis thaliana unknown
           protein (At3g22750) mRNA, complete cds.
          Length = 378

 Score =  359 bits (921), Expect = 4e-98
 Identities = 163/195 (83%), Positives = 185/195 (94%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L++ R+KKLAFK+V+QLALDLSRGLSYLHS++IVHRDVK ENMLLD  RNLKIADFGVAR
Sbjct: 184 LFRNRRKKLAFKVVVQLALDLSRGLSYLHSERIVHRDVKTENMLLDYQRNLKIADFGVAR 243

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           VEAQNPKDMTGETGTLGYMAPEVLDGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct: 244 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADV 303

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           SSAVVRQNLRP+IPRCCP++LA+IMK+CW+ANP+KRPEM+EVV L+EA+DT+KGGGMIPE
Sbjct: 304 SSAVVRQNLRPDIPRCCPTALATIMKRCWEANPEKRPEMEEVVSLLEAVDTTKGGGMIPE 363

Query: 293 DQAGGCFCFAPTRGP 249
           DQ  GCFCF   RGP
Sbjct: 364 DQRPGCFCFVSGRGP 378



>gb:AC120505_1739743 Oryza sativa chromosome 3 BAC OSJNBa0066H15
           genomic sequence, complete sequence.>gb:AC128646_1740576
           Oryza sativa chromosome 3 BAC OSJNBb0029I19 genomic
           sequence, complete sequence.
          Length = 379

 Score =  354 bits (909), Expect = 1e-96
 Identities = 160/195 (82%), Positives = 181/195 (92%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K  ++KLA+K+V+QLALDL+RGLSYLHS+KIVHRDVK ENMLLDT RNLKIADFGVAR
Sbjct: 185 LIKNSRRKLAYKVVVQLALDLARGLSYLHSRKIVHRDVKTENMLLDTQRNLKIADFGVAR 244

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           VEAQNPKDMTG TGTLGYMAPEVLDGKPYNRKCDVYSFG+CLWEIYCCD+PYPDLSFA+V
Sbjct: 245 VEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPDLSFADV 304

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           SSAVV QNLRP++PRCCPS+ A+IM+KCWDANPDKRP+MDEVV+L+EA+DTSKGGGMIP+
Sbjct: 305 SSAVVHQNLRPDVPRCCPSAFANIMRKCWDANPDKRPDMDEVVQLLEALDTSKGGGMIPD 364

Query: 293 DQAGGCFCFAPTRGP 249
            Q+ GC CF   RGP
Sbjct: 365 GQSSGCLCFTKARGP 379



>gb:ATAC009325_1542880 Arabidopsis thaliana chromosome III BAC F4P13
           genomic sequence, complete sequence.>gb:AY057647_1564060
           Arabidopsis thaliana AT3g01490/F4P13_4 mRNA, complete
           cds.>gb:AY136392_1581893 Arabidopsis thaliana putative
           protein kinase (At3g01490) mRNA, complete
           cds.>gb:BT000206_1634484 Arabidopsis thaliana putative
           protein kinase (At3g01490) mRNA, complete cds.
          Length = 411

 Score =  350 bits (898), Expect = 2e-95
 Identities = 161/195 (82%), Positives = 180/195 (92%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K R++KLAFK+VIQL+LDL+RGLSYLHS+KIVHRDVK ENMLLD SR LKIADFGVAR
Sbjct: 217 LIKTRRRKLAFKVVIQLSLDLARGLSYLHSQKIVHRDVKTENMLLDKSRTLKIADFGVAR 276

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct: 277 LEASNPNDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV 336

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANP+KRPEM+EVV ++EAIDTSKGGGMIP 
Sbjct: 337 TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPEKRPEMEEVVAMLEAIDTSKGGGMIPP 396

Query: 293 DQAGGCFCFAPTRGP 249
           DQ  GCFCF   RGP
Sbjct: 397 DQQQGCFCFRRHRGP 411



>pir|G71410|G71410 probable protein kinase - Arabidopsis
           thaliana>gb:ATCHRIV39_1545242 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 39.>gb:ATFCA2_1551528
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 2.>gb:BT006041_1638935 Arabidopsis thaliana
           clone U50806 putative kinase (At4g14780) mRNA, complete
           cds.>gb:AK118177_1816169 Arabidopsis thaliana At4g14780
           mRNA for kinase like protein, complete cds, clone:
           RAFL19-49-L08.
          Length = 364

 Score =  347 bits (889), Expect = 2e-94
 Identities = 158/195 (81%), Positives = 176/195 (90%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + KKLAFK VI+LALDL+RGLSYLHS+KIVHRDVK ENMLLD  +NLKIADFGVAR
Sbjct: 170 LIRHKSKKLAFKAVIKLALDLARGLSYLHSEKIVHRDVKTENMLLDAQKNLKIADFGVAR 229

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           VEA NPKDMTGETGTLGYMAPEV+DGKPYNR+CDVYSFG+CLWEIYCCD+PYPDLSF +V
Sbjct: 230 VEALNPKDMTGETGTLGYMAPEVIDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFVDV 289

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           SSAVV  NLRPEIPRCCP++LA IMK CWD NP KRPEM EVV+++E +DTSKGGGMIPE
Sbjct: 290 SSAVVLHNLRPEIPRCCPTALAGIMKTCWDGNPQKRPEMKEVVKMLEGVDTSKGGGMIPE 349

Query: 293 DQAGGCFCFAPTRGP 249
           DQ+ GCFCFAP RGP
Sbjct: 350 DQSRGCFCFAPARGP 364



>gb:AP003855_1834345 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0039G05.
          Length = 388

 Score =  343 bits (881), Expect = 2e-93
 Identities = 160/196 (81%), Positives = 178/196 (90%), Gaps = 1/196 (0%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K R++KLA+K+V+QLALDL+RGLSYLHSKKIVHRDVK ENMLLD SR +KIADFGVAR
Sbjct: 193 LIKNRRRKLAYKVVVQLALDLARGLSYLHSKKIVHRDVKTENMLLDKSRTVKIADFGVAR 252

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct: 253 IEASNPSDMTGETGTLGYMAPEVLNGHPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV 312

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           +SAVVRQNLRPEIPRCCPSSLA++MK+CWDANPDKRP M EVV ++EAIDTSKGGGMIP 
Sbjct: 313 TSAVVRQNLRPEIPRCCPSSLANVMKRCWDANPDKRPAMAEVVSMLEAIDTSKGGGMIPT 372

Query: 293 DQAGGCF-CFAPTRGP 249
           DQ  GCF CF   RGP
Sbjct: 373 DQPQGCFSCFGRHRGP 388



>gb:AB026650_1517245 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPF21.
          Length = 385

 Score =  343 bits (881), Expect = 2e-93
 Identities = 156/195 (80%), Positives = 178/195 (91%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K R++KL FKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct: 191 LIKNRRRKLTFKIVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR 250

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDL+F+EV
Sbjct: 251 VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCDMPYPDLTFSEV 310

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct: 311 TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN 370

Query: 293 DQAGGCFCFAPTRGP 249
           DQ  GC CF   RGP
Sbjct: 371 DQQQGCLCFRRKRGP 385



>gb:AC098571_1736752 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1126_B10, complete sequence.
          Length = 381

 Score =  342 bits (877), Expect = 5e-93
 Identities = 159/196 (81%), Positives = 178/196 (90%), Gaps = 1/196 (0%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K R+KKLAFK+V+Q+ALDL+RGLSYLHSKKIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct: 186 LIKNRRKKLAFKVVVQIALDLARGLSYLHSKKIVHRDVKTENMLLDKTRTVKIADFGVAR 245

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +EA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+EV
Sbjct: 246 LEASNPSDMTGETGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEV 305

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           +SAVVRQNLRPE+PRCCPSSLA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP 
Sbjct: 306 TSAVVRQNLRPEMPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEAIDTSKGGGMIPV 365

Query: 293 DQAGGCF-CFAPTRGP 249
           DQ  GC  CF   RGP
Sbjct: 366 DQRQGCLSCFRQYRGP 381



>gb:AY085263_1570335 Arabidopsis thaliana clone 142106 mRNA,
           complete sequence.
          Length = 385

 Score =  341 bits (874), Expect = 1e-92
 Identities = 155/195 (79%), Positives = 177/195 (90%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K R++KL FKIV+QLALDL+RGLSYLHS+KIVHRDVK ENMLLD +R +KIADFGVAR
Sbjct: 191 LIKNRRRKLTFKIVVQLALDLARGLSYLHSQKIVHRDVKTENMLLDKTRTVKIADFGVAR 250

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           VEA NP DMTGETGTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCC +PYPDL+F+EV
Sbjct: 251 VEASNPNDMTGETGTLGYMAPEVLNGNPYNRKCDVYSFGICLWEIYCCXMPYPDLTFSEV 310

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           +SAVVRQNLRP+IPRCCPS+LA++MK+CWDANPDKRPEMDEVV ++E+IDT+KGGGMIP 
Sbjct: 311 TSAVVRQNLRPDIPRCCPSALAAVMKRCWDANPDKRPEMDEVVPMLESIDTTKGGGMIPN 370

Query: 293 DQAGGCFCFAPTRGP 249
           DQ  GC CF   RGP
Sbjct: 371 DQQQGCLCFRRKRGP 385



>gb:AY224453_1590655 Oryza sativa (japonica cultivar-group) isolate
           23379 putative protein kinase mRNA, complete cds.
          Length = 382

 Score =  327 bits (838), Expect = 2e-88
 Identities = 155/197 (78%), Positives = 174/197 (88%), Gaps = 2/197 (1%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K R+KKLAFK+V+Q+ALDL+RGLSYLHSKKIVHRDVK ENMLL     +KIADFGVAR
Sbjct: 186 LIKNRRKKLAFKVVVQIALDLARGLSYLHSKKIVHRDVKTENMLLARQELVKIADFGVAR 245

Query: 653 VEAQNPKDMT-GETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAE 477
           +EA NP DMT G+ GTLGYMAPEVL+G PYNRKCDVYSFG+CLWEIYCCD+PYPDLSF+E
Sbjct: 246 LEASNPSDMTRGKPGTLGYMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSE 305

Query: 476 VSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIP 297
           V+SAVVRQNLRPE+PRCCPSSLA++MK+CWDANPDKRPEM EVV ++EAIDTSKGGGMIP
Sbjct: 306 VTSAVVRQNLRPEMPRCCPSSLANVMKRCWDANPDKRPEMAEVVSMLEAIDTSKGGGMIP 365

Query: 296 EDQAGGCF-CFAPTRGP 249
            DQ  GC  CF   RGP
Sbjct: 366 VDQRQGCLSCFRQYRGP 382



>pir|T48115|T48115 protein kinase ATMRK1 (EC 2.7.1.-) [imported] -
           Arabidopsis thaliana>gb:AB006810_1510078 Arabidopsis
           thaliana mRNA for ATMRK1, complete
           cds.>gb:ATF16M2_1548851 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F16M2.>gb:AY080717_1568439
           Arabidopsis thaliana putative ATMRK1 protein (At3g63260)
           mRNA, complete cds.>gb:AY117337_1579378 Arabidopsis
           thaliana putative ATMRK1 protein (At3g63260) mRNA,
           complete cds.
          Length = 391

 Score =  323 bits (828), Expect = 2e-87
 Identities = 151/195 (77%), Positives = 170/195 (87%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K  + KL  K VIQLALDL+RGLSYLHSK IVHRDVK+ENMLL  ++ LKIADFGVAR
Sbjct: 197 LIKKYRAKLPIKDVIQLALDLARGLSYLHSKAIVHRDVKSENMLLQPNKTLKIADFGVAR 256

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           VEAQNP+DMTGETGTLGYMAPEVL+GKPYNRKCDVYSFGVCLWEIYCCD+PY D SFAE+
Sbjct: 257 VEAQNPQDMTGETGTLGYMAPEVLEGKPYNRKCDVYSFGVCLWEIYCCDMPYADCSFAEI 316

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           S AVV +NLRPEIP+CCP ++A+IMK+CWD NPD+RPEM+EVV+L+EAIDTSKGGGMI  
Sbjct: 317 SHAVVHRNLRPEIPKCCPHAVANIMKRCWDPNPDRRPEMEEVVKLLEAIDTSKGGGMIAP 376

Query: 293 DQAGGCFCFAPTRGP 249
           DQ  GC CF   RGP
Sbjct: 377 DQFQGCLCFFKPRGP 391



>gb:AY086480_1571528 Arabidopsis thaliana clone 253505 mRNA,
           complete sequence.
          Length = 391

 Score =  320 bits (821), Expect = 2e-86
 Identities = 150/195 (76%), Positives = 169/195 (86%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K  + KL  K VIQLALDL+RGLSYLHSK IVHRDVK+ENMLL  ++ LKIADFGVAR
Sbjct: 197 LIKKYRAKLPIKDVIQLALDLARGLSYLHSKAIVHRDVKSENMLLQPNKTLKIADFGVAR 256

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           VEAQNP+DMTG TGTLGYMAPEVL+GKPYNRKCDVYSFGVCLWEIYCCD+PY D SFAE+
Sbjct: 257 VEAQNPQDMTGGTGTLGYMAPEVLEGKPYNRKCDVYSFGVCLWEIYCCDMPYADCSFAEI 316

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           S AVV +NLRPEIP+CCP ++A+IMK+CWD NPD+RPEM+EVV+L+EAIDTSKGGGMI  
Sbjct: 317 SHAVVHRNLRPEIPKCCPHAVANIMKRCWDPNPDRRPEMEEVVKLLEAIDTSKGGGMIAP 376

Query: 293 DQAGGCFCFAPTRGP 249
           DQ  GC CF   RGP
Sbjct: 377 DQFQGCLCFFKPRGP 391



>gb:AC087852_1734226 Oryza sativa chromosome 3 BAC OJ1124_H03
           genomic sequence, complete sequence.
          Length = 407

 Score =  266 bits (680), Expect = 4e-70
 Identities = 129/198 (65%), Positives = 155/198 (78%), Gaps = 4/198 (2%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           LYK R KKL +K V+QLALD++RGL YLH +KIVHRDVKAENMLLD  + LKIADFGVAR
Sbjct: 208 LYKHRDKKLPYKKVVQLALDMARGLRYLHGEKIVHRDVKAENMLLDRKKTLKIADFGVAR 267

Query: 653 VEA-QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAE 477
           VEA  +  DMTG+TGT+GYMAPEVL G+ Y+ KCDVYSFGV LWE YCC + YP+ S A+
Sbjct: 268 VEAGADGDDMTGQTGTIGYMAPEVLQGRAYDHKCDVYSFGVLLWETYCCAMAYPNYSLAD 327

Query: 476 VSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKG-GGM- 303
           +S  V +  +RP+IPRCCP ++A IM +CWDANPD RPEM EVV L+E IDTS+G GGM 
Sbjct: 328 ISYHVDKLGIRPDIPRCCPKAMADIMARCWDANPDNRPEMSEVVALLEKIDTSRGKGGMT 387

Query: 302 -IPEDQAGGCFCFAPTRG 252
            +PE  + GC CF  +RG
Sbjct: 388 PVPEHASQGCSCFGFSRG 405



>gb:AY738763_1626111 Carica papaya serine/threonine protein kinase 1
           mRNA, partial cds.
          Length = 202

 Score =  182 bits (463), Expect = 5e-45
 Identities = 89/100 (89%), Positives = 94/100 (94%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + R+KKLA K+VIQLALDLSRGLSYLHSKKIVHRDVK ENMLLDT R LKIADFGVAR
Sbjct: 103 LIRNRRKKLAIKVVIQLALDLSRGLSYLHSKKIVHRDVKTENMLLDTHRTLKIADFGVAR 162

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGV 534
           VEAQNP+DMTGETGTLGYMAPEVLDGKPYNRKCDVYS+GV
Sbjct: 163 VEAQNPRDMTGETGTLGYMAPEVLDGKPYNRKCDVYSYGV 202



>gb:AY156510_1585390 Oryza sativa (japonica cultivar-group)
           serine/threonine protein kinase (DPK1) mRNA, complete
           cds.>gb:AY646225_1619847 Oryza sativa (indica
           cultivar-group) serine/threonine and tyrosine protein
           kinase mRNA, complete cds.>gb:AP003799_1833522 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           8, BAC clone:OJ1006_H01.
          Length = 417

 Score =  172 bits (436), Expect = 7e-42
 Identities = 76/170 (44%), Positives = 122/170 (71%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + + +  K+ ++ ALD++RG++Y+H    +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 226 LNRRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVAR 285

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E +  + MT ETGT  +MAPEV+  +PY++K DVYSFG+ LWE+   +LP+ +++  + 
Sbjct: 286 IEVKT-EGMTPETGTYRWMAPEVIQHRPYDQKVDVYSFGIVLWELVTGNLPFANMTAVQA 344

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
           + AVV + +RP IP  C  +LA IM +CWDANPD RP   EVVR++E ++
Sbjct: 345 AFAVVNKGVRPAIPHDCLPALAEIMTRCWDANPDARPPFTEVVRMLEQVE 394



>gb:AY036609_1560054 Triticum aestivum serine/threonine protein
           kinase mRNA, complete cds.
          Length = 416

 Score =  170 bits (431), Expect = 3e-41
 Identities = 74/170 (43%), Positives = 121/170 (71%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + + +  K+ ++ ALD++RG++Y+H    +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 225 LNRRQNRSVPLKLAVKQALDVARGMAYVHGLGFIHRDLKSDNLLISGDKSIKIADFGVAR 284

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E +  + MT ETGT  +MAPE++  +PYN+K DVYSFG+ LWE+    LP+P+++  + 
Sbjct: 285 IEVKT-EGMTPETGTYRWMAPEMIQHRPYNQKVDVYSFGIVLWELISGTLPFPNMTAVQA 343

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
           + AVV + +RP IP  C  +L  IM +CWDANP+ RP   +VVR++E ++
Sbjct: 344 AFAVVNKGVRPAIPHDCLPALGEIMTRCWDANPNVRPPFTDVVRMLERVE 393



>gb:AC006403_1534088 Arabidopsis thaliana chromosome 2 clone T28I24
           map mi238, complete sequence.>gb:AY046026_1561518
           Arabidopsis thaliana putative protein kinase (At2g24360)
           mRNA, complete cds.>gb:AY133876_1581696 Arabidopsis
           thaliana clone U09900 putative protein kinase
           (At2g24360) mRNA, complete cds.
          Length = 411

 Score =  167 bits (424), Expect = 2e-40
 Identities = 75/171 (43%), Positives = 121/171 (70%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + + +  K+ ++ ALD++RG++Y+H +  +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 220 LTRRQNRAVPLKLAVKQALDVARGMAYVHGRNFIHRDLKSDNLLISADKSIKIADFGVAR 279

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  + MT ETGT  +MAPE++  + YN+K DVYSFG+ LWE+    LP+ +++  + 
Sbjct: 280 IEVQT-EGMTPETGTYRWMAPEMIQHRAYNQKVDVYSFGIVLWELITGLLPFQNMTAVQA 338

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
           + AVV + +RP +P  C   L+ IM +CWDANP+ RP   EVV+L+EA +T
Sbjct: 339 AFAVVNRGVRPTVPNDCLPVLSDIMTRCWDANPEVRPCFVEVVKLLEAAET 389



>pir|G84635|G84635 probable protein kinase [imported] - Arabidopsis
           thaliana
          Length = 407

 Score =  167 bits (424), Expect = 2e-40
 Identities = 75/171 (43%), Positives = 121/171 (70%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + + +  K+ ++ ALD++RG++Y+H +  +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 216 LTRRQNRAVPLKLAVKQALDVARGMAYVHGRNFIHRDLKSDNLLISADKSIKIADFGVAR 275

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  + MT ETGT  +MAPE++  + YN+K DVYSFG+ LWE+    LP+ +++  + 
Sbjct: 276 IEVQT-EGMTPETGTYRWMAPEMIQHRAYNQKVDVYSFGIVLWELITGLLPFQNMTAVQA 334

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
           + AVV + +RP +P  C   L+ IM +CWDANP+ RP   EVV+L+EA +T
Sbjct: 335 AFAVVNRGVRPTVPNDCLPVLSDIMTRCWDANPEVRPCFVEVVKLLEAAET 385



>pir|T10671|T10671 protein kinase homolog F6E21.90 - Arabidopsis
           thaliana>gb:ATCHRIV74_1547038 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           74.>gb:AY085535_1570604 Arabidopsis thaliana clone
           156374 mRNA, complete sequence.>gb:AY125513_1580321
           Arabidopsis thaliana AT4g31170/F6E21_90 mRNA, complete
           cds.>gb:BT000587_1634865 Arabidopsis thaliana protein
           kinase - like protein (At4g31170/F6E21_90) mRNA,
           complete cds.
          Length = 412

 Score =  167 bits (422), Expect = 3e-40
 Identities = 75/171 (43%), Positives = 118/171 (69%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K + + +  K+ +  ALD++RG++Y+H +  +HRD+K++N+L+   R++KIADFGVAR
Sbjct: 221 LTKRQNRAVPLKLAVMQALDVARGMAYVHERNFIHRDLKSDNLLISADRSIKIADFGVAR 280

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  + MT ETGT  +MAPE++  +PY +K DVYSFG+ LWE+    LP+ +++  + 
Sbjct: 281 IEVQT-EGMTPETGTYRWMAPEMIQHRPYTQKVDVYSFGIVLWELITGLLPFQNMTAVQA 339

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
           + AVV + +RP +P  C   L  IM +CWDA+P+ RP   E+V L+EA +T
Sbjct: 340 AFAVVNRGVRPTVPADCLPVLGEIMTRCWDADPEVRPCFAEIVNLLEAAET 390



>gb:AY156511_1585391 Oryza sativa (japonica cultivar-group)
           serine/threonine protein kinase (DPK2) mRNA, complete
           cds.>gb:OSJN00081_1694544 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0060N03, complete
           sequence.
          Length = 422

 Score =  166 bits (419), Expect = 7e-40
 Identities = 74/167 (44%), Positives = 119/167 (71%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K + + +  K+ ++ ALD++RG++Y+H+   +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 231 LMKRQNRSVPLKLAVKQALDVARGMAYVHALGFIHRDLKSDNLLISGDKSIKIADFGVAR 290

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E +  + MT ETGT  +MAPE++  +PY++K DVYSFG+ LWE+    LP+ +++  + 
Sbjct: 291 IEVKT-EGMTPETGTYRWMAPEMIQHRPYDQKVDVYSFGIVLWELITGMLPFANMTAVQA 349

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
           + AVV + +RP IP+ C   L+ IM +CWD NPD RP   EVVR++E
Sbjct: 350 AFAVVNKGVRPAIPQDCLPVLSEIMTRCWDPNPDVRPPFTEVVRMLE 396



>gb:AP004744_1844236 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0065C04.
          Length = 428

 Score =  163 bits (412), Expect = 4e-39
 Identities = 73/167 (43%), Positives = 117/167 (70%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + K +   + ++ ALD++RG++Y+H+ + +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 237 LARRQNKSVPLGLAVKQALDVARGMAYVHALRFIHRDLKSDNLLISADKSIKIADFGVAR 296

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  + MT ETGT  +MAPE++  +PY+ K DVYSFG+ LWE+    LP+ +++  + 
Sbjct: 297 IEVQT-EGMTPETGTYRWMAPEMIQHRPYDHKVDVYSFGIVLWELITGMLPFTNMTAVQA 355

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
           + AVV +  RP IP+ C  SL+ IM  CWDANP+ RP   E+V ++E
Sbjct: 356 AFAVVNRGSRPAIPQDCVDSLSKIMTCCWDANPEVRPSFAEIVVMLE 402



>gb:AY224431_1590633 Oryza sativa (japonica cultivar-group) isolate
           20610 serine/thronine protein kinase-like protein mRNA,
           complete cds.
          Length = 361

 Score =  163 bits (412), Expect = 4e-39
 Identities = 73/167 (43%), Positives = 117/167 (70%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + K +   + ++ ALD++RG++Y+H+ + +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 170 LARRQNKSVPLGLAVKQALDVARGMAYVHALRFIHRDLKSDNLLISADKSIKIADFGVAR 229

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  + MT ETGT  +MAPE++  +PY+ K DVYSFG+ LWE+    LP+ +++  + 
Sbjct: 230 IEVQT-EGMTPETGTYRWMAPEMIQHRPYDHKVDVYSFGIVLWELITGMLPFTNMTAVQA 288

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
           + AVV +  RP IP+ C  SL+ IM  CWDANP+ RP   E+V ++E
Sbjct: 289 AFAVVNRGSRPAIPQDCVDSLSKIMTCCWDANPEVRPSFAEIVVMLE 335



>gb:AB016885_1513121 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19M22.>gb:AY092959_1574913 Arabidopsis
           thaliana protein-tyrosine kinase (At5g58950) mRNA,
           complete cds.>gb:BT010172_1640238 Arabidopsis thaliana
           At5g58950 mRNA, complete cds.
          Length = 525

 Score =  162 bits (410), Expect = 7e-39
 Identities = 78/196 (39%), Positives = 128/196 (65%), Gaps = 2/196 (1%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L+K   + L  K +I+ A+D++RG+ Y+HS++I+HRD+K EN+L+D   +LKIADFG+A 
Sbjct: 299 LHKPENRSLPLKKLIEFAIDIARGMEYIHSRRIIHRDLKPENVLIDEEFHLKIADFGIA- 357

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
            E +    +  + GT  +MAPE++  KP+ RK DVYSFG+ LWE+    +PY D++  + 
Sbjct: 358 CEEEYCDMLADDPGTYRWMAPEMIKRKPHGRKADVYSFGLVLWEMVAGAIPYEDMNPIQA 417

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME--AIDTSKGGGMI 300
           + AVV +N+RP IP  CP ++ +++++CW   PDKRPE  ++V+++E  AI   + G + 
Sbjct: 418 AFAVVHKNIRPAIPGDCPVAMKALIEQCWSVAPDKRPEFWQIVKVLEQFAISLEREGNL- 476

Query: 299 PEDQAGGCFCFAPTRG 252
             + +    C  P +G
Sbjct: 477 --NLSSSKICKDPRKG 490



>gb:FSY298992_1679426 Fagus sylvatica partial mRNA for protein
           kinase (pk1 gene), clone FsPK1.
          Length = 480

 Score =  162 bits (409), Expect = 9e-39
 Identities = 75/172 (43%), Positives = 118/172 (68%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L+K  +K L  + +I  ALD++RG+ Y+HS+ ++HRD+K EN+L+D   +LKIADFG+A 
Sbjct: 266 LHKLERKSLPLQKLIAFALDIARGMEYIHSQGVIHRDLKPENVLIDQEFHLKIADFGIAC 325

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
            EA     +  + GT  +MAPE++  K Y RK DVYSFG+ LWE+    +PY D++  + 
Sbjct: 326 EEAYCDS-LADDPGTYRWMAPEMIKHKSYGRKVDVYSFGLILWEMVAGTIPYEDMNPVQA 384

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
           + AVV +NLRP IPR CP ++ +++++CW    +KRPE  +VV+++E  ++S
Sbjct: 385 AFAVVNKNLRPVIPRYCPPAMRALIEQCWSLQSEKRPEFWQVVKVLEQFESS 436



>gb:AY206984_1589551 Oryza sativa (japonica cultivar-group)
           serine/threonine protein kinase (DPK4) mRNA, complete
           cds.
          Length = 428

 Score =  161 bits (408), Expect = 1e-38
 Identities = 72/167 (43%), Positives = 116/167 (69%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + K +   + ++ ALD++RG++Y+H+ + +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 237 LARRQNKSVPLGLAVKQALDVARGMAYVHALRFIHRDLKSDNLLISADKSIKIADFGVAR 296

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  + MT ETGT  +MAPE++  +PY+ K DVY FG+ LWE+    LP+ +++  + 
Sbjct: 297 IEVQT-EGMTPETGTYRWMAPEMIQHRPYDHKVDVYGFGIVLWELITGMLPFTNMTAVQA 355

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
           + AVV +  RP IP+ C  SL+ IM  CWDANP+ RP   E+V ++E
Sbjct: 356 AFAVVNRGSRPAIPQDCVDSLSKIMTCCWDANPEVRPSFAEIVVMLE 402



>gb:AF462860_1801969 Arabidopsis thaliana AT5g58950/k19m22_150 mRNA,
           complete cds.
          Length = 525

 Score =  160 bits (406), Expect = 2e-38
 Identities = 77/196 (39%), Positives = 127/196 (64%), Gaps = 2/196 (1%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L+K   + L  K +I+  +D++RG+ Y+HS++I+HRD+K EN+L+D   +LKIADFG+A 
Sbjct: 299 LHKPENRSLPLKKLIEFVIDIARGMEYIHSRRIIHRDLKPENVLIDEEFHLKIADFGIA- 357

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
            E +    +  + GT  +MAPE++  KP+ RK DVYSFG+ LWE+    +PY D++  + 
Sbjct: 358 CEEEYCDMLADDPGTYRWMAPEMIKRKPHGRKADVYSFGLVLWEMVAGAIPYEDMNPIQA 417

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME--AIDTSKGGGMI 300
           + AVV +N+RP IP  CP ++ +++++CW   PDKRPE  ++V+++E  AI   + G + 
Sbjct: 418 AFAVVHKNIRPAIPGDCPVAMKALIEQCWSVAPDKRPEFWQIVKVLEQFAISLERKGNL- 476

