BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8714
         (732 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF227979_1778889 Euphorbia esula 40S ribosomal protein S16 mR...   276   3e-73   
sp|P46293|RS16_GOSHI|RS16_GOSHI 40S ribosomal protein S16.>pir|S41193|S4119...   268   1e-70   Gossypium hirsutum [American cotton]
sp|O22647|RS16_FRIAG|RS16_FRIAG 40S ribosomal protein S16.>gb:AF031546_1762...   266   3e-70   Fritillaria agrestis
pir|E84489|E84489 40S ribosomal protein S16 [imported] - Arabido...   261   7e-69   Arabidopsis thaliana [mouse-ear cress]
sp|Q42340|RS16_ARATH|RS16_ARATH 40S ribosomal protein S16.>gb:AY059138_1564...   261   9e-69   Arabidopsis thaliana [mouse-ear cress]
sp|Q9XEK7|RS16_TORRU|RS16_TORRU 40S ribosomal protein S16.>gb:AF108725_1768...   253   3e-66   Syntrichia ruralis
gb:ATAC016829_1543646 Arabidopsis thaliana chromosome III BAC T6...   247   2e-64   
gb:AY495970_1609064 Capsicum annuum small subunit ribosomal prot...   240   2e-62   
sp|P46294|RS16_ORYSA|RS16_ORYSA 40S ribosomal protein S16.>pir|T04083|T0408...   237   1e-61   Oryza sativa [red rice]
gb:BC084715_2109024 Rattus norvegicus cDNA clone IMAGE:7311638, ...   233   2e-60   
gb:BC082286_2108353 Mus musculus ribosomal protein S16, mRNA (cD...   233   2e-60   
gb:BC064030_2105287 Rattus norvegicus cDNA clone IMAGE:6887619, ...   233   2e-60   
pir|A39760|R3HU16 ribosomal protein S16, cytosolic [validated] -...   233   2e-60   
sp|P62249|RS16_HUMAN|RS16_HUMAN 40S ribosomal protein S16.>sp|P14131|RS16_M...   233   2e-60   Homo sapiens [man]
sp|Q90YQ7|RS16_ICTPU|RS16_ICTPU 40S ribosomal protein S16.>gb:AF402825_2492...   233   3e-60   Ictalurus punctatus
gb:BC084534_2563905 Xenopus tropicalis hypothetical LOC496563, m...   231   8e-60   
sp|Q98TR7|RS16_HETFO|RS16_HETFO 40S ribosomal protein S16.>gb:AY027434_2508...   231   8e-60   Heteropneustes fossilis
sp|Q9W237|RS16_DROME|RS16_DROME 40S ribosomal protein S16.>gb:AE013599_1133...   228   9e-59   Drosophila melanogaster
gb:MUSRPS16_2129908 Mouse S16 ribosomal protein gene, complete cds.   228   1e-58   
pir|S11623|R3MS16 ribosomal protein S16 - mouse                       225   7e-58   
gb:AF548333_1281136 Branchiostoma belcheri ribosomal protein S16...   224   1e-57   
sp|Q95V31|RS16_SPOFR|RS16_SPOFR 40S ribosomal protein S16.>gb:AF429981_1270...   224   2e-57   Spodoptera frugiperda
sp|P16149|RS16_LUPPO|RS16_LUPPO 40S ribosomal protein S16.>pir|S15003|R3YL1...   224   2e-57   Lupinus polyphyllus
gb:AY826142_1180102 Aedes albopictus clone AL_16240 ribosomal pr...   223   3e-57   
sp|P62251|RS16_AEDAE|RS16_AEDAE 40S ribosomal protein S16.>gb:AY552053_1335...   223   3e-57   Aedes aegypti
gb:PDA488155_2577702 Pachymedusa dacnicolor partial mRNA for rib...   222   6e-57   
gb:AY769332_1350483 Bombyx mori ribosomal protein S16 (RpS16) mR...   221   1e-56   
gb:AX885241_1480694 Sequence 1104 from Patent EP1033401.              214   2e-54   
sp|O60144|RS16_SCHPO|RS16_SCHPO 40S ribosomal protein S16.>pir|T39778|T3977...   211   1e-53   Schizosaccharomyces pombe
sp|Q29201|RS16_PIG|RS16_PIG 40S ribosomal protein S16 (Fragment).              210   2e-53   Sus scrofa [pigs]
gb:AB017604_1513659 Schizosaccharomyces pombe mRNA for ribosomal...   210   2e-53   
pir|T43419|T43419 ribosomal protein S16 - fission yeast (Schizos...   210   2e-53   Schizosaccharomyces pombe
sp|Q22054|RS16_CAEEL|RS16_CAEEL 40S ribosomal protein S16.>pir|T24280|T2428...   206   3e-52   Caenorhabditis elegans [roundworm]
gb:AE016817_1747642 Ashbya gossypii (= Eremothecium gossypii) AT...   205   6e-52   
sp|O94017|RS16_CANAL|RS16_CANAL 40S ribosomal protein S16.>pir|T52145|T5214...   205   8e-52   Candida albicans
gb:CR382128_1660865 Yarrowia lipolytica chromosome B of strain C...   203   2e-51   
gb:AY159357_1305247 Hydra vulgaris ribosomal protein S16 mRNA, p...   203   3e-51   
gb:CR380955_1651551 Candida glabrata strain CBS138 chromosome I ...   202   4e-51   
gb:AY145037_1583828 Kluyveromyces lactis clone P2225 RPS16 gene,...   202   4e-51   
gb:AY145016_1583807 Saccharomyces kluyveri clone P2220 RPS16 gen...   202   4e-51   
pir|S67619|S67619 ribosomal protein S16.e, cytosolic - yeast (Sa...   202   5e-51   Saccharomyces cerevisiae [brewer's yeast]
sp|P40213|RS16_YEAST|RS16_YEAST 40S ribosomal protein S16 (RP61R).               202   7e-51   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382136_1668969 Debaryomyces hansenii chromosome D of strain...   201   1e-50   
gb:AY144901_1583692 Saccharomyces exiguus clone P2020 RPS16 gene...   197   1e-49   
sp|Q876B4|RS16_SACEX|RS16_SACEX 40S ribosomal protein S16.                       197   2e-49   Kazachstania exigua
gb:AY144855_1583646 Saccharomyces bayanus RPS16 gene, partial cds.    196   4e-49   
gb:AY144854_1583645 Saccharomyces bayanus RPS16 gene, partial cds.    196   4e-49   
gb:AY144955_1583746 Saccharomyces castellii clone Contig1629 RPS...   196   5e-49   
gb:AY144956_1583747 Saccharomyces castellii clone Contig2037 RPS...   194   1e-48   
gb:AE017342_1754935 Cryptococcus neoformans var. neoformans JEC2...   192   5e-48   
gb:PFMAL8P1_1192200 Plasmodium falciparum 3D7 chromosome 8, *** ...   192   5e-48   
gb:AY144900_1583691 Saccharomyces exiguus clone P2009 RPS16 gene...   191   9e-48   
gb:A63925_1450143 Sequence 50 from Patent WO9723633.                  184   1e-45   
gb:BC072146_2556406 Xenopus laevis hypothetical protein MGC80065...   175   9e-43   
pir|B90134|B90134 40S ribosomal protein S16 [imported] - Guillar...   164   1e-39   Guillardia theta
gb:AF481058_1275341 Aplysia californica 40S ribosomal protein S1...   136   4e-31   
gb:BC071674_1988729 Homo sapiens cDNA clone MGC:87876 IMAGE:5394...   123   3e-27   
gb:AY550068_1431343 Sus scrofa 40S ribosomal protein S16 mRNA, p...   122   9e-27   
sp|O26146|RLSX_METTH|RLSX_METTH Fused L13/S9 ribosomal protein [Includes: 5...   119   4e-26   Methanothermobacter thermautotrophicus
sp|Q8TVB5|RS9_METKA|RS9_METKA 30S ribosomal protein S9P.>gb:AE010438_26310...   116   4e-25   Methanopyrus kandleri
gb:CNS07EGA_1372944 chromosome III of strain GB-M1 of Encephalit...   115   1e-24   
sp|O59299|RS9_PYRHO|RS9_PYRHO 30S ribosomal protein S9P.>pir|A71043|A71043...   112   9e-24   Pyrococcus horikoshii
sp|Q979K1|RS9_THEVO|RS9_THEVO 30S ribosomal protein S9P.>gb:BA000011_66560...   111   2e-23   Thermoplasma volcanium
sp|Q8U0E7|RS9_PYRFU|RS9_PYRFU 30S ribosomal protein S9P.>gb:AE010263_26121...   111   2e-23   Pyrococcus furiosus
sp|Q9V195|RS9_PYRAB|RS9_PYRAB 30S ribosomal protein S9P.>pir|H75171|H75171...   111   2e-23   Pyrococcus abyssi
sp|Q9HL08|RS9_THEAC|RS9_THEAC 30S ribosomal protein S9P.>gb:TACID2_196204 ...   108   1e-22   Thermoplasma acidophilum
sp|Q9HQJ2|RS9_HALN1|RS9_HALN1 30S ribosomal protein S9P.                        108   1e-22   Halobacterium sp.
pir|C41715|R3HS3 ribosomal protein S9 [validated] - Haloarcula m...   107   2e-22   
sp|P54024|RS9_METJA|RS9_METJA 30S ribosomal protein S9P.>pir|D64324|D64324...   107   2e-22   Methanocaldococcus jannaschii
sp|P05763|RS9_HALMA|RS9_HALMA 30S ribosomal protein S9P (HmaS9) (HS3) (F1).     107   2e-22   Haloarcula marismortui
pir|A72558|A72558 probable ribosomal protein S9 APE1749 - Aeropy...   106   5e-22   Aeropyrum pernix
sp|Q8TT42|RS9_METAC|RS9_METAC 30S ribosomal protein S9P.>gb:AE010721_26597...   106   5e-22   Methanosarcina acetivorans
sp|Q9YB48|RS9_AERPE|RS9_AERPE 30S ribosomal protein S9P.                        106   5e-22   Aeropyrum pernix
sp|Q8PW44|RS9_METMA|RS9_METMA 30S ribosomal protein S9P.>gb:AE013411_29208...   105   6e-22   Methanosarcina mazei
gb:AP006878_576652 Thermococcus kodakaraensis strain KOD1 DNA, c...   105   1e-21   
sp|O29136|RS9_ARCFU|RS9_ARCFU 30S ribosomal protein S9P.>pir|H69390|H69390...   103   3e-21   Archaeoglobus fulgidus
gb:BX957222_844578 Methanococcus maripaludis S2 complete genome;...   102   5e-21   
gb:AK097937_1915012 Homo sapiens cDNA FLJ40618 fis, clone THYMU2...   101   1e-20   
gb:AE017261_419341 Picrophilus torridus DSM 9790, complete genome.    100   3e-20   
gb:AE009779_255568 Pyrobaculum aerophilum strain IM2 section 34 ...    99   6e-20   
sp|Q8ZYQ0|RS9_PYRAE|RS9_PYRAE 30S ribosomal protein S9P.                         99   6e-20   Pyrobaculum aerophilum
gb:AY192166_1309057 Leishmania enriettii ribosomal protein S16 (...    96   7e-19   
sp|Q96YW3|RS9_SULTO|RS9_SULTO 30S ribosomal protein S9P.>gb:BA000023_69274...    92   7e-18   Sulfurisphaera tokodaii
pir|S75420|S75420 ribosomal protein S9 [similarity] - Sulfolobus...    92   1e-17   Saccharolobus solfataricus
sp|P95992|RS9_SULSO|RS9_SULSO 30S ribosomal protein S9P.                         92   1e-17   Saccharolobus solfataricus
sp|P39468|RS9_SULAC|RS9_SULAC 30S ribosomal protein S9P.>pir|S47026|S47026...    87   2e-16   Sulfolobus acidocaldarius
gb:BX908798_831312 Parachlamydia-related symbiont UWE25, complet...    76   7e-13   
pir|G84269|G84269 30S ribosomal protein S9P [imported] - Halobac...    75   9e-13   Halobacterium salinarum
gb:AE017199_403268 Nanoarchaeum equitans Kin4-M, complete genome.      74   4e-12   
sp|Q8KBK5|RS9_CHLTE|RS9_CHLTE 30S ribosomal protein S9.>gb:AE012931_287245...    72   1e-11   Chlorobaculum tepidum
gb:BX842647_823503 Bdellovibrio bacteriovorus complete genome, s...    66   7e-10   
gb:AE017317_440763 Desulfovibrio vulgaris subsp. vulgaris str. H...    65   1e-09   
sp|Q9PKR2|RS9_CHLMU|RS9_CHLMU 30S ribosomal protein S9.>pir|H81705|H81705 ...    65   2e-09   Chlamydia muridarum [agent of mouse pneumonitis]
sp|Q822Z3|RS9_CHLCV|RS9_CHLCV 30S ribosomal protein S9.>gb:AE016995_374591...    65   2e-09   Chlamydia caviae
sp|O84128|RS9_CHLTR|RS9_CHLTR 30S ribosomal protein S9.>pir|B71554|B71554 ...    64   2e-09   Chlamydia trachomatis
gb:CP000013_869572 Borrelia garinii PBi, complete genome.              63   5e-09   
sp|O51313|RS9_BORBU|RS9_BORBU 30S ribosomal protein S9.>pir|A70142|A70142 ...    63   5e-09   Borreliella burgdorferi
gb:AY774849_2149562 Synthetic construct Francisella tularensis c...    63   6e-09   
gb:AJ749949_531731 Francisella tularensis subsp. tularensis comp...    63   6e-09   
sp|Q9Z8T8|RS9_CHLPN|RS9_CHLPN 30S ribosomal protein S9.>pir|B72101|B72101 ...    63   6e-09   Chlamydia pneumoniae