Query: 299 PEDQAGGCFCFAPTRG 252
             + +    C  P +G
Sbjct: 477 --NLSSSKICKDPRKG 490



>gb:AY156512_1585392 Oryza sativa (japonica cultivar-group)
           serine/threonine protein kinase (DPK3) mRNA, complete
           cds.>gb:AP005772_1857600 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0073A21.
          Length = 421

 Score =  159 bits (401), Expect = 8e-38
 Identities = 70/170 (41%), Positives = 119/170 (70%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L + + K +  ++ ++ ALD++RG++Y+H+   +HRD+K++N+L+   +++KIADFGVAR
Sbjct: 230 LARRQNKSVPLRLAVKQALDIARGMAYVHALGFIHRDLKSDNLLIAADKSIKIADFGVAR 289

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E +  + MT ETGT  +MAPE++  +PY+ K DVYSFG+ LWE+    LP+ +++  + 
Sbjct: 290 IEVKT-EGMTPETGTYRWMAPEMIQHRPYDHKVDVYSFGIVLWELITGMLPFTNMTAVQA 348

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
           + AVV +  RP IP+ C  +L+ IM  CWDANP+ RP   ++V ++E+ +
Sbjct: 349 AFAVVNKGARPVIPQDCLPALSHIMTLCWDANPEVRPAFTDIVCMLESAE 398



>gb:AE005173_893909 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC003113_1531108 Genomic sequence
           for Arabidopsis thaliana BAC F24O1 from chromosome I,
           complete sequence.
          Length = 415

 Score =  157 bits (398), Expect = 2e-37
 Identities = 72/170 (42%), Positives = 111/170 (65%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K     L+ + V++LALD+SRG+ YLHS+ ++HRD+K+ N+LL+    +K+ADFG + 
Sbjct: 201 LNKKEPYSLSIETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLLNDEMRVKVADFGTSC 260

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  ++  G  GT  +MAPE++  KPY RK DVYSFG+ LWE+    LP+  ++  + 
Sbjct: 261 LETQC-REAKGNMGTYRWMAPEMIKEKPYTRKVDVYSFGIVLWELTTALLPFQGMTPVQA 319

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
           + AV  +N RP +P  C  +LA ++K+CW  NP KRP+   +V ++E  D
Sbjct: 320 AFAVAEKNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAVLEKYD 369



>pir|T01451|T01451 protein kinase homolog F24O1.13 - Arabidopsis
           thaliana
          Length = 390

 Score =  157 bits (398), Expect = 2e-37
 Identities = 72/170 (42%), Positives = 111/170 (65%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K     L+ + V++LALD+SRG+ YLHS+ ++HRD+K+ N+LL+    +K+ADFG + 
Sbjct: 176 LNKKEPYSLSIETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLLNDEMRVKVADFGTSC 235

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  ++  G  GT  +MAPE++  KPY RK DVYSFG+ LWE+    LP+  ++  + 
Sbjct: 236 LETQC-REAKGNMGTYRWMAPEMIKEKPYTRKVDVYSFGIVLWELTTALLPFQGMTPVQA 294

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
           + AV  +N RP +P  C  +LA ++K+CW  NP KRP+   +V ++E  D
Sbjct: 295 AFAVAEKNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAVLEKYD 344



>pir|T12955|T12955 probable protein kinase (EC 2.7.1.-) T6H20.40 -
           Arabidopsis thaliana>gb:ATT6H20_1556338 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T6H20.
          Length = 475

 Score =  157 bits (397), Expect = 2e-37
 Identities = 75/169 (44%), Positives = 118/169 (69%), Gaps = 2/169 (1%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L+K  +K L  + +I   LD+++G+ Y+HS++IVH+D+K EN+L+D   +LKIADFG+A 
Sbjct: 250 LHKLEQKSLPLEQLIDFGLDIAKGMEYIHSREIVHQDLKPENVLIDNDFHLKIADFGIAC 309

Query: 653 VEAQNPKDMTGET-GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAE 477
            E     D+ G+  GT  +MAPEVL   P+ RKCDVYSFG+ LWE+    LPY ++ FAE
Sbjct: 310 EEEY--CDVLGDNIGTYRWMAPEVLKRIPHGRKCDVYSFGLLLWEMVAGALPYEEMKFAE 367

Query: 476 -VSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
            ++ AV+ + +RP IP  CP+++  ++++CW +  DKRPE  ++V+++E
Sbjct: 368 QIAYAVIYKKIRPVIPTDCPAAMKELIERCWSSQTDKRPEFWQIVKVLE 416



>gb:AP006548_1862367 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone: P0705E11.
          Length = 603

 Score =  156 bits (395), Expect = 4e-37
 Identities = 79/194 (40%), Positives = 122/194 (62%), Gaps = 5/194 (2%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           K K  FK+  ++ + +D+S+G+SYLH   I+HRD+K  N+L+D +  +K+ADFGVARV+A
Sbjct: 410 KHKGVFKLPALLGVVMDVSKGMSYLHQNNIIHRDLKTANLLMDENGTVKVADFGVARVKA 469

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
           Q+   MT ETGT  +MAPEV++ KPY+ K DV+SFG+ +WE+    +PY  L+  + +  
Sbjct: 470 QSGV-MTAETGTYRWMAPEVIEHKPYDHKADVFSFGILMWELLTGKIPYEYLTPLQAAVG 528

Query: 464 VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKG---GGMIPE 294
           VV++ LRP IP+   + L+ +++KCW   P +RP+  E++  ++ I    G    G   E
Sbjct: 529 VVQKGLRPTIPKNAHAKLSELLQKCWQQEPAERPDFSEILETLQRIAEEVGDEHDGKHKE 588

Query: 293 DQAGGCFCFAPTRG 252
              GG F     RG
Sbjct: 589 KILGGLFSALRGRG 602



>pir|D84555|D84555 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AY070086_1566728 Arabidopsis thaliana
           putative protein kinase (At2g17700) mRNA, complete
           cds.>gb:AY096470_1576014 Arabidopsis thaliana putative
           protein kinase (At2g17700) mRNA, complete cds.
          Length = 546

 Score =  155 bits (393), Expect = 7e-37
 Identities = 70/166 (42%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           K+K AFK+  ++++ALD+++G+SYLH   I+HRD+K  N+L+D    +K+ADFGVARV+ 
Sbjct: 374 KQKCAFKLQTLLKVALDVAKGMSYLHQNNIIHRDLKTANLLMDEHGLVKVADFGVARVQI 433

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
           ++   MT ETGT  +MAPEV++ KPYN K DV+S+ + LWE+   D+PY  L+  + +  
Sbjct: 434 ESGV-MTAETGTYRWMAPEVIEHKPYNHKADVFSYAIVLWELLTGDIPYAFLTPLQAAVG 492

Query: 464 VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           VV++ LRP+IP+     +  ++++CW  +P++RP  +E++ +++ I
Sbjct: 493 VVQKGLRPKIPKKTHPKVKGLLERCWHQDPEQRPLFEEIIEMLQQI 538



>pir|S29851|S29851 protein kinase 6 (EC 2.7.1.-) -
           soybean>gb:SOYPROKIN_1716079 Glycine max protein kinase
           (PK6) mRNA, complete cds.
          Length = 462

 Score =  155 bits (392), Expect = 9e-37
 Identities = 71/172 (41%), Positives = 117/172 (68%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L+K   + ++ + +I  ALD++RG+ Y+HS+ ++HRD+K EN+L++   +LKIADFG+A 
Sbjct: 248 LHKLEHQTISLQKLIAFALDIARGMEYIHSQGVIHRDLKPENILINEDNHLKIADFGIAC 307

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
            EA     +  + GT  +MAPE++  K Y +K DVYSFG+ LWE+    +PY D++  + 
Sbjct: 308 EEASCDL-LADDPGTYRWMAPEMIKRKSYGKKVDVYSFGLILWEMLTGTIPYEDMNPIQA 366

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
           + AVV +N RP IP  CP ++ +++++CW   PDKRPE  +VV+++E  ++S
Sbjct: 367 AFAVVNKNSRPIIPSNCPPAMRALIEQCWSLQPDKRPEFWQVVKILEQFESS 418



>gb:AP003076_1824632 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0481E12.
          Length = 637

 Score =  155 bits (391), Expect = 1e-36
 Identities = 71/167 (42%), Positives = 112/167 (67%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L+K   K L  + +I + LD++ G+ Y+HS+ +VHRDVK EN++ D+    KI DFG++ 
Sbjct: 419 LHKQEHKSLPLEKIISIGLDIANGIGYIHSQGVVHRDVKPENIIFDSEFCAKIVDFGISC 478

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
            EA+    +  +TGT  +MAPE++  KPY RK DVYSFG+ LWE++   +PY DL+  + 
Sbjct: 479 EEAECDP-LANDTGTFRWMAPEMMKHKPYGRKVDVYSFGLILWEMFTGSVPYEDLNPFQA 537

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
           + AV  +N RP IP  CP+ L  ++++CW + PDKRPE  ++V++++
Sbjct: 538 AFAVFDKNERPVIPSSCPAPLRLLIEQCWASQPDKRPEFWQIVQILD 584



>gb:AP002845_1823134 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0482C06.>gb:AP002863_1823297 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0005A05.
          Length = 376

 Score =  154 bits (390), Expect = 2e-36
 Identities = 68/168 (40%), Positives = 119/168 (70%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L++     +  ++V++L+L+++RG+SYLHS+ I+HRD+K+EN+LLD   ++K+ADFG++ 
Sbjct: 154 LHQQEPHSVPIELVLKLSLEIARGMSYLHSQGILHRDLKSENILLDGDMSVKVADFGISC 213

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E+Q      G TGT  +MAPE++  K + RK DVYSFG+ LWEI    +P+ +++  + 
Sbjct: 214 LESQCGSGK-GFTGTYRWMAPEMIKEKHHTRKVDVYSFGIVLWEILTALVPFSEMTPEQA 272

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEA 330
           + AV  +N RP +P  CP +++ ++ +CW  NPD+RP+ D++V ++E+
Sbjct: 273 AVAVALKNARPPLPPSCPVAISHLITQCWATNPDRRPQFDDIVAILES 320



>gb:FSPKF1PRO_1679313 F.sylvatica mRNA for PKF1 protein.
          Length = 204

 Score =  154 bits (389), Expect = 2e-36
 Identities = 70/158 (44%), Positives = 110/158 (69%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETG 612
           I  ALD++RG+ Y+HS+ ++HRD+K+EN+L+D   +LKIADFG+A  E      +  + G
Sbjct: 4   IAFALDIARGMEYIHSQGVIHRDLKSENVLIDQEFHLKIADFGIA-YEEDYCDSLADDPG 62

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIP 432
           T  +MAPE++  K Y RK DVYSFG+ LWE+    +PY D++  + + AVV +NLRP IP
Sbjct: 63  TYRWMAPEMIKHKSYGRKVDVYSFGLILWEMVAGTIPYQDMNPVQAAFAVVNKNLRPVIP 122

Query: 431 RCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
           R CP ++ +++++CW    +KRPE  +VV+++E  ++S
Sbjct: 123 RDCPPAMRALIEQCWSLQSEKRPEFWQVVKVLEQFESS 160



>gb:AP004078_1837343 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1020_C02.>gb:AP005851_1859088 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0088N06.
          Length = 583

 Score =  153 bits (387), Expect = 3e-36
 Identities = 69/166 (41%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           KK  +FK+  ++++A D+S+G++YLH   I+HRD+K  N+L+D ++ +K+ADFGVARV+ 
Sbjct: 393 KKNNSFKLSEILRVATDISKGMNYLHQNNIIHRDLKTANLLMDENKVVKVADFGVARVKD 452

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
           Q+   MT ETGT  +MAPEV++ KPY+ K DV+SFG+ LWE+    +PY  L+  + +  
Sbjct: 453 QSGV-MTAETGTYRWMAPEVIEHKPYDHKADVFSFGIVLWELLTGKIPYEYLTPLQAAIG 511

Query: 464 VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           VV++ LRP IP+     L+ +++KCW  +P +RP+  +++ +++ +
Sbjct: 512 VVQKGLRPTIPKDTHPKLSELLQKCWHRDPAERPDFSQILEILQRL 557



>gb:AY093017_1574971 Arabidopsis thaliana putative protein
           (At4g35780) mRNA, complete cds.>gb:AY128938_1581018
           Arabidopsis thaliana putative protein (At4g35780) mRNA,
           complete cds.
          Length = 570

 Score =  153 bits (387), Expect = 3e-36
 Identities = 74/184 (40%), Positives = 119/184 (64%), Gaps = 2/184 (1%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           K K  FKI  ++++ALD+S+G++YLH   I+HRD+K  N+L+D    +K+ADFGVARV+ 
Sbjct: 380 KHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQT 439

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
           ++   MT ETGT  +MAPEV++ KPY+ + DV+S+ + LWE+   +LPY  L+  + +  
Sbjct: 440 ESGV-MTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVG 498

Query: 464 VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPEDQA 285
           VV++ LRP+IP+     L  +++KCW  +P  RP   E++ ++  +    G     +D+ 
Sbjct: 499 VVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLIREVGDDERHKDKH 558

Query: 284 GGCF 273
           GG F
Sbjct: 559 GGYF 562



>gb:AP003685_1832011 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0548E04.>gb:AP007231_1863384 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0535F09.
          Length = 564

 Score =  152 bits (385), Expect = 6e-36
 Identities = 77/189 (40%), Positives = 123/189 (65%), Gaps = 5/189 (2%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           K+K +FK+  +++ A+D+S+G++YLH  KI+HRD+K  N+L+D    +K+ADFGVARV+A
Sbjct: 373 KRKGSFKLPSLLKAAVDISKGMNYLHQNKIIHRDLKTANLLMDEHELIKVADFGVARVKA 432

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
           ++   MT ETGT  +MAPEV++ KPY+ K DV+SFGV LWE+    +P+  L+  + +  
Sbjct: 433 ESGI-MTAETGTYRWMAPEVIEHKPYDSKADVFSFGVVLWELLTGKIPHEFLTPLQAAIG 491

Query: 464 VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMI---PE 294
           VV++ LRP IP+     LA +++ CW  N   RP+  ++++ ++ I    G  +     E
Sbjct: 492 VVQEGLRPVIPKATDPKLALLLESCWQQNAVNRPDFVQILQKLDEIAGEHGIDLTHPHKE 551

Query: 293 DQAGGCFCF 267
            + GG F F
Sbjct: 552 KEKGGFFTF 560



>pir|T04683|T04683 hypothetical protein F8D20.290 - Arabidopsis
           thaliana>gb:ATCHRIV84_1547538 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 84.>gb:ATF8D20_1551137
           Arabidopsis thaliana DNA chromosome 4, BAC clone F8D20
           (ESSAII project).
          Length = 553

 Score =  151 bits (381), Expect = 2e-35
 Identities = 77/189 (40%), Positives = 122/189 (64%), Gaps = 7/189 (3%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           K K  FKI  ++++ALD+S+G++YLH   I+HRD+K  N+L+D    +K+ADFGVARV+ 
Sbjct: 363 KHKGVFKIQSLLKVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQT 422

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
           ++   MT ETGT  +MAPEV++ KPY+ + DV+S+ + LWE+   +LPY  L+  + +  
Sbjct: 423 ESGV-MTAETGTYRWMAPEVIEHKPYDHRADVFSYAIVLWELLTGELPYSYLTPLQAAVG 481

Query: 464 VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM-----EAIDTSKGGGMI 300
           VV++ LRP+IP+     L  +++KCW  +P  RP   E++ ++     E ID S     +
Sbjct: 482 VVQKGLRPKIPKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLIREVIDLS-----L 536

Query: 299 PEDQAGGCF 273
            +D+ GG F
Sbjct: 537 HKDKHGGYF 545



>gb:AP003573_1831084 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0523F01.>gb:AP005386_1850836 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0019I19.
          Length = 398

 Score =  149 bits (376), Expect = 6e-35
 Identities = 71/177 (40%), Positives = 111/177 (62%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K     L+ + +++LALD+SRG+ YLH++ ++HRD+K++N+LL+    +K+ADFG + 
Sbjct: 190 LNKKDPYSLSSETILKLALDISRGMEYLHAQGVIHRDLKSQNLLLNDEMRVKVADFGTSC 249

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E    +   G  GT  +MAPE+   KPY RK DVYSFG+ LWE+  C LP+  ++  + 
Sbjct: 250 LETAC-QATKGNKGTYRWMAPEMTKEKPYTRKVDVYSFGIVLWELTTCLLPFQGMTPVQA 308

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGM 303
           + A   +NLRP +   C   L +++K+CW ANP +RPE   +V ++E  D     GM
Sbjct: 309 AYAASEKNLRPPLSTSCSPVLNNLIKRCWSANPARRPEFSYIVSVLEKYDHCVKEGM 365



>gb:AY027437_1559041 Arachis hypogaea serine/threonine/tyrosine
           kinase mRNA, complete cds.
          Length = 411

 Score =  147 bits (372), Expect = 2e-34
 Identities = 69/157 (43%), Positives = 108/157 (68%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR 654
           L K + + +  K+ ++ ALD++RG++Y+    ++HRD+K++N+L+  ++++KIADFGVA 
Sbjct: 223 LMKRQNRSVPLKLAVKQALDVARGMAYVPWLGLIHRDLKSDNLLIFGAKSIKIADFGVAG 282

Query: 653 VEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEV 474
           +E Q  + MT ETGT  +MAPE++  +PY +K DVYSFG+ LWE+    LP+ ++   + 
Sbjct: 283 IEVQT-EGMTPETGTYRWMAPEMIQHRPYTQKVDVYSFGIVLWELIPGMLPFQNMPAVQA 341

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRP 363
           + AVV +N+RP IP  C   L  IM +CWD NPD RP
Sbjct: 342 AFAVVTKNVRPIIPNDCLPVLRDIMPRCWDPNPDVRP 378



>gb:AC135502_1742480 Oryza sativa chromosome 3 BAC OSJNBb0085A04
           genomic sequence, complete sequence.
          Length = 351

 Score =  145 bits (365), Expect = 1e-33
 Identities = 65/158 (41%), Positives = 108/158 (68%), Gaps = 1/158 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDM-TGE 618
           +++LALD++RG+ YLH++ +VHRD+K EN++LD    +K+AD G + +EA    D  + +
Sbjct: 146 IVRLALDVARGMEYLHARGVVHRDLKPENLMLDGGGRVKVADLGTSCLEATCRGDKCSSK 205

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT  +MAPE++  K  NRK DVYSFG+ LWE+  C +P+ +LS  +V+ +V  ++ RP 
Sbjct: 206 AGTFRWMAPEMIHDKRCNRKVDVYSFGLVLWELTTCLVPFQNLSPVQVAYSVCDRDARPP 265

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
           +   CP ++ S++K+CW   P +RPE  ++V ++E+ D
Sbjct: 266 LSPSCPPAINSLIKRCWSTEPARRPEFKQIVSVLESYD 303



>gb:AP004315_1840087 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0571D04.
          Length = 438

 Score =  144 bits (362), Expect = 3e-33
 Identities = 69/156 (44%), Positives = 110/156 (70%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           V+++A D+S+G++YLH   IVHRD+K  N+L+D  + +K+ADFGVARV+ Q+   MT ET
Sbjct: 260 VLRIASDVSKGMNYLHQINIVHRDLKTANLLMD-DQVVKVADFGVARVKDQSGV-MTAET 317

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           GT  +MAPEV++  PY+++ DV+SFG+ +WE+    LPY D++  + + AVV+++LRP I
Sbjct: 318 GTYRWMAPEVIEHLPYDQRADVFSFGIVIWELLTGKLPYEDMTPLQAAVAVVQKDLRPII 377

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           P      LA +++KCW  +P  RP   E++ ++ +I
Sbjct: 378 PADTHPMLAGLLQKCWQKDPALRPTFSEILDILNSI 413



>gb:AY653733_2371668 Mimivirus, complete genome.
          Length = 1651

 Score =  137 bits (345), Expect = 2e-31
 Identities = 67/158 (42%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = -1

Query: 812  KLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
            KL  K++ Q AL    G+ YLH+    I+HRD+K  N+L+D S N+KIADFG AR++ +N
Sbjct: 1488 KLKIKMLYQTAL----GIGYLHNSDPIIIHRDIKPSNILVDDSMNVKIADFGFARIKEEN 1543

Query: 638  PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVV 459
               +    GT  + APE++ G+ Y  K DV+SFG+ +WE+  C  P+   +F +VS  ++
Sbjct: 1544 --SVMTRCGTPCWTAPEIIRGEKYTEKVDVFSFGIVMWEVLTCKEPFSGCNFMKVSMDIL 1601

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
             +  RP+IP  CP     +MK+CW A PDKRP M++V+
Sbjct: 1602 -EGARPQIPSDCPIDFTKLMKQCWHAKPDKRPSMEDVI 1638



 Score =  100 bits (249), Expect = 3e-20
 Identities = 64/173 (36%), Positives = 95/173 (54%), Gaps = 9/173 (5%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNP-KDMTGET 615
            I++A   ++G+ +LHS  IVHRD+K+ N+LLD+  N+K++DFG+ +++  N  K  T E 
Sbjct: 893  IRIAYQAAKGMHFLHSSDIVHRDLKSLNLLLDSKWNVKVSDFGLTKIKDNNKGKSSTKED 952

Query: 614  G--TLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNL 447
               ++ + APEVL  K        DVYSFG+ +WE+     PY  LS A ++ AV+R NL
Sbjct: 953  SVCSIQWTAPEVLSEKQDIDYILADVYSFGIIMWELMTRLRPYIGLSPAAIAVAVIRDNL 1012

Query: 446  RPEIP----RCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMI 300
            RPEI         S    ++  CW  +   RP   E+   M  + T  GG  I
Sbjct: 1013 RPEIQEEDINLMSSDYVELVNICWHKDTMIRPSFLEI---MTKLSTLIGGSGI 1062



>gb:AP003197_1824969 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1015E06.
          Length = 563

 Score =  137 bits (345), Expect = 2e-31
 Identities = 68/164 (41%), Positives = 109/164 (66%), Gaps = 2/164 (1%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           +I +ALD++ GL Y+HS+ +VHRD+K EN+L D +  +KIADFG+A  E+     +  + 
Sbjct: 371 IISIALDVACGLEYIHSQGVVHRDIKPENILFDENFCVKIADFGIACEESMCDV-LVEDE 429

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           GT  +MAPE++  K YNRK DVYSFG+ LWE+    +P+ DL+  + + AV  ++ RP I
Sbjct: 430 GTYRWMAPEMIKRKAYNRKVDVYSFGLLLWEMISGRIPFDDLTPLQAAYAVATRHARPVI 489

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT--SKGG 309
           P  CP +L  ++++C    P+KRP+  ++V+++E   +  S+GG
Sbjct: 490 PPECPMALRPLIEQCCSLQPEKRPDFWQIVKILEEFHSVLSQGG 533



>gb:AP004654_1842732 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0015C07.
          Length = 200

 Score =  136 bits (342), Expect = 6e-31
 Identities = 64/156 (41%), Positives = 102/156 (65%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++++A+ +S+G++YLH   I+HRD+K  N+L+   + +KIADFGVAR +      MT ET
Sbjct: 22  ILRIAISISKGMNYLHQNNIIHRDLKTANLLMGYHQVVKIADFGVAR-QGNQEGQMTAET 80

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           GT  +MAPE+++ KPY+ K DV+SF + LWE+    +PY +++  + +   VRQ  R EI
Sbjct: 81  GTYRWMAPEIINHKPYDNKADVFSFAIVLWELVTLKVPYDNMTPLQAALG-VRQGFRLEI 139

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           P      L+ ++++CWD +PD RP   E+V  +E I
Sbjct: 140 PSSVNPRLSKLIQRCWDEDPDVRPVFAEIVIELEDI 175



>gb:AY653733_2371676 Mimivirus, complete genome.
          Length = 1657

 Score =  133 bits (335), Expect = 4e-30
 Identities = 62/158 (39%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = -1

Query: 812  KLAFKIVIQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
            KL +   I++ +++++G+SYLHS    I+HRD+K  N+L+D + N+KIADFG AR++ +N
Sbjct: 1491 KLEWHQKIKILVNIAKGISYLHSFDPPIIHRDIKPSNILIDENWNVKIADFGFARIKEEN 1550

Query: 638  PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVV 459
               +    GT  + APE++    Y+ K DV+SFG+ +WE+  C  P+   +F +++  ++
Sbjct: 1551 A--IMTRCGTPCWTAPEIIRNDIYDEKVDVFSFGIVMWEVLTCKEPFIGANFMKITMDIL 1608

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
             +++RP+IP+ CP   A +M+KCW A   KRP MD+V+
Sbjct: 1609 -EDVRPKIPQDCPEEFAKLMRKCWHAKSTKRPTMDDVI 1645



 Score =  103 bits (256), Expect = 5e-21
 Identities = 63/180 (35%), Positives = 101/180 (56%), Gaps = 11/180 (6%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR----VEAQ 642
            + F + +++A   S+G+ +LHS  I HRD+K+ N+LLD   N+K++DFG+ +    V++ 
Sbjct: 881  IPFALKVKIAYQASKGMHFLHSSGITHRDLKSLNLLLDIKWNVKVSDFGLTKFKSDVKSI 940

Query: 641  NPKDMTGETGTLGYMAPEVL--DGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSS 468
            NP+      GT+ + APE+L  D +      DVYSFG+ +WE+   D PY  +S A ++ 
Sbjct: 941  NPEKF---AGTIQWTAPEILSEDREVDYILSDVYSFGIIMWELITRDQPYFGMSPAAIAV 997

Query: 467  AVVRQNLRPEIPRCCPSSLA----SIMKKCWDANPDKRPEMDEVV-RLMEAIDTSKGGGM 303
            +V+R N RP I     S +A     ++  CW  +P  RP   E++ RL   +  S   GM
Sbjct: 998  SVIRDNYRPVISDQLRSEVAPEYIELLTSCWHFDPTIRPTFLEIMTRLSNLMGDSGMTGM 1057



>gb:OSJN00088_1694685 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0085I10, complete sequence.
          Length = 778

 Score =  131 bits (330), Expect = 1e-29
 Identities = 68/164 (41%), Positives = 102/164 (62%), Gaps = 2/164 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD+++G++YLH  +  IVH D+K  NML+D + ++K+ DFG++R +A         
Sbjct: 614  LRMALDVAKGINYLHCLNPPIVHWDLKTPNMLVDKNWSVKVGDFGLSRFKANTFISSKSV 673

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPE L G+P N KCDVYSFGV LWE+     P+  LS A+V  AV  QN R  
Sbjct: 674  AGTPEWMAPEFLRGEPSNEKCDVYSFGVILWELMTMQQPWNGLSPAQVVGAVAFQNRRLP 733

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGG 306
            IP+     LA++++ CWD +P +RP    +V  ++ +  S  GG
Sbjct: 734  IPQETVPELAALVESCWDDDPRQRPSFSSIVDTLKKLLKSMLGG 777



>pir|T05675|T05675 hypothetical protein F20M13.30 - Arabidopsis
           thaliana>gb:ATCHRIV89_1547800 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           89.>gb:ATF20M13_1549506 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20M13 (ESSA project).
          Length = 545

 Score =  131 bits (330), Expect = 1e-29
 Identities = 66/171 (38%), Positives = 106/171 (61%), Gaps = 2/171 (1%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           K+K  FK+  + ++A+D+ +G+SYLH   I+HRD+KA N+L+D +  +K+ADFGVARV+A
Sbjct: 366 KQKGVFKLPTLFKVAIDICKGMSYLHQNNIIHRDLKAANLLMDENEVVKVADFGVARVKA 425

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
           Q    MT ETGT  +MAPEV++ KPY+ K DV+S+G+ LWE+                  
Sbjct: 426 QTGV-MTAETGTYRWMAPEVIEHKPYDHKADVFSYGIVLWEL------------------ 466

Query: 464 VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKG 312
           +  + LRP IP+     LA ++++ W+ +  +RP+  E++  ++ I    G
Sbjct: 467 LTGKGLRPTIPKNTHPKLAELLERLWEHDSTQRPDFSEIIEQLQEIAKEVG 517



>pir|T04688|T04688 hypothetical protein F4B14.50 - Arabidopsis
           thaliana
          Length = 509

 Score =  129 bits (325), Expect = 5e-29
 Identities = 66/179 (36%), Positives = 106/179 (59%), Gaps = 5/179 (2%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++ +ALD+S+G++YLH   I+HRD+K  N+L+D    +K+ADFGVARV+ ++   MT ET
Sbjct: 347 IVTVALDVSKGMNYLHQNNIIHRDLKTANLLMDEHEVVKVADFGVARVQTESGV-MTAET 405

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           GT  +MAPEV++ KPY+ + DV+S+ + LWE+                  +  + LRP+I
Sbjct: 406 GTYRWMAPEVIEHKPYDHRADVFSYAIVLWEL------------------LTGEGLRPKI 447

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM-----EAIDTSKGGGMIPEDQAGGCF 273
           P+     L  +++KCW  +P  RP   E++ ++     E ID S     + +D+ GG F
Sbjct: 448 PKETHPKLTELLEKCWQQDPALRPNFAEIIEMLNQLIREVIDLS-----LHKDKHGGYF 501



>gb:DDI297966_1376943 Dictyostelium discoideum mRNA for SHK1
           protein.
          Length = 527

 Score =  129 bits (324), Expect = 7e-29
 Identities = 66/168 (39%), Positives = 105/168 (62%), Gaps = 6/168 (3%)
 Frame = -1