gb:AE017248_415901 Treponema denticola ATCC 35405, section 3 of ...    62   8e-09   
sp|Q9X1G4|RS9_THEMA|RS9_THEMA 30S ribosomal protein S9.>pir|F72250|F72250 ...    61   2e-08   Thermotoga maritima
sp|Q7VUV9|RS9_BORPE|RS9_BORPE 30S ribosomal protein S9.>gb:BX640420_807361...    61   2e-08   Bordetella pertussis
sp|Q7W3Z2|RS9_BORPA|RS9_BORPA 30S ribosomal protein S9.>gb:BX640435_812118...    60   3e-08   Bordetella parapertussis
gb:AE017263_421046 Mesoplasma florum L1 complete genome.               60   4e-08   
sp|Q7WFC4|RS9_BORBR|RS9_BORBR 30S ribosomal protein S9.>gb:BX640450_817004...    60   4e-08   Bordetella bronchiseptica
sp|Q7MX42|RS9_PORGI|RS9_PORGI 30S ribosomal protein S9.>gb:AE017173_396723...    59   7e-08   Porphyromonas gingivalis
sp|Q9PMI3|RS9_CAMJE|RS9_CAMJE 30S ribosomal protein S9.>pir|D81294|D81294 ...    59   7e-08   
gb:AE016942_363242 Bacteroides thetaiotaomicron VPI-5482, sectio...    59   9e-08   
gb:AP006841_574531 Bacteroides fragilis YCH46 DNA, complete genome.    59   1e-07   
gb:CR555306_105907 Azoarcus sp. EbN1 complete genome.                  59   1e-07   
sp|Q8R7Y9|RS9_THETN|RS9_THETN 30S ribosomal protein S9.>gb:AE013170_289825...    58   2e-07   
sp|Q8F0T3|RS9_LEPIN|RS9_LEPIN 30S ribosomal protein S9.>gb:AE011499_273643...    57   3e-07   
gb:BX842644_822715 Mycoplasma mycoides subsp. mycoides SC genomi...    56   8e-07   
sp|P56016|RS9_HELPY|RS9_HELPY 30S ribosomal protein S9.>pir|C64530|C64530 ...    56   8e-07   Helicobacter pylori
sp|Q7VIV5|RS9_HELHP|RS9_HELHP 30S ribosomal protein S9.>gb:AE017145_390252...    56   8e-07   Helicobacter hepaticus
sp|Q7M7R1|RS9_WOLSU|RS9_WOLSU 30S ribosomal protein S9.>gb:BX571662_779387...    55   1e-06   Wolinella succinogenes
sp|Q82UK1|RS9_NITEU|RS9_NITEU 30S ribosomal protein S9.>gb:BX321861_773811...    55   1e-06   Nitrosomonas europaea
gb:BC057240_1985392 Homo sapiens mitochondrial ribosomal protein...    55   2e-06   
gb:BC047784_1984022 Homo sapiens mitochondrial ribosomal protein...    55   2e-06   
gb:ABE291783_1529743 Atropa belladonna partial mRNA for 40S ribo...    55   2e-06   
sp|P82933|RT09_HUMAN|RT09_HUMAN 28S ribosomal protein S9, mitochondrial pre...    55   2e-06   Homo sapiens [man]
sp|Q87DD4|RS9_XYLFT|RS9_XYLFT 30S ribosomal protein S9.>gb:AE012556_284168...    54   2e-06   Xylella fastidiosa
sp|Q7UEY4|RS9_RHOBA|RS9_RHOBA 30S ribosomal protein S9.>gb:BX294151_770786...    54   2e-06   Rhodopirellula baltica
sp|Q8Y245|RS9_RALSO|RS9_RALSO 30S ribosomal protein S9.>gb:AL646059_545419...    53   5e-06   Ralstonia solanacearum
sp|Q83AX9|RS9_COXBU|RS9_COXBU 30S ribosomal protein S9.>gb:AE016965_368932...    53   5e-06   Coxiella burnetii
sp|Q97EL3|RS9_CLOAB|RS9_CLOAB 30S ribosomal protein S9.>pir|B97281|B97281 ...    53   5e-06   Clostridium acetobutylicum
gb:AE014297_1138384 Drosophila melanogaster chromosome 3R, compl...    53   6e-06   
gb:CP000009_862478 Gluconobacter oxydans 621H, complete genome.        53   6e-06   
gb:AE004969_61662 Neisseria gonorrhoeae FA 1090, complete genome.      53   6e-06   
sp|O83987|RS9_TREPA|RS9_TREPA 30S ribosomal protein S9.>pir|C71251|C71251 ...    52   8e-06   Treponema pallidum
sp|Q7NRT4|RS9_CHRVO|RS9_CHRVO 30S ribosomal protein S9.>gb:AE016923_358657...    52   8e-06   Chromobacterium violaceum
sp|Q81VP8|RS9_BACAN|RS9_BACAN 30S ribosomal protein S9.>gb:AE017024_380439...    52   8e-06   Bacillus anthracis [anthrax]
gb:AY673996_1621428 Gracilaria tenuistipitata var. liui chloropl...    52   1e-05   
gb:AE017332_445926 Mycoplasma hyopneumoniae 232, complete genome.      52   1e-05   
sp|P80374|RS9_THETH|RS9_THETH 30S ribosomal protein S9.>gb:TTH409331_19848...    52   1e-05   Thermus thermophilus
sp|Q927P3|RS9_LISIN|RS9_LISIN 30S ribosomal protein S9.>pir|AC1775|AC1775 ...    52   1e-05   
sp|Q81J12|RS9_BACCR|RS9_BACCR 30S ribosomal protein S9.>gb:AE016998_375201...    52   1e-05   Bacillus cereus
gb:AP008226_578921 Thermus thermophilus HB8 genomic DNA, complet...    52   1e-05   
sp|Q8D362|RS9_WIGBR|RS9_WIGBR 30S ribosomal protein S9.>gb:BA000021_686885...    52   1e-05   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
sp|P51291|RR9_PORPU|RR9_PORPU Chloroplast 30S ribosomal protein S9.>pir|S7...    52   1e-05   Porphyra purpurea
sp|Q92QR5|RS9_RHIME|RS9_RHIME 30S ribosomal protein S9.>gb:SME591786_18526...    51   2e-05   Sinorhizobium meliloti
sp|Q9JQZ9|RS9_NEIMA|RS9_NEIMA 30S ribosomal protein S9.>pir|A81012|A81012 ...    51   2e-05   
sp|P07842|RS9_BACST|RS9_BACST 30S ribosomal protein S9 (BS10).>pir|S08564|...    51   2e-05   Geobacillus stearothermophilus
sp|Q9KGD4|RS9_BACHD|RS9_BACHD 30S ribosomal protein S9.>pir|A83671|A83671 ...    51   2e-05   Bacillus halodurans
gb:AP006628_566574 Onion yellows phytoplasma OY-M DNA, complete ...    51   2e-05   
sp|Q9PD43|RS9_XYLFA|RS9_XYLFA 30S ribosomal protein S9.>pir|E82669|E82669 ...    51   2e-05   Xylella fastidiosa
gb:BA000043_736717 Geobacillus kaustophilus HTA426 DNA, complete...    50   3e-05   
gb:AY773199_2148681 Synthetic construct 30S ribosomal RNA protei...    50   4e-05   
gb:BX572601_802382 Rhodopseudomonas palustris CGA009 complete ge...    50   4e-05   
gb:CR378673_96519 Photobacterium profundum SS9; segment 11/12.         50   4e-05   
pir|H65114|R3EC9 ribosomal protein S9 [validated] - Escherichia ...    50   4e-05   
sp|Q7N079|RS9_PHOLL|RS9_PHOLL 30S ribosomal protein S9.>gb:BX571872_788869...    50   4e-05   Photorhabdus laumondii subsp. laumondii
sp|P02363|RS9_ECOLI|RS9_ECOLI 30S ribosomal protein S9.                          50   4e-05   Escherichia coli [E. coli]
sp|P59514|RS9_BUCBP|RS9_BUCBP 30S ribosomal protein S9.>gb:AE014017_302756...    50   4e-05   
gb:BC088242_2110438 Rattus norvegicus cDNA clone IMAGE:7366193, ...    50   5e-05   
gb:AE013598_297853 Xanthomonas oryzae pv. oryzae KACC10331, comp...    50   5e-05   
gb:AE005674_72854 Shigella flexneri 2a str. 301, complete genome.      50   5e-05   
sp|Q8PD66|RS9_XANCP|RS9_XANCP 30S ribosomal protein S9.>gb:AE012145_279751...    50   5e-05   Xanthomonas campestris pv. campestris
sp|Q8PQ41|RS9_XANAC|RS9_XANAC 30S ribosomal protein S9.>gb:AE011675_275450...    50   5e-05   Xanthomonas citri
sp|Q83Q07|RS9_SHIFL|RS9_SHIFL 30S ribosomal protein S9.                          50   5e-05   Shigella flexneri
sp|Q8EAG3|RS9_SHEON|RS9_SHEON 30S ribosomal protein S9.>gb:AE015825_318253...    50   5e-05   Shewanella oneidensis
sp|Q890R7|RS9_CLOTE|RS9_CLOTE 30S ribosomal protein S9.>gb:AE015945_321590...    50   5e-05   Clostridium tetani
gb:CP000010_866515 Burkholderia mallei ATCC 23344 chromosome 1, ...    49   7e-05   
gb:BX897700_828894 Bartonella quintana str. Toulouse, complete g...    49   7e-05   
gb:BX571965_792708 Burkholderia pseudomallei strain K96243, chro...    49   7e-05   
gb:AE017180_401164 Geobacter sulfurreducens PCA, complete genome.      49   7e-05   
gb:AE013614_298469 Yersinia pestis KIM section 14 of 415 of the ...    49   7e-05   
gb:CR543861_104814 Acinetobacter sp. ADP1 complete genome.             49   7e-05   
pir|AF0908|AF0908 ribosomal protein S9 [similarity] - Salmonella...    49   7e-05   Salmonella enterica subsp. enterica serovar Typhi
sp|Q8ZB62|RS9_YERPE|RS9_YERPE 30S ribosomal protein S9.>pir|AC0433|AC0433 ...    49   7e-05   Yersinia pestis
sp|Q8XFX5|RS9_SALTY|RS9_SALTY 30S ribosomal protein S9.                          49   7e-05   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q9RXY0|RS9_DEIRA|RS9_DEIRA 30S ribosomal protein S9.>pir|F75552|F75552 ...    49   9e-05   Deinococcus radiodurans
gb:CR628336_112878 Legionella pneumophila str. Paris complete ge...    49   1e-04   
sp|Q9A8H6|RS9_CAUCR|RS9_CAUCR 30S ribosomal protein S9.>pir|B87420|B87420 ...    49   1e-04   Caulobacter vibrioides
sp|Q89KE5|RS9_BRAJA|RS9_BRAJA 30S ribosomal protein S9.>gb:BA000040_733222...    49   1e-04   Bradyrhizobium japonicum
gb:BX950851_839064 Erwinia carotovora subsp. atroseptica SCRI104...    48   2e-04   
gb:AP006618_557261 Nocardia farcinica IFM 10152 DNA, complete ge...    48   2e-04   
gb:AP006627_562511 Bacillus clausii KSM-K16 DNA, complete genome.      48   2e-04   
gb:CP000046_92295 Staphylococcus aureus subsp. aureus COL, compl...    48   2e-04   
sp|Q83IA3|RS9_TROW8|RS9_TROW8 30S ribosomal protein S9.>sp|Q83GU6|RS9_TROW...    48   2e-04   Tropheryma whipplei
sp|Q99S52|RS9_STAAM|RS9_STAAM 30S ribosomal protein S9.>pir|D90018|D90018 ...    48   2e-04   Staphylococcus aureus
sp|Q7UZW9|RS9_PROMP|RS9_PROMP 30S ribosomal protein S9.>gb:BX572094_797157...    48   2e-04   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
gb:CP000023_874071 Streptococcus thermophilus LMG 18311, complet...    47   3e-04   
gb:BX897699_827400 Bartonella henselae strain Houston-1, complet...    47   3e-04   
sp|Q8CWU4|RS9_STRR6|RS9_STRR6 30S ribosomal protein S9.>pir|H97905|H97905 ...    47   3e-04   Streptococcus pneumoniae
gb:AP006840_570227 Symbiobacterium thermophilum DNA, complete ge...    47   4e-04   
gb:CP000031_85729 Silicibacter pomeroyi DSS-3, complete genome.        47   4e-04   
sp|Q97SN4|RS9_STRPN|RS9_STRPN 30S ribosomal protein S9.>pir|H95034|H95034 ...    47   4e-04   
sp|Q8CRJ0|RS9_STAEP|RS9_STAEP 30S ribosomal protein S9.>gb:CP000029_82389 ...    47   4e-04   Staphylococcus epidermidis
sp|Q8EWW8|RS9_MYCPE|RS9_MYCPE 30S ribosomal protein S9.>gb:BA000026_693432...    47   4e-04   Mycoplasma penetrans
gb:AE017333_446104 Bacillus licheniformis DSM 13, complete genom...    47   5e-04   
gb:AE017242_414951 Mycobacterium avium subsp. paratuberculosis s...    47   5e-04   
sp|Q8XHV7|RS9_CLOPE|RS9_CLOPE 30S ribosomal protein S9.>gb:BA000016_675409...    47   5e-04   Clostridium perfringens
gb:AE017282_427687 Methylococcus capsulatus str. Bath, complete ...    46   6e-04   
gb:AE016827_342911 Mannheimia succiniciproducens MBEL55E, comple...    46   6e-04   
sp|P40828|RS9_MYCLE|RS9_MYCLE 30S ribosomal protein S9.>pir|S72982|S72982 ...    46   6e-04   Mycobacterium leprae
sp|Q8Y459|RS9_LISMO|RS9_LISMO 30S ribosomal protein S9.>pir|AD1399|AD1399 ...    46   6e-04   
gb:CR522870_100171 Desulfotalea psychrophila LSv54 chromosome.         46   8e-04   
pir|H69699|H69699 ribosomal protein S9 [similarity] - Bacillus s...    46   8e-04   Bacillus subtilis
sp|Q8DW97|RS9_STRMU|RS9_STRMU 30S ribosomal protein S9.>gb:AE014868_312619...    46   8e-04   Streptococcus mutans serotype C