Query: 812 KLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVE--A 645
           KL     +++A D + G+ +LHS     +HRD+K  N+L+D +  +K+ DFG+++++   
Sbjct: 136 KLPLITRMRMAKDAALGVLWLHSSNPVFIHRDLKTSNLLVDANLTVKVCDFGLSQIKQRG 195

Query: 644 QNPKD-MTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDL-SFAEVS 471
           +N KD   G  GT  +MAPEVL G+ +N K DVYSFG+ LW+I+     +P+  +F +  
Sbjct: 196 ENLKDGQDGAKGTPLWMAPEVLQGRLFNEKADVYSFGLVLWQIFTRQELFPEFDNFFKFV 255

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           +A+  + LRP IP  CP SL  +++KCWD NP+ RP  + +V  +E I
Sbjct: 256 AAICEKQLRPSIPDDCPKSLKELIQKCWDPNPEVRPSFEGIVSELEEI 303



>gb:AY056257_1563575 Arabidopsis thaliana putative serine/threonine
            kinase (At4g23050) mRNA, complete cds.
          Length = 735

 Score =  128 bits (321), Expect = 2e-28
 Identities = 64/169 (37%), Positives = 103/169 (60%), Gaps = 2/169 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD++RG++YLH +   IVHRD+K+ N+L+D + N+K+ DFG+++ +          
Sbjct: 566  LRMALDVARGMNYLHRRNPPIVHRDLKSSNLLVDKNWNVKVGDFGLSKWKNATFLSTKSG 625

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDV+SFGV LWE+    +P+  L+  +V   V   + R +
Sbjct: 626  KGTPQWMAPEVLRSEPSNEKCDVFSFGVILWELMTTLVPWDRLNSIQVVGVVGFMDRRLD 685

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPED 291
            +P      +ASI++ CW  +P KRP  +E++  M ++    G G   ED
Sbjct: 686  LPEGLNPRIASIIQDCWQTDPAKRPSFEELISQMMSLFRKPGSGAQEED 734



>pir|T05137|T05137 protein kinase homolog F7H19.240 - Arabidopsis
            thaliana>gb:ATCHRIV58_1546142 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 58.>gb:ATF7H19_1550948
            Arabidopsis thaliana DNA chromosome 4, BAC clone F7H19
            (ESSA project).>gb:AY062764_1565420 Arabidopsis thaliana
            putative serine/threonine kinase (F7H19.240) mRNA,
            complete cds.>gb:AY114692_1578734 Arabidopsis thaliana
            putative serine/threonine kinase (At4g23050) mRNA,
            complete cds.
          Length = 736

 Score =  128 bits (321), Expect = 2e-28
 Identities = 64/169 (37%), Positives = 103/169 (60%), Gaps = 2/169 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD++RG++YLH +   IVHRD+K+ N+L+D + N+K+ DFG+++ +          
Sbjct: 567  LRMALDVARGMNYLHRRNPPIVHRDLKSSNLLVDKNWNVKVGDFGLSKWKNATFLSTKSG 626

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDV+SFGV LWE+    +P+  L+  +V   V   + R +
Sbjct: 627  KGTPQWMAPEVLRSEPSNEKCDVFSFGVILWELMTTLVPWDRLNSIQVVGVVGFMDRRLD 686

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPED 291
            +P      +ASI++ CW  +P KRP  +E++  M ++    G G   ED
Sbjct: 687  LPEGLNPRIASIIQDCWQTDPAKRPSFEELISQMMSLFRKPGSGAQEED 735



>gb:AY099792_1576817 Arabidopsis thaliana MAP kinase, putative
            (At1g18160) mRNA, complete cds.
          Length = 992

 Score =  127 bits (318), Expect = 3e-28
 Identities = 62/171 (36%), Positives = 102/171 (59%), Gaps = 2/171 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD +RG++YLHS    IVHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 814  LRMALDAARGMNYLHSCNPVIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKVSTYLSSKST 873

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P ++KCDVYS+GV LWE++    P+  ++  +V  AV  Q+ R +
Sbjct: 874  AGTAEWMAPEVLRNEPADKKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLD 933

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPEDQA 285
            IP      +A I++KCW  +P  RP   E++  ++ +        +P   A
Sbjct: 934  IPEFVDPGIADIIRKCWQTDPRLRPSFGEIMDSLKQLQKPIQRAAVPSSSA 984



>gb:AF265343_2483211 Danio rerio protein kinase Npk mRNA, complete
           cds.
          Length = 371

 Score =  126 bits (317), Expect = 4e-28
 Identities = 59/170 (34%), Positives = 103/170 (60%), Gaps = 3/170 (1%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMT 624
           V+  A+++++G+ YLH++   K++HRD+K+ N++L     LKI DFG +++ +       
Sbjct: 138 VMTWAMEIAKGMHYLHAEAPLKVIHRDLKSRNVVLTADNVLKICDFGASKMVSHTTH--M 195

Query: 623 GETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
              GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+      +V+  VV ++ R
Sbjct: 196 SLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGFEGLQVAWLVVEKHER 255

Query: 443 PEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           P IP  CP+S A +M++CW+A P +RP+  +++  +E   T K    +P+
Sbjct: 256 PTIPSSCPASFADLMRRCWNAEPKERPQFKQILGTLE---TMKNDSRLPD 302



>gb:AP005797_1857950 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1131G07.
          Length = 864

 Score =  126 bits (317), Expect = 4e-28
 Identities = 62/151 (41%), Positives = 99/151 (65%), Gaps = 2/151 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD+++G++YLH+    IVHRD+K+ N+L+D +  +K++DFG++R++          
Sbjct: 699  LKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVKVSDFGMSRLKHHTFLSSKST 758

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDVYSFGV LWE+    +P+  L+  +V  AV  QN R E
Sbjct: 759  AGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLE 818

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            IP+     +A+I+  CW+ +P KRP   +++
Sbjct: 819  IPKEIDPLVATIISSCWENDPSKRPSFSQLL 849



>pir|F86316|F86316 protein T10O22.13 [imported] - Arabidopsis
            thaliana>gb:AE005172_890780 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC069551_1540954 Genomic sequence for
            Arabidopsis thaliana BAC T10O22 from chromosome I,
            complete sequence.
          Length = 988

 Score =  126 bits (316), Expect = 6e-28
 Identities = 62/171 (36%), Positives = 101/171 (59%), Gaps = 2/171 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD +RG++YLHS    IVHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 810  LRMALDAARGMNYLHSCNPVIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKVSTYLSSKST 869

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P + KCDVYS+GV LWE++    P+  ++  +V  AV  Q+ R +
Sbjct: 870  AGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLD 929

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPEDQA 285
            IP      +A I++KCW  +P  RP   E++  ++ +        +P   A
Sbjct: 930  IPEFVDPGIADIIRKCWQTDPRLRPSFGEIMDSLKQLQKPIQRAAVPSSSA 980



>gb:AB110951_1527048 Delphinium 'MagicFountains dark blue' EDR1 mRNA
            for enhanced disease resistance 1, complete cds.
          Length = 993

 Score =  125 bits (313), Expect = 1e-27
 Identities = 61/157 (38%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSK--KIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD++ G++ LH+    IVHRD+K+ N+L+D + N+K+ DFG++R++          
Sbjct: 811  IRMALDVAMGMNCLHTSIPTIVHRDLKSLNLLVDDNWNVKVCDFGLSRLKHNTFLSSKST 870

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDVYSFGV LWE+    LP+  ++  +V  AV  QN R +
Sbjct: 871  AGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATLRLPWTGMNQMQVVGAVGFQNRRLD 930

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP+     +A+I+++CW  +P+ RP   ++   ++++
Sbjct: 931  IPKELDPLVATIIRECWQTDPNLRPSFSQLTAALQSL 967



>gb:AY653733_2371681 Mimivirus, complete genome.
          Length = 1624

 Score =  124 bits (312), Expect = 2e-27
 Identities = 70/164 (42%), Positives = 98/164 (59%), Gaps = 2/164 (1%)
 Frame = -1

Query: 812  KLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
            K+ F   ++L    + G+ YLHS    IVHRD+K  N+L+D   N+KIADFG AR++  N
Sbjct: 1456 KITFANKLKLLYGAAMGIDYLHSSNPMIVHRDIKPANILVDEHFNVKIADFGFARIKEDN 1515

Query: 638  PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVV 459
               MT   GT  + APEV+ G+ Y  K DV+SFGV +WE+     P+ + +F +VS  ++
Sbjct: 1516 TT-MT-RCGTPCWTAPEVIRGEKYCEKADVFSFGVVMWEVLTGKEPFAECNFMKVSLDIL 1573

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
             +  RP IP  CP   A ++KKCW A   KRP M EVV+ +  I
Sbjct: 1574 -EGGRPIIPSDCPHEFAKLIKKCWHAKAHKRPTMTEVVQQLMLI 1616



 Score =  104 bits (260), Expect = 2e-21
 Identities = 55/170 (32%), Positives = 102/170 (60%), Gaps = 8/170 (4%)
 Frame = -1

Query: 812  KLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPK 633
            ++ + + I++A   S+G+ +LHS  IVHRD+K+ N+LLD+  N+K++DFG+ +V+++  K
Sbjct: 879  EIPYALKIKMAYQASKGMHFLHSSGIVHRDLKSLNLLLDSKWNVKVSDFGLTKVKSELDK 938

Query: 632  DMTGET--GTLGYMAPEVLDGKPY--NRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
              T +   GT+ ++APE+L+          DVYSFG+ LWE+   + PY  ++ A ++ +
Sbjct: 939  KKTNDNIIGTIHWIAPEILNDSTEVDYILADVYSFGIILWELLTREQPYKGMTPAAIAVS 998

Query: 464  VVRQNLRPEIPRCCPSS----LASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            V+R  +RP I     ++       ++K+CW ++   RP   E++  +  I
Sbjct: 999  VIRDGMRPPISDEAVTAHSIEYIDLIKQCWHSDTIIRPTFLEIMTRLSNI 1048



>pir|T08864|T08864 hypothetical protein A_TM017A05.2 - Arabidopsis
           thaliana
          Length = 346

 Score =  124 bits (311), Expect = 2e-27
 Identities = 65/185 (35%), Positives = 107/185 (57%), Gaps = 21/185 (11%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
           K+K AFK+  ++++ALD+++G+SYLH   I+HRD+K  N+L+D    +K+ADFGVARV+ 
Sbjct: 173 KQKCAFKLQTLLKVALDVAKGMSYLHQNNIIHRDLKTANLLMDEHGLVKVADFGVARVQI 232

Query: 644 QNPKDMTGETGTLGYMAPE-------------------VLDGKPYNRKCDVYSFGVCLWE 522
           ++   MT ETGT  +MAPE                   V++ KPYN K DV+S+ + LWE
Sbjct: 233 ESGV-MTAETGTYRWMAPEVFLSLIWHSYFDNKLAKTQVIEHKPYNHKADVFSYAIVLWE 291

Query: 521 IYCCDLPYPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVR 342
           +   D                   LRP+IP+     +  ++++CW  +P++RP  +E++ 
Sbjct: 292 LLTGD------------------GLRPKIPKKTHPKVKGLLERCWHQDPEQRPLFEEIIE 333

Query: 341 LMEAI 327
           +++ I
Sbjct: 334 MLQQI 338



>gb:AC116989_1207576 Dictyostelium discoideum chromosome 2 map
            4545040-4559643 strain AX4, complete sequence.
          Length = 2165

 Score =  124 bits (310), Expect = 3e-27
 Identities = 58/159 (36%), Positives = 97/159 (61%)
 Frame = -1

Query: 812  KLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPK 633
            KL   +++ +A D++RG+ +LH++ I+HRD+K+ N+L+D   N+KIAD G+AR E    +
Sbjct: 2005 KLDSTLILAIAFDIARGMQHLHTRNIIHRDLKSSNLLMDKHFNIKIADLGIAR-ETSFTQ 2063

Query: 632  DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQ 453
             MT   GT+ + APE+L  + YN+K DVYS+ + L+E+   + PY  +        V  +
Sbjct: 2064 TMT-TIGTVAWTAPEILRHESYNQKADVYSYAIVLYELLTGEEPYQGIPPMNAGILVASK 2122

Query: 452  NLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
             LRPE+P  C  +   ++  CW  +P+KRP  +E+   +
Sbjct: 2123 GLRPELPDNCDPNWKKLVVWCWSEDPNKRPSFEEITNYL 2161



>pir|T06576|T06576 probable protein kinase TCTR2 -
            tomato>gb:LEAJ5077_1684233 Lycopersicon esculentum mRNA
            for protein kinase TCTR2.
          Length = 982

 Score =  124 bits (310), Expect = 3e-27
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD+++G+  LH+    IVHRD+K+ N+L+DT  N+K+ DFG++R++          
Sbjct: 800  IKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKST 859

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCD+YSFGV LWE+    LP+  ++  +V  AV  QN R E
Sbjct: 860  AGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLE 919

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEV 348
            IP+     +A I+ +CW  +P+ RP   ++
Sbjct: 920  IPKELDPIVARIIWECWQTDPNLRPSFAQL 949



>gb:AY323913_1599368 Brassica juncea CTR1-like kinase kinase kinase
            mRNA, complete cds.>gb:AY323914_1599369 Brassica juncea
            CTR1-like kinase kinase kinase gene, complete cds.
          Length = 970

 Score =  123 bits (309), Expect = 4e-27
 Identities = 61/167 (36%), Positives = 100/167 (59%), Gaps = 2/167 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD +RG++YLHS    IVHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 786  LRMALDAARGMNYLHSCSPMIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKNSTYLSSKST 845

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P + KCDVYS+GV LWE++    P+  ++  +V  AV  Q+ R +
Sbjct: 846  AGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTLQQPWGRMNAMQVVGAVGFQHRRLD 905

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIP 297
            IP     ++A ++ KCW  +   RP   E++  ++ +     G  IP
Sbjct: 906  IPDFVDPAIAELISKCWQTDSKLRPSFAEIMVTLKKLQRPATGSNIP 952



>gb:AY140072_1582512 Arabidopsis thaliana protein kinase ATN1-like
           protein (At5g01850) mRNA, complete
           cds.>gb:BT002168_1635771 Arabidopsis thaliana protein
           kinase ATN1-like protein (At5g01850) mRNA, complete cds.
          Length = 333

 Score =  123 bits (309), Expect = 4e-27
 Identities = 66/175 (37%), Positives = 103/175 (58%), Gaps = 9/175 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLL-DTSRNLKIADFGVA 657
           L   R + L   + +  ALD++R L  LH+  I+HRD+K +N+LL +  +++K+ADFG+A
Sbjct: 106 LTSIRPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLADFGLA 165

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E+     MT ETGT  +MAPE+         + K YN K DVYSFG+ LWE+    +P
Sbjct: 166 REESVTEM-MTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNRMP 224

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           +  +S  + + A   +  RP +P     SLA I++ CW  +P+ RP   +++RL+
Sbjct: 225 FEGMSNLQAAYAAAFKQERPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLL 279



>gb:AY075641_1567782 Arabidopsis thaliana AT5g11850/F14F18_20 mRNA,
            complete cds.
          Length = 880

 Score =  123 bits (309), Expect = 4e-27
 Identities = 60/157 (38%), Positives = 100/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD+++G++YLH+    +VHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 708  MRMALDVAKGMNYLHTSHPTVVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHHTYLSSKST 767

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDVYSFGV LWE+    +P+  L+  +V  AV  QN R E
Sbjct: 768  AGTPEWMAPEVLRNEPANEKCDVYSFGVILWELATSRVPWKGLNPMQVVGAVGFQNRRLE 827

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP     ++A I+++CW   P  RP   ++++ ++ +
Sbjct: 828  IPDDIDLTVAQIIRECWQTEPHLRPSFTQLMQSLKRL 864



>gb:ATY14199_1557509 Arabidopsis thaliana mRNA for MAP3K delta-1
           protein kinase, partial.
          Length = 406

 Score =  123 bits (309), Expect = 4e-27
 Identities = 60/157 (38%), Positives = 100/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++ALD+++G++YLH+    +VHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 234 MRMALDVAKGMNYLHTSHPTVVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHHTYLSSKST 293

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT  +MAPEVL  +P N KCDVYSFGV LWE+    +P+  L+  +V  AV  QN R E
Sbjct: 294 AGTPEWMAPEVLRNEPANEKCDVYSFGVILWELATSRVPWKGLNPMQVVGAVGFQNRRLE 353

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           IP     ++A I+++CW   P  RP   ++++ ++ +
Sbjct: 354 IPDDIDLTVAQIIRECWQTEPHLRPSFTQLMQSLKRL 390



>pir|T52626|T52626 probable mitogen-activated protein kinase MAP3K
           delta-1 [imported] - Arabidopsis thaliana (fragment)
          Length = 406

 Score =  123 bits (309), Expect = 4e-27
 Identities = 60/157 (38%), Positives = 100/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++ALD+++G++YLH+    +VHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 234 MRMALDVAKGMNYLHTSHPTVVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHHTYLSSKST 293

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT  +MAPEVL  +P N KCDVYSFGV LWE+    +P+  L+  +V  AV  QN R E
Sbjct: 294 AGTPEWMAPEVLRNEPANEKCDVYSFGVILWELATSRVPWKGLNPMQVVGAVGFQNRRLE 353

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           IP     ++A I+++CW   P  RP   ++++ ++ +
Sbjct: 354 IPDDIDLTVAQIIRECWQTEPHLRPSFTQLMQSLKRL 390



>gb:AB049732_2046199 Mus musculus mRNA for MLTK-beta, complete cds.
          Length = 454

 Score =  123 bits (308), Expect = 5e-27
 Identities = 58/168 (34%), Positives = 100/168 (59%), Gaps = 3/168 (1%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++  + ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMEHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESM 263



>gb:AB049731_2046198 Mus musculus mRNA for MLTK alpha, complete
           cds.>gb:BC023718_2094228 Mus musculus RIKEN cDNA
           B230120H23 gene, mRNA (cDNA clone MGC:35825
           IMAGE:5346593), complete cds.
          Length = 802

 Score =  123 bits (308), Expect = 5e-27
 Identities = 58/168 (34%), Positives = 100/168 (59%), Gaps = 3/168 (1%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++  + ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMEHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESM 263



>gb:AF465843_1903498 Homo sapiens cervical cancer suppressor gene-4
           protein (HCCS-4) mRNA, complete cds.
          Length = 312

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/173 (35%), Positives = 102/173 (58%), Gaps = 5/173 (2%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++    ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI--DTS 318
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++  DTS
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTS 268



>gb:AF238255_1892403 Homo sapiens mixed lineage kinase ZAK mRNA,
           complete cds.
          Length = 800

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/173 (35%), Positives = 102/173 (58%), Gaps = 5/173 (2%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++    ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI--DTS 318
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++  DTS
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTS 268



>gb:AB049734_1867750 Homo sapiens mRNA for MLTK-beta, complete
           cds.>gb:AF325454_1896819 Homo sapiens mixed lineage
           kinase mRNA, partial cds.>gb:AF480462_1904642 Homo
           sapiens mixed lineage kinase-related kinase MRK-beta
           mRNA, complete cds.>gb:BC001401_1967558 Homo sapiens
           sterile alpha motif and leucine zipper containing kinase
           AZK, mRNA (cDNA clone MGC:808 IMAGE:3051317), complete
           cds.
          Length = 455

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/173 (35%), Positives = 102/173 (58%), Gaps = 5/173 (2%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++    ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI--DTS 318
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++  DTS
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTS 268



>gb:AB049733_1867749 Homo sapiens mRNA for MLTK-alpha, complete cds.
          Length = 800

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/173 (35%), Positives = 102/173 (58%), Gaps = 5/173 (2%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++    ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI--DTS 318
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++  DTS
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTS 268



>gb:AB030034_1865937 Homo sapiens mlklak mRNA for plaucible
           mixed-lineage kinase protein, complete cds.
          Length = 800

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/173 (35%), Positives = 102/173 (58%), Gaps = 5/173 (2%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++    ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI--DTS 318
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++  DTS
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTS 268



>gb:AY099627_1576652 Arabidopsis thaliana putative protein kinase
            (At1g73660) mRNA, complete cds.
          Length = 1030

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/167 (36%), Positives = 100/167 (59%), Gaps = 2/167 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD +RG++YLHS    IVHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 847  LRMALDAARGMNYLHSCNPMIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTYLSSKST 906

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P + KCDVYS+GV LWE++    P+  ++  +V  AV  Q+ R +
Sbjct: 907  AGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLD 966

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIP 297
            IP     ++A ++ KCW  +   RP   E++  ++ +     G  IP
Sbjct: 967  IPDFVDPAIADLISKCWQTDSKLRPSFAEIMASLKRLQKPVTGSNIP 1013



>gb:CQ834626_1453979 Sequence 497 from Patent
           WO2004058805.>gb:AF251441_1893024 Homo sapiens
           sterile-alpha motif and leucine zipper containing kinase
           AZK mRNA, complete cds.>gb:AF480461_1904641 Homo sapiens
           mixed lineage kinase-related kinase MRK-alpha mRNA,
           complete cds.
          Length = 800

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/173 (35%), Positives = 102/173 (58%), Gaps = 5/173 (2%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++    ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI--DTS 318
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++  DTS
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTS 268



>gb:AK045444_1167417 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230120H23 product:sterile-alpha motif and leucine
           zipper containing kinase AZK, full insert sequence.
          Length = 289

 Score =  123 bits (308), Expect = 5e-27
 Identities = 58/168 (34%), Positives = 100/168 (59%), Gaps = 3/168 (1%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++  + ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMEHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFQWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESM 263



>pir|F96763|F96763 hypothetical protein F25P22.8 [imported] -
            Arabidopsis thaliana>gb:AE005173_894912 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC012679_1537775 Arabidopsis thaliana
            chromosome 1 BAC F25P22 genomic sequence, complete
            sequence.
          Length = 1030

 Score =  123 bits (308), Expect = 5e-27
 Identities = 61/167 (36%), Positives = 100/167 (59%), Gaps = 2/167 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD +RG++YLHS    IVHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 847  LRMALDAARGMNYLHSCNPMIVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTYLSSKST 906

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P + KCDVYS+GV LWE++    P+  ++  +V  AV  Q+ R +
Sbjct: 907  AGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGFQHRRLD 966

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIP 297
            IP     ++A ++ KCW  +   RP   E++  ++ +     G  IP
Sbjct: 967  IPDFVDPAIADLISKCWQTDSKLRPSFAEIMASLKRLQKPVTGSNIP 1013



>gb:AY163574_1305768 Dictyostelium discoideum RGS-containing protein
            kinase RCK1 mRNA, complete cds.
          Length = 1123

 Score =  122 bits (307), Expect = 6e-27
 Identities = 60/167 (35%), Positives = 100/167 (59%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            + ++  ++F   +  AL ++RG+ YLHS  I+HRD+K+ N+LL     +KI DFG +RV 
Sbjct: 927  RDQRNNISFGQRLHFALGIARGMRYLHSMSIIHRDLKSMNILLTKRLKIKIVDFGTSRV- 985

Query: 647  AQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSS 468
              N  +MT   GT  +MAPE+   + Y  K DVYS+ + L+EI+     Y + +   + +
Sbjct: 986  -ANKYNMTTHVGTQAWMAPEIFTSRTYTNKVDVYSYAIILFEIFTRKSAYDENANINIPN 1044

Query: 467  AVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
             V++   RPE+P+   +S+++I+KKCW   P  RP   ++V  +E+I
Sbjct: 1045 MVMKGE-RPELPKDMQTSISNIIKKCWQQKPSNRPSFIKIVAYLESI 1090



>pir|T12956|T12956 hypothetical protein T6H20.50 - Arabidopsis
            thaliana>gb:ATT6H20_1556339 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T6H20.
          Length = 1171

 Score =  122 bits (307), Expect = 6e-27
 Identities = 67/185 (36%), Positives = 106/185 (57%), Gaps = 6/185 (3%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
            +A+D++ G+ YLH KKIVH D+K++N+L+   D  R + K+ D G+++V+ Q      G 
Sbjct: 997  IAMDIAFGMEYLHGKKIVHFDLKSDNLLVNLRDPHRPICKVGDLGLSKVKCQTLIS-GGV 1055

Query: 617  TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
             GTL +MAPE+L+G     + K DV+SFG+ LWE++  + PY DL +  +   +V   LR
Sbjct: 1056 RGTLPWMAPELLNGTSSLVSEKVDVFSFGIVLWELFTGEEPYADLHYGAIIGGIVSNTLR 1115

Query: 443  PEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPEDQAGGCFCFA 264
            P+IP  C      +M++CW A P +RP   E+V  +  + T      +P  + G      
Sbjct: 1116 PQIPDFCDMDWKLLMERCWSAEPSERPSFTEIVNELRTMATK-----LPSKEQGS----- 1165

Query: 263  PTRGP 249
             T+GP
Sbjct: 1166 -TQGP 1169



>gb:AY382677_1604093 Lycopersicon esculentum CTR1-like protein kinase
            (CTR4) gene, complete cds.>gb:AY382678_1604094
            Lycopersicon esculentum CTR1-like protein kinase (CTR4)
            mRNA, complete cds.
          Length = 793

 Score =  122 bits (306), Expect = 8e-27
 Identities = 59/155 (38%), Positives = 98/155 (63%), Gaps = 2/155 (1%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETG 612
            +A D+++G++YLH +K  +VHRD+K+ N+L+DT   +K+ DFG++R++A          G
Sbjct: 638  MAYDVAKGMNYLHKRKPPVVHRDLKSPNLLVDTKYTVKVCDFGLSRLKANTFLSSKSAAG 697

Query: 611  TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIP 432
            T  +MAPEVL  +P N K D+YSFGV LWE+     P+ +L+  +V +AV  + +R EIP
Sbjct: 698  TPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWSNLNPPQVVAAVGFKGMRLEIP 757

Query: 431  RCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R     + +I++ CW   P KRP    ++ +++ +
Sbjct: 758  RDLNHPVTTIIEACWVNEPWKRPSFSTIMDMLKPL 792



>gb:AY032953_1559419 Rosa hybrid cultivar CTR1-like protein kinase
            (CTR1) mRNA, complete cds.
          Length = 847

 Score =  122 bits (306), Expect = 8e-27
 Identities = 63/157 (40%), Positives = 97/157 (61%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            + +A D+++G++YLH +   IVHRD+K+ N+L+D    +K+ DFG++R++A         
Sbjct: 674  LYMAHDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSA 733

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N K DVYSFGV LWE+     P+ +L+ A+V +AV  +N R E
Sbjct: 734  AGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLE 793

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IPR     +ASI++ CW   P KRP    ++  +  +
Sbjct: 794  IPRDLNPQVASIIEACWANEPWKRPSFASIMESLRPL 830



>gb:AB025626_1516491 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MMJ24.>gb:AY058062_1564201 Arabidopsis
           thaliana AT3g27560/MMJ24_11 mRNA, complete
           cds.>gb:AY090300_1574052 Arabidopsis thaliana
           AT3g27560/MMJ24_11 mRNA, complete cds.
          Length = 356

 Score =  122 bits (306), Expect = 8e-27
 Identities = 65/175 (37%), Positives = 101/175 (57%), Gaps = 9/175 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTS-RNLKIADFGVA 657
           L   R K+L  ++ +  ALD++R +  LHS  I+HRD+K EN++L    + +K+ADFG+A
Sbjct: 114 LVSLRPKRLDIRLAVGFALDIARAMECLHSHGIIHRDLKPENLILSADHKTVKLADFGLA 173

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E+   + MT ETGT  +MAPE+         + K YN K D YSF + LWE+    LP
Sbjct: 174 REESLT-EMMTAETGTYRWMAPELYSTVTLRQGEKKHYNHKVDAYSFAIVLWELILNKLP 232

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           +  +S  + + A   +NLRP      P  L  I+  CW  +P++RP   E+++++
Sbjct: 233 FEGMSNLQAAYAAAFKNLRPS-AEDLPGDLEMIVTSCWKEDPNERPNFTEIIQML 286



>gb:CQ834624_1453978 Sequence 495 from Patent WO2004058805.
          Length = 800

 Score =  122 bits (306), Expect = 8e-27
 Identities = 58/168 (34%), Positives = 99/168 (58%), Gaps = 3/168 (1%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTSRNLKIADFGVARV 651
           R +++    ++  A D+++G+ YLH +   K++HRD+K+ N+++     LKI DFG +R 
Sbjct: 98  RSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRF 157

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              N        GT  +MAPEV+   P +  CD YS+GV LWE+   ++P+  L   +V+
Sbjct: 158 H--NHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVA 215

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
             VV +N R  IP  CP S A ++ +CW+A+  KRP   +++ ++E++
Sbjct: 216 WLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESM 263



>pir|S61766|S61766 protein kinase ATN1 (EC 2.7.1.-) - Arabidopsis
           thaliana>gb:ATATN1_1544107 A.thaliana mRNA for ATN1
           protein kinase.
          Length = 356

 Score =  122 bits (306), Expect = 8e-27
 Identities = 65/175 (37%), Positives = 101/175 (57%), Gaps = 9/175 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTS-RNLKIADFGVA 657
           L   R K+L  ++ +  ALD++R +  LHS  I+HRD+K EN++L    + +K+ADFG+A
Sbjct: 114 LVSLRPKRLDIRLAVGFALDIARAMECLHSHGIIHRDLKPENLILSADHKTVKLADFGLA 173

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E+   + MT ETGT  +MAPE+         + K YN K D YSF + LWE+    LP
Sbjct: 174 REESLT-EMMTAETGTYRWMAPELYSTVTLRQGEKKHYNHKVDAYSFAIVLWELILNKLP 232