sp|Q9CNB1|RS9_PASMU|RS9_PASMU 30S ribosomal protein S9.>gb:AE006087_215409...    46   8e-04   Pasteurella multocida
sp|O06259|RS9_MYCTU|RS9_MYCTU 30S ribosomal protein S9.>pir|H70976|H70976 ...    46   8e-04   Mycobacterium tuberculosis
sp|Q7VLF7|RS9_HAEDU|RS9_HAEDU 30S ribosomal protein S9.>gb:AE017155_392895...    46   8e-04   [Haemophilus] ducreyi
sp|P21470|RS9_BACSU|RS9_BACSU 30S ribosomal protein S9 (BS10).                   46   8e-04   Bacillus subtilis
sp|Q8YPK7|RS9_ANASP|RS9_ANASP 30S ribosomal protein S9.>pir|AD2329|AD2329 ...    46   8e-04   Anabaena sp.
sp|Q9TL29|RR9_NEPOL|RR9_NEPOL Chloroplast 30S ribosomal protein S9.>gb:AF1...    46   8e-04   Nephroselmis olivacea
sp|P19459|RR9_GUITH|RR9_GUITH Chloroplast 30S ribosomal protein S9.>gb:AF0...    46   8e-04   Guillardia theta
gb:AY657385_2146395 Synthetic construct Peudomonas aeruginosa cl...    45   0.001   
gb:BC069980_2106231 Mus musculus mitochondrial ribosomal protein...    45   0.001   
gb:BC051936_2100842 Mus musculus mitochondrial ribosomal protein...    45   0.001   
gb:BC022587_2093799 Mus musculus mitochondrial ribosomal protein...    45   0.001   
gb:AK009082_1154936 Mus musculus adult male tongue cDNA, RIKEN f...    45   0.001   
gb:CP000033_88631 Lactobacillus acidophilus NCFM, complete genome.     45   0.001   
sp|Q99Y08|RS9_STRPY|RS9_STRPY 30S ribosomal protein S9.>gb:AE006617_220755...    45   0.001   Streptococcus pyogenes
sp|Q7V520|RS9_PROMM|RS9_PROMM 30S ribosomal protein S9.>gb:BX572100_799101...    45   0.001   Prochlorococcus marinus
sp|Q8YGJ0|RS9_BRUME|RS9_BRUME 30S ribosomal protein S9.>pir|AC3398|AC3398 ...    45   0.001   
gb:BAP239043_746989 Buchnera aphidicola partial yhbz; rpsI; rplM...    45   0.001   
gb:AE017340_456180 Idiomarina loihiensis L2TR, complete genome.        45   0.001   
sp|Q7U4H4|RS9_SYNPX|RS9_SYNPX 30S ribosomal protein S9.>gb:BX569694_776996...    45   0.001   Synechococcus sp.
sp|Q7NBH4|RS9_MYCGA|RS9_MYCGA 30S ribosomal protein S9.>gb:AE016968_369563...    45   0.001   
sp|Q9CDG7|RS9_LACLA|RS9_LACLA 30S ribosomal protein S9.>pir|E86906|E86906 ...    45   0.001   Lactococcus lactis subsp. lactis
sp|Q8E7E4|RS9_STRA3|RS9_STRA3 30S ribosomal protein S9.>sp|Q8E1Y6|RS9_STRA...    45   0.002   
sp|Q9HVY3|RS9_PSEAE|RS9_PSEAE 30S ribosomal protein S9.>pir|H83092|H83092 ...    45   0.002   Pseudomonas aeruginosa
sp|P57470|RS9_BUCAI|RS9_BUCAI 30S ribosomal protein S9.>pir|E84975|E84975 ...    45   0.002   
sp|Q8G1C9|RS9_BRUSU|RS9_BRUSU 30S ribosomal protein S9.>gb:AE014291_308231...    45   0.002   Brucella suis bv. 1
sp|O67723|RS9_AQUAE|RS9_AQUAE 30S ribosomal protein S9.>pir|A70462|A70462 ...    45   0.002   Aquifex aeolicus
gb:S75161_169035 rplM=ribosomal protein L13 homolog...stringent ...    44   0.002   
pir|F64123|F64123 ribosomal protein S9 - Haemophilus influenzae ...    44   0.002   Haemophilus influenzae
pir|B43310|B43310 ribosomal protein S9 - Haemophilus somnus            44   0.002   Histophilus somni
sp|P31782|RS9_HAESO|RS9_HAESO 30S ribosomal protein S9.                          44   0.002   Histophilus somni
sp|P44388|RS9_HAEIN|RS9_HAEIN 30S ribosomal protein S9.                          44   0.002   Haemophilus influenzae
sp|P73293|RS9_SYNY3|RS9_SYNY3 30S ribosomal protein S9.>pir|S77474|S77474 ...    44   0.003   Synechocystis sp.
sp|Q8DMK7|RS9_SYNEL|RS9_SYNEL 30S ribosomal protein S9.>gb:BA000039_725894...    44   0.003   Synechococcus elongatus
sp|Q982W9|RS9_RHILO|RS9_RHILO 30S ribosomal protein S9.>gb:BA000012_672624...    44   0.003   Mesorhizobium loti
sp|Q88N96|RS9_PSEPK|RS9_PSEPK 30S ribosomal protein S9.>gb:AE016778_330754...    44   0.003   Pseudomonas putida
sp|Q8RGG8|RS9_FUSNN|RS9_FUSNN 30S ribosomal protein S9.>gb:AE010545_264235...    44   0.003   Fusobacterium nucleatum subsp. nucleatum
sp|O07828|RS9_PROMA|RS9_PROMA 30S ribosomal protein S9.>gb:AE017166_396140...    44   0.004   Prochlorococcus marinus
sp|Q8UFZ8|RS9_AGRT5|RS9_AGRT5 30S ribosomal protein S9.>pir|AI2729|AI2729 ...    44   0.004   Agrobacterium tumefaciens
gb:AP008231_581587 Synechococcus elongatus PCC 6301 DNA, complet...    43   0.005   
gb:CP000027_79511 Dehalococcoides ethenogenes 195, complete genome.    43   0.005   
sp|O94150|RT09_CANAL|RT09_CANAL 40S ribosomal protein S9, mitochondrial pre...    43   0.005   Candida albicans
sp|Q87WW8|RS9_PSESM|RS9_PSESM 30S ribosomal protein S9.>gb:AE016871_353786...    43   0.005   Pseudomonas syringae pv. tomato
sp|Q82Z47|RS9_ENTFA|RS9_ENTFA 30S ribosomal protein S9.>gb:AE016957_367160...    43   0.005   Enterococcus faecalis
gb:AE017308_437852 Mycoplasma mobile 163K complete genome.             43   0.007   
sp|Q92IV4|RS9_RICCN|RS9_RICCN 30S ribosomal protein S9.>pir|D97739|D97739 ...    43   0.007   Rickettsia conorii
sp|Q8K9G0|RS9_BUCAP|RS9_BUCAP 30S ribosomal protein S9.>gb:AE014114_303289...    43   0.007   
gb:AY548459_627483 Fremyella diplosiphon clone 3098E8 30S riboso...    42   0.009   
pir|H72557|H72557 hypothetical protein APE1748 - Aeropyrum perni...    42   0.009   Aeropyrum pernix
sp|P75179|RS9_MYCPN|RS9_MYCPN 30S ribosomal protein S9.>pir|S73552|S73552 ...    42   0.009   Mycoplasma pneumoniae
sp|P47656|RS9_MYCGE|RS9_MYCGE 30S ribosomal protein S9.>pir|A64246|A64246 ...    42   0.009   Mycoplasma genitalium
gb:AF332374_1787199 Zea mays 9S ribosomal protein (lem1) gene, c...    42   0.011   
sp|Q8G423|RS9_BIFLO|RS9_BIFLO 30S ribosomal protein S9.>gb:AE014295_312233...    42   0.011   Bifidobacterium longum
sp|Q9MUV1|RR9_MESVI|RR9_MESVI Chloroplast 30S ribosomal protein S9.>gb:AF1...    42   0.011   Mesostigma viride
gb:AX876773_1476685 Sequence 11678 from Patent EP1074617.              42   0.015   
gb:AE017283_431561 Propionibacterium acnes KPA171202, complete g...    42   0.015   
gb:AE008692_240621 Zymomonas mobilis subsp. mobilis ZM4, complet...    42   0.015   
sp|Q9ZDU0|RS9_RICPR|RS9_RICPR 30S ribosomal protein S9.>pir|G71677|G71677 ...    42   0.015   Rickettsia prowazekii
sp|Q8ETV3|RS9_OCEIH|RS9_OCEIH 30S ribosomal protein S9.>gb:BA000028_694539...    42   0.015   Oceanobacillus iheyensis
sp|Q9KUF0|RS9_VIBCH|RS9_VIBCH 30S ribosomal protein S9.>pir|C82308|C82308 ...    41   0.019   
sp|Q9PPR3|RS9_UREPA|RS9_UREPA 30S ribosomal protein S9.>pir|D82873|D82873 ...    41   0.025   Ureaplasma parvum serovar 3
gb:AE014186_938344 Plasmodium falciparum 3D7 chromosome 11 compl...    40   0.033   
gb:AE017197_402213 Rickettsia typhi str. Wilmington complete gen...    40   0.033   
gb:U01744_203464 Mycoplasma genitalium random genomic clone esg1...    40   0.033   
sp|Q9P4C1|RT09_KLUMA|RT09_KLUMA 40S ribosomal protein S9, mitochondrial pre...    40   0.033   Kluyveromyces marxianus
sp|Q87SI4|RS9_VIBPA|RS9_VIBPA 30S ribosomal protein S9.>gb:BA000031_705899...    40   0.033   
sp|P48135|RR9_CYAPA|RR9_CYAPA Cyanelle 30S ribosomal protein S9.>pir|T0694...    40   0.033   Cyanophora paradoxa
gb:AB022675_1515250 Oryza sativa (japonica cultivar-group) rps9 ...    40   0.043   
gb:AE017201_403747 Lactobacillus johnsonii NCC 533, section 2 of...    40   0.043   
gb:AE016822_340944 Leifsonia xyli subsp. xyli str. CTCB07, compl...    40   0.043   
sp|Q82DL8|RS9_STRAW|RS9_STRAW 30S ribosomal protein S9.>gb:BA000030_702845...    40   0.043   Streptomyces avermitilis
sp|Q98Q72|RS9_MYCPU|RS9_MYCPU 30S ribosomal protein S9.>pir|H90573|H90573 ...    40   0.043   Mycoplasma pulmonis
sp|Q7ND17|RS9_GLOVI|RS9_GLOVI 30S ribosomal protein S9.>gb:BA000045_744494...    40   0.043   Gloeobacter violaceus
sp|Q9TLV4|RR9_CYACA|RR9_CYACA Chloroplast 30S ribosomal protein S9.>gb:AF0...    40   0.043   Cyanidium caldarium
gb:AE016818_1748181 Ashbya gossypii (= Eremothecium gossypii) AT...    40   0.057   
gb:CP000020_872397 Vibrio fischeri ES114 chromosome I, complete ...    39   0.074   
gb:CR767821_117148 Ehrlichia ruminantium strain Welgevonden, com...    39   0.097   
sp|Q7VQR6|RS9_CANBF|RS9_CANBF 30S ribosomal protein S9.>gb:BX248584_763679...    39   0.097   Candidatus Blochmannia floridanus
gb:CR382126_1659288 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.13    
gb:AE017321_442205 Wolbachia endosymbiont strain TRS of Brugia m...    39   0.13    
sp|Q8DEJ0|RS9_VIBVU|RS9_VIBVU 30S ribosomal protein S9.>sp|Q7MNX0|RS9_VIBV...    39   0.13    
gb:CP000030_83836 Anaplasma marginale str. St. Maries, complete ...    38   0.22    
sp|Q53875|RS9_STRCO|RS9_STRCO 30S ribosomal protein S9.>pir|T35564|T35564 ...    38   0.22    
gb:CR382139_1672436 Debaryomyces hansenii chromosome G of strain...    37   0.28    
gb:CR380958_1653365 Candida glabrata strain CBS138 chromosome L ...    37   0.37    
gb:PM30SRP_158752 Prochlorococcus marinus gene encoding putative...    37   0.37    
gb:AF281817_2226772 Tupaia herpesvirus strain 2, complete genome.      36   0.63    
gb:BX842617_1643688 Neurospora crassa DNA linkage group V cosmid...    36   0.82    
pir|T21503|T21503 hypothetical protein F28D9.1 - Caenorhabditis ...    36   0.82    
sp|P38120|RT09_YEAST|RT09_YEAST Probable 40S ribosomal protein S9, mitochon...    36   0.82    
gb:AY574369_1957079 Macaca mulatta inhibin alpha subunit variant...    35   1.1     
gb:CRUCOLVIIA_2111999 Cricetulus griseus type VII collagen mRNA,...    34   3.1     
pir|I48103|I48103 type VII collagen - Chinese hamster (fragment)       34   3.1     
gb:CR382132_1666081 Yarrowia lipolytica chromosome F of strain C...    33   4.1     
pir|S27923|S27923 gene LF3 protein - human herpesvirus 4>gb:HHV5...    33   4.1     
gb:BX897699_827488 Bartonella henselae strain Houston-1, complet...    33   5.3     
gb:AJ628860_528108 Sphingomonas herbicidovorans partial tnpA gen...    33   5.3     
gb:AE017239_414068 Mycobacterium avium subsp. paratuberculosis s...    33   5.3     
gb:AP004067_1837173 Oryza sativa (japonica cultivar-group) genom...    33   6.9     
gb:AE017242_414807 Mycobacterium avium subsp. paratuberculosis s...    33   6.9     
gb:CR555306_106228 Azoarcus sp. EbN1 complete genome.                  33   6.9     
sp|P21561|YGY3_HALSQ|YGY3_HALSQ Hypothetical 50.6 kDa protein in the 5'regi...    33   6.9     
sp|Q8IYF1|ELA2_HUMAN|ELA2_HUMAN RNA polymerase II transcription factor SIII...    33   6.9     
gb:AL356504_1924616 Human DNA sequence from clone RP1-14N1 on ch...    32   9.0     