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           +  +S  + + A   +NLRP      P  L  I+  CW  +P++RP   E+++++
Sbjct: 233 FEGMSNLQAAYAAAFKNLRPS-AEDLPGDLEMIVTSCWKEDPNERPNFTEIIQML 286



>gb:AF305913_1784487 Arabidopsis thaliana EDR1 (EDR1) mRNA, complete
            cds.
          Length = 933

 Score =  122 bits (305), Expect = 1e-26
 Identities = 61/158 (38%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD++ G++ LH+    IVHRD+K  N+L+D + N+K+ DFG++R++          
Sbjct: 768  IKMALDVAMGMNCLHTSTPTIVHRDLKTPNLLVDNNWNVKVGDFGLSRLKHNTFLSSKST 827

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDVYSFGV LWE+    LP+  ++  +V  AV  QN R E
Sbjct: 828  AGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATLRLPWRGMNPMQVVGAVGFQNRRLE 887

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
            IP+     +  I+ +CW  +P+ RP   ++  +++ ++
Sbjct: 888  IPKELDPVVGRIILECWQTDPNLRPSFAQLTEVLKPLN 925



>gb:AY382676_1604092 Lycopersicon esculentum CTR1-like protein kinase
            (CTR3) mRNA, complete cds.>gb:AY382679_1604095
            Lycopersicon esculentum CTR1-like protein kinase (CTR3)
            gene, complete cds.
          Length = 837

 Score =  122 bits (305), Expect = 1e-26
 Identities = 61/157 (38%), Positives = 97/157 (61%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            + +A D+++G++YLH +   IVHRD+K+ N+L+D    +K+ DFG++R++A         
Sbjct: 662  LSMAYDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSA 721

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N K DVYSFGV LWE+     P+ +L+ A+V +AV  +  R +
Sbjct: 722  AGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWSNLNPAQVVAAVGFKGKRLD 781

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IPR     +ASI++ CW   P KRP    ++ ++  +
Sbjct: 782  IPRDLTPQVASIIEACWAKEPWKRPSFAAIMDMLRPL 818



>gb:AE005172_889877 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC003981_1531285 Genomic sequence
            for Arabidopsis thaliana BAC F22O13 from chromosome I,
            complete sequence.
          Length = 2651

 Score =  122 bits (305), Expect = 1e-26
 Identities = 61/158 (38%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD++ G++ LH+    IVHRD+K  N+L+D + N+K+ DFG++R++          
Sbjct: 878  IKMALDVAMGMNCLHTSTPTIVHRDLKTPNLLVDNNWNVKVGDFGLSRLKHNTFLSSKST 937

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDVYSFGV LWE+    LP+  ++  +V  AV  QN R E
Sbjct: 938  AGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATLRLPWRGMNPMQVVGAVGFQNRRLE 997

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
            IP+     +  I+ +CW  +P+ RP   ++  +++ ++
Sbjct: 998  IPKELDPVVGRIILECWQTDPNLRPSFAQLTEVLKPLN 1035



>pir|T00726|T00726 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) F22O13.21 - Arabidopsis thaliana
          Length = 1015

 Score =  122 bits (305), Expect = 1e-26
 Identities = 61/158 (38%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD++ G++ LH+    IVHRD+K  N+L+D + N+K+ DFG++R++          
Sbjct: 850  IKMALDVAMGMNCLHTSTPTIVHRDLKTPNLLVDNNWNVKVGDFGLSRLKHNTFLSSKST 909

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDVYSFGV LWE+    LP+  ++  +V  AV  QN R E
Sbjct: 910  AGTPEWMAPEVLRNEPSNEKCDVYSFGVILWELATLRLPWRGMNPMQVVGAVGFQNRRLE 969

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
            IP+     +  I+ +CW  +P+ RP   ++  +++ ++
Sbjct: 970  IPKELDPVVGRIILECWQTDPNLRPSFAQLTEVLKPLN 1007



>gb:AF386508_1794704 Pyrus communis putative
           serine/threonine-specific protein kinase (CTR1) mRNA,
           partial cds.
          Length = 520

 Score =  121 bits (304), Expect = 1e-26
 Identities = 69/171 (40%), Positives = 104/171 (60%), Gaps = 6/171 (3%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           ++LALD+++G++YLH  +  IVH D+K+ N+L+D +   K+ DFG++R +A         
Sbjct: 347 LRLALDVAKGINYLHCLNPPIVHWDLKSPNLLVDKNWTAKVCDFGLSRFKANTFISSKSV 406

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT  +MAPE L G+P N K DVYSFGV LWE+     P+ +L+ A+V +AV  +N R E
Sbjct: 407 AGTPEWMAPEFLRGEPSNEKSDVYSFGVILWELATMQQPWGNLNPAQVVAAVGFKNKRLE 466

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPE----MDEVVRLMEAIDTSKGGGMIP 297
           IPR    ++A+I++ CW   P KRP     MD +  L++A  T      +P
Sbjct: 467 IPRDLNPNVAAIIEACWANEPWKRPSFAVIMDSLTPLIKAPVTQPSRADMP 517



>gb:LES318955_1684578 Lycopersicon esculentum tctr2 gene, exons 1-13.
          Length = 982

 Score =  121 bits (304), Expect = 1e-26
 Identities = 61/150 (40%), Positives = 94/150 (62%), Gaps = 2/150 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD+++G+   H+    IVHRD+K+ N+L+DT  N+K+ DFG++R++          
Sbjct: 800  IKMALDVAKGMDCSHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKST 859

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCD+YSFGV LWE+    LP+  ++  +V  AV  QN R E
Sbjct: 860  AGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLE 919

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEV 348
            IP+     +A I+ +CW  +P+ RP   ++
Sbjct: 920  IPKELDPIVARIIWECWQTDPNLRPSFAQL 949



>gb:AP005522_1853393 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0479H10.
          Length = 1078

 Score =  120 bits (302), Expect = 2e-26
 Identities = 57/157 (36%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD++RG++YLH  S  +VHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 903  LRMALDVARGMNYLHNCSPVVVHRDLKSPNLLVDKNWVVKVCDFGLSRMKNSTFLSSRST 962

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P + KCDV+S+GV LWE++    P+  ++  +V  AV  Q  R +
Sbjct: 963  AGTAEWMAPEVLRNEPSDEKCDVFSYGVILWELFTLLQPWEGMNPMQVVGAVGFQQRRLD 1022

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP     ++A I+++CW  +P  RP   E++  ++ +
Sbjct: 1023 IPAHVDPTIAEIIRRCWQTDPKMRPSFSEIMSSLKPL 1059



>gb:AY059769_1564621 Arabidopsis thaliana putative protein kinase
            (At1g67890) mRNA, complete cds.
          Length = 765

 Score =  120 bits (302), Expect = 2e-26
 Identities = 63/165 (38%), Positives = 100/165 (60%), Gaps = 2/165 (1%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L +  K KL  +  I +A D++RG++YLH  S  I+HRD+K+ N+L+D +  +K+ADFG+
Sbjct: 572  LLQRNKSKLDLRRRIHMASDIARGMNYLHHCSPPIIHRDLKSSNLLVDRNWTVKVADFGL 631

Query: 659  ARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
            +R++ +      G  GT  +MAPEVL  +  + K DVYSFGV LWE+    +P+ +L+  
Sbjct: 632  SRIKHETYLTTNGR-GTPQWMAPEVLRNEAADEKSDVYSFGVVLWELVTEKIPWENLNAM 690

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +V  AV   N R E+P+       ++M+ CW + P  RP   E++
Sbjct: 691  QVIGAVGFMNQRLEVPKDVDPQWIALMESCWHSEPQCRPSFQELM 735



>sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 (EC
            2.7.1.37).>pir|T48400|T48400 serine/threonine-protein
            kinase ctr1 - Arabidopsis thaliana>gb:ATF17C15_1548899
            Arabidopsis thaliana DNA chromosome 5, BAC clone F17C15
            (ESSA project).>gb:ATHCTR1A_1553136 Arabidopsis thaliana
            negative regulator of the ethylene response pathway
            (CTR1) mRNA, complete cds.>gb:ATHCTR1B_1553137
            Arabidopsis thaliana negative regulator of the ethylene
            response pathway (CTR1) gene, complete cds.
          Length = 821

 Score =  120 bits (302), Expect = 2e-26
 Identities = 62/157 (39%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            + +A D+++G++YLH++   IVHRD+K+ N+L+D    +K+ DFG++R++A         
Sbjct: 652  LSMAYDVAKGMNYLHNRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKASTFLSSKSA 711

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N K DVYSFGV LWE+     P+ +L+ A+V +AV  +  R E
Sbjct: 712  AGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKCKRLE 771

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IPR     +A+I++ CW   P KRP    ++ L+  +
Sbjct: 772  IPRNLNPQVAAIIEGCWTNEPWKRPSFATIMDLLRPL 808



>gb:HVU495779_1682731 Hordeum vulgare partial mRNA for putative
           protein kinase.
          Length = 226

 Score =  120 bits (301), Expect = 3e-26
 Identities = 62/162 (38%), Positives = 96/162 (59%), Gaps = 6/162 (3%)
 Frame = -1

Query: 785 LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
           + +D++ G+ YLH K IVH D+K+ N+L+   D  R + K+ D G+++V+ Q      G 
Sbjct: 58  IVMDVAFGMEYLHGKNIVHFDLKSNNLLVNLRDPQRPICKVGDLGLSKVKCQTLIS-GGV 116

Query: 617 TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
            GTL  MAPE+L+G     + K DV+SFG+ +WE+   + PY DL +  +   +V   LR
Sbjct: 117 RGTLPLMAPELLNGSSNLVSEKVDVFSFGIVMWELLTGEEPYADLHYGAIIGGIVNNTLR 176

Query: 443 PEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
           P +P  C     S+M++CW A P +RP   EVV+ + A+ TS
Sbjct: 177 PLVPESCDPQWRSLMEQCWSAEPTERPSFTEVVKRLRAMATS 218



>gb:AY321500_1599131 Cucumis sativus protein kinase mRNA, complete
           cds.
          Length = 352

 Score =  120 bits (301), Expect = 3e-26
 Identities = 65/175 (37%), Positives = 99/175 (56%), Gaps = 9/175 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTS-RNLKIADFGVA 657
           L   R + L   + I  ALD++R +  LHS  I+HRD+K EN++L    + +K+ADFG+A
Sbjct: 114 LLNLRPRSLELDVAIGFALDIARAMECLHSHGIIHRDLKPENLILTADHKTIKLADFGLA 173

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E+   + MT ETGT  +MAPE+         D K YN K D YSF + LWE+    LP
Sbjct: 174 REESVT-EMMTAETGTYRWMAPELYSTVTLKHGDKKHYNHKVDAYSFAIVLWELILNRLP 232

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           +  +S  + + A   +N+RP      P  LA I+  CW  +P+ RP   ++++++
Sbjct: 233 FEGMSNLQPAYAAAFKNMRPSAEN-LPEDLALIVTSCWREDPNTRPNFSQIIQML 286



>gb:AP004777_1844923 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0458B05.>gb:AP004879_1846485 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0475F05.
          Length = 783

 Score =  120 bits (300), Expect = 4e-26
 Identities = 61/166 (36%), Positives = 98/166 (59%), Gaps = 2/166 (1%)
 Frame = -1

Query: 818  KKKLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
            ++ L  K  + +A D+++G++YLH +   IVHRD+K+ N+L+D    +K+ DFG++R++A
Sbjct: 606  RENLDEKRRLSMAFDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKA 665

Query: 644  QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
                      GT  +MAPEV+  +P N K DVYSFGV LWE+     P+  L+ A+V +A
Sbjct: 666  NTFLSSKTAAGTPEWMAPEVIRDEPSNEKSDVYSFGVILWELMTLQQPWSTLNPAQVVAA 725

Query: 464  VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            V     R EIP      +A+IM+ CW   P +RP    ++  ++ +
Sbjct: 726  VGFNGRRLEIPSSVDPKVAAIMESCWTKEPWRRPSFASIMESLKPL 771



>gb:AC133007_1741305 Oryza sativa chromosome 3 BAC OSJNBa0094J08
           genomic sequence, complete sequence.
          Length = 383

 Score =  120 bits (300), Expect = 4e-26
 Identities = 64/177 (36%), Positives = 97/177 (54%), Gaps = 9/177 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRN-LKIADFGVA 657
           L   R  +L     I  ALD++  +  LH+  I+HRD+K +N+LL  +R  LK+ DFG+A
Sbjct: 147 LNSLRPSQLDIHTAIGYALDIAHAMECLHANGIIHRDLKPDNLLLTANRKKLKLTDFGLA 206

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E      MT ETGT  +MAPE+         + K Y  K DVYSFG+ LWE+    +P
Sbjct: 207 REETVTEM-MTAETGTYRWMAPELYSTVTLQRGEKKHYTNKVDVYSFGIVLWELLTNKMP 265

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEA 330
           +  +S  + + A   +  RP +P   P  L  I++ CW  +P  RP   +++R+++A
Sbjct: 266 FEGMSNLQAAYAAAFKQARPPLPEETPQELVFIVQSCWVEDPAMRPSFSQIIRMLDA 322



>pir|T48206|T48206 protein kinase ATN1-like protein - Arabidopsis
           thaliana>gb:ATT20L15_1555038 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T20L15 (ESSA project).
          Length = 356

 Score =  120 bits (300), Expect = 4e-26
 Identities = 66/175 (37%), Positives = 104/175 (59%), Gaps = 9/175 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLL-DTSRNLKIADFGVA 657
           L   R + L   + +  ALD++R L  LH+  I+HRD+K +N+LL +  +++K+ADFG+A
Sbjct: 130 LTSIRPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLADFGLA 189

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E+   + MT ETGT  +MAPE+         + K YN K DVYSFG+ LWE+    +P
Sbjct: 190 REESVT-EMMTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNRMP 248

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           +  +S  + + A   +  RP +P     SLA I++ CW  +P+ RP   +++RL+
Sbjct: 249 FEGMSNLQAAYAAAFKE-RPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLL 302



>sp|P83104|M3K7_DROME Putative mitogen-activated protein kinase
           kinase kinase 7 (EC 2.7.1.-).>gb:AE014297_1140522
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003732_1222515 Drosophila melanogaster
           chromosome 3R, section 70 of 118 of the complete
           sequence.
          Length = 393

 Score =  120 bits (300), Expect = 4e-26
 Identities = 70/175 (40%), Positives = 99/175 (56%), Gaps = 9/175 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHS--KKIVHRDVKAENMLL-DTSRNLKIADFG 663
           LY   K +   +  ++ AL  ++ L+YLHS  + IVHRD+K +NMLL +   +LKI DFG
Sbjct: 95  LYGDDKWEYTVEQAVRWALQCAKALAYLHSLDRPIVHRDIKPQNMLLYNQHEDLKICDFG 154

Query: 662 VARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPY----- 498
           +A   + N  DM G   TL YMAPE +    Y  KCDVYSFG+ LWE+    LPY     
Sbjct: 155 LATDMSNNKTDMQG---TLRYMAPEAIKHLKYTAKCDVYSFGIMLWELMTRQLPYSHLEN 211

Query: 497 PDLSFAEVSSAVVRQNLRPEIPRC-CPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           P+  +A + +    + L  E  R  CP  +  +M+ C D NP+KRP M E+ + +
Sbjct: 212 PNSQYAIMKAISSGEKLPMEAVRSDCPEGIKQLMECCMDINPEKRPSMKEIEKFL 266



>gb:AB024031_1515752 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K6A12.>gb:BT004621_1637655 Arabidopsis
           thaliana At5g50180 gene, complete cds.
          Length = 346

 Score =  119 bits (298), Expect = 7e-26
 Identities = 66/175 (37%), Positives = 98/175 (56%), Gaps = 9/175 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTS-RNLKIADFGVA 657
           L   R   L  ++ I  ALD++RG+  LHS  I+HRD+K EN+LL    + +K+ADFG+A
Sbjct: 108 LLNLRPACLETRVAIGFALDIARGMECLHSHGIIHRDLKPENLLLTADHKTVKLADFGLA 167

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E+   + MT ETGT  +MAPE+         + K YN K D YSF + LWE+    LP
Sbjct: 168 REESLT-EMMTAETGTYRWMAPELYSTVTLRLGEKKHYNHKVDAYSFAIVLWELLHNKLP 226

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           +  +S  + + A   +N+RP      P  L  I+  CW+ +P+ RP    ++ L+
Sbjct: 227 FEGMSNLQAAYAAAFKNVRPS-AESLPEELGDIVTSCWNEDPNARPNFTHIIELL 280



>pir|F86297|F86297 hypothetical protein F3O9.7 - Arabidopsis
            thaliana>gb:AE005172_890610 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:F3O9_1678274
            Arabidopsis thaliana chromosome 1 BAC F3O9 sequence,
            complete sequence.
          Length = 1147

 Score =  119 bits (298), Expect = 7e-26
 Identities = 61/162 (37%), Positives = 97/162 (59%), Gaps = 6/162 (3%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
            +A+D + G+ YLH+K IVH D+K +N+L+   D SR + K+ DFG+++++ +N     G 
Sbjct: 972  IAMDAAFGMEYLHAKNIVHFDLKCDNLLVNLKDPSRPICKVGDFGLSKIK-RNTLVSGGV 1030

Query: 617  TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
             GTL +MAPE+L+G     + K DV+SFG+ LWEI   + PY ++ +  +   +V   LR
Sbjct: 1031 RGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLR 1090

Query: 443  PEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
            P IP  C S    +M++CW  NP  RP   E+   +  + T+
Sbjct: 1091 PTIPSYCDSDWRILMEECWAPNPTARPSFTEIAGRLRVMSTA 1132



>gb:U01064_1401659 Dictyostelium discoideum AX2 protein tyrosine
           kinase mRNA, partial cds.
          Length = 422

 Score =  118 bits (296), Expect = 1e-25
 Identities = 61/165 (36%), Positives = 102/165 (61%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQ 642
           +K KL   ++ ++  DLS G+ +LHS +++HRD+ ++N+LLD  +N+KIADFG+A   + 
Sbjct: 226 QKIKLNPLMMYKMIHDLSLGMEHLHSIQMLHRDLTSKNILLDEFKNIKIADFGLATTLSD 285

Query: 641 NPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAV 462
           +   ++G T    + +PE+  G  YN K DVYSFG+ ++EIY   +P+  L     ++  
Sbjct: 286 D-MTLSGITNPR-WRSPELTKGLVYNEKVDVYSFGLVVYEIYTGKIPFEGLDGTASAAKA 343

Query: 461 VRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
             +N RP IP  CP SL  ++ KCW ++P +RP   E++  +E +
Sbjct: 344 AFENYRPAIPPDCPVSLRKLITKCWASDPSQRPSFTEILTELETM 388



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 24/77 (31%), Positives = 44/77 (57%)
 Frame = -1

Query: 554 DVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANP 375
           DVY++   LWE     LP+   +   V++ V  +NLRP+IP  CP  +  ++ +CW   P
Sbjct: 17  DVYAYAFVLWEALTSHLPFRKFNDISVAAKVAYENLRPKIPTSCPLFIRKLINRCWAPLP 76

Query: 374 DKRPEMDEVVRLMEAID 324
             RP  +++++L + ++
Sbjct: 77  SDRPTFNDILKLFDHLE 93



>gb:AE014296_1137022 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1137023 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE014296_1137024
           Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003516_1213691 Drosophila melanogaster
           chromosome 3L, section 69 of 83 of the complete
           sequence.>gb:AE003516_1213692 Drosophila melanogaster
           chromosome 3L, section 69 of 83 of the complete
           sequence.>gb:AE003516_1213693 Drosophila melanogaster
           chromosome 3L, section 69 of 83 of the complete
           sequence.>gb:AY094787_1297961 Drosophila melanogaster
           LD14856 full insert cDNA.
          Length = 977

 Score =  118 bits (296), Expect = 1e-25
 Identities = 52/150 (34%), Positives = 90/150 (60%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++  +  ++ G+ YLHS KI+HRD+K+ N+L+ T+  +KI+DFG +R E           
Sbjct: 249 LVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVVKISDFGTSR-EWNEISTKMSFA 307

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           GT+ +MAPEV+  +P + K D++S+GV LWE+  C++PY D+  + +   V   +L+  +
Sbjct: 308 GTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLTCEIPYKDVDSSAIIWGVGNNSLKLLV 367

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           P  CP     ++K CW + P  RP   +++
Sbjct: 368 PSTCPEGFKLLVKLCWKSKPRNRPSFRQIL 397



>pir|T18287|T18287 protein-tyrosine kinase (EC 2.7.1.112) - slime mold
             (Dictyostelium discoideum)>gb:DDU64830_1377377
            Dictyostelium discoideum AX2 protein tyrosine kinase
            gene, complete cds.
          Length = 1338

 Score =  118 bits (296), Expect = 1e-25
 Identities = 61/165 (36%), Positives = 102/165 (61%)
 Frame = -1

Query: 821  RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQ 642
            +K KL   ++ ++  DLS G+ +LHS +++HRD+ ++N+LLD  +N+KIADFG+A   + 
Sbjct: 1142 QKIKLNPLMMYKMIHDLSLGMEHLHSIQMLHRDLTSKNILLDEFKNIKIADFGLATTLSD 1201

Query: 641  NPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAV 462
            +   ++G T    + +PE+  G  YN K DVYSFG+ ++EIY   +P+  L     ++  
Sbjct: 1202 D-MTLSGITNPR-WRSPELTKGLVYNEKVDVYSFGLVVYEIYTGKIPFEGLDGTASAAKA 1259

Query: 461  VRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              +N RP IP  CP SL  ++ KCW ++P +RP   E++  +E +
Sbjct: 1260 AFENYRPAIPPDCPVSLRKLITKCWASDPSQRPSFTEILTELETM 1304



 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 43/162 (26%), Positives = 82/162 (50%), Gaps = 2/162 (1%)
 Frame = -1

Query: 812  KLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPK 633
            K+   + I+++ D++  +  LHSK + H ++ + ++ LD  + +K++          N  
Sbjct: 851  KIDMALFIKISKDIASVMGLLHSKDVAHGNLTSRSIYLDRFQIVKVS------FPKLNAT 904

Query: 632  DMTGETGTLGYMAPEVLDGKPYNRKC--DVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVV 459
            D+        YMAPE+   +     C  DVY++   LWE     LP+   +   V++ V 
Sbjct: 905  DLNNPAIEPRYMAPEMTRMEEDQISCSIDVYAYAFVLWEALTSHLPFRKFNDISVAAKVA 964

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
             +NLRP+IP  CP  +  ++ +CW   P  RP  +++++L +
Sbjct: 965  YENLRPKIPTSCPLFIRKLINRCWAPLPSDRPTFNDILKLFD 1006



>gb:AP004057_1837030 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1316_E06.
          Length = 189

 Score =  118 bits (295), Expect = 2e-25
 Identities = 63/152 (41%), Positives = 91/152 (59%), Gaps = 6/152 (3%)
 Frame = -1

Query: 785 LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
           LA+D + G+ YLH K IVH D+K EN+L+   D  R + KI D G+++V+ Q+     G 
Sbjct: 25  LAMDAAFGMEYLHGKNIVHFDLKCENLLVNMRDPQRPICKIGDLGLSKVK-QHTLVSGGV 83

Query: 617 TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
            GTL +MAPE+L GK    + K DVYSFG+ +WE+   + PY D+  A +   +V  +LR
Sbjct: 84  RGTLPWMAPELLSGKSNMVSEKIDVYSFGIVMWELLTGEEPYSDMRAAAIIGGIVNNSLR 143

Query: 443 PEIPRCCPSSLASIMKKCWDANPDKRPEMDEV 348
           P+IP  C     S+M+ CW + P  RP   E+
Sbjct: 144 PQIPSWCDPEWKSLMENCWASEPADRPSFTEI 175



>gb:AC117072_1207665 Dictyostelium discoideum chromosome 2 map
           3879572-4071762 strain AX4, complete sequence.
          Length = 1024

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/161 (35%), Positives = 98/161 (60%), Gaps = 3/161 (1%)
 Frame = -1

Query: 818 KKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGVAR-VE 648
           K +L+  + +++ +D+++G++YLH  S  I+HRD+K+ N+L+D + N+K++DFG++R + 
Sbjct: 451 KSELSLSVKVKMLIDVAQGMNYLHTYSPPIIHRDLKSLNLLVDNNFNVKVSDFGLSRFIS 510

Query: 647 AQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSS 468
                      GTL ++APEV +G  Y  K DVYSFG+ LWEI     P  ++S   +  
Sbjct: 511 GGIGSSAKTFCGTLSWIAPEVFNGSGYTTKVDVYSFGIVLWEILTHKQPSGNISATSLG- 569

Query: 467 AVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
                   PE+P  CP S + ++K+C + NPD+RP   +++
Sbjct: 570 -------HPELPSNCPQSFSDLIKECCNRNPDQRPNFSQIL 603



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 33/124 (26%), Positives = 64/124 (51%), Gaps = 10/124 (8%)
 Frame = -1

Query: 683  LKIADFGVARVEAQNPKDMTGET-GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD 507
            +K+ DFG++R   Q  ++   E  G   Y  PE+L    Y+ K D+YS  + L+E++   
Sbjct: 891  IKVHDFGLSRFNTQENEESLKEIKGNFLYSPPELLSLNTYSNKSDIYSLSIVLYELFETC 950

Query: 506  L------PYPDLSF---AEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMD 354
            L      PY +++     ++     + NLRP I    P+ ++ I+++ W ++   RP +D
Sbjct: 951  LTKTYKKPYHEVTLDFDFQIIHKTSKLNLRPTISNNMPNEISKILQQGWFSDSVLRPSLD 1010

Query: 353  EVVR 342
             +++
Sbjct: 1011 TIIK 1014



>gb:S77473_2139484 VNK=nonreceptor protein-tyrosine kinase [mice,
           mRNA Partial, 1656 nt].
          Length = 511

 Score =  117 bits (294), Expect = 2e-25
 Identities = 66/175 (37%), Positives = 99/175 (56%), Gaps = 5/175 (2%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 334 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 390

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 391 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 449

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV----RLMEAIDTSKGGGMIPEDQA 285
            P  CP S+ ++M  CW+A P +RP   ++V    R + ++  S  GG   E  A
Sbjct: 450 PPDGCPGSVHTLMGSCWEAEPARRPPFRKIVEKLGRDVRSVGVSAAGGQEAEGSA 504



>gb:AP005297_1850082 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1734_E02.
          Length = 991

 Score =  117 bits (294), Expect = 2e-25
 Identities = 57/157 (36%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD++RG++YLH+    IVHRD+K+ N+L+D +  +K+ DFG+++++ +        
Sbjct: 817  LRMALDVARGMNYLHNCTPVIVHRDLKSPNLLVDKNWVVKVCDFGLSKMKNKTFLSSRST 876

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P + KCDV+S+GV LWE+     P+  ++  +V  AV  QN R +
Sbjct: 877  AGTAEWMAPEVLRNEPSDEKCDVFSYGVILWELCTLLQPWEGMNAMQVVGAVGFQNRRLD 936

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP     ++A I+ KCW  +P  RP   +++  ++ +
Sbjct: 937  IPDNTDPAIAEIIAKCWQTDPKLRPSFADIMASLKPL 973



>gb:AP005297_1850081 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1734_E02.
          Length = 1111

 Score =  117 bits (294), Expect = 2e-25
 Identities = 57/157 (36%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD++RG++YLH+    IVHRD+K+ N+L+D +  +K+ DFG+++++ +        
Sbjct: 937  LRMALDVARGMNYLHNCTPVIVHRDLKSPNLLVDKNWVVKVCDFGLSKMKNKTFLSSRST 996

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P + KCDV+S+GV LWE+     P+  ++  +V  AV  QN R +
Sbjct: 997  AGTAEWMAPEVLRNEPSDEKCDVFSYGVILWELCTLLQPWEGMNAMQVVGAVGFQNRRLD 1056

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP     ++A I+ KCW  +P  RP   +++  ++ +
Sbjct: 1057 IPDNTDPAIAEIIAKCWQTDPKLRPSFADIMASLKPL 1093



>gb:AY738149_1626097 Zea mays salt-inducible protein kinase mRNA,
           complete cds.
          Length = 323

 Score =  117 bits (294), Expect = 2e-25
 Identities = 62/177 (35%), Positives = 103/177 (58%), Gaps = 6/177 (3%)
 Frame = -1

Query: 830 YKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFG 663
           Y  R+K+L       +A+D + GL YLHSK IVH D+K +N+L+   D SR + K+ DFG
Sbjct: 146 YLDRRKRLI------IAMDAAFGLEYLHSKNIVHVDLKCDNLLVNLKDQSRPICKVGDFG 199

Query: 662 VARVEAQNPKDMTGETGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDL 489
           +++++ +N     G  GTL +MAPE+L+G     + K DV+SFG+ +WEI   + PY ++
Sbjct: 200 LSKIK-RNTLASGGVRGTLPWMAPELLNGSSNKVSEKVDVFSFGIVMWEILTGEEPYANM 258

Query: 488 SFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
            +  +   +V   LRP +P  C      +M++CW  +P +RP   E+   + ++  +
Sbjct: 259 HYGAIIGGIVNNTLRPHVPASCDPEWRRLMEQCWAPDPAQRPAFTEIAGRLRSMSVA 315



>gb:AY347832_1177991 Malus x domestica clone 17-4 protein kinase
           mRNA, partial cds.
          Length = 142