>gb:AF227979_1778889 Euphorbia esula 40S ribosomal protein S16 mRNA,
           partial cds.
          Length = 144

 Score =  276 bits (706), Expect = 3e-73
 Identities = 135/144 (93%), Positives = 141/144 (97%)
 Frame = +2

Query: 95  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR 274
           AA P ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA+EPILLLGRHR
Sbjct: 1   AATPTESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHR 60

Query: 275 FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA 454
           FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVA+YQK+VDEQSKKEIKDILVRYDRTLLVA
Sbjct: 61  FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEQSKKEIKDILVRYDRTLLVA 120

Query: 455 DPRRCEPKKFGGRGARARFQKSYR 526
           DPRRCEPKKFGGRGARARFQKSYR
Sbjct: 121 DPRRCEPKKFGGRGARARFQKSYR 144



>sp|P46293|RS16_GOSHI 40S ribosomal protein S16.>pir|S41193|S41193
           ribosomal protein S16 protein - upland
           cotton>gb:GHRP16_1680139 G.hirsutum mRNA for ribosomal
           protein 16, small subunit.
          Length = 145

 Score =  268 bits (684), Expect = 1e-70
 Identities = 133/145 (91%), Positives = 137/145 (94%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH 271
           MA   +ESVQCFGRKKTAVAVTHCKRGRGLIKING PIEL++PEILR+KA EPILLLGR 
Sbjct: 1   MAEKAIESVQCFGRKKTAVAVTHCKRGRGLIKINGCPIELVEPEILRFKAVEPILLLGRQ 60

Query: 272 RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV 451
           RF GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILV YDRTLLV
Sbjct: 61  RFTGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVGYDRTLLV 120

Query: 452 ADPRRCEPKKFGGRGARARFQKSYR 526
           ADPRRCEPKKFGGRGARARFQKSYR
Sbjct: 121 ADPRRCEPKKFGGRGARARFQKSYR 145



>sp|O22647|RS16_FRIAG 40S ribosomal protein S16.>gb:AF031546_1762580
           Fritillaria agrestis ribosomal protein S16 (rps16) mRNA,
           complete cds.
          Length = 145

 Score =  266 bits (680), Expect = 3e-70
 Identities = 129/145 (88%), Positives = 138/145 (95%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH 271
           MA    ESVQCFGRKKTAVAVTHCKRGRGLIK+NG PIEL++PEILRYKAFEPILLLGRH
Sbjct: 1   MATPATESVQCFGRKKTAVAVTHCKRGRGLIKVNGSPIELVKPEILRYKAFEPILLLGRH 60

Query: 272 RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV 451
           RF GVDMRIRV+GGG TSQIYAIRQSIAKALVA+YQKYVDEQ+KKE+KDIL+RYDRTLLV
Sbjct: 61  RFVGVDMRIRVRGGGKTSQIYAIRQSIAKALVAYYQKYVDEQAKKEVKDILMRYDRTLLV 120

Query: 452 ADPRRCEPKKFGGRGARARFQKSYR 526
           ADPRRCEPKKFGGRGAR+RFQKSYR
Sbjct: 121 ADPRRCEPKKFGGRGARSRFQKSYR 145



>pir|E84489|E84489 40S ribosomal protein S16 [imported] -
           Arabidopsis thaliana>gb:AC006586_1534531 Arabidopsis
           thaliana chromosome 2 clone F7B19 map mi421, complete
           sequence.>gb:AY086902_1571942 Arabidopsis thaliana clone
           29241 mRNA, complete sequence.>gb:AF370576_1792359
           Arabidopsis thaliana 40S ribosomal protein S16
           (At2g09990; F7B19.13) mRNA, complete cds.
          Length = 146

 Score =  261 bits (668), Expect = 7e-69
 Identities = 129/146 (88%), Positives = 137/146 (93%), Gaps = 1/146 (0%)
 Frame = +2

Query: 92  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR 268
           MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEPILLLG+
Sbjct: 1   MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPILLLGK 60

Query: 269 HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL 448
           HRFAGV+MRIRV GGGHTSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct: 61  HRFAGVNMRIRVNGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL 120

Query: 449 VADPRRCEPKKFGGRGARARFQKSYR 526
           VADPRRCEPKKFGGRGAR+R+QKSYR
Sbjct: 121 VADPRRCEPKKFGGRGARSRYQKSYR 146



>sp|Q42340|RS16_ARATH 40S ribosomal protein S16.>gb:AY059138_1564501
           Arabidopsis thaliana putative 40S ribosomal protein S16
           (At5g18380) mRNA, complete cds.>gb:AF370178_1792066
           Arabidopsis thaliana putative 40S ribosomal protein S16
           (At5g18380) mRNA, complete cds.
          Length = 146

 Score =  261 bits (667), Expect = 9e-69
 Identities = 128/146 (87%), Positives = 137/146 (93%), Gaps = 1/146 (0%)
 Frame = +2

Query: 92  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR 268
           MA  P  ESVQCFGRKKTAVAVTHCKRG GLIK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct: 1   MATQPATESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPVLLLGK 60

Query: 269 HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL 448
           HRFAGV+MRIRV GGGHTSQ+YAIRQSIAKALVA+YQKYVDEQSKKEIKDILVRYDRTLL
Sbjct: 61  HRFAGVNMRIRVNGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLL 120

Query: 449 VADPRRCEPKKFGGRGARARFQKSYR 526
           VADPRRCEPKKFGGRGAR+R+QKSYR
Sbjct: 121 VADPRRCEPKKFGGRGARSRYQKSYR 146



>sp|Q9XEK7|RS16_TORRU 40S ribosomal protein S16.>gb:AF108725_1768637
           Tortula ruralis ribosomal protein S16 mRNA, complete
           cds.
          Length = 142

 Score =  253 bits (645), Expect = 3e-66
 Identities = 124/142 (87%), Positives = 138/142 (97%)
 Frame = +2

Query: 101 APVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFA 280
           A VESVQCFGRKKTAVAVT+C+RGRGLI++  VPIEL++PEILRYKAFEP+LLLGR +FA
Sbjct: 2   AAVESVQCFGRKKTAVAVTYCRRGRGLIRLT-VPIELVEPEILRYKAFEPVLLLGRSKFA 60

Query: 281 GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP 460
           GVDMRIRVKGGG+TSQIYAIRQSIAKALVA++QKYVDEQSKKEIKD+L+RYDRTLLVADP
Sbjct: 61  GVDMRIRVKGGGNTSQIYAIRQSIAKALVAYFQKYVDEQSKKEIKDVLLRYDRTLLVADP 120

Query: 461 RRCEPKKFGGRGARARFQKSYR 526
           RRCEPKKFGGRGAR+RFQKSYR
Sbjct: 121 RRCEPKKFGGRGARSRFQKSYR 142



>gb:ATAC016829_1543646 Arabidopsis thaliana chromosome III BAC T6K12
           genomic sequence, complete sequence.>gb:BT004760_1637794
           Arabidopsis thaliana At3g04230 gene, complete cds.
          Length = 146

 Score =  247 bits (630), Expect = 2e-64
 Identities = 122/146 (83%), Positives = 133/146 (91%), Gaps = 1/146 (0%)
 Frame = +2

Query: 92  MAAAPV-ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGR 268
           MA  P  ESVQCFGRKKTA AVT+CKRG G+IK+NG PIEL QPEILR+K FEP+LLLG+
Sbjct: 1   MATQPAKESVQCFGRKKTATAVTYCKRGSGMIKLNGSPIELYQPEILRFKIFEPVLLLGK 60

Query: 269 HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL 448
           HRFAGVDMRIR  GGG+TS++YAIRQSIAKALVA+YQKYVDEQSKKEIKDIL+RYDRTLL
Sbjct: 61  HRFAGVDMRIRATGGGNTSRVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILMRYDRTLL 120

Query: 449 VADPRRCEPKKFGGRGARARFQKSYR 526
           VADPRRCE KKFGG GARARFQKSYR
Sbjct: 121 VADPRRCESKKFGGPGARARFQKSYR 146



>gb:AY495970_1609064 Capsicum annuum small subunit ribosomal protein
           S16 (SRP2) mRNA, partial cds.
          Length = 123

 Score =  240 bits (613), Expect = 2e-62
 Identities = 117/122 (95%), Positives = 121/122 (99%)
 Frame = +2

Query: 161 CKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAI 340
           CKRGRGLIKINGVPIEL+QPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAI
Sbjct: 2   CKRGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAI 61

Query: 341 RQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKS 520
           RQSIAKALVAFYQK+VDEQ KKEIKDIL+RYDRTLLVADPRRCEPKKFGGRGAR+RFQKS
Sbjct: 62  RQSIAKALVAFYQKFVDEQQKKEIKDILIRYDRTLLVADPRRCEPKKFGGRGARSRFQKS 121

Query: 521 YR 526
           YR
Sbjct: 122 YR 123



>sp|P46294|RS16_ORYSA 40S ribosomal protein S16.>pir|T04083|T04083
           probable ribosomal protein S16 -
           rice>gb:RICRPSAAA_1703767 Oryza sativa ribosomal protein
           S16 mRNA, complete cds.
          Length = 149

 Score =  237 bits (605), Expect = 1e-61
 Identities = 120/149 (80%), Positives = 131/149 (87%), Gaps = 4/149 (2%)
 Frame = +2

Query: 92  MAAA----PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILL 259
           MAAA    P  +VQCFGRKK AVAV++CK GRGLIK+NGVPIELI+PE+LR KAFEPILL
Sbjct: 1   MAAALTRPPPGTVQCFGRKKAAVAVSYCKPGRGLIKVNGVPIELIRPEMLRLKAFEPILL 60

Query: 260 LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR 439
            GR RF  +DMRIRV+GGG TSQIYAIRQ+IAKALVA+YQKYVDE SKKE+KDI  RYDR
Sbjct: 61  AGRSRFKDIDMRIRVRGGGKTSQIYAIRQAIAKALVAYYQKYVDEASKKEVKDIFARYDR 120

Query: 440 TLLVADPRRCEPKKFGGRGARARFQKSYR 526
           TLLVADPRRCEPKKFGGR ARARFQKSYR
Sbjct: 121 TLLVADPRRCEPKKFGGRRARARFQKSYR 149



>gb:BC084715_2109024 Rattus norvegicus cDNA clone IMAGE:7311638,
           partial cds.
          Length = 159

 Score =  233 bits (595), Expect = 2e-60
 Identities = 110/141 (78%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 19  PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 78

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 79  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 138

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCE KKFGG GARAR+QKSYR
Sbjct: 139 RCESKKFGGPGARARYQKSYR 159



>gb:BC082286_2108353 Mus musculus ribosomal protein S16, mRNA (cDNA
           clone IMAGE:6438016), partial cds.
          Length = 157

 Score =  233 bits (595), Expect = 2e-60
 Identities = 110/141 (78%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 17  PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 76

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 77  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 136

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCE KKFGG GARAR+QKSYR
Sbjct: 137 RCESKKFGGPGARARYQKSYR 157



>gb:BC064030_2105287 Rattus norvegicus cDNA clone IMAGE:6887619,
           partial cds.
          Length = 161

 Score =  233 bits (595), Expect = 2e-60
 Identities = 110/141 (78%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 21  PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 80

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 81  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 140

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCE KKFGG GARAR+QKSYR
Sbjct: 141 RCESKKFGGPGARARYQKSYR 161