 Score =  117 bits (293), Expect = 3e-25
 Identities = 58/133 (43%), Positives = 85/133 (63%)
 Frame = -1

Query: 677 IADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPY 498
           +ADFGVARV +Q+   MT ETGT  +MAPEV++ K Y+ K DV+SFGV LWE+    LPY
Sbjct: 1   VADFGVARVISQSGV-MTAETGTYRWMAPEVIEHKLYDHKADVFSFGVVLWELLTGKLPY 59

Query: 497 PDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
             L+  + +  VV++ LRP IP+  P  LA +++KCW  +P  RP+  E++ +++A+   
Sbjct: 60  EYLTPLQAAVGVVQKGLRPTIPKNTPPKLAELLEKCWQQDPKSRPDFLEIIEILQALAKE 119

Query: 317 KGGGMIPEDQAGG 279
            G G      +GG
Sbjct: 120 VGDGEERHKSSGG 132



>gb:AF416233_1269265 Drosophila melanogaster mixed lineage kinase
           (DMLK) mRNA, complete cds.
          Length = 1148

 Score =  117 bits (292), Expect = 3e-25
 Identities = 62/177 (35%), Positives = 102/177 (57%), Gaps = 11/177 (6%)
 Frame = -1

Query: 812 KLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTS--------RNLKIADF 666
           K+   +++  A+ ++RG++YLH++    I+HRD+K+ N+L+  +        + LKI DF
Sbjct: 219 KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDF 278

Query: 665 GVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLS 486
           G+AR E  N + M+   GT  +M PEV+    Y++  DV+S+GV LWE+   + PY    
Sbjct: 279 GLAR-EMYNTQRMSA-AGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFD 336

Query: 485 FAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSK 315
              V+  V    L   IP+ CP +  ++MK CW  +P KRP   E+++ +E+I  SK
Sbjct: 337 PLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSK 393



>gb:AE014298_1124768 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003443_1209950 Drosophila melanogaster
           chromosome X, section 27 of 74 of the complete
           sequence.>gb:AY045717_1289377 Drosophila melanogaster
           mixed lineage protein kinase (slpr) mRNA, complete cds.
          Length = 1161

 Score =  117 bits (292), Expect = 3e-25
 Identities = 62/177 (35%), Positives = 102/177 (57%), Gaps = 11/177 (6%)
 Frame = -1

Query: 812 KLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTS--------RNLKIADF 666
           K+   +++  A+ ++RG++YLH++    I+HRD+K+ N+L+  +        + LKI DF
Sbjct: 232 KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDF 291

Query: 665 GVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLS 486
           G+AR E  N + M+   GT  +M PEV+    Y++  DV+S+GV LWE+   + PY    
Sbjct: 292 GLAR-EMYNTQRMSA-AGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFD 349

Query: 485 FAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSK 315
              V+  V    L   IP+ CP +  ++MK CW  +P KRP   E+++ +E+I  SK
Sbjct: 350 PLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSK 406



>pir|B96827|B96827 hypothetical protein T8K14.1 [imported] -
            Arabidopsis thaliana>gb:AE005173_895478 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:T8K14_1724160 Arabidopsis thaliana
            chromosome 1 BAC T8K14 sequence, complete sequence.
          Length = 1248

 Score =  117 bits (292), Expect = 3e-25
 Identities = 63/165 (38%), Positives = 99/165 (60%), Gaps = 9/165 (5%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
            +A+D + G+ YLHSK  VH D+K +N+L+   D SR + K+ DFG+++++ +N     G 
Sbjct: 1073 IAMDAAFGMEYLHSKNTVHFDLKCDNLLVNLKDPSRPICKVGDFGLSKIK-RNTLVSGGV 1131

Query: 617  TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
             GTL +MAPE+L+G     + K DV+SFG+ LWEI   + PY ++ +  +   +V   LR
Sbjct: 1132 RGTLPWMAPELLNGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLR 1191

Query: 443  PEIPRCCPSSLASIMKKCWDANPDKRPEMDEV---VRLMEAIDTS 318
            P IP  C     ++M++CW  NP  RP   E+   +R+M +  TS
Sbjct: 1192 PTIPGFCDDEWRTLMEECWAPNPMARPSFTEIAGRLRVMSSAATS 1236



>gb:AB011482_1511484 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MUA2.
          Length = 1054

 Score =  116 bits (291), Expect = 5e-25
 Identities = 61/152 (40%), Positives = 90/152 (59%), Gaps = 6/152 (3%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
            +A+D + G+ YLH K IVH D+K EN+L+   D  R + KI D G+++V+ Q      G 
Sbjct: 890  IAMDTAFGMEYLHGKNIVHFDLKCENLLVNMRDPQRPICKIGDLGLSKVK-QKTLVSGGV 948

Query: 617  TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
             GTL +MAPE+L GK    + K DVYSFG+ +WE+   + PY D+  A +   +V   LR
Sbjct: 949  RGTLPWMAPELLSGKSNMVSEKIDVYSFGIVMWELLTGEEPYADMHCASIIGGIVNNALR 1008

Query: 443  PEIPRCCPSSLASIMKKCWDANPDKRPEMDEV 348
            P+IP+ C      +M+ CW + P +RP   E+
Sbjct: 1009 PKIPQWCDPEWKGLMESCWTSEPTERPSFTEI 1040



>gb:AB009052_1510657 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MNF13.
          Length = 353

 Score =  116 bits (291), Expect = 5e-25
 Identities = 65/189 (34%), Positives = 103/189 (54%), Gaps = 10/189 (5%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTS-RNLKIADFGVA 657
           L   R   L  ++ +  ALD++R +  LHS  ++HRD+K E+++L    + +K+ADFG+A
Sbjct: 114 LVSLRPGSLDIRVAVGYALDIARAMECLHSHGVIHRDLKPESLILTADYKTVKLADFGLA 173

Query: 656 RVEAQNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLP 501
           R E+     MT ETGT  +MAPE+         + K YN K D YSF + LWE+    LP
Sbjct: 174 REESLTEM-MTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDAYSFAIVLWELIHNKLP 232

Query: 500 YPDLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVR-LMEAID 324
           +  +S  + + A   +N+RP      P  LA I+  CW  +P+ RP   E+++ L+  + 
Sbjct: 233 FEGMSNLQAAYAAAFKNVRPSADD-LPKDLAMIVTSCWKEDPNDRPNFTEIIQMLLRCLS 291

Query: 323 TSKGGGMIP 297
           T     ++P
Sbjct: 292 TISSTELVP 300



>gb:BC066441_2554331 Danio rerio zgc:77370, mRNA (cDNA clone
           MGC:77370 IMAGE:6968966), complete cds.
          Length = 856

 Score =  116 bits (290), Expect = 6e-25
 Identities = 51/157 (32%), Positives = 95/157 (60%)
 Frame = -1

Query: 815 KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNP 636
           +K+   +++  A+ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E ++ 
Sbjct: 230 RKITPCLLVDWAMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSK-ELRDK 288

Query: 635 KDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVR 456
                  GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V  
Sbjct: 289 STKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEIPYKDVDSSAIIWGVGN 348

Query: 455 QNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +L+  +P  CP     ++++CW+  P  RP   +++
Sbjct: 349 NSLQLPLPDSCPDGFKILLRQCWNCKPRNRPSFRQIL 385



>gb:AP005558_1854032 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OJ1155_H10.>gb:AP006171_1861310 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OSJNBa0070E11.
          Length = 760

 Score =  116 bits (290), Expect = 6e-25
 Identities = 57/157 (36%), Positives = 97/157 (61%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            + +A D+++G++YLH +   IVHRD+K+ N+L+D    +K+ DFG++R++A         
Sbjct: 591  LNMAFDVAKGMNYLHKRSPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSL 650

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N K DVYSFGV LWE+     P+ +L+ A+V +AV  +  R +
Sbjct: 651  AGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELMTMQQPWCNLNPAQVVAAVGFKGRRLD 710

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP+     +A++++ CW   P +RP    ++  + ++
Sbjct: 711  IPKDLNPQVAALIESCWANEPWRRPSFANIMDSLRSL 747



>gb:AC020580_1538529 Arabidopsis thaliana chromosome 3 BAC F5E6
            genomic sequence, complete sequence.>gb:AY091084_1574311
            Arabidopsis thaliana putative protein kinase (At3g06620)
            mRNA, complete cds.>gb:AY123022_1579900 Arabidopsis
            thaliana putative protein kinase (At3g06620) mRNA,
            complete cds.
          Length = 773

 Score =  116 bits (290), Expect = 6e-25
 Identities = 61/165 (36%), Positives = 99/165 (60%), Gaps = 2/165 (1%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L +    KL ++  I +ALD++RG++YLH  S  I+HRD+K+ N+L+D +  +K+ADFG+
Sbjct: 579  LLQKSTSKLDWRRRIHMALDIARGMNYLHHCSPPIIHRDLKSSNLLVDKNWTVKVADFGL 638

Query: 659  ARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
            +R++ +         GT  +MAPEVL  +  + K D+YSFGV LWE+    +P+  L+  
Sbjct: 639  SRIKHETYLTSKSGKGTPQWMAPEVLRNESADEKSDIYSFGVVLWELATEKIPWETLNSM 698

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +V  AV   + R EIP+       S+M+ CW ++   RP   E++
Sbjct: 699  QVIGAVGFMDQRLEIPKDIDPRWISLMESCWHSDTKLRPTFQELM 743



>pir|T00486|T00486 serine/threonine-specific protein kinase homolog
            F19I3.28 - Arabidopsis thaliana>gb:AC004238_1531576
            Arabidopsis thaliana chromosome 2 clone F19I3 map ve016,
            complete sequence.
          Length = 1257

 Score =  116 bits (290), Expect = 6e-25
 Identities = 59/162 (36%), Positives = 96/162 (59%), Gaps = 6/162 (3%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
            +A+D + G+ YLHSK IVH D+K +N+L+   D +R + K+ DFG+++++ +N     G 
Sbjct: 1082 IAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIK-RNTLVTGGV 1140

Query: 617  TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
             GTL +MAPE+L G     + K DV+SFG+ LWEI   + PY ++ +  +   +V   LR
Sbjct: 1141 RGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLR 1200

Query: 443  PEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
            P +P  C      +M++CW  +P  RP   E+ R +  + +S
Sbjct: 1201 PTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIARRLRTMSSS 1242



>gb:AP004079_1837370 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1067_B01.
          Length = 352

 Score =  115 bits (289), Expect = 8e-25
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 9/171 (5%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTS-RNLKIADFGVARVEA 645
           R + L  ++ +  ALD++R +  LH+  I+HRD+K EN+LL    R +K+ D G+AR E 
Sbjct: 118 RPRSLEPRVAVGFALDIARAMECLHAHAIIHRDLKPENLLLTADQRTVKLVDLGLAREET 177

Query: 644 QNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLPYPDL 489
                MT ETGT  +MAPE+         + K YN K DVYSF + LWE+    LP+  +
Sbjct: 178 LTEM-MTAETGTYRWMAPELYSTVTLRHGEKKHYNHKVDVYSFAIVLWELLHNRLPFEGM 236

Query: 488 SFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
           S  + + A   +N+RP      P  L+ I+  CW   P++RP   ++V+++
Sbjct: 237 SNLQAAYAAAFKNIRPSADN-LPEELSEILTTCWKEEPNERPNFTQIVQML 286



>gb:AP003019_1824229 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC
            clone:OSJNBa0035I03.>gb:AP007257_1863434 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, BAC
            clone:OSJNBb0019L07.
          Length = 1273

 Score =  115 bits (289), Expect = 8e-25
 Identities = 57/161 (35%), Positives = 95/161 (59%), Gaps = 6/161 (3%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRN----LKIADFGVARVEAQNPKDMTGE 618
            +A+D++ G+ YLH K IVH D+K++N+L++         K+ D G+++V+ Q      G 
Sbjct: 1105 IAMDVAFGMEYLHEKNIVHFDLKSDNLLVNLRDPQHPICKVGDLGLSKVKCQTLIS-GGV 1163

Query: 617  TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
             GTL +MAPE+L+G     + K DV+SFG+ +WE+   + PY +L +  +   +V   LR
Sbjct: 1164 RGTLPWMAPELLNGSSSLVSEKVDVFSFGIVMWELLTGEEPYAELHYGAIIGGIVNNTLR 1223

Query: 443  PEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            P +P  C     S+M++CW + P +RP   EV + + A+ T
Sbjct: 1224 PPVPESCDPRWRSLMEQCWSSEPSERPSFTEVGKRLRAMAT 1264



>gb:AF305912_1784486 Hordeum vulgare EDR1 (EDR1) mRNA, complete cds.
          Length = 957

 Score =  115 bits (289), Expect = 8e-25
 Identities = 58/157 (36%), Positives = 97/157 (61%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSK--KIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD++RG++ LH+    IVHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 777  IKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKST 836

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +  N KCD+YSFGV LWE+     P+  ++  +V  AV  Q+ R +
Sbjct: 837  AGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMNQMQVVGAVGFQDRRLD 896

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP+     +ASI++ CW  +P+ RP   ++   ++ +
Sbjct: 897  IPKEVDPIVASIIRDCWQKDPNLRPSFIQLTSYLKTL 933



>gb:AF305911_1784485 Oryza sativa EDR1 (EDR1) mRNA, partial cds.
          Length = 903

 Score =  115 bits (289), Expect = 8e-25
 Identities = 58/157 (36%), Positives = 97/157 (61%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSK--KIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD+++G++ LH     IVHRD+K+ N+L+D + N+K+ DFG++R++          
Sbjct: 720  IKMALDVAKGMNCLHISVPTIVHRDLKSPNLLVDNNWNVKVCDFGLSRLKHSTFLSSKST 779

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +  N KCDVYSFGV LWE+    +P+  ++  +V  AV  Q+ R +
Sbjct: 780  AGTPEWMAPEVLRNEQSNEKCDVYSFGVILWELATLRMPWSGMNPMQVVGAVGFQDKRLD 839

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP+     +A I+ +CW  +P+ RP   ++   ++ +
Sbjct: 840  IPKEIDPLVARIIWECWQKDPNLRPSFAQLTSALKTV 876



>gb:AC084380_1733543 Oryza sativa chromosome 3 BAC OSJNBa0090P23
            genomic sequence, complete sequence.
          Length = 859

 Score =  115 bits (289), Expect = 8e-25
 Identities = 66/176 (37%), Positives = 102/176 (57%), Gaps = 7/176 (3%)
 Frame = -1

Query: 821  RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVAR 654
            + K L ++  I +A D + G+ YLHSK IVH D+K +N+L+   D SR + K+ADFG+++
Sbjct: 678  KNKYLDWRKRIMVAKDAAIGMEYLHSKDIVHFDLKCDNLLVNIKDPSRPICKVADFGLSK 737

Query: 653  VEAQNPKDMTGETGTLGYMAPEVL--DGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
            ++ Q      G  GTL +MAPE+L   G   + K DVYSFG+ +WEI   + PY  + + 
Sbjct: 738  MK-QATLVSGGMRGTLPWMAPELLTMSGTKVSEKIDVYSFGIVMWEILTGEDPYDGMHYG 796

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEV-VRLMEAIDTSK 315
             V   ++   LRP +P  C      +M++CW   P++RP   EV  RL   ++ S+
Sbjct: 797  GVIGGILSNTLRPLVPTSCNLEWRKLMEQCWSTEPERRPSFAEVATRLRSMLEASQ 852



>gb:AY167575_1586291 Oryza sativa (japonica cultivar-group) EDR1
            (EDR1) mRNA, complete cds.
          Length = 1017

 Score =  115 bits (289), Expect = 8e-25
 Identities = 58/157 (36%), Positives = 97/157 (61%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSK--KIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I++ALD+++G++ LH     IVHRD+K+ N+L+D + N+K+ DFG++R++          
Sbjct: 834  IKMALDVAKGMNCLHISVPTIVHRDLKSPNLLVDNNWNVKVCDFGLSRLKHSTFLSSKST 893

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +  N KCDVYSFGV LWE+    +P+  ++  +V  AV  Q+ R +
Sbjct: 894  AGTPEWMAPEVLRNEQSNEKCDVYSFGVILWELATLRMPWSGMNPMQVVGAVGFQDKRLD 953

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP+     +A I+ +CW  +P+ RP   ++   ++ +
Sbjct: 954  IPKEIDPLVARIIWECWQKDPNLRPSFAQLTSALKTV 990



>gb:AB100686_1526266 Delphinium 'MagicFountains dark blue' CTR1 mRNA
            for constitutive triple response 1-like protein kinase,
            complete cds.
          Length = 800

 Score =  115 bits (289), Expect = 8e-25
 Identities = 56/157 (35%), Positives = 94/157 (59%), Gaps = 2/157 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            I +A D+++G++YLH +   IVHRD+K+ N+L+D    +K+ DF ++R++A         
Sbjct: 627  ISMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDNMYTVKVCDFWLSRLKANTYLSAKSA 686

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +    KCD YSFGV LWE+     P+ +L+ A+V +AV  ++ R  
Sbjct: 687  AGTPEWMAPEVLRDEHQTEKCDGYSFGVILWELMTLQKPWNNLNQAQVVAAVGFKHKRLP 746

Query: 437  IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            IP      +A +++ CW  +P KRP    ++  ++++
Sbjct: 747  IPSSLDPDIAVLIEACWSKDPSKRPSFSSIMEYLQSL 783



>gb:DDIDPYK1A_1377077 D.discoideum protein-tyrosine kinase-1 (DPYK1)
           mRNA, complete cds.
          Length = 337

 Score =  115 bits (289), Expect = 8e-25
 Identities = 60/166 (36%), Positives = 97/166 (58%), Gaps = 15/166 (9%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLD----------TSRN---LKIADFG 663
           I ++LALD+++G++YLH  +  I+HRD+ + N+LLD          +SR     KI+DFG
Sbjct: 144 IRLKLALDIAKGMNYLHGWTPPILHRDLSSRNILLDHNIDPKNPLVSSRQDIKCKISDFG 203

Query: 662 VARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSF 483
           ++R++ +    MT   G + YMAPEV  G   + K DVYS+G+ L+E+   D P  D+  
Sbjct: 204 LSRLKKEQASQMTQSVGCIPYMAPEVFKGDSNSEKSDVYSYGMVLFELLTSDEPQQDMKP 263

Query: 482 AEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +++     ++ RP IP    S    I+ +CWD+NPD RP   +++
Sbjct: 264 MKMAHLAAYESYRPPIPLTTSSKWKEILTQCWDSNPDSRPTFKQII 309



>sp|P18160|KYK1_DICDI Non-receptor tyrosine kinase spore lysis A (EC
            2.7.1.112) (Tyrosine- protein kinase
            1).>pir|T18276|T18276 protein-tyrosine kinase (EC
            2.7.1.112) 1 - slime mold  (Dictyostelium
            discoideum)>gb:DDU32174_1377329 Dictyostelium discoideum
            spore lysis A (splA) gene, complete cds.
          Length = 1584

 Score =  115 bits (289), Expect = 8e-25
 Identities = 60/166 (36%), Positives = 97/166 (58%), Gaps = 15/166 (9%)
 Frame = -1

Query: 797  IVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLD----------TSRN---LKIADFG 663
            I ++LALD+++G++YLH  +  I+HRD+ + N+LLD          +SR     KI+DFG
Sbjct: 1391 IRLKLALDIAKGMNYLHGWTPPILHRDLSSRNILLDHNIDPKNPVVSSRQDIKCKISDFG 1450

Query: 662  VARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSF 483
            ++R++ +    MT   G + YMAPEV  G   + K DVYS+G+ L+E+   D P  D+  
Sbjct: 1451 LSRLKKEQASQMTQSVGCIPYMAPEVFKGDSNSEKSDVYSYGMVLFELLTSDEPQQDMKP 1510

Query: 482  AEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
             +++     ++ RP IP    S    I+ +CWD+NPD RP   +++
Sbjct: 1511 MKMAHLAAYESYRPPIPLTTSSKWKEILTQCWDSNPDSRPTFKQII 1556



>gb:AP004008_1836269 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OJ1226_A12.
          Length = 1112

 Score =  115 bits (288), Expect = 1e-24
 Identities = 59/162 (36%), Positives = 95/162 (58%), Gaps = 6/162 (3%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKKIVHRDVKAENMLL---DTSRNL-KIADFGVARVEAQNPKDMTGE 618
            +A+D + G+ YLH+K IVH D+K++N+L+   D  R + K+ D G+++V+ Q      G 
Sbjct: 947  IAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLIS-GGV 1005

Query: 617  TGTLGYMAPEVLDGKP--YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLR 444
             GTL +MAPE+L+G     + K DV+SFG+ LWE+   + PY DL +  +   +V   LR
Sbjct: 1006 RGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLR 1065

Query: 443  PEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
            P +P  C     S+M++CW   P +RP   E+   + ++  S
Sbjct: 1066 PAVPDSCDPEWRSLMEQCWSTEPSERPTFTEIAGRLRSMAAS 1107



>gb:AP003264_1826694 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0485G01.
          Length = 376

 Score =  115 bits (288), Expect = 1e-24
 Identities = 59/164 (35%), Positives = 95/164 (57%), Gaps = 1/164 (0%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQ 642
           +KKKL+++  +++  D+ RGL  +H  KIVHRD+K+ N L++    +KI DFG++RV   
Sbjct: 211 QKKKLSWRRRLKIVRDICRGLMCIHRMKIVHRDLKSANCLVNKHWTVKICDFGLSRVMTD 270

Query: 641 NPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAV 462
           +P       GT  +MAPE++  +P+  KCD++S GV +WE+     P+  +S  +V   V
Sbjct: 271 SPMTDNSSAGTPEWMAPELIRNEPFTEKCDIFSLGVIMWELCTLSRPWDGISPVQVVYTV 330

Query: 461 VRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV-RLME 333
             +  R EIP      L  ++  CW A P  RP   E++ RL++
Sbjct: 331 ANEGSRLEIPE---GPLGKLIADCW-AEPQDRPSCQEILTRLLD 370



>pir|B35670|B35670 protein-tyrosine kinase (EC 2.7.1.112) 2 - slime
           mold  (Dictyostelium discoideum) (fragment)
          Length = 410

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/179 (34%), Positives = 102/179 (56%), Gaps = 4/179 (2%)
 Frame = -1

Query: 818 KKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
           K K +F +V+++A D++ GL +LHS  IVHRD+ ++N+LLD   N+KI+DFG++  E   
Sbjct: 201 KVKYSFPLVLKMATDMALGLLHLHSITIVHRDLTSQNILLDELGNIKISDFGLS-AEKSR 259

Query: 638 PKDMTGETGTL---GYMAPEVLDGKP-YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              MT   G +    +  PE+      Y+ K DVY F + +WEI   ++P+ DL  ++ S
Sbjct: 260 EGSMTMTNGGICNPRWRPPELTKNLGHYSEKVDVYCFSLVVWEILTGEIPFSDLDGSQRS 319

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           + V    LRP IP  C   L  ++ +CW+A+P+ RP    +V  ++ I  +   G + +
Sbjct: 320 AQVAYAGLRPPIPEYCDPELKLLLTQCWEADPNDRPPFTYIVNKLKEISWNNPIGFVSD 378



>pir|T48544|T48544 MAP3K delta-1 protein kinase - Arabidopsis
            thaliana>gb:ATF14F18_1548531 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F14F18 (ESSA project).
          Length = 886

 Score =  115 bits (287), Expect = 1e-24
 Identities = 57/137 (41%), Positives = 90/137 (65%), Gaps = 2/137 (1%)
 Frame = -1

Query: 791  IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
            +++ALD+++G++YLH+    +VHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 748  MRMALDVAKGMNYLHTSHPTVVHRDLKSPNLLVDKNWVVKVCDFGLSRMKHHTYLSSKST 807

Query: 617  TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
             GT  +MAPEVL  +P N KCDVYSFGV LWE+    +P+  L+  +V  AV  QN R E
Sbjct: 808  AGTPEWMAPEVLRNEPANEKCDVYSFGVILWELATSRVPWKGLNPMQVVGAVGFQNRRLE 867

Query: 437  IPRCCPSSLASIMKKCW 387
            IP     ++A I+++CW
Sbjct: 868  IPDDIDLTVAQIIRECW 884



>sp|P18161|KYK2_DICDI Tyrosine-protein kinase 2 (EC 2.7.1.112)
           (Fragment).>gb:DDIDPYK2A_1377078 D.discoideum
           protein-tyrosine kinase-2 (DPYK2) mRNA, complete cds.
          Length = 410

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/179 (34%), Positives = 102/179 (56%), Gaps = 4/179 (2%)
 Frame = -1

Query: 818 KKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
           K K +F +V+++A D++ GL +LHS  IVHRD+ ++N+LLD   N+KI+DFG++  E   
Sbjct: 201 KVKYSFPLVLKMATDMALGLLHLHSITIVHRDLTSQNILLDELGNIKISDFGLS-AEKSR 259

Query: 638 PKDMTGETGTL---GYMAPEVLDGKP-YNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
              MT   G +    +  PE+      Y+ K DVY F + +WEI   ++P+ DL  ++ S
Sbjct: 260 EGSMTMTNGGICNPRWRPPELTKNLGHYSEKVDVYCFSLVVWEILTGEIPFSDLDGSQRS 319

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMIPE 294
           + V    LRP IP  C   L  ++ +CW+A+P+ RP    +V  ++ I  +   G + +
Sbjct: 320 AQVAYAGLRPPIPEYCDPELKLLLTQCWEADPNDRPPFTYIVNKLKEISWNNPIGFVSD 378



>gb:BC050050_1984251 Homo sapiens mitogen-activated protein kinase
           kinase kinase 12, mRNA (cDNA clone MGC:42552
           IMAGE:4824512), complete cds.
          Length = 567

 Score =  114 bits (286), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 394



>gb:AF283474S2_1894670 Homo sapiens zipper protein kinase (MAP3K12)
           gene, exons 2 through 15 and complete cds.
          Length = 859

 Score =  114 bits (286), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 212 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 270

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 271 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 330

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 331 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 361



>gb:AC036106_1539978 Arabidopsis thaliana chromosome 3 BAC T8E24
            genomic sequence, complete sequence.
          Length = 777

 Score =  114 bits (286), Expect = 2e-24
 Identities = 60/165 (36%), Positives = 97/165 (58%), Gaps = 2/165 (1%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L +    KL ++  I +ALD++RG++YLH  S  I+HRD+K+ N+L+D +  +K+ADFG+
Sbjct: 531  LLQRNMSKLDWRRRINMALDIARGMNYLHRCSPPIIHRDLKSSNLLVDKNLTVKVADFGL 590

Query: 659  ARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
            +R++           G   +MAPEVL  +  + K D+YSFGV LWE+    +P+ +L+  
Sbjct: 591  SRIKHHTYLTSKSGKGMPQWMAPEVLRNESADEKSDIYSFGVVLWELATEKIPWENLNSM 650

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +V  AV   N R EIP+       S+++ CW  +   RP   E++
Sbjct: 651  QVIGAVGFMNQRLEIPKDIDPDWISLIESCWHRDAKLRPTFQELM 695



>gb:AC020580_1538527 Arabidopsis thaliana chromosome 3 BAC F5E6
            genomic sequence, complete sequence.
          Length = 763

 Score =  114 bits (286), Expect = 2e-24
 Identities = 60/165 (36%), Positives = 97/165 (58%), Gaps = 2/165 (1%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L +    KL ++  I +ALD++RG++YLH  S  I+HRD+K+ N+L+D +  +K+ADFG+
Sbjct: 531  LLQRNMSKLDWRRRINMALDIARGMNYLHRCSPPIIHRDLKSSNLLVDKNLTVKVADFGL 590

Query: 659  ARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
            +R++           G   +MAPEVL  +  + K D+YSFGV LWE+    +P+ +L+  
Sbjct: 591  SRIKHHTYLTSKSGKGMPQWMAPEVLRNESADEKSDIYSFGVVLWELATEKIPWENLNSM 650

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +V  AV   N R EIP+       S+++ CW  +   RP   E++
Sbjct: 651  QVIGAVGFMNQRLEIPKDIDPDWISLIESCWHRDAKLRPTFQELM 695



>gb:CR858343_1182524 Pongo pygmaeus mRNA; cDNA DKFZp459K2433 (from
           clone DKFZp459K2433).
          Length = 892

 Score =  114 bits (286), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 394



>gb:AK029882_1161701 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4931421L15
           product:mitogen activated protein kinase kinase kinase
           12, full insert sequence.
          Length = 888

 Score =  114 bits (286), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 394



>pir|JC2363|JC2363 protein kinase (EC 2.7.1.37) ZPK - human
          Length = 668

 Score =  114 bits (286), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 212 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 270

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 271 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 330

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 331 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 361



>sp|P41243|MATK_RAT Megakaryocyte-associated tyrosine-protein kinase
           (EC 2.7.1.112) (Tyrosine-protein kinase CTK) (Protein
           kinase BATK).>pir|I56579|I56579 protein-tyrosine kinase
           (EC 2.7.1.112) batk - rat>gb:BC087726_2110190 Rattus
           norvegicus megakaryocyte-associated tyrosine kinase,
           mRNA (cDNA clone MGC:105436 IMAGE:7320205), complete
           cds.>gb:RATBATK_2131599 Rattus norvegicus non-receptor
           protein kinase (batk) gene, complete cds.
          Length = 467

 Score =  114 bits (286), Expect = 2e-24
 Identities = 59/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E +  K +    
Sbjct: 288 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAELR--KGLDSSR 345

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 346 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 404

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            P  CP  + ++M  CW+A P +RP   ++V
Sbjct: 405 PPDSCPGPVHTLMGSCWEAEPSRRPPFRKIV 435



>sp|Q60700|M3KC_MOUSE Mitogen-activated protein kinase kinase kinase
           12 (EC 2.7.1.37) (Leucine-zipper protein kinase) (ZPK)
           (Dual leucine zipper bearing kinase)
           (DLK).>pir|A55318|A55318 serine/threonine protein kinase
           (EC 2.7.1.-) DLK - mouse>gb:BC047158_2099475 Mus
           musculus mitogen activated protein kinase kinase kinase
           12, mRNA (cDNA clone MGC:54613 IMAGE:6494216), complete
           cds.>gb:BC057572_2102796 Mus musculus mitogen activated
           protein kinase kinase kinase 12, mRNA (cDNA clone
           MGC:67004 IMAGE:6401321), complete
           cds.>gb:MMU14636_2118509 Mus musculus serine/threonine
           protein kinase DLK mRNA, complete cds.
          Length = 888

 Score =  114 bits (286), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 394



>sp|Q12852|M3KC_HUMAN Mitogen-activated protein kinase kinase kinase
           12 (EC 2.7.1.37) (Leucine-zipper protein kinase)
           (ZPK).>gb:HSU07358_2021683 Human protein kinase (zpk)
           mRNA, complete cds.
          Length = 859

 Score =  114 bits (286), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 212 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 270

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 271 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 330

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 331 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 361



>gb:MUSCTK_2125597 Mouse mRNA for ctk, complete cds.
          Length = 465

 Score =  114 bits (285), Expect = 2e-24
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 287 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 343

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 344 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 402

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            P  CP S+ ++M  CW+A P +RP   ++V
Sbjct: 403 PPDGCPGSVHTLMGSCWEAEPARRPPFRKIV 433



>gb:MMU23789_2119365 Mus musculus zipper protein kinase (ZPK) mRNA,
           complete cds.
          Length = 888

 Score =  114 bits (285), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 90/151 (59%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW+  P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNTKPRNRPSFRQIL 394



>gb:MMHYLTK_2115419 M.musculus HYLTK gene.
          Length = 465

 Score =  114 bits (285), Expect = 2e-24
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 287 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 343

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 344 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 402

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            P  CP S+ ++M  CW+A P +RP   ++V
Sbjct: 403 PPDGCPGSVHTLMGSCWEAEPARRPPFRKIV 433



>gb:AK034374_1163734 Mus musculus adult male diencephalon cDNA,
           RIKEN full-length enriched library, clone:9330184H02
           product:mitogen activated protein kinase kinase kinase
           12, full insert sequence.
          Length = 888

 Score =  114 bits (285), Expect = 2e-24
 Identities = 49/151 (32%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNSKPRNRPSFRKIL 394



>gb:AK013606_1157580 Mus musculus adult male hippocampus cDNA, RIKEN
           full-length enriched library, clone:2900029A15
           product:megakaryocyte-associated tyrosine kinase, full
           insert sequence.
          Length = 465

 Score =  114 bits (285), Expect = 2e-24
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 287 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 343

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 344 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 402

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            P  CP S+ ++M  CW+A P +RP   ++V
Sbjct: 403 PPDGCPGSVHTLMGSCWEAEPARRPPFRKIV 433



>pir|S52076|S49313 protein kinase - slime mold (Dictyostelium
           discoideum)>gb:DDPROKING_1377239 D.discoideum gene for
           protein kinase.
          Length = 1094

 Score =  114 bits (285), Expect = 2e-24
 Identities = 66/166 (39%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = -1

Query: 785 LALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR-VEAQNPKDMTGETGT 609
           +ALD+S  +SYLHSK IVHRD+K+ N+L+D +  +K+ DFG AR VE  N K MT   GT
Sbjct: 126 IALDVSLAMSYLHSKSIVHRDLKSTNLLVDKNWKIKVCDFGFARIVEEDNNKSMT-ICGT 184

Query: 608 LGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYP---DLSFAEVSSAVVRQNLRPE 438
             +M+PE++ G  Y+ + D++SFG+ L EI     P P   D SF  ++  +VR  L   
Sbjct: 185 DNWMSPEMITGLDYDERSDIFSFGIVLLEIISRVKPAPYMRDASFG-LAEDIVRNQL--- 240

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGGGMI 300
           IP  CP SL  +   C   +P+ RP   E+ + ++ I T+    ++
Sbjct: 241 IPTDCPESLIDLTFNCCSVDPNNRPSFKEISQTLKQIKTTLDSNIV 286



>pir|I48926|I48926 protein-tyrosine kinase (EC 2.7.1.112) Ctk -
           mouse>gb:MMU05210_2118044 Mus musculus protein tyrosine
           kinase Ctk mRNA, complete cds.
          Length = 465

 Score =  114 bits (285), Expect = 2e-24
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 287 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 343

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 344 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 402

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            P  CP S+ ++M  CW+A P +RP   ++V
Sbjct: 403 PPDGCPGSVHTLMGSCWEAEPARRPPFRKIV 433



>pir|I59296|I59296 protein-tyrosine kinase (EC 2.7.1.112),
           megakoryocyte-associated - mouse>gb:MUSNTK_2129440 Mus
           musculus tyrosine protein kinase (Ntk) mRNA, complete
           cds.
          Length = 505

 Score =  114 bits (285), Expect = 2e-24
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 327 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 383

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 384 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 442

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            P  CP S+ ++M  CW+A P +RP   ++V
Sbjct: 443 PPDGCPGSVHTLMGSCWEAEPARRPPFRKIV 473



>sp|P41242|MATK_MOUSE Megakaryocyte-associated tyrosine-protein
           kinase (EC 2.7.1.112) (Tyrosine-protein kinase CTK)
           (Protein kinase NTK).
          Length = 505

 Score =  114 bits (285), Expect = 2e-24
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 1/151 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q AL ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 327 LLQFALHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 383

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    ++ K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 384 LPVKWTAPEALKNGRFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 442

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            P  CP S+ ++M  CW+A P +RP   ++V
Sbjct: 443 PPDGCPGSVHTLMGSCWEAEPARRPPFRKIV 473



>pir|JC5399|JC5399 dual leucine zipper kinase (EC 2.7.-.-) - rat
          Length = 888

 Score =  114 bits (284), Expect = 3e-24
 Identities = 48/151 (31%), Positives = 91/151 (60%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++Y+H  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYIHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW++ P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNSKPRNRPSFRQIL 394



>pir|T09911|T09911 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) T22A6.310 - Arabidopsis
            thaliana>gb:ATCHRIV61_1546331 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 61.>gb:ATT22A6_1555197
            Arabidopsis thaliana DNA chromosome 4, BAC clone T22A6
            (ESSA project).
          Length = 963

 Score =  114 bits (284), Expect = 3e-24
 Identities = 64/171 (37%), Positives = 97/171 (56%), Gaps = 2/171 (1%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L + R+ ++A  +V  +    ++GL+YLH  +  +VH D+K+ N+L+D +  +K+ DFG+
Sbjct: 769  LDQRRRLRMALDVVCAIP-HYAKGLNYLHCLNPPVVHWDLKSPNLLVDKNWTVKVCDFGL 827

Query: 659  ARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
            +R +A          GT  +MAPE L G+P N K DVYSFGV LWE+     P+  LS A
Sbjct: 828  SRFKANTFIPSKSVAGTPEWMAPEFLRGEPTNEKSDVYSFGVVLWELITLQQPWNGLSPA 887

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            +V  AV  QN R  IP      L S+M+ CW   P +RP    +V  ++ +
Sbjct: 888  QVVGAVAFQNRRLIIPPNTSPVLVSLMEACWADEPSQRPAFGSIVDTLKKL 938



>sp|Q63796|M3KC_RAT Mitogen-activated protein kinase kinase kinase
           12 (EC 2.7.1.37) (MAPK- upstream kinase)
           (MUK).>gb:RATPK_2133429 Rattus norvegicus mRNA for
           protein kinase (MUK), complete cds.
          Length = 888

 Score =  114 bits (284), Expect = 3e-24
 Identities = 49/151 (32%), Positives = 90/151 (59%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++  ++ ++ G++YLH  KI+HRD+K+ NML+     +KI+DFG ++ E  +       
Sbjct: 245 LLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSK-ELSDKSTKMSF 303

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V   +L   
Sbjct: 304 AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLP 363

Query: 437 IPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           +P  CP     ++++CW+  P  RP   +++
Sbjct: 364 VPSSCPDGFKILLRQCWNRKPRNRPSFRQIL 394



>gb:AY119549_1301118 Drosophila melanogaster GH26507 full insert
           cDNA.
          Length = 1161

 Score =  113 bits (283), Expect = 4e-24
 Identities = 61/177 (34%), Positives = 101/177 (57%), Gaps = 11/177 (6%)
 Frame = -1

Query: 812 KLAFKIVIQLALDLSRGLSYLHSK---KIVHRDVKAENMLLDTS--------RNLKIADF 666
           K+   +++  A+ ++RG++YLH++    I+HRD+K+ N+L+  +        + LKI DF
Sbjct: 232 KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDF 291

Query: 665 GVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLS 486
           G+AR E  N + M+   GT  +M PEV+    Y++   V+S+GV LWE+   + PY    
Sbjct: 292 GLAR-EMYNTQRMSA-AGTYAWMPPEVISVSTYSKFSYVWSYGVLLWELITGETPYKGFD 349

Query: 485 FAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSK 315
              V+  V    L   IP+ CP +  ++MK CW  +P KRP   E+++ +E+I  SK
Sbjct: 350 PLSVAYGVAVNTLTLPIPKTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSK 406



>gb:AC020580_1538528 Arabidopsis thaliana chromosome 3 BAC F5E6
           genomic sequence, complete sequence.>gb:AC036106_1539979
           Arabidopsis thaliana chromosome 3 BAC T8E24 genomic
           sequence, complete sequence.
          Length = 671

 Score =  113 bits (282), Expect = 5e-24
 Identities = 59/151 (39%), Positives = 93/151 (61%), Gaps = 2/151 (1%)
 Frame = -1

Query: 833 LYKXRKKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGV 660
           L +    KL ++  I +ALD++RG++YLH  S  I+HRD+K+ N+L+D +  +K+ADFG+
Sbjct: 519 LLQRSMSKLDWRRRINMALDIARGMNYLHCCSPPIIHRDLKSSNLLVDRNWTVKVADFGL 578

Query: 659 ARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
           +R++ Q         GT  +MAPEVL  +  + K D+YSFGV LWE+    +P+ +L+  
Sbjct: 579 SRIKHQTYLTSKSGKGTPQWMAPEVLRNESADEKSDIYSFGVVLWELATEKIPWENLNSM 638

Query: 479 EVSSAVVRQNLRPEIPRCCPSSLASIMKKCW 387
           +V  AV   N R EIP+       S+++ CW
Sbjct: 639 QVIGAVGFMNQRLEIPKDTDPDWISLIESCW 669



>gb:AK176081_1818069 Arabidopsis thaliana mRNA for protein kinase
           ATN1-like protein, partial cds, clone: RAFL22-83-O17.
          Length = 317

 Score =  112 bits (281), Expect = 7e-24
 Identities = 65/167 (38%), Positives = 95/167 (56%), Gaps = 9/167 (5%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLL-DTSRNLKIADFGVARVEA 645
           R K L  K+ I  ALD++RG+ +L++  I+HRD+K  NMLL    +++K+ADFG+AR E 
Sbjct: 76  RPKPLDLKLSISFALDIARGMEFLNANGIIHRDLKPSNMLLTGDQKHVKLADFGLAREET 135

Query: 644 QNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLPYPDL 489
           +    MT E GT  +MAPE+         + K Y+ K DVYSF +  WE+     P+   
Sbjct: 136 KG--FMTFEAGTYRWMAPELFSYDTLEIGEKKHYDHKVDVYSFAIVFWELLTNKTPFKGK 193

Query: 488 SFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEV 348
           +   V+ A   +N RP +    P  + SI++ CW  NPD RPE  E+
Sbjct: 194 NNIFVAYA-ASKNQRPSVEN-LPEGVVSILQSCWAENPDARPEFKEI 238



>gb:AB018119_1513893 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSN2.
          Length = 405

 Score =  112 bits (281), Expect = 7e-24
 Identities = 65/167 (38%), Positives = 95/167 (56%), Gaps = 9/167 (5%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLL-DTSRNLKIADFGVARVEA 645
           R K L  K+ I  ALD++RG+ +L++  I+HRD+K  NMLL    +++K+ADFG+AR E 
Sbjct: 164 RPKPLDLKLSISFALDIARGMEFLNANGIIHRDLKPSNMLLTGDQKHVKLADFGLAREET 223

Query: 644 QNPKDMTGETGTLGYMAPEVL--------DGKPYNRKCDVYSFGVCLWEIYCCDLPYPDL 489
           +    MT E GT  +MAPE+         + K Y+ K DVYSF +  WE+     P+   
Sbjct: 224 KG--FMTFEAGTYRWMAPELFSYDTLEIGEKKHYDHKVDVYSFAIVFWELLTNKTPFKGK 281

Query: 488 SFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEV 348
           +   V+ A   +N RP +    P  + SI++ CW  NPD RPE  E+
Sbjct: 282 NNIFVAYA-ASKNQRPSVEN-LPEGVVSILQSCWAENPDARPEFKEI 326



>gb:BC081976_2108214 Rattus norvegicus cDNA clone MGC:94134
           IMAGE:7127060, complete cds.
          Length = 563

 Score =  112 bits (280), Expect = 9e-24
 Identities = 50/157 (31%), Positives = 92/157 (58%)
 Frame = -1

Query: 815 KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNP 636
           +K+  ++++  +  ++ G++YLH  KI+HRD+K+ N+L+  +  +KI+DFG ++ E  + 
Sbjct: 249 RKITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGTSK-ELSDK 307

Query: 635 KDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVR 456
                  GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V  
Sbjct: 308 STKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGS 367

Query: 455 QNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +L   +P  CP     +MK+ W + P  RP   + +
Sbjct: 368 NSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTL 404



>gb:AB001872_1863573 Homo sapiens mRNA for leucine zipper bearing
           kinase, complete cds.
          Length = 966

 Score =  112 bits (280), Expect = 9e-24
 Identities = 50/157 (31%), Positives = 92/157 (58%)
 Frame = -1

Query: 815 KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNP 636
           +K+  ++++  +  ++ G++YLH  KI+HRD+K+ N+L+  +  +KI+DFG ++ E  + 
Sbjct: 249 RKITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGTSK-ELSDK 307

Query: 635 KDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVR 456
                  GT+ +MAPEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V  
Sbjct: 308 STKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGS 367

Query: 455 QNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +L   +P  CP     +MK+ W + P  RP   + +
Sbjct: 368 NSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTL 404



>gb:AK084850_1174343 Mus musculus 13 days embryo lung cDNA, RIKEN
            full-length enriched library, clone:D430001L02
            product:fibroblast growth factor receptor 4, full insert
            sequence.
          Length = 799

 Score =  112 bits (280), Expect = 9e-24
 Identities = 61/164 (37%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F  ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 581  LSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYY 640

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 641  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 699

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R E P  CPS L  +M++CW A P +RP   ++V  ++ +
Sbjct: 700  REGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKV 743



>pir|JC1450|JC1450 fibroblast growth factor receptor 4 -
           rat>gb:RATFGR4A_2132196 Rattus sp. fibroblast growth
           factor receptor subtype 4 (FGFR4) mRNA, complete cds.
          Length = 650

 Score =  112 bits (280), Expect = 9e-24
 Identities = 61/164 (37%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809 LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
           L+F  ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 432 LSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYY 491

Query: 629 MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 492 KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 550

Query: 458 RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           R+  R E P  CPS L  +M++CW A P +RP   ++V  ++ +
Sbjct: 551 REGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKV 594



>gb:BC033313_2097437 Mus musculus fibroblast growth factor receptor 4,
            mRNA (cDNA clone MGC:30362 IMAGE:5132831), complete cds.
          Length = 799

 Score =  112 bits (279), Expect = 1e-23
 Identities = 61/164 (37%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F  ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 581  LSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYY 640

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 641  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 699

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R E P  CPS L  +M++CW A P +RP   ++V  ++ +
Sbjct: 700  REGHRMERPPNCPSELYGLMRECWHAVPSQRPTFKQLVEALDKV 743



>gb:AP005613_1854944 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0082C09.
          Length = 790

 Score =  112 bits (279), Expect = 1e-23
 Identities = 58/164 (35%), Positives = 97/164 (59%), Gaps = 1/164 (0%)
 Frame = -1

Query: 821  RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQ 642
            +K KL+++  +++  D+ RGL  +H  KIVHRD+K+ N L++    +K+ DFG++RV + 
Sbjct: 625  QKGKLSWRRRLKMLRDICRGLMCMHRLKIVHRDLKSANCLVNKHWAVKLCDFGLSRVMSN 684

Query: 641  NPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAV 462
            +  +     GT  +MAPE++  +P+  KCD++S GV +WE+     P+  +   +V   V
Sbjct: 685  SAMNDNSSAGTPEWMAPELIRNEPFTEKCDIFSLGVIMWELCTLSRPWEGIPSVQVVYNV 744

Query: 461  VRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV-RLME 333
              +  R EIP      L S++  CW A PDKRP   E++ RL++
Sbjct: 745  ANEGARLEIP---DGPLGSLIADCW-AEPDKRPGCQEILTRLLD 784



>gb:AY029067_1559204 Rosa hybrid cultivar CTR2 protein kinase mRNA,
           partial cds.
          Length = 227

 Score =  112 bits (279), Expect = 1e-23
 Identities = 58/141 (41%), Positives = 89/141 (63%), Gaps = 2/141 (1%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +++ALD++RG++ LHS    IVHRD+K+ N+L+D + N+K+ DFG++R++          
Sbjct: 87  LKMALDVARGMNCLHSSNPTIVHRDLKSPNLLVDKNWNVKVGDFGLSRLKHNTFLSSKST 146

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT  +MAPEVL  +  N KCDVYSFGV LWE+    L +  ++  +V  AV  QN R +
Sbjct: 147 AGTPEWMAPEVLRNENSNEKCDVYSFGVILWELATLKLAWSGMNPMQVVGAVGFQNRRLD 206

Query: 437 IPRCCPSSLASIMKKCWDANP 375
           IP+     +A I+ +CW  +P
Sbjct: 207 IPKEVDPPVARIIWQCWQNDP 227



>pir|F96701|F96701 hypothetical protein T23K23.26 [imported] -
            Arabidopsis thaliana>gb:AE005173_894411 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC012563_1537765 Arabidopsis thaliana
            chromosome 1 BAC T23K23 genomic sequence, complete
            sequence.
          Length = 738

 Score =  112 bits (279), Expect = 1e-23
 Identities = 59/151 (39%), Positives = 93/151 (61%), Gaps = 2/151 (1%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLH--SKKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L +  K KL  +  I +A D++RG++YLH  S  I+HRD+K+ N+L+D +  +K+ADFG+
Sbjct: 572  LLQRNKSKLDLRRRIHMASDIARGMNYLHHCSPPIIHRDLKSSNLLVDRNWTVKVADFGL 631

Query: 659  ARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFA 480
            +R++ +      G  GT  +MAPEVL  +  + K DVYSFGV LWE+    +P+ +L+  
Sbjct: 632  SRIKHETYLTTNGR-GTPQWMAPEVLRNEAADEKSDVYSFGVVLWELVTEKIPWENLNAM 690

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCW 387
            +V  AV   N R E+P+       ++M+ CW
Sbjct: 691  QVIGAVGFMNQRLEVPKDVDPQWIALMESCW 721



>gb:HSFGFR4G_2013214 Homo sapiens FGFR-4 gene.
          Length = 802

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/164 (35%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F +++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 584  LSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYY 643

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 644  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 702

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R + P  CP  L  +M++CW A P +RP   ++V  ++ +
Sbjct: 703  REGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKV 746



>gb:AF487555_1904814 Homo sapiens fibroblast growth factor receptor 4
            (FGFR4) gene, complete cds.
          Length = 802

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/164 (35%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F +++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 584  LSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYY 643

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 644  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 702

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R + P  CP  L  +M++CW A P +RP   ++V  ++ +
Sbjct: 703  REGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKV 746



>gb:AF359246_1898884 Homo sapiens fibroblast growth factor receptor
           4 variant mRNA, complete cds.
          Length = 592

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/164 (35%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809 LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
           L+F +++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 374 LSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYY 433

Query: 629 MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 434 KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 492

Query: 458 RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           R+  R + P  CP  L  +M++CW A P +RP   ++V  ++ +
Sbjct: 493 REGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKV 536



>gb:AF202063_1889830 Homo sapiens fibroblast growth factor receptor 4,
            soluble-form splice variant (FGFR4) mRNA, complete cds.
          Length = 762

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/164 (35%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F +++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 544  LSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYY 603

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 604  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 662

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R + P  CP  L  +M++CW A P +RP   ++V  ++ +
Sbjct: 663  REGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKV 706



>gb:A27171_1448223 Tyrosine kinase receptor gene.
          Length = 802

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/164 (35%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F +++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 584  LSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYY 643

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 644  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 702

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R + P  CP  L  +M++CW A P +RP   ++V  ++ +
Sbjct: 703  REGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKV 746



>pir|S15345|TVHUF4 fibroblast growth factor receptor 4 precursor -
            human>gb:HSFGFR4_2013213 Human FGFR-4 mRNA for fibroblast
            growth factor receptor (FGFR-4).
          Length = 802

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/164 (35%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F +++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 584  LSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYY 643

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 644  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 702

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R + P  CP  L  +M++CW A P +RP   ++V  ++ +
Sbjct: 703  REGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKV 746



>sp|P22455|FGR4_HUMAN Fibroblast growth factor receptor 4 precursor
            (EC 2.7.1.112) (FGFR-4).>gb:BC011847_1973256 Homo sapiens
            fibroblast growth factor receptor 4, transcript variant
            3, mRNA (cDNA clone MGC:20292 IMAGE:4121396), complete
            cds.>gb:HUMFGFR4X_2031108 Human fibroblast growth factor
            receptor 4 (FGFR4) mRNA, complete cds.
          Length = 802

 Score =  111 bits (278), Expect = 1e-23
 Identities = 59/164 (35%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F +++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 584  LSFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYY 643

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SFG+ LWEI+     PYP +   E+ S ++
Sbjct: 644  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFS-LL 702

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R + P  CP  L  +M++CW A P +RP   ++V  ++ +
Sbjct: 703  REGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKV 746



>gb:AF110519_1768823 Lycopersicon esculentum ethylene-inducible
            CTR1-like protein kinase mRNA, complete cds.
          Length = 806

 Score =  111 bits (277), Expect = 2e-23
 Identities = 61/163 (37%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = -1

Query: 818  KKKLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
            KK L  +  + LA D++ G++YLH +   IVHRD+K+ N+L+D    +KI DFG++R +A
Sbjct: 624  KKVLDERRPLCLAYDVANGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKICDFGLSRFKA 683

Query: 644  QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
                      GT  +MAPEV+  +P N K DVYSFGV LWE+     P+  L+  +V +A
Sbjct: 684  NTFLSSKTAAGTPEWMAPEVIRDEPSNEKSDVYSFGVILWELATLQQPWNKLNPPQVIAA 743

Query: 464  VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            V     + +IP      +A I++ CW   P KRP    ++ ++
Sbjct: 744  VGFNRKKLDIPSVLNPRVAIIIEACWANEPWKRPSFSTIMDML 786



>gb:AF110518_1768822 Lycopersicon esculentum ethylene-inducible
            CTR1-like protein kinase mRNA, complete cds.
          Length = 829

 Score =  111 bits (277), Expect = 2e-23
 Identities = 61/163 (37%), Positives = 93/163 (57%), Gaps = 2/163 (1%)
 Frame = -1

Query: 818  KKKLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
            KK L  +  + LA D++ G++YLH +   IVHRD+K+ N+L+D    +KI DFG++R +A
Sbjct: 647  KKVLDERRPLCLAYDVANGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKICDFGLSRFKA 706

Query: 644  QNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA 465
                      GT  +MAPEV+  +P N K DVYSFGV LWE+     P+  L+  +V +A
Sbjct: 707  NTFLSSKTAAGTPEWMAPEVIRDEPSNEKSDVYSFGVILWELATLQQPWNKLNPPQVIAA 766

Query: 464  VVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            V     + +IP      +A I++ CW   P KRP    ++ ++
Sbjct: 767  VGFNRKKLDIPSVLNPRVAIIIEACWANEPWKRPSFSTIMDML 809



>gb:CR859621_1183728 Pongo pygmaeus mRNA; cDNA DKFZp459C184 (from
           clone DKFZp459C184).
          Length = 966

 Score =  111 bits (277), Expect = 2e-23
 Identities = 49/157 (31%), Positives = 92/157 (58%)
 Frame = -1

Query: 815 KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNP 636
           +K+  ++++  +  ++ G++YLH  KI+HRD+K+ N+L+  +  +KI+DFG ++ E  + 
Sbjct: 249 RKITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGTSK-ELSDK 307

Query: 635 KDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVR 456
                  GT+ ++APEV+  +P + K D++SFGV LWE+   ++PY D+  + +   V  
Sbjct: 308 STKMSFAGTVAWLAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGS 367

Query: 455 QNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
            +L   +P  CP     +MK+ W + P  RP   + +
Sbjct: 368 NSLHLPVPSTCPDGFKILMKQTWQSKPRNRPSFRQTL 404



>pir|T46150|T46150 protein kinase ATN1-like protein - Arabidopsis
           thaliana>gb:ATF18B3_1549077 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F18B3.>gb:ATT3A5_1555941
           Arabidopsis thaliana DNA chromosome 3, BAC clone T3A5.
          Length = 370

 Score =  111 bits (277), Expect = 2e-23
 Identities = 60/167 (35%), Positives = 94/167 (56%), Gaps = 9/167 (5%)
 Frame = -1

Query: 821 RKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTS-RNLKIADFGVARVEA 645
           R   L  K+ +  ALD+SR + ++HS  I+HRD+   N+L+    +++K+ADFG+AR E 
Sbjct: 128 RPGPLDLKMSLSFALDISRAMEFVHSNGIIHRDLNPRNLLVTGDLKHVKLADFGIAREET 187

Query: 644 QNPKDMTGETGTLGYMAPEVLDGKP--------YNRKCDVYSFGVCLWEIYCCDLPYPDL 489
           +    MT E GT  +MAPEV   +P        Y+ K D+YSF + LW++   + P+PD+
Sbjct: 188 RG--GMTCEAGTSKWMAPEVYSPEPLRVGEKKEYDHKADIYSFAIVLWQLVTNEEPFPDV 245

Query: 488 SFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEV 348
             +     +V Q  RP + +  P     I++ CW  +PD RPE  E+
Sbjct: 246 PNSLFVPYLVSQGRRPILTK-TPDVFVPIVESCWAQDPDARPEFKEI 291



>gb:MMU76762_2123442 Mus musculus fps/fes-related tyrosine kinase
            mRNA, complete cds.
          Length = 823

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 98/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            + RK +L  K +++ +LD++ G+ YL SK  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 651  RKRKDELKLKQLVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQE 710

Query: 647  AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                   +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 711  DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 770

Query: 473  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
               V R   R   P+ CP  + +IM KCWD  P+ RP+ +++ + +  I
Sbjct: 771  REQVER-GYRMSAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKELTVI 818



>gb:BC058100_2103032 Mus musculus fer (fms/fps related) protein
            kinase, testis specific 2, mRNA (cDNA clone MGC:67175
            IMAGE:6813507), complete cds.
          Length = 765

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 98/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            + RK +L  K +++ +LD++ G+ YL SK  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 593  RKRKDELKLKQLVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQE 652

Query: 647  AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                   +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 653  DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 712

Query: 473  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
               V R   R   P+ CP  + +IM KCWD  P+ RP+ +++ + +  I
Sbjct: 713  REQVER-GYRMSAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKELTVI 760



>gb:BC051249_2100695 Mus musculus fer (fms/fps related) protein
           kinase, testis specific 2, mRNA (cDNA clone
           IMAGE:5003440), partial cds.
          Length = 449

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 98/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827 KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
           + RK +L  K +++ +LD++ G+ YL SK  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 277 RKRKDELKLKQLVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQE 336

Query: 647 AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                  +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 337 DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 396

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              V R   R   P+ CP  + +IM KCWD  P+ RP+ +++ + +  I
Sbjct: 397 REQVER-GYRMSAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKELTVI 444



>gb:AY526095_2085955 Mus musculus cardiac ankyrin repeat kinase
            isoform 1 mRNA, complete cds.
          Length = 834

 Score =  110 bits (276), Expect = 3e-23
 Identities = 59/171 (34%), Positives = 104/171 (60%), Gaps = 4/171 (2%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L   +K+ L  +  + +A+D+++G+ YLHS  + I+HRD+ + N+LL    +  +ADFG 
Sbjct: 549  LLHEQKRILDLQSKLIIAVDVAKGMEYLHSLTQPIIHRDLNSHNILLYEDGHAVVADFGE 608

Query: 659  AR-VEAQNPKDMTGETGTLGYMAPEVLDG-KPYNRKCDVYSFGVCLWEIYCCDLPYPDLS 486
            +R +++ +  +MT + G L +MAPEV      Y  K DV+S+ +CLWE+   ++P+  L 
Sbjct: 609  SRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADVFSYALCLWELLIGEIPFAHLK 668