>pir|A39760|R3HU16 ribosomal protein S16, cytosolic [validated] -
           human>pir|S09041|R3RT16 ribosomal protein S16, cytosolic
           [validated] - rat>gb:AK010613_1155882 Mus musculus ES
           cells cDNA, RIKEN full-length enriched library,
           clone:2410030D18 product:ribosomal protein S16, full
           insert sequence.>gb:AK010641_1155906 Mus musculus ES
           cells cDNA, RIKEN full-length enriched library,
           clone:2410039G10 product:ribosomal protein S16, full
           insert sequence.>gb:AK011060_1156168 Mus musculus 13
           days embryo liver cDNA, RIKEN full-length enriched
           library, clone:2510039P04 product:ribosomal protein S16,
           full insert sequence.>gb:AK019400_1160047 Mus musculus
           12 days embryo head cDNA, RIKEN full-length enriched
           library, clone:3010027N19 product:ribosomal protein S16,
           full insert sequence.>gb:AK083946_1174128 Mus musculus
           12 days embryo spinal ganglion cDNA, RIKEN full-length
           enriched library, clone:D130068B06 product:ribosomal
           protein S16, full insert sequence.>gb:AK088413_1175392
           Mus musculus 2 days neonate thymus thymic cells cDNA,
           RIKEN full-length enriched library, clone:E430016B11
           product:ribosomal protein S16, full insert
           sequence.>gb:AK088716_1175575 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430024E18 product:ribosomal
           protein S16, full insert sequence.>gb:AB061841_1868817
           Homo sapiens RPS16 gene for ribosomal protein S16,
           complete cds and sequence.>gb:BC004324_1969176 Homo
           sapiens ribosomal protein S16, mRNA (cDNA clone
           MGC:10931 IMAGE:3628799), complete
           cds.>gb:BC007977_1971129 Homo sapiens ribosomal protein
           S16, mRNA (cDNA clone MGC:15283 IMAGE:4310307), complete
           cds.>gb:HUMSRAA_2036718 Human ribosomal protein S16
           mRNA, complete cds.>gb:RRRPS16_2138213 Rat mRNA for
           ribosomal protein S16.
          Length = 146

 Score =  233 bits (595), Expect = 2e-60
 Identities = 110/141 (78%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 6   PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 65

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 66  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 125

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCE KKFGG GARAR+QKSYR
Sbjct: 126 RCESKKFGGPGARARYQKSYR 146



>sp|P62249|RS16_HUMAN 40S ribosomal protein
           S16.>sp|P14131|RS16_MOUSE 40S ribosomal protein
           S16.>sp|P62250|RS16_RAT 40S ribosomal protein
           S16.>gb:BC086066_2564657 Xenopus laevis hypothetical
           LOC495727, mRNA (cDNA clone IMAGE:7197762), partial cds.
          Length = 145

 Score =  233 bits (595), Expect = 2e-60
 Identities = 110/141 (78%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 5   PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 64

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 65  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 124

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCE KKFGG GARAR+QKSYR
Sbjct: 125 RCESKKFGGPGARARYQKSYR 145



>sp|Q90YQ7|RS16_ICTPU 40S ribosomal protein S16.>gb:AF402825_2492071
           Ictalurus punctatus 40S ribosomal protein S16 mRNA,
           complete cds.
          Length = 146

 Score =  233 bits (593), Expect = 3e-60
 Identities = 110/144 (76%), Positives = 127/144 (88%)
 Frame = +2

Query: 95  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR 274
           A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E I+P  L+YK  EP+LLLG+ R
Sbjct: 3   AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLETIEPATLQYKLLEPVLLLGKER 62

Query: 275 FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA 454
           FAGVD+R+RVKGGGH +Q+YAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct: 63  FAGVDIRVRVKGGGHVAQVYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA 122

Query: 455 DPRRCEPKKFGGRGARARFQKSYR 526
           DPRRCE KKFGG GARAR+QKSYR
Sbjct: 123 DPRRCESKKFGGPGARARYQKSYR 146



>gb:BC084534_2563905 Xenopus tropicalis hypothetical LOC496563, mRNA
           (cDNA clone MGC:89983 IMAGE:7026066), complete cds.
          Length = 146

 Score =  231 bits (590), Expect = 8e-60
 Identities = 108/144 (75%), Positives = 128/144 (88%)
 Frame = +2

Query: 95  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR 274
           A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ R
Sbjct: 3   AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKER 62

Query: 275 FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA 454
           FAGVD+R+RVKGGGH +Q+YAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct: 63  FAGVDIRVRVKGGGHVAQVYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVA 122

Query: 455 DPRRCEPKKFGGRGARARFQKSYR 526
           DPRRCE KKFGG GARAR+QKSYR
Sbjct: 123 DPRRCESKKFGGPGARARYQKSYR 146



>sp|Q98TR7|RS16_HETFO 40S ribosomal protein S16.>gb:AY027434_2508528
           Heteropneustes fossilis ribosomal protein S16 mRNA,
           complete cds.
          Length = 146

 Score =  231 bits (590), Expect = 8e-60
 Identities = 109/144 (75%), Positives = 127/144 (88%)
 Frame = +2

Query: 95  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR 274
           A  P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E I+P  L+YK  EP+LLLG+ R
Sbjct: 3   AKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLETIEPATLQYKLLEPVLLLGKER 62

Query: 275 FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA 454
           FAGVD+R+RVKGGGH +Q+YAIRQ+I+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVA
Sbjct: 63  FAGVDIRVRVKGGGHVAQVYAIRQAISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVA 122

Query: 455 DPRRCEPKKFGGRGARARFQKSYR 526
           DPRRCE KKFGG GARAR+QKSYR
Sbjct: 123 DPRRCESKKFGGPGARARYQKSYR 146



>sp|Q9W237|RS16_DROME 40S ribosomal protein S16.>gb:AE013599_1133324
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AY231801_1177094 Drosophila yakuba clone
           yak-em_CG4046 mRNA sequence.>gb:AY232065_1177358
           Drosophila yakuba clone yak-ad_CG4046 mRNA
           sequence.>gb:AE003458_1210623 Drosophila melanogaster
           chromosome 2R, section 66 of 74 of the complete
           sequence.>gb:AY070671_1294816 Drosophila melanogaster
           RH07540 full length cDNA.
          Length = 148

 Score =  228 bits (581), Expect = 9e-59
 Identities = 107/141 (75%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           PV++VQ FGRKKTA AV +CKRG GL+K+NG P+E I+P++L+YK  EP+LLLG+ +FAG
Sbjct: 8   PVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAG 67

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RV GGGH +QIYAIRQ+I+KALVAFYQKYVDE SKKEIKDILV+YDRTLLV DPR
Sbjct: 68  VDIRVRVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPR 127

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCEPKKFGG GARAR+QKSYR
Sbjct: 128 RCEPKKFGGPGARARYQKSYR 148



>gb:MUSRPS16_2129908 Mouse S16 ribosomal protein gene, complete cds.
          Length = 145

 Score =  228 bits (580), Expect = 1e-58
 Identities = 109/141 (77%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKT +AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 6   PLQSVQVFGRKKT-LAVAHCKRGNGLIKVNGRPLEMIEPRALQYKLLEPVLLLGKERFAG 64

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 65  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 124

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCE KKFGG GARAR+QKSYR
Sbjct: 125 RCESKKFGGPGARARYQKSYR 145



>pir|S11623|R3MS16 ribosomal protein S16 - mouse
          Length = 145

 Score =  225 bits (573), Expect = 7e-58
 Identities = 107/141 (75%), Positives = 126/141 (89%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRK+T +AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 6   PLQSVQVFGRKET-LAVAHCKRGNGLIKVNGRPLEMIEPRALQYKVLEPVLLLGKERFAG 64

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIY IRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 65  VDIRVRVKGGGHVAQIYGIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 124

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCE KKFGG GARAR+QKSYR
Sbjct: 125 RCESKKFGGPGARARYQKSYR 145



>gb:AF548333_1281136 Branchiostoma belcheri ribosomal protein S16
           mRNA, complete cds.
          Length = 147

 Score =  224 bits (571), Expect = 1e-57
 Identities = 109/144 (75%), Positives = 125/144 (86%)
 Frame = +2

Query: 95  AAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHR 274
           A  P +SVQ FGRKKTA AV HCKRG GL+KING P++L +P +L+YK  EPI LLG+ R
Sbjct: 4   AKGPTQSVQVFGRKKTATAVAHCKRGNGLLKINGHPLQLWEPAMLKYKLEEPIRLLGKDR 63

Query: 275 FAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVA 454
           FAGVD+R+RVKGGGH +QIYAIRQSI+KALVA+YQK+VDE SKKEIKDIL+ YDRTLLVA
Sbjct: 64  FAGVDIRVRVKGGGHAAQIYAIRQSISKALVAYYQKFVDEASKKEIKDILISYDRTLLVA 123

Query: 455 DPRRCEPKKFGGRGARARFQKSYR 526
           DPRR EPKKFGG GARAR+QKSYR
Sbjct: 124 DPRRREPKKFGGPGARARYQKSYR 147



>sp|Q95V31|RS16_SPOFR 40S ribosomal protein S16.>gb:AF429981_1270210
           Spodoptera frugiperda ribosomal protein S16 mRNA,
           complete cds.
          Length = 151

 Score =  224 bits (570), Expect = 2e-57
 Identities = 101/141 (71%), Positives = 128/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P+++VQ FGRKKTA AV +CKRG G++++NG P++L++P +L+YK  EPILLLG+ +F+G
Sbjct: 11  PIQAVQVFGRKKTATAVAYCKRGHGVLRVNGRPLDLVEPRLLQYKLQEPILLLGKEKFSG 70

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+ VKGGGH +Q+YAIRQ+I+KAL+AFYQKYVDE SKKEIKDILV+YDR+LLVADPR
Sbjct: 71  VDIRVTVKGGGHVAQVYAIRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVADPR 130

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCEPKKFGG GARAR+QKSYR
Sbjct: 131 RCEPKKFGGPGARARYQKSYR 151



>sp|P16149|RS16_LUPPO 40S ribosomal protein S16.>pir|S15003|R3YL16
           ribosomal protein S16, cytosolic - large-leaved
           lupine>gb:LPRPS16_1685286 L.polyphyllus mRNA for
           ribosomal protein S16.
          Length = 145

 Score =  224 bits (570), Expect = 2e-57
 Identities = 111/117 (94%), Positives = 115/117 (98%)
 Frame = +2

Query: 176 GLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIA 355
           GLIKING PIEL++PEILR+KAFEPILLLG+ RFAGVDMRIRVKGGGHTSQIYAIRQSIA
Sbjct: 29  GLIKINGSPIELVEPEILRFKAFEPILLLGKSRFAGVDMRIRVKGGGHTSQIYAIRQSIA 88

Query: 356 KALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
           KALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR
Sbjct: 89  KALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 145



>gb:AY826142_1180102 Aedes albopictus clone AL_16240 ribosomal
           protein S16 mRNA, complete cds.
          Length = 172

 Score =  223 bits (568), Expect = 3e-57
 Identities = 103/141 (73%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           PV +VQ FGRKKTA AV +CKRG+GL+++NG P++ I+P++L+YK  EP+LLLG+ +FAG
Sbjct: 8   PVNAVQVFGRKKTATAVAYCKRGKGLLRVNGRPLDQIEPKVLQYKLQEPLLLLGKEKFAG 67

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+RIRV GGGH +QIYAIRQ+I+KALV+FYQKYVDE S+KE+KDIL +YDRTLLVADPR
Sbjct: 68  VDIRIRVSGGGHVAQIYAIRQAISKALVSFYQKYVDEASRKELKDILTQYDRTLLVADPR 127

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCEPKKFGG GARAR+QKSYR
Sbjct: 128 RCEPKKFGGPGARARYQKSYR 148



>sp|P62251|RS16_AEDAE 40S ribosomal protein S16.>gb:AY552053_1335061
           Aedes aegypti 40S ribosomal protein S16 mRNA, complete
           cds.
          Length = 148

 Score =  223 bits (568), Expect = 3e-57
 Identities = 103/141 (73%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           PV +VQ FGRKKTA AV +CKRG+GL+++NG P++ I+P++L+YK  EP+LLLG+ +FAG
Sbjct: 8   PVNAVQVFGRKKTATAVAYCKRGKGLLRVNGRPLDQIEPKVLQYKLQEPLLLLGKEKFAG 67

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+RIRV GGGH +QIYAIRQ+I+KALV+FYQKYVDE S+KE+KDIL +YDRTLLVADPR
Sbjct: 68  VDIRIRVSGGGHVAQIYAIRQAISKALVSFYQKYVDEASRKELKDILTQYDRTLLVADPR 127

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCEPKKFGG GARAR+QKSYR
Sbjct: 128 RCEPKKFGGPGARARYQKSYR 148



>gb:PDA488155_2577702 Pachymedusa dacnicolor partial mRNA for
           ribosomal protein S16 (rps16 gene).
          Length = 134

 Score =  222 bits (565), Expect = 6e-57
 Identities = 103/134 (76%), Positives = 121/134 (90%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAGVD+R+RV
Sbjct: 1   FGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKERFAGVDIRVRV 60

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGGH +Q+YAIRQ+I+K+LVA+YQKYVDE SKKEIKDIL++YDRTLLVADPRRCE KKF
Sbjct: 61  KGGGHVAQVYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKF 120

Query: 485 GGRGARARFQKSYR 526
           GG GARAR+QKSYR
Sbjct: 121 GGPGARARYQKSYR 134



>gb:AY769332_1350483 Bombyx mori ribosomal protein S16 (RpS16) mRNA,
           complete cds.
          Length = 151

 Score =  221 bits (562), Expect = 1e-56
 Identities = 100/141 (70%), Positives = 127/141 (90%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P+++VQ FGRKKTA AV +CKRG G++++NG P++L++P +L+YK  EPILLLG+ +F+ 
Sbjct: 11  PIQAVQVFGRKKTATAVAYCKRGHGMLRVNGRPLDLVEPRLLQYKLQEPILLLGKEKFSM 70

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+ VKGGGH +Q+YAIRQ+I+KAL+AFYQKYVDE SKKEIKDILV+YDR+LLVADPR
Sbjct: 71  VDIRVTVKGGGHVAQVYAIRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVADPR 130

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           RCEPKKFGG GARAR+QKSYR
Sbjct: 131 RCEPKKFGGPGARARYQKSYR 151



>gb:AX885241_1480694 Sequence 1104 from Patent EP1033401.
          Length = 147

 Score =  214 bits (544), Expect = 2e-54
 Identities = 100/129 (77%), Positives = 116/129 (89%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 6   PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 65

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPR
Sbjct: 66  VDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR 125

Query: 464 RCEPKKFGG 490
           RCE KKFGG
Sbjct: 126 RCESKKFGG 134



>sp|O60144|RS16_SCHPO 40S ribosomal protein S16.>pir|T39778|T39778
           40s ribosomal protein S16 [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC664_1718193 S.pombe
           chromosome I cosmid c664.>gb:SPBC18H10_1719385 S.pombe
           chromosome II cosmid c18H10.
          Length = 140

 Score =  211 bits (537), Expect = 1e-53
 Identities = 99/140 (70%), Positives = 118/140 (84%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           ++SVQCFG+K  A AV HCK G+GLIK+NG P+ L+QPEILR K +EPIL+ G  +FAGV
Sbjct: 1   MQSVQCFGKKGNATAVAHCKVGKGLIKVNGAPLSLVQPEILRMKVYEPILVAGADKFAGV 60

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+R+RV GGGH SQIYAIRQ+I+KA+VA+YQK+VDE SK E+K  L+ YDRTLLVADPRR
Sbjct: 61  DIRVRVSGGGHVSQIYAIRQAISKAIVAYYQKFVDEHSKAELKKALITYDRTLLVADPRR 120

Query: 467 CEPKKFGGRGARARFQKSYR 526
            EPKKFGG GARAR QKSYR
Sbjct: 121 MEPKKFGGHGARARQQKSYR 140



>sp|Q29201|RS16_PIG 40S ribosomal protein S16 (Fragment).
          Length = 135

 Score =  210 bits (535), Expect = 2e-53
 Identities = 99/131 (75%), Positives = 114/131 (87%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 5   PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 64

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           VD+R+RVKGGGH +QIYAIRQSI KALVA+YQKYVDE SKK IKDIL++YDRTLLVADP 
Sbjct: 65  VDIRVRVKGGGHVAQIYAIRQSIXKALVAYYQKYVDEASKKXIKDILIQYDRTLLVADPX 124

Query: 464 RCEPKKFGGRG 496
           RCE KKFGG G
Sbjct: 125 RCESKKFGGPG 135



>gb:AB017604_1513659 Schizosaccharomyces pombe mRNA for ribosomal
           protein S16 homolog, partial cds.
          Length = 138

 Score =  210 bits (534), Expect = 2e-53
 Identities = 99/138 (71%), Positives = 116/138 (84%)
 Frame = +2

Query: 113 SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM 292
           SVQCFG+K  A AV HCK G+GLIK+NG P+ L+QPEILR K +EPIL+ G  +FAGVD+
Sbjct: 1   SVQCFGKKGNATAVAHCKVGKGLIKVNGAPLSLVQPEILRMKVYEPILVAGADKFAGVDI 60

Query: 293 RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE 472
           R+RV GGGH SQIYAIRQ+I+KA+VA+YQK+VDE SK E+K  L+ YDRTLLVADPRR E
Sbjct: 61  RVRVSGGGHVSQIYAIRQAISKAIVAYYQKFVDEHSKAELKKALITYDRTLLVADPRRME 120

Query: 473 PKKFGGRGARARFQKSYR 526
           PKKFGG GARAR QKSYR
Sbjct: 121 PKKFGGHGARARQQKSYR 138



>pir|T43419|T43419 ribosomal protein S16 - fission yeast
           (Schizosaccharomyces pombe) (fragment)
          Length = 138

 Score =  210 bits (534), Expect = 2e-53
 Identities = 99/138 (71%), Positives = 116/138 (84%)
 Frame = +2

Query: 113 SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM 292
           SVQCFG+K  A AV HCK G+GLIK+NG P+ L+QPEILR K +EPIL+ G  +FAGVD+
Sbjct: 1   SVQCFGKKGNATAVAHCKVGKGLIKVNGAPLSLVQPEILRMKVYEPILVAGADKFAGVDI 60

Query: 293 RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE 472
           R+RV GGGH SQIYAIRQ+I+KA+VA+YQK+VDE SK E+K  L+ YDRTLLVADPRR E
Sbjct: 61  RVRVSGGGHVSQIYAIRQAISKAIVAYYQKFVDEHSKAELKKALITYDRTLLVADPRRME 120

Query: 473 PKKFGGRGARARFQKSYR 526
           PKKFGG GARAR QKSYR
Sbjct: 121 PKKFGGHGARARQQKSYR 138



>sp|Q22054|RS16_CAEEL 40S ribosomal protein S16.>pir|T24280|T24280
           hypothetical protein T01C3.6 - Caenorhabditis
           elegans>gb:CET01C3_1366961 Caenorhabditis elegans cosmid
           T01C3, complete sequence.
          Length = 144

 Score =  206 bits (525), Expect = 3e-52
 Identities = 97/140 (69%), Positives = 120/140 (85%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V+SVQ FGRKKTA AV HCK+G+GLIK+NG P+E ++P+ILR K  EP+LL+G+ RF  V
Sbjct: 5   VQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKERFQDV 64

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+RIRV GGGH +QIYA+RQ++AKALVA+Y KYVDEQSK+E+K+I   YD++LLVADPRR
Sbjct: 65  DIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVADPRR 124

Query: 467 CEPKKFGGRGARARFQKSYR 526
            E KKFGG GARAR+QKSYR
Sbjct: 125 RESKKFGGPGARARYQKSYR 144



>gb:AE016817_1747642 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 143

 Score =  205 bits (522), Expect = 6e-52
 Identities = 99/145 (68%), Positives = 120/145 (82%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH 271
           M+A P  SVQ FG+KK+A AV H K G+GLIK+NG PI L+QPEILR+K +EP+LL+G  
Sbjct: 1   MSAVP--SVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLD 58

Query: 272 RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV 451
           +FA +D+R+RV GGGH SQ+YAIRQ+IAK LVA++QK+VDEQSK E+K     YDRTLL+
Sbjct: 59  KFANIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLI 118

Query: 452 ADPRRCEPKKFGGRGARARFQKSYR 526
           AD RR EPKKFGGRGARARFQKSYR
Sbjct: 119 ADSRRPEPKKFGGRGARARFQKSYR 143



>sp|O94017|RS16_CANAL 40S ribosomal protein S16.>pir|T52145|T52145
           ribosomal protein rps16 [imported] - yeast (Candida
           albicans)>gb:CAC49C10_1644808 C.albicans cosmid Ca49C10.
          Length = 142

 Score =  205 bits (521), Expect = 8e-52
 Identities = 97/139 (69%), Positives = 116/139 (83%)
 Frame = +2

Query: 110 ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVD 289
           +SVQ FG+KKTA AV H K G+GLIKING PI L+QPEILR+K +EP+ L+G  +F G+D
Sbjct: 4   QSVQTFGKKKTATAVAHVKAGKGLIKINGSPITLVQPEILRFKVYEPLTLVGLDKFQGID 63

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +R++V GGGH SQ+YAIRQ+IAK LVA++QKYVDE SK E+K I   YD+TLLVAD RR 
Sbjct: 64  IRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEASKNELKKIFASYDKTLLVADSRRM 123

Query: 470 EPKKFGGRGARARFQKSYR 526
           EPKKFGGRGARARFQKSYR
Sbjct: 124 EPKKFGGRGARARFQKSYR 142



>gb:CR382128_1660865 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 173

 Score =  203 bits (517), Expect = 2e-51
 Identities = 100/151 (66%), Positives = 121/151 (80%)
 Frame = +2

Query: 74  QRRTTRMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPI 253
           Q  TT M+A    SVQ FG+KKTA AV H K G+GLIK+NG PI LI+P +LR K +EP+
Sbjct: 27  QTHTTTMSA----SVQTFGKKKTATAVAHVKAGKGLIKLNGTPITLIEPAVLRMKVYEPL 82

Query: 254 LLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRY 433
           L++G  +FA VD+RI+V GGGH SQIYAIRQ+IAK LVAF+QK+VDEQSK E+K    ++
Sbjct: 83  LVVGLDKFANVDIRIKVNGGGHVSQIYAIRQAIAKGLVAFHQKFVDEQSKNELKKAFTQF 142

Query: 434 DRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
           DRTLL+ADPRR EPKKFGG GARAR+QKSYR
Sbjct: 143 DRTLLIADPRRMEPKKFGGPGARARYQKSYR 173



>gb:AY159357_1305247 Hydra vulgaris ribosomal protein S16 mRNA,
           partial cds.
          Length = 144

 Score =  203 bits (516), Expect = 3e-51
 Identities = 93/138 (67%), Positives = 120/138 (86%)
 Frame = +2

Query: 113 SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM 292
           SVQ +GRKKTA AV  CK G G+IK+NG P++L++P  LR K  EP+LLLG+ +FAGV++
Sbjct: 7   SVQVYGRKKTATAVAFCKAGHGMIKVNGRPLDLVEPVSLRMKVQEPVLLLGKDKFAGVNI 66

Query: 293 RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE 472
           ++RVKGGG  +Q+YA+RQ+I+KA+VA+YQK+VDE SKKEIKD+L++YDR+LLVADPRRCE
Sbjct: 67  QVRVKGGGQVAQLYAVRQAISKAIVAYYQKFVDEASKKEIKDVLIQYDRSLLVADPRRCE 126

Query: 473 PKKFGGRGARARFQKSYR 526
            KKFGG GARAR+QKSYR
Sbjct: 127 AKKFGGPGARARYQKSYR 144



>gb:CR380955_1651551 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 143

 Score =  202 bits (515), Expect = 4e-51
 Identities = 95/140 (67%), Positives = 117/140 (83%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V SVQ FG+KK+A AV H K G+GLIK+NG PI L++PEILR+K +EP+LL+G  +FA +
Sbjct: 4   VPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFANI 63

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+R+RV GGGH SQ+YAIRQ+IAK LVA++QK+VDEQSK E+K     YDRTLL+AD RR
Sbjct: 64  DIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADARR 123

Query: 467 CEPKKFGGRGARARFQKSYR 526
            EPKKFGG+GARARFQKSYR
Sbjct: 124 PEPKKFGGKGARARFQKSYR 143



>gb:AY145037_1583828 Kluyveromyces lactis clone P2225 RPS16 gene,
           complete cds.>gb:CR382125_1658209 Kluyveromyces lactis
           strain NRRL Y-1140 chromosome E of strain NRRL Y-1140 of
           Kluyveromyces lactis.
          Length = 143

 Score =  202 bits (515), Expect = 4e-51
 Identities = 95/140 (67%), Positives = 117/140 (83%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V SVQ FG+KK+A AV H K G+GLIK+NG PI L+QPEILR+K +EP+LL+G  +FA +
Sbjct: 4   VPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANI 63

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+R++V GGGH SQ+YAIRQ+IAK LVA++QK+VDEQSK E+K     YDRTLL+AD RR
Sbjct: 64  DIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRR 123

Query: 467 CEPKKFGGRGARARFQKSYR 526
            EPKKFGGRGAR+RFQKSYR
Sbjct: 124 PEPKKFGGRGARSRFQKSYR 143



>gb:AY145016_1583807 Saccharomyces kluyveri clone P2220 RPS16 gene,
           complete cds.
          Length = 143

 Score =  202 bits (515), Expect = 4e-51
 Identities = 95/140 (67%), Positives = 117/140 (83%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V SVQ FG+KK+A AV H K G+GLIK+NG PI L+QPEILR+K +EP+LL+G  +FA +
Sbjct: 4   VPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKFANI 63

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+R+RV GGGH SQ+YAIRQ+IAK LVA++QK+VDEQSK E+K     YDRTLL+AD RR
Sbjct: 64  DIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRR 123

Query: 467 CEPKKFGGRGARARFQKSYR 526
            EPKKFGG+GAR+RFQKSYR
Sbjct: 124 PEPKKFGGKGARSRFQKSYR 143



>pir|S67619|S67619 ribosomal protein S16.e, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SC9375_1705879
           S.cerevisiae chromosome XIII cosmid
           9375.>gb:SCYDL083C_1711649 S.cerevisiae chromosome IV
           reading frame ORF YDL083c.
          Length = 143

 Score =  202 bits (514), Expect = 5e-51
 Identities = 96/145 (66%), Positives = 120/145 (82%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH 271
           M+A P  SVQ FG+KK+A AV H K G+GLIK+NG PI L++PEILR+K +EP+LL+G  
Sbjct: 1   MSAVP--SVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLD 58

Query: 272 RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV 451
           +F+ +D+R+RV GGGH SQ+YAIRQ+IAK LVA++QKYVDEQSK E+K     YDRTLL+
Sbjct: 59  KFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLI 118