Query: 485  FAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
             A  ++ +   ++RP I    P  ++S++ + W+A P+ RPE  EVVR +E
Sbjct: 669  PAAAAADMAYHHIRPPIGYSIPKPISSLLMRGWNACPEGRPEFSEVVRKLE 719



>gb:AF187884_1415790 Canis familiaris protein tyrosine kinase fer
            mRNA, complete cds.
          Length = 823

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 97/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            + +K ++  K +++ +LD + G+SYL SK  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 650  RKKKDEIKLKQLVKFSLDAASGMSYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQE 709

Query: 647  AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                   +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 710  DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 769

Query: 473  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            +  V R   R   P+ CP  +  IM KCWD  P+ RP+  E+ + +  I
Sbjct: 770  TEQVER-GYRISAPQHCPEDIFKIMMKCWDYKPENRPKFSELQKELTVI 817



>gb:AB006566_1193036 Ephydatia fluviatilis EfPTK62 mRNA for protein
            tyrosine kinase, complete cds.
          Length = 743

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 99/169 (58%), Gaps = 5/169 (2%)
 Frame = -1

Query: 821  RKKKLAFKIVIQL-ALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEA 645
            RK+ +   + ++L A +++ G+ YL +K+ VHRD+ A N+L+ + + +KI+DFG++R   
Sbjct: 557  RKQPIPDVLTLKLWAAEIASGMMYLETKRFVHRDLAARNILVQSMKQVKISDFGLSRAVG 616

Query: 644  QNP---KDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAE 477
             N    K   G    + + APE ++   ++   DV+S+G+ LWE++   D PY D++ AE
Sbjct: 617  ANSDYYKASQGGRWPVKWYAPESINFGTFSHASDVWSYGITLWEMFSFGDAPYGDMTGAE 676

Query: 476  VSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEA 330
            V   V   N R E PR CPSS+  +M +CW   P++RP   ++    E+
Sbjct: 677  VLDRVENLNYRLECPRDCPSSIYELMLRCWSLEPNERPTFAQLYDSFES 725



>gb:AK082799_1173677 Mus musculus ES cells cDNA, RIKEN full-length
            enriched library, clone:C330021J21 product:fer (fms/fps
            related) protein kinase, testis specific 2, full insert
            sequence.
          Length = 698

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 98/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            + RK +L  K +++ +LD++ G+ YL SK  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 526  RKRKDELKLKQLVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQE 585

Query: 647  AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                   +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 586  DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 645

Query: 473  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
               V R   R   P+ CP  + +IM KCWD  P+ RP+ +++ + +  I
Sbjct: 646  REQVER-GYRMSAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKELTVI 693



>pir|S04328|S04328 protein-tyrosine kinase (EC 2.7.1.112) flk - rat
           (fragment)
          Length = 323

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 97/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827 KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
           + RK +L  K +++ +LD++ G+ YL  K  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 151 RKRKDELKLKQLVRFSLDVAAGMLYLEGKNCIHRDLAARNCLVGENNTLKISDFGMSRQE 210

Query: 647 AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                  +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 211 DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 270

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              V R   R   P+ CP  + +IM KCWD  P+ RP+  ++ + + AI
Sbjct: 271 REQVER-GYRMSAPQNCPEEIFTIMMKCWDYKPENRPKFSDLHKELTAI 318



>sp|P09760|FLK_RAT Tyrosine-protein kinase FLK (EC 2.7.1.112)
           (Fragment).>gb:RNFLK_2134851 Rat mRNA for flk protein.
          Length = 323

 Score =  110 bits (276), Expect = 3e-23
 Identities = 58/169 (34%), Positives = 97/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827 KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
           + RK +L  K +++ +LD++ G+ YL  K  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 151 RKRKDELKLKQLVRFSLDVAAGMLYLEGKNCIHRDLAARNCLVGENNTLKISDFGMSRQE 210

Query: 647 AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                  +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 211 DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 270

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              V R   R   P+ CP  + +IM KCWD  P+ RP+  ++ + + AI
Sbjct: 271 REQVER-GYRMSAPQNCPEEIFTIMMKCWDYKPENRPKFSDLHKELTAI 318



>gb:BT019655_1991169 Homo sapiens mitogen-activated protein kinase
           kinase kinase 7 mRNA, complete cds.
          Length = 606

 Score =  110 bits (275), Expect = 3e-23
 Identities = 58/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  YN KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYNEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:AY743662_1626536 Triticum aestivum EDR1 (EDR1) mRNA, partial
           cds.
          Length = 209

 Score =  110 bits (275), Expect = 3e-23
 Identities = 56/142 (39%), Positives = 89/142 (62%), Gaps = 2/142 (1%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSK--KIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           I++ALD++RG++ LH+    IVHRD+K+ N+L+D +  +K+ DFG++R++          
Sbjct: 67  IKMALDVARGMNCLHTSVPTIVHRDLKSPNLLVDDNWTVKVCDFGLSRLKHSTFLSSKST 126

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPE 438
            GT  +MAPEVL  +  N KCD+YSFGV LWE+     P+  +   +V  AV  Q+ R +
Sbjct: 127 AGTPEWMAPEVLRNEQSNEKCDIYSFGVILWELATLRKPWHGMDQMQVVGAVGFQDRRLD 186

Query: 437 IPRCCPSSLASIMKKCWDANPD 372
           IP+     +ASI++ CW  +P+
Sbjct: 187 IPKEVDPIVASIIRDCWQKDPN 208



>gb:AY232270_1311379 Dictyostelium discoideum putative protein Roco8
            (roco8) gene, partial cds.
          Length = 1766

 Score =  110 bits (275), Expect = 3e-23
 Identities = 62/183 (33%), Positives = 108/183 (59%), Gaps = 15/183 (8%)
 Frame = -1

Query: 821  RKKK-----LAFKIVIQLALDLSRGLSYLHS--KKIVHRDVKAENMLL---DTSRN---L 681
            +KKK     L +++++++  D++ G+++LH+    +VHRD+K+ N+LL    T+ N    
Sbjct: 1581 KKKKEDGQVLDWQMLLKIVTDIASGMAFLHNITPPLVHRDLKSPNILLASHPTNPNEISA 1640

Query: 680  KIADFGVARVEAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLP 501
            K++DFG++R   QN      +  T  + +PEVL G  YN K D+YSFG+ LWE Y  +LP
Sbjct: 1641 KVSDFGLSRSIVQNFSSKVVDNPT--WQSPEVLKGMEYNEKSDIYSFGMILWECYHLELP 1698

Query: 500  YPDLSFAEVSSAV--VRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            + +  F  +S+    +   LRP I + C    +S++ KCW+A+P+ RP  + +++ +  I
Sbjct: 1699 FDEFDFKFMSTLEDNILSGLRPSINQNCNRMYSSLITKCWNADPNLRPSFNSILKTLNEI 1758

Query: 326  DTS 318
              S
Sbjct: 1759 KDS 1761



>gb:BC078445_2106828 Mus musculus mitogen activated protein kinase
           kinase kinase 10, mRNA (cDNA clone IMAGE:5689242),
           partial cds.
          Length = 805

 Score =  110 bits (274), Expect = 4e-23
 Identities = 59/171 (34%), Positives = 98/171 (57%), Gaps = 11/171 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKK---IVHRDVKAENML-LDTSRN-------LKIADFGVARV 651
           +++  A+ ++RG++YLH+     I+HRD+K+ N+L L+   N       LKI DFG+AR 
Sbjct: 60  VLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLARE 119

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
             +  K      GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY ++    V+
Sbjct: 120 WHKTTK--MSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVA 177

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
             V    L   IP  CP   A ++++CWD +P  RP+   +++ +E I+ S
Sbjct: 178 YGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKQLEVIEQS 228



>gb:HSMSTMR_2018915 H.sapiens MST mRNA for serine/threonine kinase.
          Length = 953

 Score =  110 bits (274), Expect = 4e-23
 Identities = 59/171 (34%), Positives = 98/171 (57%), Gaps = 11/171 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKK---IVHRDVKAENML-LDTSRN-------LKIADFGVARV 651
           +++  A+ ++RG++YLH+     I+HRD+K+ N+L L+   N       LKI DFG+AR 
Sbjct: 195 VLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLARE 254

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
             +  K      GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY ++    V+
Sbjct: 255 WHKTTK--MSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVA 312

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
             V    L   IP  CP   A ++++CWD +P  RP+   +++ +E I+ S
Sbjct: 313 YGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVIEQS 363



>gb:AP005419_1851497 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0046G12.
          Length = 396

 Score =  110 bits (274), Expect = 4e-23
 Identities = 60/161 (37%), Positives = 90/161 (55%), Gaps = 6/161 (3%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGE 618
           +  AL+++  + YLH +   +VHRD+K  N+LLD    +++ADFG AR        +TGE
Sbjct: 231 VSRALEIALAMRYLHEQTPAVVHRDLKPSNVLLDGDSRVRVADFGHARFLPDGTAALTGE 290

Query: 617 TGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSF--AEVSSAVVRQNLR 444
           TGT  YMAPE++  +PY  KCDVYSFG+ L E+   + PY D  +  ++++  V    LR
Sbjct: 291 TGTYVYMAPEIIRCEPYTEKCDVYSFGIILNELVTGEHPYIDTGYGPSKIALEVADGKLR 350

Query: 443 PEIPR--CCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
           P++       S L  ++   WDA P KRP    +   +  I
Sbjct: 351 PKLAERDVNSSVLNDLICGTWDAEPSKRPSFATITSALRKI 391



>pir|T07406|T07406 probable protein kinase -
            tomato>gb:AY079048_1568160 Lycopersicon esculentum
            ethylene-responsive protein kinase Le-CTR1 (ER50) gene,
            complete cds.>gb:LETYRKINA_1684687 Lycopersicon
            esculentum mRNA for putative protein
            kinase.>gb:AF096250_1767806 Lycopersicon esculentum
            ethylene-responsive protein kinase TCTR1 (ER50) mRNA,
            complete cds.
          Length = 829

 Score =  110 bits (274), Expect = 4e-23
 Identities = 58/152 (38%), Positives = 88/152 (57%), Gaps = 2/152 (1%)
 Frame = -1

Query: 785  LALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGETG 612
            +A D++ G++YLH +   IVHRD+K+ N+L+D    +KI DFG++R +A          G
Sbjct: 658  MAYDVANGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKICDFGLSRFKANTFLSSKTAAG 717

Query: 611  TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEIP 432
            T  +MAPEV+  +P N K DVYSFGV LWE+     P+  L+  +V +AV     R +IP
Sbjct: 718  TPEWMAPEVIRDEPSNEKSDVYSFGVILWELATLQQPWNKLNPPQVIAAVGFNRKRLDIP 777

Query: 431  RCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
                  +A I++ CW   P KRP    ++ ++
Sbjct: 778  SDLNPQVAIIIEACWANEPWKRPSFSTIMDML 809



>sp|Q02779|M3KA_HUMAN Mitogen-activated protein kinase kinase kinase
           10 (EC 2.7.1.37) (Mixed lineage kinase 2) (Protein
           kinase MST).>pir|S68178|S68178 mixed-lineage protein
           kinase 2 (EC 2.7.1.-) - human>gb:HARNAMLK2_1996076
           H.sapiens mRNA for mixed lineage kinase 2.
          Length = 954

 Score =  110 bits (274), Expect = 4e-23
 Identities = 59/171 (34%), Positives = 98/171 (57%), Gaps = 11/171 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKK---IVHRDVKAENML-LDTSRN-------LKIADFGVARV 651
           +++  A+ ++RG++YLH+     I+HRD+K+ N+L L+   N       LKI DFG+AR 
Sbjct: 195 VLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLARE 254

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
             +  K      GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY ++    V+
Sbjct: 255 WHKTTK--MSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVA 312

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTS 318
             V    L   IP  CP   A ++++CWD +P  RP+   +++ +E I+ S
Sbjct: 313 YGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVIEQS 363



>gb:AB025535_2461107 Eptatretus burgeri mRNA for FGFR3/4b, partial
           cds.
          Length = 333

 Score =  109 bits (273), Expect = 6e-23
 Identities = 62/167 (37%), Positives = 94/167 (56%), Gaps = 4/167 (2%)
 Frame = -1

Query: 815 KKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN- 639
           ++L FK ++     ++RG+ YL SKK +HRD+ A N+L+     +KIADFG+AR +  N 
Sbjct: 104 EQLTFKDLVSCTYQVARGMEYLASKKCIHRDLAARNVLVTEENVMKIADFGLAR-DVHNI 162

Query: 638 --PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSS 468
              K  T     + +MAPE L  + Y  +CDV+SFGV LWEI+     PYP +   E+  
Sbjct: 163 DYYKKTTNGRLPVKWMAPEALFDRVYTHQCDVWSFGVLLWEIFTLGGSPYPGIPVEELFK 222

Query: 467 AVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            ++++  R + P  CP  L  IM+ CW A   +RP   ++V   + I
Sbjct: 223 -LLKEGHRMDKPTNCPKELYVIMRACWAAAASQRPTFKQLVESFDRI 268



>sp|P16591|FER_HUMAN Proto-oncogene tyrosine-protein kinase FER (EC
            2.7.1.112) (p94-FER) (c-FER).>pir|A31943|TVHUFE
            protein-tyrosine kinase (EC 2.7.1.112) fer -
            human>gb:HUMTKFER_2037780 Human tyrosine kinase (FER)
            mRNA, complete cds.
          Length = 822

 Score =  109 bits (273), Expect = 6e-23
 Identities = 58/169 (34%), Positives = 96/169 (56%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            + +K +L  K +++ +LD + G+ YL SK  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 650  RRKKDELKLKQLVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQE 709

Query: 647  AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                   +G +   + + APE L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 710  DGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 769

Query: 473  SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
               V R   R   P+ CP  ++ IM KCWD  P+ RP+  E+ + +  I
Sbjct: 770  REQVER-GYRMSAPQHCPEDISKIMMKCWDYKPENRPKFSELQKELTII 817



>gb:BX119992_2567065 Zebrafish DNA sequence from clone CH211-225H9
           in linkage group 20 Contains the gene for a novel
           protein similar to vertebratemitogen-activated protein
           kinase kinase kinase 7 (MAP3K7), complete sequence.
          Length = 551

 Score =  109 bits (272), Expect = 7e-23
 Identities = 57/153 (37%), Positives = 87/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHSKK---IVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G+SYLH  K   ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 124 LQCSQGVSYLHGMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 180

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V +  RP +
Sbjct: 181 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHRGTRPPL 240

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P ++ S+M +CW  +P +RP M+E+V++M
Sbjct: 241 IKNLPKAIESLMTRCWSKDPSQRPSMEEIVKIM 273



>gb:AB065372_2463044 Gallus gallus mRNA for vascular endothelial
            growth factor receptor-1, complete cds.
          Length = 1327

 Score =  109 bits (272), Expect = 7e-23
 Identities = 64/183 (34%), Positives = 99/183 (54%), Gaps = 7/183 (3%)
 Frame = -1

Query: 818  KKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
            K  L  + +I  +  ++RG+ +L S+K +HRD+ A N+LL  +  +KI DFG+AR   +N
Sbjct: 984  KLPLTMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN 1043

Query: 638  PKDMTGETG--TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEVSS 468
            P  +        L +MAPE +  K YN K DV+S+GV LWEI+     PYP +   E   
Sbjct: 1044 PDYVRKGDARLPLKWMAPESIFDKIYNTKSDVWSYGVLLWEIFSLGASPYPGVQIDEDFC 1103

Query: 467  AVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVR----LMEAIDTSKGGGMI 300
            + +++  R   P      +  IM  CW +NP++RP   E+V+    L++A    +G   I
Sbjct: 1104 SKLKEGTRMRAPEQATEEIYQIMLDCWRSNPNERPWFSELVKRLGDLLQASVQQEGKDYI 1163

Query: 299  PED 291
            P D
Sbjct: 1164 PLD 1166



>pir|S18209|S18209 fibroblast growth factor receptor 4 precursor
            (clone 61) - mouse
          Length = 799

 Score =  109 bits (272), Expect = 7e-23
 Identities = 60/164 (36%), Positives = 93/164 (56%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F  ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 581  LSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYY 640

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SF + LWEI+     PYP +   E+ S ++
Sbjct: 641  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGIPVEELFS-LL 699

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R E P  CPS L  +M++CW A P +RP   ++V  ++ +
Sbjct: 700  REGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKV 743



>sp|Q03142|FGR4_MOUSE Fibroblast growth factor receptor 4 precursor
            (EC 2.7.1.112) (FGFR-4) (Protein-tyrosine kinase receptor
            MPK-11).>gb:MMFGFR4M_2114915 M.musculus mRNA for
            fibroblast growth facter receptor 4 (FGFR-4).
          Length = 808

 Score =  109 bits (272), Expect = 7e-23
 Identities = 60/164 (36%), Positives = 93/164 (56%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKD 630
            L+F  ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 590  LSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYY 649

Query: 629  MTGETGTL--GYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
                 G L   +MAPE L  + Y  + DV+SF + LWEI+     PYP +   E+ S ++
Sbjct: 650  KKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFEILLWEIFTLGGSPYPGIPVEELFS-LL 708

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            R+  R E P  CPS L  +M++CW A P +RP   ++V  ++ +
Sbjct: 709  REGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVEALDKV 752



>gb:AY335653_2144871 Synthetic construct Homo sapiens
           megakaryocyte-associated tyrosine kinase (MATK) mRNA,
           partial cds.
          Length = 508

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/145 (39%), Positives = 84/145 (57%), Gaps = 1/145 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q +L ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 329 LLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 385

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    +  K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 386 LPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 444

Query: 437 IPRCCPSSLASIMKKCWDANPDKRP 363
            P  CP  +  +M  CW+A P +RP
Sbjct: 445 PPEGCPGPVHVLMSSCWEAEPARRP 469



>gb:AY075653_1567792 Arabidopsis thaliana At1g14000/F7A19_9 mRNA,
           complete cds.
          Length = 438

 Score =  108 bits (271), Expect = 1e-22
 Identities = 66/194 (34%), Positives = 109/194 (56%), Gaps = 8/194 (4%)
 Frame = -1

Query: 830 YKXRKKKLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSR--NLKIADFG 663
           Y   K  L     +  ALD++RG++YLH++   I+HRD+K  N+LL  S   +LK+ DFG
Sbjct: 248 YLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFG 307

Query: 662 VAR-VEAQNPKD---MTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYP 495
           +++ ++ QN  D   MTGETG+  YMAPEV   + Y++K DV+SF + L+E+   + P+ 
Sbjct: 308 LSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFA 367

Query: 494 DLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSK 315
           +    E +  V   +      + C   L  ++ KCWDA+ ++RP   ++++ +E I  + 
Sbjct: 368 NHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKET- 426

Query: 314 GGGMIPEDQAGGCF 273
               +P D   G F
Sbjct: 427 ----LPSDHHWGLF 436



>gb:AC068197_1540360 Genomic sequence for Arabidopsis thaliana BAC
           F16A14 from chromosome I, complete sequence.
          Length = 445

 Score =  108 bits (271), Expect = 1e-22
 Identities = 66/194 (34%), Positives = 109/194 (56%), Gaps = 8/194 (4%)
 Frame = -1

Query: 830 YKXRKKKLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSR--NLKIADFG 663
           Y   K  L     +  ALD++RG++YLH++   I+HRD+K  N+LL  S   +LK+ DFG
Sbjct: 255 YLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFG 314

Query: 662 VAR-VEAQNPKD---MTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYP 495
           +++ ++ QN  D   MTGETG+  YMAPEV   + Y++K DV+SF + L+E+   + P+ 
Sbjct: 315 LSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFA 374

Query: 494 DLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSK 315
           +    E +  V   +      + C   L  ++ KCWDA+ ++RP   ++++ +E I  + 
Sbjct: 375 NHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKET- 433

Query: 314 GGGMIPEDQAGGCF 273
               +P D   G F
Sbjct: 434 ----LPSDHHWGLF 443



>gb:HSM802388_1186692 Homo sapiens mRNA; cDNA DKFZp434N1212 (from
           clone DKFZp434N1212).
          Length = 466

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/145 (39%), Positives = 84/145 (57%), Gaps = 1/145 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q +L ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 288 LLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 344

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    +  K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 345 LPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 403

Query: 437 IPRCCPSSLASIMKKCWDANPDKRP 363
            P  CP  +  +M  CW+A P +RP
Sbjct: 404 PPEGCPGPVHVLMSSCWEAEPARRP 428



>pir|C86273|C86273 protein kinases homolog F7A19.9 - Arabidopsis
           thaliana>gb:AE005172_890391 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007576_1535938 Arabidopsis thaliana
           chromosome I BAC F7A19 genomic sequence, complete
           sequence.
          Length = 438

 Score =  108 bits (271), Expect = 1e-22
 Identities = 66/194 (34%), Positives = 109/194 (56%), Gaps = 8/194 (4%)
 Frame = -1

Query: 830 YKXRKKKLAFKIVIQLALDLSRGLSYLHSKK--IVHRDVKAENMLLDTSR--NLKIADFG 663
           Y   K  L     +  ALD++RG++YLH++   I+HRD+K  N+LL  S   +LK+ DFG
Sbjct: 248 YLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFG 307

Query: 662 VAR-VEAQNPKD---MTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYP 495
           +++ ++ QN  D   MTGETG+  YMAPEV   + Y++K DV+SF + L+E+   + P+ 
Sbjct: 308 LSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFA 367

Query: 494 DLSFAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSK 315
           +    E +  V   +      + C   L  ++ KCWDA+ ++RP   ++++ +E I  + 
Sbjct: 368 NHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKET- 426

Query: 314 GGGMIPEDQAGGCF 273
               +P D   G F
Sbjct: 427 ----LPSDHHWGLF 436



>sp|P42679|MATK_HUMAN Megakaryocyte-associated tyrosine-protein
           kinase (EC 2.7.1.112) (Tyrosine-protein kinase CTK)
           (Protein kinase HYL) (Hematopoietic consensus
           tyrosine-lacking kinase).>pir|A55625|A55625
           protein-tyrosine kinase (EC 2.7.1.112) matk, short
           splice form - human>gb:AC005777_1875040 Homo sapiens
           chromosome 19, cosmid F16403, complete
           sequence.>gb:BC000114_1966436 Homo sapiens
           megakaryocyte-associated tyrosine kinase, transcript
           variant 1, mRNA (cDNA clone MGC:1708 IMAGE:3350365),
           complete cds.>gb:BC003109_1968695 Homo sapiens
           megakaryocyte-associated tyrosine kinase, transcript
           variant 1, mRNA (cDNA clone MGC:2101 IMAGE:3357648),
           complete cds.>gb:H006874S13_1996013 Homo sapiens
           megakaryocyte-associated tyrosine kinase (MATK) gene,
           exon 13 and complete cds.>gb:HSHYLTK_2014294 H.sapiens
           HYL tyrosine kinase mRNA.
          Length = 507

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/145 (39%), Positives = 84/145 (57%), Gaps = 1/145 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q +L ++ G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 329 LLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAER---KGLDSSR 385

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    +  K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 386 LPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKGYRME 444

Query: 437 IPRCCPSSLASIMKKCWDANPDKRP 363
            P  CP  +  +M  CW+A P +RP
Sbjct: 445 PPEGCPGPVHVLMSSCWEAEPARRP 469



>gb:BT019653_2151472 Synthetic construct Homo sapiens
           mitogen-activated protein kinase kinase kinase 7 mRNA,
           partial cds.
          Length = 580

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:AY335698_2144916 Synthetic construct Homo sapiens
           mitogen-activated protein kinase kinase kinase 7
           (MAP3K7) mRNA, partial cds.
          Length = 580

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:BC006665_2090293 Mus musculus mitogen activated protein kinase
           kinase kinase 7, mRNA (cDNA clone MGC:5989
           IMAGE:3499247), complete cds.
          Length = 606

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:BT019654_1991168 Homo sapiens mitogen-activated protein kinase
           kinase kinase 7 mRNA, complete cds.
          Length = 579

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:AF218074_1890646 Homo sapiens TGF beta-activated kinase splice
           variant d (TAK1) mRNA, complete
           cds.>gb:HSJ154G14_2015784 Human DNA sequence from clone
           RP1-154G14 on chromosome 6q15-16.3 Contains the 3' end
           of the MAP3K7 gene for mitogen-activated protein kinase
           kinase kinase 7 (TGF-beta activated kinase 1, TAK1),
           complete sequence.>gb:HSJ988J12_2016700 Human DNA
           sequence from clone RP5-988J12 on chromosome 6q16.1-16.3
           Contains the 5' end of the MAP3K7 gene for
           mitogen-activated protein kinase kinase kinase 7
           (TGF-beta activated kinase 1, TAK1) and two CpG islands,
           complete sequence.
          Length = 491

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:AB009358_1864123 Homo sapiens mRNA for TGF-beta activated kinase
           1c, complete cds.>gb:HSJ154G14_2015783 Human DNA
           sequence from clone RP1-154G14 on chromosome 6q15-16.3
           Contains the 3' end of the MAP3K7 gene for
           mitogen-activated protein kinase kinase kinase 7
           (TGF-beta activated kinase 1, TAK1), complete
           sequence.>gb:HSJ988J12_2016699 Human DNA sequence from
           clone RP5-988J12 on chromosome 6q16.1-16.3 Contains the
           5' end of the MAP3K7 gene for mitogen-activated protein
           kinase kinase kinase 7 (TGF-beta activated kinase 1,
           TAK1) and two CpG islands, complete sequence.
          Length = 518

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:AY349915_1322030 Drosophila simulans strain Sim7 Tak1 gene,
           partial cds.
          Length = 380

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 4/156 (2%)
 Frame = -1

Query: 782 ALDLSRGLSYLHS---KKIVHRDVKAENMLL-DTSRNLKIADFGVARVEAQNPKDMTGET 615
           A   + GL+YLH+   K ++HRDVK  N+LL +  RNLKI DFG     A     MT   
Sbjct: 118 ARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTV---ADKSTMMTNNR 174

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           G+  +MAPEV +G  Y  KCD++S+ + LWE+     P+  +  A      + +  RP +
Sbjct: 175 GSAAWMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPL 234

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              CP  +  +M  CW   P+ RP M  +V +M  I
Sbjct: 235 LTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEI 270



>gb:AY349910_1322025 Drosophila simulans strain Sim2 Tak1 gene,
           partial cds.>gb:AY349911_1322026 Drosophila simulans
           strain Sim3 Tak1 gene, partial cds.>gb:AY349912_1322027
           Drosophila simulans strain Sim4 Tak1 gene, partial
           cds.>gb:AY349913_1322028 Drosophila simulans strain Sim5
           Tak1 gene, partial cds.>gb:AY349914_1322029 Drosophila
           simulans strain Sim6 Tak1 gene, partial
           cds.>gb:AY349916_1322031 Drosophila simulans strain Sim8
           Tak1 gene, partial cds.
          Length = 380

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 4/156 (2%)
 Frame = -1

Query: 782 ALDLSRGLSYLHS---KKIVHRDVKAENMLL-DTSRNLKIADFGVARVEAQNPKDMTGET 615
           A   + GL+YLH+   K ++HRDVK  N+LL +  RNLKI DFG     A     MT   
Sbjct: 118 ARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTV---ADKSTMMTNNR 174

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           G+  +MAPEV +G  Y  KCD++S+ + LWE+     P+  +  A      + +  RP +
Sbjct: 175 GSAAWMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPL 234

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              CP  +  +M  CW   P+ RP M  +V +M  I
Sbjct: 235 LTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEI 270



>gb:AY349909_1322024 Drosophila simulans strain Sim1 Tak1 gene,
           partial cds.
          Length = 380

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 4/156 (2%)
 Frame = -1

Query: 782 ALDLSRGLSYLHS---KKIVHRDVKAENMLL-DTSRNLKIADFGVARVEAQNPKDMTGET 615
           A   + GL+YLH+   K ++HRDVK  N+LL +  RNLKI DFG     A     MT   
Sbjct: 118 ARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTV---ADKSTMMTNNR 174

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           G+  +MAPEV +G  Y  KCD++S+ + LWE+     P+  +  A      + +  RP +
Sbjct: 175 GSAAWMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPL 234

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              CP  +  +M  CW   P+ RP M  +V +M  I
Sbjct: 235 LTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEI 270



>gb:AF200688_1250239 Dictyostelium discoideum tyrosine kinase ZAK1
           mRNA, partial cds.
          Length = 759

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/159 (35%), Positives = 94/159 (59%), Gaps = 15/159 (9%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNL-------------KIADFGVARV 651
           ++L  D+++G+ YLH + I+HRD+ + N+LLD  R +             K+ DFG++  
Sbjct: 485 VKLLTDIAKGILYLHKQHIIHRDLTSNNVLLDFKREILPNQLYGSNEFTAKVCDFGLSSN 544

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           ++++ K + G  G++ YMAPE L+G P N K D+YSFG+ +W+++    P    S  E++
Sbjct: 545 QSESKK-LRG--GSIHYMAPENLNGSPINEKSDIYSFGLLVWQMFSYAPPNTIYSPKEMA 601

Query: 470 SAV--VRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPE 360
           S V   +QN RP+IP   P     ++ +CWD NP  RP+
Sbjct: 602 SMVSDPKQNYRPQIPFNVPLKFKELITQCWDRNPLNRPK 640