Query: 452 ADPRRCEPKKFGGRGARARFQKSYR 526
           AD RR EPKKFGG+GAR+RFQKSYR
Sbjct: 119 ADSRRPEPKKFGGKGARSRFQKSYR 143



>sp|P40213|RS16_YEAST 40S ribosomal protein S16 (RP61R).
          Length = 142

 Score =  202 bits (513), Expect = 7e-51
 Identities = 94/140 (67%), Positives = 117/140 (83%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V SVQ FG+KK+A AV H K G+GLIK+NG PI L++PEILR+K +EP+LL+G  +F+ +
Sbjct: 3   VPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNI 62

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+R+RV GGGH SQ+YAIRQ+IAK LVA++QKYVDEQSK E+K     YDRTLL+AD RR
Sbjct: 63  DIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRR 122

Query: 467 CEPKKFGGRGARARFQKSYR 526
            EPKKFGG+GAR+RFQKSYR
Sbjct: 123 PEPKKFGGKGARSRFQKSYR 142



>gb:CR382136_1668969 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 142

 Score =  201 bits (510), Expect = 1e-50
 Identities = 93/138 (67%), Positives = 114/138 (82%)
 Frame = +2

Query: 113 SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM 292
           SVQ FG+KKTA AV H K G+GLIK+NG PI L+QPEILR+K +EP+ L+G  +F  +D+
Sbjct: 5   SVQTFGKKKTATAVAHVKAGKGLIKVNGAPITLVQPEILRFKVYEPLTLVGLDKFQNIDI 64

Query: 293 RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE 472
           R++V GGGH SQ+YAIRQ+IAK LVA++QK+VDE SK E+K +   YD+TLLVAD RR E
Sbjct: 65  RVKVSGGGHVSQVYAIRQAIAKGLVAYHQKFVDEASKNELKKVFASYDKTLLVADSRRME 124

Query: 473 PKKFGGRGARARFQKSYR 526
           PKKFGGRGARARFQKSYR
Sbjct: 125 PKKFGGRGARARFQKSYR 142



>gb:AY144901_1583692 Saccharomyces exiguus clone P2020 RPS16 gene,
           complete cds.
          Length = 143

 Score =  197 bits (502), Expect = 1e-49
 Identities = 93/145 (64%), Positives = 118/145 (81%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRH 271
           M+A P  SVQ FG+KK+A AV H K G+GLIK+NG PI L+QPEILR+K +EP+LL+G  
Sbjct: 1   MSAVP--SVQTFGKKKSATAVAHVKAGKGLIKVNGAPITLVQPEILRFKVYEPLLLVGLD 58

Query: 272 RFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLV 451
           +F  +D+R+RV GGGH SQ+YAIRQ+IAK L+A++QK+VDEQSK E+K     YDRTLL+
Sbjct: 59  KFTNIDIRVRVTGGGHVSQVYAIRQAIAKGLIAYHQKFVDEQSKNELKRAFTLYDRTLLI 118

Query: 452 ADPRRCEPKKFGGRGARARFQKSYR 526
           AD R  EPKKFGG+GAR+R+QKSYR
Sbjct: 119 ADSRMPEPKKFGGKGARSRYQKSYR 143



>sp|Q876B4|RS16_SACEX 40S ribosomal protein S16.
          Length = 142

 Score =  197 bits (501), Expect = 2e-49
 Identities = 91/140 (65%), Positives = 115/140 (82%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V SVQ FG+KK+A AV H K G+GLIK+NG PI L+QPEILR+K +EP+LL+G  +F  +
Sbjct: 3   VPSVQTFGKKKSATAVAHVKAGKGLIKVNGAPITLVQPEILRFKVYEPLLLVGLDKFTNI 62

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+R+RV GGGH SQ+YAIRQ+IAK L+A++QK+VDEQSK E+K     YDRTLL+AD R 
Sbjct: 63  DIRVRVTGGGHVSQVYAIRQAIAKGLIAYHQKFVDEQSKNELKRAFTLYDRTLLIADSRM 122

Query: 467 CEPKKFGGRGARARFQKSYR 526
            EPKKFGG+GAR+R+QKSYR
Sbjct: 123 PEPKKFGGKGARSRYQKSYR 142



>gb:AY144855_1583646 Saccharomyces bayanus RPS16 gene, partial cds.
          Length = 135

 Score =  196 bits (498), Expect = 4e-49
 Identities = 90/134 (67%), Positives = 113/134 (84%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           FG+KK+A AV H K G+GLIK+NG PI L++PEILR+K +EP+LL+G  +F+ +D+R+RV
Sbjct: 2   FGKKKSATAVAHVKSGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRV 61

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGGH SQ+YAIRQ+IAK LVA++QKYVDEQSK E+K     YDRTLL+AD RR EPKKF
Sbjct: 62  TGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKF 121

Query: 485 GGRGARARFQKSYR 526
           GG+GAR+RFQKSYR
Sbjct: 122 GGKGARSRFQKSYR 135



>gb:AY144854_1583645 Saccharomyces bayanus RPS16 gene, partial cds.
          Length = 135

 Score =  196 bits (498), Expect = 4e-49
 Identities = 90/134 (67%), Positives = 113/134 (84%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           FG+KK+A AV H K G+GLIK+NG PI L++PEILR+K +EP+LL+G  +F+ +D+R+RV
Sbjct: 2   FGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRV 61

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGGH SQ+YAIRQ+IAK LVA++QKYVDEQSK E+K     YDRTLL+AD RR EPKKF
Sbjct: 62  TGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKF 121

Query: 485 GGRGARARFQKSYR 526
           GG+GAR+RFQKSYR
Sbjct: 122 GGKGARSRFQKSYR 135



>gb:AY144955_1583746 Saccharomyces castellii clone Contig1629 RPS16
           gene, partial cds.
          Length = 135

 Score =  196 bits (497), Expect = 5e-49
 Identities = 90/134 (67%), Positives = 113/134 (84%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           FG+KK+A AV H K G+GLIK+NG PI L++PEILR+K +EP+LL+G  +FA +D+R+RV
Sbjct: 2   FGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFANIDIRVRV 61

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGGH SQ+YAIRQ+IAK LVA++QK+VDEQSK E+K     YDRTLL+AD RR EPKKF
Sbjct: 62  TGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKF 121

Query: 485 GGRGARARFQKSYR 526
           GG+GAR+RFQKSYR
Sbjct: 122 GGKGARSRFQKSYR 135



>gb:AY144956_1583747 Saccharomyces castellii clone Contig2037 RPS16
           gene, partial cds.
          Length = 135

 Score =  194 bits (494), Expect = 1e-48
 Identities = 89/134 (66%), Positives = 113/134 (84%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           FG+KK+A AV H K G+GLIK+NG PI L++PEILR+K +EP+LL+G  +FA +D+R+RV
Sbjct: 2   FGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFANIDIRVRV 61

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGGH SQ+YAIRQ+IAK LVA++QK+VDEQSK E+K     YDRTLL+AD RR EPKKF
Sbjct: 62  TGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKF 121

Query: 485 GGRGARARFQKSYR 526
           GG+GAR++FQKSYR
Sbjct: 122 GGKGARSKFQKSYR 135



>gb:AE017342_1754935 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 140

 Score =  192 bits (488), Expect = 5e-48
 Identities = 93/140 (66%), Positives = 112/140 (80%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           + SVQ FG+KKTA AV H   GRGLI++NG PI L++P +LRYK +EP+L++G  RFA +
Sbjct: 1   MSSVQTFGKKKTATAVAHVTPGRGLIRLNGSPISLVEPVVLRYKVYEPVLVVGPERFANM 60

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+R+RVKGGGH SQ+YA+RQ+IAK +VAFY K  D  S  E+K  LV YDRTLLVADPRR
Sbjct: 61  DIRLRVKGGGHVSQLYALRQAIAKGVVAFYAKNEDAASAIELKKALVAYDRTLLVADPRR 120

Query: 467 CEPKKFGGRGARARFQKSYR 526
            EPKKFGGRGARAR QKSYR
Sbjct: 121 MEPKKFGGRGARARRQKSYR 140



>gb:PFMAL8P1_1192200 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 144

 Score =  192 bits (488), Expect = 5e-48
 Identities = 89/140 (63%), Positives = 116/140 (82%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V+ VQ FG+KKTAVAV     G+GLIK+NG  ++L++P IL+ K +EP+ L+G  +   +
Sbjct: 5   VKRVQTFGKKKTAVAVATVTNGKGLIKLNGKNLDLVEPYILKTKVYEPLWLIGSGKLKNL 64

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+RIRVKGGG TSQIYAIRQ+I K ++++YQKYVDE +KKE+KD+L+RYDR+LLV D RR
Sbjct: 65  DIRIRVKGGGQTSQIYAIRQAIGKGIISYYQKYVDESTKKELKDVLLRYDRSLLVGDTRR 124

Query: 467 CEPKKFGGRGARARFQKSYR 526
           CEPKKFGG+GARAR+QKSYR
Sbjct: 125 CEPKKFGGKGARARYQKSYR 144



>gb:AY144900_1583691 Saccharomyces exiguus clone P2009 RPS16 gene,
           partial cds.
          Length = 135

 Score =  191 bits (486), Expect = 9e-48
 Identities = 87/134 (64%), Positives = 111/134 (82%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           FG+KK+A AV H K G+GLIK+NG PI L+QPEILR+K +EP+LL+G  +F  +D+R+RV
Sbjct: 2   FGKKKSATAVAHVKAGKGLIKVNGAPITLVQPEILRFKVYEPLLLVGLDKFTNIDIRVRV 61

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGGH SQ+YAIRQ+IAK L+A++QK+VDEQSK E+K     YDRTLL+AD R  EPKKF
Sbjct: 62  TGGGHVSQVYAIRQAIAKGLIAYHQKFVDEQSKNELKRAFTLYDRTLLIADSRMPEPKKF 121

Query: 485 GGRGARARFQKSYR 526
           GG+GAR+R+QKSYR
Sbjct: 122 GGKGARSRYQKSYR 135



>gb:A63925_1450143 Sequence 50 from Patent WO9723633.
          Length = 141

 Score =  184 bits (467), Expect = 1e-45
 Identities = 88/138 (63%), Positives = 108/138 (78%)
 Frame = +2

Query: 113 SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM 292
           +VQ FG+KKTA AV H   GRGLI++NG PI L +P +LRYK +EPIL++G  +   +D+
Sbjct: 4   AVQTFGKKKTATAVAHATPGRGLIRLNGQPISLAEPALLRYKYYEPILVIGAEKINQIDI 63

Query: 293 RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE 472
           R++VKGGGH SQ+YA+RQ+I KA+VA+Y K VD  S  EIK  LV YDRTLL+ADPRR E
Sbjct: 64  RLKVKGGGHVSQVYAVRQAIGKAIVAYYAKNVDAASALEIKKALVAYDRTLLIADPRRME 123

Query: 473 PKKFGGRGARARFQKSYR 526
           PKKFGG GARAR QKSYR
Sbjct: 124 PKKFGGPGARARVQKSYR 141



>gb:BC072146_2556406 Xenopus laevis hypothetical protein MGC80065,
           mRNA (cDNA clone MGC:80065 IMAGE:4406134), complete cds.
          Length = 106

 Score =  175 bits (443), Expect = 9e-43
 Identities = 81/106 (76%), Positives = 97/106 (91%)
 Frame = +2

Query: 209 LIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYV 388
           +I+P  L+YK  EP+LLLG+ RFAGVD+R+RVKGGGH +Q+YAIRQ+I+K+LVA+YQKYV
Sbjct: 1   MIEPATLQYKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQVYAIRQAISKSLVAYYQKYV 60

Query: 389 DEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
           DE SKKEIKDIL++YDRTLLVADPRRCE KKFGG GARAR+QKSYR
Sbjct: 61  DEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARARYQKSYR 106



>pir|B90134|B90134 40S ribosomal protein S16 [imported] - Guillardia
           theta nucleomorph>gb:AF083031_1766835 Guillardia theta
           nucleomorph chromosome 3, complete sequence.
          Length = 142

 Score =  164 bits (416), Expect = 1e-39
 Identities = 74/139 (53%), Positives = 108/139 (77%), Gaps = 1/139 (0%)
 Frame = +2

Query: 113 SVQCFGRKKTAVAVTHCKR-GRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVD 289
           ++Q +G+KK + A+   K  G+G+IK+NG+PI+L+QPE L+ K FEP  +L    F  +D
Sbjct: 4   TIQVYGKKKNSTAIALVKGPGKGIIKVNGIPIDLLQPETLKIKVFEPFFILRSDTFTDID 63

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +RI+VKGGGH SQ+YAIRQ+IA+ ++ + +KYV E++K + K++L+ YDR+LLV D R  
Sbjct: 64  IRIKVKGGGHVSQLYAIRQAIARGIIRYAEKYVGEETKIKFKNLLLNYDRSLLVKDSRNV 123

Query: 470 EPKKFGGRGARARFQKSYR 526
           EPKK+GG+GARAR+QKSYR
Sbjct: 124 EPKKYGGKGARARYQKSYR 142



>gb:AF481058_1275341 Aplysia californica 40S ribosomal protein S16
           mRNA, partial cds.
          Length = 76

 Score =  136 bits (342), Expect = 4e-31
 Identities = 63/76 (82%), Positives = 73/76 (96%)
 Frame = +2

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
           RVKGGGH +QIYAIRQ+I+KA+V++YQKYVDE SKKEIKDIL++YDR+LLVADPRRCEPK
Sbjct: 1   RVKGGGHVAQIYAIRQAISKAIVSYYQKYVDEASKKEIKDILIQYDRSLLVADPRRCEPK 60