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
           KK+  FK   +I +  DL   LS+LH   ++HRD+K  N++LD ++NLK+ DFG + ++
Sbjct: 99  KKQGRFKESRIISMIADLVETLSFLHKHHVIHRDIKTANLVLDKNKNLKLIDFGASTIQ 157



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 27/90 (30%), Positives = 37/90 (41%)
 Frame = -1

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           GT  YMAPEV       RK DV+S    + E+   DL               + N  P I
Sbjct: 236 GTFNYMAPEVKRNYRATRKSDVWSLSCTIIEMAGGDLSQ-------------KLNGIPII 282

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           P     +L   +  C   +P KR  M+E++
Sbjct: 283 PDHLSDTLKDFLNHCLVIDPKKRSYMEELL 312



>gb:AC116979_1207093 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 781

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/159 (35%), Positives = 94/159 (59%), Gaps = 15/159 (9%)
 Frame = -1

Query: 791 IQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNL-------------KIADFGVARV 651
           ++L  D+++G+ YLH + I+HRD+ + N+LLD  R +             K+ DFG++  
Sbjct: 485 VKLLTDIAKGILYLHKQHIIHRDLTSNNVLLDFKREILPNQLYGSNEFTAKVCDFGLSSN 544

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           ++++ K + G  G++ YMAPE L+G P N K D+YSFG+ +W+++    P    S  E++
Sbjct: 545 QSESKK-LRG--GSIHYMAPENLNGSPINEKSDIYSFGLLVWQMFSYAPPNTIYSPKEMA 601

Query: 470 SAV--VRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPE 360
           S V   +QN RP+IP   P     ++ +CWD NP  RP+
Sbjct: 602 SMVSDPKQNYRPQIPFNVPLKFKELITQCWDRNPLNRPK 640



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 24/59 (40%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = -1

Query: 818 KKKLAFKI--VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
           KK+  FK   +I +  DL   LS+LH   ++HRD+K  N++LD ++NLK+ DFG + ++
Sbjct: 99  KKQGRFKESRIISMIADLVETLSFLHKHHVIHRDIKTANLVLDKNKNLKLIDFGASTIQ 157



 Score = 37.7 bits (86), Expect = 0.27
 Identities = 28/90 (31%), Positives = 38/90 (42%)
 Frame = -1

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           GT  YMAPEV       RK DV+S G  + E+   DL               + N  P I
Sbjct: 236 GTFNYMAPEVKRNYRATRKSDVWSLGCTIIEMAGGDLSQ-------------KLNGIPII 282

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVV 345
           P     +L   +  C   +P KR  M+E++
Sbjct: 283 PDHLSDTLKDFLNHCLVIDPKKRSYMEELL 312



>gb:CR857142_1181392 Pongo pygmaeus mRNA; cDNA DKFZp469K1121 (from
           clone DKFZp469K1121).
          Length = 606

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:AE014298_1126609 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003571_1216015 Drosophila melanogaster
           chromosome X, section 68 of 74 of the complete
           sequence.>gb:AF199466_1250081 Drosophila melanogaster
           TGF-beta activated-kinase 1 homolog mRNA, complete
           cds.>gb:AY051953_1290547 Drosophila melanogaster LD42274
           full length cDNA.
          Length = 678

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/156 (36%), Positives = 82/156 (52%), Gaps = 4/156 (2%)
 Frame = -1

Query: 782 ALDLSRGLSYLHS---KKIVHRDVKAENMLL-DTSRNLKIADFGVARVEAQNPKDMTGET 615
           A   + GL+YLH+   K ++HRDVK  N+LL +  RNLKI DFG     A     MT   
Sbjct: 118 ARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTV---ADKSTMMTNNR 174

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSAVVRQNLRPEI 435
           G+  +MAPEV +G  Y  KCD++S+ + LWE+     P+  +  A      + +  RP +
Sbjct: 175 GSAAWMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPL 234

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              CP  +  +M  CW   P+ RP M  +V +M  I
Sbjct: 235 LTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEI 270



>pir|JC5955|JC5955 transforming growth factor-beta activated kinase
           (EC 2.7.-.-) 1a - human>gb:AB009356_1864121 Homo sapiens
           mRNA for TGF-beta activated kinase 1a, complete
           cds.>gb:BC017715_1976221 Homo sapiens mitogen-activated
           protein kinase kinase kinase 7, transcript variant A,
           mRNA (cDNA clone MGC:21263 IMAGE:3906837), complete
           cds.>gb:HSJ154G14_2015782 Human DNA sequence from clone
           RP1-154G14 on chromosome 6q15-16.3 Contains the 3' end
           of the MAP3K7 gene for mitogen-activated protein kinase
           kinase kinase 7 (TGF-beta activated kinase 1, TAK1),
           complete sequence.>gb:HSJ988J12_2016701 Human DNA
           sequence from clone RP5-988J12 on chromosome 6q16.1-16.3
           Contains the 5' end of the MAP3K7 gene for
           mitogen-activated protein kinase kinase kinase 7
           (TGF-beta activated kinase 1, TAK1) and two CpG islands,
           complete sequence.
          Length = 579

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>pir|JC5957|JC5957 transforming growth factor-beta activated kinase
           (EC 2.7.-.-) 1c - human
          Length = 567

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>sp|Q62073|M3K7_MOUSE Mitogen-activated protein kinase kinase kinase
           7 (EC 2.7.1.-) (Transforming growth
           factor-beta-activated kinase 1) (TGF-beta- activated
           kinase 1).>gb:AK053911_1170636 Mus musculus 0 day
           neonate eyeball cDNA, RIKEN full-length enriched
           library, clone:E130320K22 product:mitogen activated
           protein kinase kinase kinase 7, full insert
           sequence.>gb:MUSTAK1_2130109 Mouse mRNA for TAK1
           (TGF-beta-activated kinase), complete cds.
          Length = 579

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>sp|O43318|M3K7_HUMAN Mitogen-activated protein kinase kinase kinase
           7 (EC 2.7.1.-) (Transforming growth
           factor-beta-activated kinase 1) (TGF-beta- activated
           kinase 1).>pir|JC5956|JC5956 transforming growth
           factor-beta activated kinase (EC 2.7.-.-) 1b -
           human>gb:AB009357_1864122 Homo sapiens mRNA for TGF-beta
           activated kinase 1b, complete cds.>gb:HSJ154G14_2015781
           Human DNA sequence from clone RP1-154G14 on chromosome
           6q15-16.3 Contains the 3' end of the MAP3K7 gene for
           mitogen-activated protein kinase kinase kinase 7
           (TGF-beta activated kinase 1, TAK1), complete
           sequence.>gb:HSJ988J12_2016702 Human DNA sequence from
           clone RP5-988J12 on chromosome 6q16.1-16.3 Contains the
           5' end of the MAP3K7 gene for mitogen-activated protein
           kinase kinase kinase 7 (TGF-beta activated kinase 1,
           TAK1) and two CpG islands, complete sequence.
          Length = 606

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/153 (37%), Positives = 86/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query: 779 LDLSRGLSYLHS---KKIVHRDVKAENMLLDTSRN-LKIADFGVARVEAQNPKDMTGETG 612
           L  S+G++YLHS   K ++HRD+K  N+LL      LKI DFG A         MT   G
Sbjct: 135 LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTA---CDIQTHMTNNKG 191

Query: 611 TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVSSA-VVRQNLRPEI 435
           +  +MAPEV +G  Y+ KCDV+S+G+ LWE+     P+ ++          V    RP +
Sbjct: 192 SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPL 251

Query: 434 PRCCPSSLASIMKKCWDANPDKRPEMDEVVRLM 336
            +  P  + S+M +CW  +P +RP M+E+V++M
Sbjct: 252 IKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIM 284



>gb:AY335606_2144824 Synthetic construct Homo sapiens
           mitogen-activated protein kinase kinase kinase 11
           (MAP3K11) mRNA, partial cds.>gb:BT009866_2151255
           Synthetic construct Homo sapiens mitogen-activated
           protein kinase kinase kinase 11 mRNA, partial cds.
          Length = 848

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 11/169 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIV---HRDVKAENMLL--------DTSRNLKIADFGVARV 651
           +++  A+ ++RG+ YLH + +V   HRD+K+ N+LL           + LKI DFG+AR 
Sbjct: 214 VLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEHKTLKITDFGLAR- 272

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           E      M+   GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY  +    V+
Sbjct: 273 EWHKTTQMSA-AGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVA 331

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
             V    L   IP  CP   A +M  CW  +P +RP+   +++ +EA++
Sbjct: 332 YGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALE 380



>gb:BC081952_2108191 Rattus norvegicus cDNA clone MGC:94039
           IMAGE:7122664, complete cds.
          Length = 850

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 11/169 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIV---HRDVKAENMLL--------DTSRNLKIADFGVARV 651
           +++  A+ ++RG+ YLH + +V   HRD+K+ N+LL           + LKI DFG+AR 
Sbjct: 215 VLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIEGDDMEHKTLKITDFGLAR- 273

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           E      M+   GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY  +    V+
Sbjct: 274 EWHKTTQMSA-AGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVA 332

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
             V    L   IP  CP   A +M  CW  +P +RP+   +++ +EA++
Sbjct: 333 YGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALE 381



>gb:BC047152_2099469 Mus musculus mitogen activated protein kinase
           kinase kinase 11, mRNA (cDNA clone MGC:54514
           IMAGE:6476975), complete cds.
          Length = 850

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 11/169 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIV---HRDVKAENMLL--------DTSRNLKIADFGVARV 651
           +++  A+ ++RG+ YLH + +V   HRD+K+ N+LL           + LKI DFG+AR 
Sbjct: 215 VLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIEGDDMEHKTLKITDFGLAR- 273

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           E      M+   GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY  +    V+
Sbjct: 274 EWHKTTQMSA-AGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVA 332

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
             V    L   IP  CP   A +M  CW  +P +RP+   +++ +EA++
Sbjct: 333 YGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALE 381



>gb:AF155142_2056858 Mus musculus mixed lineage kinase 3 (Mlk3) and
           two pore domain K+ channel subunit (Kcnk6) genes,
           complete cds.
          Length = 850

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 11/169 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIV---HRDVKAENMLL--------DTSRNLKIADFGVARV 651
           +++  A+ ++RG+ YLH + +V   HRD+K+ N+LL           + LKI DFG+AR 
Sbjct: 215 VLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIEGDDMEHKTLKITDFGLAR- 273

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           E      M+   GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY  +    V+
Sbjct: 274 EWHKTTQMSA-AGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVA 332

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
             V    L   IP  CP   A +M  CW  +P +RP+   +++ +EA++
Sbjct: 333 YGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALE 381



>gb:S71669_2041213 lsk=leukocyte carboxyl-terminal src kinase
           related gene [human, peripheral T cells, mRNA, 1744 nt].
          Length = 465

 Score =  108 bits (269), Expect = 2e-22
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 1/145 (0%)
 Frame = -1

Query: 794 VIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQNPKDMTGET 615
           ++Q +L +  G+ YL SKK+VHRD+ A N+L+      K++DFG+A+ E    K +    
Sbjct: 287 LLQFSLHVREGMEYLESKKLVHRDLAARNILVSEELVAKVSDFGLAKAER---KGLDSSR 343

Query: 614 GTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCD-LPYPDLSFAEVSSAVVRQNLRPE 438
             + + APE L    +  K DV+SFGV LWE++     PYP +S  EVS A V +  R E
Sbjct: 344 LPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEA-VEKRYRME 402

Query: 437 IPRCCPSSLASIMKKCWDANPDKRP 363
            P  CP  +  +M  CW+A P +RP
Sbjct: 403 PPEGCPGPVHVLMSSCWEAEPARRP 427



>gb:BC064543_1986544 Homo sapiens mitogen-activated protein kinase
           kinase kinase 11, mRNA (cDNA clone MGC:74591
           IMAGE:5733866), complete cds.
          Length = 847

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 11/169 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIV---HRDVKAENMLL--------DTSRNLKIADFGVARV 651
           +++  A+ ++RG+ YLH + +V   HRD+K+ N+LL           + LKI DFG+AR 
Sbjct: 214 VLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQHIESDDMEHKTLKITDFGLAR- 272

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           E      M+   GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY  +    V+
Sbjct: 273 EWHKTTQMSA-AGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVA 331

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
             V    L   IP  CP   A +M  CW  +P +RP+   +++ +EA++
Sbjct: 332 YGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALE 380



>pir|A39752|A39752 fibroblast growth factor receptor A1 precursor -
            African clawed frog>gb:BC077548_2560254 Xenopus laevis
            fibroblast growth factor receptor, mRNA (cDNA clone
            MGC:83463 IMAGE:6861854), complete
            cds.>gb:XELX1FGFR_2582278 Xenopus laevis fibroblast
            growth factor receptor mRNA, complete cds.
          Length = 814

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/164 (37%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR--VEAQNP 636
            L+FK ++  A  ++RG+ YL SKK +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 591  LSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYY 650

Query: 635  KDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
            K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   E+   ++
Sbjct: 651  KKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFK-LL 709

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            ++  R + P  C + L  +MK CW A P +RP  +++V  ++ I
Sbjct: 710  KEGHRMDKPTNCTNELYMMMKDCWHAMPSQRPTFNQLVEDLDRI 753



>pir|A53800|A53800 mixed-lineage protein kinase (EC 2.7.1.-) 3 -
           human>gb:AX399680_1467137 Sequence 1 from Patent
           WO0224947.>gb:BC011263_1972940 Homo sapiens
           mitogen-activated protein kinase kinase kinase 11, mRNA
           (cDNA clone MGC:17114 IMAGE:4215281), complete
           cds.>gb:HSU07747_2021822 Human SH3 domain-containing
           proline-rich kinase (sprk) mRNA, complete
           cds.>gb:HUMMLK3A_2034847 Human protein kinase (MLK-3)
           mRNA, complete cds.
          Length = 847

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/169 (34%), Positives = 94/169 (55%), Gaps = 11/169 (6%)
 Frame = -1

Query: 797 IVIQLALDLSRGLSYLHSKKIV---HRDVKAENMLL--------DTSRNLKIADFGVARV 651
           +++  A+ ++RG+ YLH + +V   HRD+K+ N+LL           + LKI DFG+AR 
Sbjct: 214 VLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEHKTLKITDFGLAR- 272

Query: 650 EAQNPKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDLPYPDLSFAEVS 471
           E      M+   GT  +MAPEV+    +++  DV+SFGV LWE+   ++PY  +    V+
Sbjct: 273 EWHKTTQMSA-AGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVA 331

Query: 470 SAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAID 324
             V    L   IP  CP   A +M  CW  +P +RP+   +++ +EA++
Sbjct: 332 YGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALE 380



>sp|P22182|FGR1_XENLA Fibroblast growth factor receptor 1 precursor
            (EC 2.7.1.112).>pir|A36477|A36477 fibroblast growth
            factor receptor A2 precursor - African clawed
            frog>gb:XLU24491_2583290 Xenopus laevis fibroblast growth
            factor receptor-1 mRNA, complete cds.
          Length = 812

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/164 (37%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 809  LAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR--VEAQNP 636
            L+FK ++  A  ++RG+ YL SKK +HRD+ A N+L+     +KIADFG+AR        
Sbjct: 589  LSFKDLVSCAYQVARGMDYLASKKCIHRDLAARNVLVTEDNIMKIADFGLARDIHHIDYY 648

Query: 635  KDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSSAVV 459
            K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   E+   ++
Sbjct: 649  KKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFK-LL 707

Query: 458  RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
            ++  R + P  C + L  +MK CW A P +RP  +++V  ++ I
Sbjct: 708  KEGHRMDKPTNCTNELYMMMKDCWHAMPSQRPTFNQLVEDLDRI 751



>gb:PWFGFR3_2578609 P.waltlii mRNA for fibroblast growth factor
            receptor 3.
          Length = 796

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 568  KLPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTDDNVMKIADFGLAR-D 626

Query: 647  AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
              N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 627  VHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 686

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 687  ELFK-LLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFKQLVEDLDRVLT 738



>gb:AY303692_2081904 Rattus norvegicus cardiac ankyrin repeat kinase
            mRNA, complete cds.
          Length = 835

 Score =  107 bits (268), Expect = 2e-22
 Identities = 58/171 (33%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L   +K+ L  +  + +A+D+++G+ YLHS  + I+HRD+ + N+LL    +  +ADFG 
Sbjct: 550  LLHEQKRILDLQSKLIIAVDVAKGMEYLHSLTQPIIHRDLNSHNILLYEDGHAVVADFGE 609

Query: 659  AR-VEAQNPKDMTGETGTLGYMAPEVLDG-KPYNRKCDVYSFGVCLWEIYCCDLPYPDLS 486
            +R +++ +  +MT + G L +MAPEV      Y  K DV+S+ +CLWE+   ++P+  L 
Sbjct: 610  SRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADVFSYSLCLWELLTGEIPFAHLK 669

Query: 485  FAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
             A  ++ +   ++RP I    P  ++S++ + W+A P+ RPE  EVV  +E
Sbjct: 670  PAAAAADMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVSKLE 720



>gb:HUMFGFLR_2031105 Human novel growth factor receptor mRNA, 3' cds.
          Length = 731

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 508  KPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLAR-D 566

Query: 647  AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
              N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 567  VHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 626

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 627  ELFK-LLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLT 678



>gb:AL138712_1919781 Human DNA sequence from clone RP11-502P18 on
            chromosome 13 Contains 3' end of novel gene similar to
            Drosophila CG11486, and the 3' end of the FLT1 gene for
            fms-related tyrosine kinase 1 (vascular endothelial
            growth factor/vascular permeability factor receptor),
            complete sequence.>gb:AL138712_1919782 Human DNA sequence
            from clone RP11-502P18 on chromosome 13 Contains 3' end
            of novel gene similar to Drosophila CG11486, and the 3'
            end of the FLT1 gene for fms-related tyrosine kinase 1
            (vascular endothelial growth factor/vascular permeability
            factor receptor), complete sequence.>gb:AL139005_1920163
            Human DNA sequence from clone RP11-95G6 on chromosome 13
            Contains the 5' end of the FLT1 gene for fms-related
            tyrosine kinase 1 (vascular endothelial growth
            factor/vascular permeability factor receptor) and a CpG
            island, complete sequence.>gb:AL139005_1920164 Human DNA
            sequence from clone RP11-95G6 on chromosome 13 Contains
            the 5' end of the FLT1 gene for fms-related tyrosine
            kinase 1 (vascular endothelial growth factor/vascular
            permeability factor receptor) and a CpG island, complete
            sequence.
          Length = 1338

 Score =  107 bits (268), Expect = 2e-22
 Identities = 76/223 (34%), Positives = 114/223 (51%), Gaps = 9/223 (4%)
 Frame = -1

Query: 818  KKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
            K+ +  + +I  +  ++RG+ +L S+K +HRD+ A N+LL  +  +KI DFG+AR   +N
Sbjct: 991  KEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN 1050

Query: 638  PKDM-TGETG-TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSS 468
            P  +  G+T   L +MAPE +  K Y+ K DV+S+GV LWEI+     PYP +   E   
Sbjct: 1051 PDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFC 1110

Query: 467  AVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVR----LMEAIDTSKGGGMI 300
            + +R+ +R   P      +  IM  CW  +P +RP   E+V     L++A     G   I
Sbjct: 1111 SRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYI 1170

Query: 299  PEDQAGGCFCFAPTRGP*GF--STPALFLPFVRRSICTLCTNS 177
            P +        A   G  GF  STPA    F + SI     NS
Sbjct: 1171 PIN--------AILTGNSGFTYSTPAFSEDFFKESISAPKFNS 1205



>gb:AF487554_1904813 Homo sapiens fibroblast growth factor receptor 3
            (FGFR3) gene, partial cds, alternatively spliced.
          Length = 769

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 546  KPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLAR-D 604

Query: 647  AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
              N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 605  VHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 664

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 665  ELFK-LLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLT 716



>gb:AF487554_1904812 Homo sapiens fibroblast growth factor receptor 3
            (FGFR3) gene, partial cds, alternatively spliced.
          Length = 771

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 548  KPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLAR-D 606

Query: 647  AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
              N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 607  VHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 666

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 667  ELFK-LLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLT 718



>gb:AF245114_1892639 Homo sapiens fibroblast growth factor receptor
           3 (FGFR3) mRNA, complete cds, alternatively spliced.
          Length = 694

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827 KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
           K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 471 KPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLAR-D 529

Query: 647 AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
             N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 530 VHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 589

Query: 479 EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
           E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 590 ELFK-LLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLT 641



>gb:AF063657_1880236 Homo sapiens vascular endothelial growth factor
            receptor (FLT1) mRNA, complete cds.
          Length = 1338

 Score =  107 bits (268), Expect = 2e-22
 Identities = 76/223 (34%), Positives = 114/223 (51%), Gaps = 9/223 (4%)
 Frame = -1

Query: 818  KKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
            K+ +  + +I  +  ++RG+ +L S+K +HRD+ A N+LL  +  +KI DFG+AR   +N
Sbjct: 991  KEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN 1050

Query: 638  PKDM-TGETG-TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSS 468
            P  +  G+T   L +MAPE +  K Y+ K DV+S+GV LWEI+     PYP +   E   
Sbjct: 1051 PDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFC 1110

Query: 467  AVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVR----LMEAIDTSKGGGMI 300
            + +R+ +R   P      +  IM  CW  +P +RP   E+V     L++A     G   I
Sbjct: 1111 SRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYI 1170

Query: 299  PEDQAGGCFCFAPTRGP*GF--STPALFLPFVRRSICTLCTNS 177
            P +        A   G  GF  STPA    F + SI     NS
Sbjct: 1171 PIN--------AILTGNSGFTYSTPAFSEDFFKESISAPKFNS 1205



>pir|I49663|I49663 tyrosine kinase (ferT) - mouse>gb:MUSFERT_2125857
           Mouse tyrosine kinase (ferT) mRNA, complete cds.
          Length = 453

 Score =  107 bits (268), Expect = 2e-22
 Identities = 57/169 (33%), Positives = 97/169 (57%), Gaps = 2/169 (1%)
 Frame = -1

Query: 827 KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
           + RK +L  K +++ +LD++ G+ YL SK  +HRD+ A N L+  +  LKI+DFG++R E
Sbjct: 281 RKRKDELKLKQLVRFSLDVAAGMLYLESKNCIHRDLAARNCLVGENNTLKISDFGMSRQE 340

Query: 647 AQNPKDMTG-ETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEV 474
                  +G +   + + A E L+   Y+ + DV+SFG+ LWE +   + PYP ++  + 
Sbjct: 341 DGGVYSSSGLKQIPIKWTAAEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQA 400

Query: 473 SSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAI 327
              V R   R   P+ CP  + +IM KCWD  P+ RP+ +++ + +  I
Sbjct: 401 REQVER-GYRMSAPQNCPEEVFTIMMKCWDYKPENRPKFNDLHKELTVI 448



>pir|S38579|S38579 fibroblast growth factor receptor 3 - Iberian
            ribbed newt  (fragment)
          Length = 797

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 569  KLPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTDDNVMKIADFGLAR-D 627

Query: 647  AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
              N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 628  VHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 687

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 688  ELFK-LLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFKQLVEDLDRVLT 739



>sp|P17948|VGR1_HUMAN Vascular endothelial growth factor receptor 1
            precursor (EC 2.7.1.112) (VEGFR-1) (Vascular permeability
            factor receptor) (Tyrosine-protein kinase receptor FLT)
            (Flt-1) (Tyrosine-protein kinase FRT) (Fms-like tyrosine
            kinase 1).>pir|S09982|S09982 protein-tyrosine kinase (EC
            2.7.1.112) flt1 precursor - human>gb:HSFLT_2013255 Human
            flt mRNA for receptor-related tyrosine kinase.
          Length = 1338

 Score =  107 bits (268), Expect = 2e-22
 Identities = 76/223 (34%), Positives = 114/223 (51%), Gaps = 9/223 (4%)
 Frame = -1

Query: 818  KKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVEAQN 639
            K+ +  + +I  +  ++RG+ +L S+K +HRD+ A N+LL  +  +KI DFG+AR   +N
Sbjct: 991  KEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN 1050

Query: 638  PKDM-TGETG-TLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFAEVSS 468
            P  +  G+T   L +MAPE +  K Y+ K DV+S+GV LWEI+     PYP +   E   
Sbjct: 1051 PDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFC 1110

Query: 467  AVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVR----LMEAIDTSKGGGMI 300
            + +R+ +R   P      +  IM  CW  +P +RP   E+V     L++A     G   I
Sbjct: 1111 SRLREGMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYI 1170

Query: 299  PEDQAGGCFCFAPTRGP*GF--STPALFLPFVRRSICTLCTNS 177
            P +        A   G  GF  STPA    F + SI     NS
Sbjct: 1171 PIN--------AILTGNSGFTYSTPAFSEDFFKESISAPKFNS 1205



>sp|P22607|FGR3_HUMAN Fibroblast growth factor receptor 3 precursor
            (EC 2.7.1.112) (FGFR-3).>pir|A38576|TVHUF3 fibroblast
            growth factor receptor 3 precursor -
            human>gb:AY768549_1962053 Homo sapiens fibroblast growth
            factor receptor 3 (achondroplasia, thanatophoric
            dwarfism) (FGFR3) gene, complete cds.>gb:HUMFGFR3_2031107
            Human fibroblast growth factor receptor (FGFR3) mRNA,
            complete cds.
          Length = 806

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 583  KPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLAR-D 641

Query: 647  AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
              N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 642  VHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 701

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 702  ELFK-LLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLT 753



>sp|P18460|CEK2_CHICK Tyrosine kinase receptor CEK2 precursor (EC
            2.7.1.112).>pir|A35963|A35963 protein-tyrosine kinase (EC
            2.7.1.112) cek2 precursor - chicken>gb:CHKCEK2_2568871
            Chicken tyrosine kinase (cek2) mRNA, complete cds.
          Length = 806

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 4/173 (2%)
 Frame = -1

Query: 827  KXRKKKLAFKIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVARVE 648
            K  +++L FK ++  A  ++RG+ YL S+K +HRD+ A N+L+     +KIADFG+AR +
Sbjct: 577  KLPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLAR-D 635

Query: 647  AQN---PKDMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCC-DLPYPDLSFA 480
              N    K  T     + +MAPE L  + Y  + DV+SFGV LWEI+     PYP +   
Sbjct: 636  VHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVE 695

Query: 479  EVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDT 321
            E+   ++++  R + P  C   L  IM++CW A P +RP   ++V  ++ + T
Sbjct: 696  ELFK-LLKEGHRMDKPANCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRVLT 747



>gb:AC091727_2467647 Takifugu rubripes clone 250A8, complete
           sequence.
          Length = 320

 Score =  107 bits (267), Expect = 3e-22
 Identities = 63/171 (36%), Positives = 100/171 (58%), Gaps = 7/171 (4%)
 Frame = -1

Query: 800 KIVIQLALDLSRGLSYLHSKKIVHRDVKAENMLLDTSRNLKIADFGVAR----VEAQNPK 633
           K ++   L ++RG+ YL SKK VHRD+ A N +LD S  +K+ADFG+AR     E  +  
Sbjct: 92  KDLMGFGLQVARGMEYLASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVH 151

Query: 632 DMTGETGTLGYMAPEVLDGKPYNRKCDVYSFGVCLWEIYCCDL-PYPDLSFAEVSSAVV- 459
           + +G    + +MA E L    +  K DV+SFGV LWE+      PY D++  +++  ++ 
Sbjct: 152 NKSGVKLPVKWMALESLQTHKFTSKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQ 211

Query: 458 -RQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLMEAIDTSKGG 309
            R+ L+PE    CP +L ++M +CW  NP++RP   E+V  + +I +S  G
Sbjct: 212 GRRLLQPEF---CPDALYTVMIECWHPNPERRPSFSELVEPISSIFSSFSG 259



>gb:AF116826_1884597 Homo sapiens clone HH498 putative
            protein-tyrosine kinase mRNA, complete
            cds.>gb:AY303691_1943041 Homo sapiens cardiac ankyrin
            repeat kinase mRNA, complete cds.>gb:BX470253_1991821
            Human DNA sequence from clone RP11-653A5 on chromosome 1
            Contains the 3' end of the gene for cardiac ankyrin
            repeat kinase (CARK), the 5' end of a novel gene and the
            3' end of a novel gene, complete sequence.
          Length = 835

 Score =  107 bits (267), Expect = 3e-22
 Identities = 58/171 (33%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = -1

Query: 833  LYKXRKKKLAFKIVIQLALDLSRGLSYLHS--KKIVHRDVKAENMLLDTSRNLKIADFGV 660
            L   +K+ L  +  + +A+D+++G+ YLH+  + I+HRD+ + N+LL    +  +ADFG 
Sbjct: 550  LLHEQKRILDLQSKLIIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAVVADFGE 609

Query: 659  AR-VEAQNPKDMTGETGTLGYMAPEVLDG-KPYNRKCDVYSFGVCLWEIYCCDLPYPDLS 486
            +R +++ +  +MT + G L +MAPEV      Y  K DV+S+ +CLWEI   ++P+  L 
Sbjct: 610  SRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEILTGEIPFAHLK 669

Query: 485  FAEVSSAVVRQNLRPEIPRCCPSSLASIMKKCWDANPDKRPEMDEVVRLME 333
             A  ++ +   ++RP I    P  ++S++ + W+A P+ RPE  EVV  +E
Sbjct: 670  PAAAAADMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFSEVVMKLE 720


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 916,031,183
Number of Sequences: 1806583
Number of extensions: 20426486
Number of successful extensions: 89196
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 71059
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 75635
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55395072964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)