Query: 479 KFGGRGARARFQKSYR 526
           KFGG GARAR+QKSYR
Sbjct: 61  KFGGPGARARYQKSYR 76



>gb:BC071674_1988729 Homo sapiens cDNA clone MGC:87876
           IMAGE:5394209, complete cds.
          Length = 152

 Score =  123 bits (309), Expect = 3e-27
 Identities = 55/83 (66%), Positives = 68/83 (81%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           P++SVQ FGRKKTA AV HCKRG GLIK+NG P+E+I+P  L+YK  EP+LLLG+ RFAG
Sbjct: 6   PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 65

Query: 284 VDMRIRVKGGGHTSQIYAIRQSI 352
           VD+R+RVKGGGH +QIY   Q +
Sbjct: 66  VDIRVRVKGGGHVAQIYGESQEL 88



>gb:AY550068_1431343 Sus scrofa 40S ribosomal protein S16 mRNA,
           partial cds.
          Length = 67

 Score =  122 bits (305), Expect = 9e-27
 Identities = 59/67 (88%), Positives = 64/67 (95%)
 Frame = +2

Query: 326 QIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARA 505
           QIYAIRQSI+KALVA+YQKYVDE SKKEIKDIL++YDRTLLVADPRRCE KKFGG GARA
Sbjct: 1   QIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARA 60

Query: 506 RFQKSYR 526
           R+QKSYR
Sbjct: 61  RYQKSYR 67



>sp|O26146|RLSX_METTH Fused L13/S9 ribosomal protein [Includes: 50S
           ribosomal protein L13P; 30S ribosomal protein
           S9P].>pir|E69150|E69150 ribosomal protein S9 -
           Methanobacterium thermoautotrophicum  (strain Delta
           H)>gb:AE000796_27743 Methanobacterium
           thermoautotrophicum from bases 10151 to 26221 (section 2
           of 148) of the complete genome.>gb:AE000666_924825
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 282

 Score =  119 bits (299), Expect = 4e-26
 Identities = 66/133 (49%), Positives = 85/133 (63%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++KTA+A    + G+G ++IN VP+EL  PE+ R K  EP+ L G      VD+ +RV 
Sbjct: 158 GKRKTAIARGTIREGKGRVRINKVPVELYTPELARLKIMEPLKLAG-DVINDVDINVRVV 216

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG   Q  A R  IA+ LV       D  S  ++K+  V+YDRT+LV DPRR EPKK+G
Sbjct: 217 GGGIVGQAEAARMVIARGLV-------DWTSDMDLKEKFVQYDRTMLVGDPRRSEPKKYG 269

Query: 488 GRGARARFQKSYR 526
           GRGARAR QKSYR
Sbjct: 270 GRGARARRQKSYR 282



>sp|Q8TVB5|RS9_METKA 30S ribosomal protein S9P.>gb:AE010438_263109
           Methanopyrus kandleri AV19 section 137 of 157 of the
           complete genome.>gb:AE009439_903890 Methanopyrus
           kandleri AV19, complete genome.
          Length = 134

 Score =  116 bits (291), Expect = 4e-25
 Identities = 60/137 (43%), Positives = 87/137 (63%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           VQ  G++KTA+A    + G G +++N  P+ +I+PE+ R K  EP+++ G    + VD+ 
Sbjct: 5   VQTTGKRKTAIARAVIREGEGRVRVNKRPVNIIEPEMARMKIMEPLIIAGEDIVSQVDID 64

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           ++V+GGG  SQ  A R +IA+ LV +           +++D  + YDR +L  DPRR EP
Sbjct: 65  VKVQGGGWMSQAEAARIAIARGLVEW-------TGDPDLRDAYMAYDRHMLKGDPRRKEP 117

Query: 476 KKFGGRGARARFQKSYR 526
           KKFGGRGARAR QKSYR
Sbjct: 118 KKFGGRGARARRQKSYR 134



>gb:CNS07EGA_1372944 chromosome III of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 145

 Score =  115 bits (287), Expect = 1e-24
 Identities = 66/141 (46%), Positives = 89/141 (63%), Gaps = 1/141 (0%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKR-GRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           V+SV   G+KK AVA   C + G   I+IN VP +LI   ++  K  E I ++ +     
Sbjct: 5   VKSVTTQGKKKRAVATCVCTQTGEFSIRINKVPFKLITNTLMIAKLKEIICIVEQANIKD 64

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
           +   I  K GG  S++YA+R + AKA++AFY  Y DE  K+EI+  L+ +DR  LVAD R
Sbjct: 65  LSFDITCKIGGDVSRVYAVRMAFAKAILAFYGTYFDEWKKQEIQKRLLDFDRFSLVADSR 124

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           + EPKKFGG GARAR+QKSYR
Sbjct: 125 KREPKKFGGPGARARYQKSYR 145



>sp|O59299|RS9_PYRHO 30S ribosomal protein S9P.>pir|A71043|A71043
           ribosomal protein S9 [similarity] - Pyrococcus
           horikoshii>gb:BA000001_650307 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 135

 Score =  112 bits (279), Expect = 9e-24
 Identities = 59/139 (42%), Positives = 87/139 (62%), Gaps = 2/139 (1%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           +Q  G++KTA+A    + GRG ++ING P+E+I+PEI R+   EP++L G   +  VD+ 
Sbjct: 4   IQTTGKRKTAIARAVIREGRGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSVDID 63

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           ++V+GGG   Q  A R +IA+ALV +            +K+  ++YDRT+LV DPRR EP
Sbjct: 64  VKVQGGGFMGQAEAARIAIARALVEW-------TGDMNLKEKFIKYDRTMLVGDPRRTEP 116

Query: 476 KK--FGGRGARARFQKSYR 526
            K     +G RA+ QKSYR
Sbjct: 117 HKPNRSTKGPRAKRQKSYR 135



>sp|Q979K1|RS9_THEVO 30S ribosomal protein S9P.>gb:BA000011_665602
           Thermoplasma volcanium GSS1 DNA, complete genome.
          Length = 132

 Score =  111 bits (277), Expect = 2e-23
 Identities = 63/133 (47%), Positives = 85/133 (63%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++KTAVA    K+G+G+I ING P EL   E+LR K  EP+ L    +  G+D+ ++VK
Sbjct: 8   GKRKTAVARAVVKKGKGIITINGTPAELYPVEVLRNKILEPVKL-AEDKAKGIDVTVKVK 66

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG T Q  A R +IA+ +V F Q         E++++  +YDRTL+V D R   PKK G
Sbjct: 67  GGGVTGQADASRTAIARGIVKFLQD-------NELENLFRQYDRTLIVNDVRIKLPKKPG 119

Query: 488 GRGARARFQKSYR 526
           GRGARA+ QKSYR
Sbjct: 120 GRGARAKKQKSYR 132



>sp|Q8U0E7|RS9_PYRFU 30S ribosomal protein S9P.>gb:AE010263_261211
           Pyrococcus furiosus DSM 3638, section 138 of 173 of the
           complete genome.>gb:AE009950_901992 Pyrococcus furiosus
           DSM 3638, complete genome.
          Length = 135

 Score =  111 bits (277), Expect = 2e-23
 Identities = 58/139 (41%), Positives = 87/139 (62%), Gaps = 2/139 (1%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           +Q  G++KTA+A    + G+G ++ING P+E+I+PEI R+   EP++L G   +  VD+ 
Sbjct: 4   IQTTGKRKTAIARAVIREGKGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSVDID 63

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           ++V+GGG   Q  A R +IA+ALV +            +K+  ++YDRT+LV DPRR EP
Sbjct: 64  VKVEGGGFMGQAEAARMAIARALVEW-------TGDMSLKEKFMKYDRTMLVGDPRRTEP 116

Query: 476 KK--FGGRGARARFQKSYR 526
            K     +G RA+ QKSYR
Sbjct: 117 HKPNRSTKGPRAKRQKSYR 135



>sp|Q9V195|RS9_PYRAB 30S ribosomal protein S9P.>pir|H75171|H75171
           ssu ribosomal protein s9p (rps9p) PAB0366 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX02_849296 Pyrococcus
           abyssi complete genome; segment 2/6.
          Length = 135

 Score =  111 bits (277), Expect = 2e-23
 Identities = 58/139 (41%), Positives = 87/139 (62%), Gaps = 2/139 (1%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           +Q  G++KTA+A    + G+G ++ING P+EL++PEI R+   EP++L G   +  VD+ 
Sbjct: 4   IQTTGKRKTAIARAVIREGKGRVRINGKPVELVEPEIARFTILEPLILAGEEIWNSVDID 63

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           ++V+GGG   Q  A R +IA+ALV +            +K+  ++YDRT+LV DPRR EP
Sbjct: 64  VKVQGGGFMGQAEAARIAIARALVEW-------TGDMNLKEKFIKYDRTMLVGDPRRTEP 116

Query: 476 KK--FGGRGARARFQKSYR 526
            K     +G RA+ QKSYR
Sbjct: 117 HKPNRSTKGPRAKRQKSYR 135



>sp|Q9HL08|RS9_THEAC 30S ribosomal protein S9P.>gb:TACID2_196204
           Thermoplasma acidophilum complete genome; segment 2/5.
          Length = 129

 Score =  108 bits (270), Expect = 1e-22
 Identities = 61/133 (45%), Positives = 89/133 (66%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++KTAVA    K+G+G++ ING P+EL    +LR K  EP LL+   +   +D+ ++V+
Sbjct: 5   GKRKTAVARAVAKKGKGIVTINGYPVELYPVRVLRNKIMEP-LLIAEDKAKDLDIAVKVR 63

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG T Q  A R +IA+A+V    KY+++    E++++  +YDRTL+V D R   PKK G
Sbjct: 64  GGGVTGQADASRTAIARAIV----KYLNDT---ELENLFRQYDRTLIVNDVRIKLPKKAG 116

Query: 488 GRGARARFQKSYR 526
           GRGARA+ QKSYR
Sbjct: 117 GRGARAKKQKSYR 129



>sp|Q9HQJ2|RS9_HALN1 30S ribosomal protein S9P.
          Length = 131

 Score =  108 bits (270), Expect = 1e-22
 Identities = 60/133 (45%), Positives = 79/133 (59%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G+KKTAVA      G G ++IN  P+EL++PE+ R K  EP  + G      VD+ I V 
Sbjct: 6   GKKKTAVARATVSDGEGRVRINSQPVELVEPEMARLKMLEPFRISGSDLRGDVDIDIDVA 65

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG   Q  A+R +IA+ LV  Y          E++D    +DR+LLV D R+ E KK+G
Sbjct: 66  GGGFAGQADAVRTAIARGLVEHY-------GDAELRDAFREFDRSLLVNDVRQRESKKWG 118

Query: 488 GRGARARFQKSYR 526
           G GARAR+QKSYR
Sbjct: 119 GPGARARYQKSYR 131



>pir|C41715|R3HS3 ribosomal protein S9 [validated] - Haloarcula
           marismortui>gb:HALHMAENOA_136617 H.marismortui tRNA-Leu,
           HL29, HmaL13, HmaS9, OrfMMV, OrfMNA, 2-phosphoglycerate
           dehydratase (HmaEno), and OrfMSG genes, complete
           cds.>gb:AY596297_631610 Haloarcula marismortui ATCC
           43049 chromosome I, complete sequence.
          Length = 132

 Score =  107 bits (267), Expect = 2e-22
 Identities = 57/133 (42%), Positives = 81/133 (60%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G+KKTAVA    + G G ++I+  P+EL+ PE+ + K  EP  +        VD+ + V+
Sbjct: 7   GKKKTAVARATVREGEGRVRIDSQPVELVDPELAQLKMLEPFRIAEDDLRGEVDVEVSVE 66

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG   Q  A R +IA+ L       VD  +  E++D  + +DR+LLV D R+ EPKK+G
Sbjct: 67  GGGVMGQADAARTAIARGL-------VDHTNDAELRDAFMEFDRSLLVNDVRQSEPKKWG 119

Query: 488 GRGARARFQKSYR 526
           G GARAR+QKSYR
Sbjct: 120 GPGARARYQKSYR 132



>sp|P54024|RS9_METJA 30S ribosomal protein S9P.>pir|D64324|D64324
           ribosomal protein S9 - Methanococcus
           jannaschii>gb:U67475_206284 Methanocaldococcus
           jannaschii DSM 2661 section 17 of 150 of the complete
           genome.>gb:L77117_1099042 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 136

 Score =  107 bits (267), Expect = 2e-22
 Identities = 61/135 (45%), Positives = 83/135 (61%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++K A+A    + G+G I+IN +PIELI+P+  R K  EPILL G    + +D+ + VK
Sbjct: 9   GKRKRAIARAVAREGKGRIRINKIPIELIEPKYKRMKLMEPILLAGEEVISQMDIDVTVK 68

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK-- 481
           GGG   Q+ A R +I KA+V F          KE++D  + YDRTLLV+D RR EP K  
Sbjct: 69  GGGVMGQMDAARTAIGKAIVEF-------TGSKELRDKFLAYDRTLLVSDARRTEPHKPS 121

Query: 482 FGGRGARARFQKSYR 526
              +G RA+ QKSYR
Sbjct: 122 RSTKGPRAKRQKSYR 136



>sp|P05763|RS9_HALMA 30S ribosomal protein S9P (HmaS9) (HS3) (F1).
          Length = 131

 Score =  107 bits (267), Expect = 2e-22
 Identities = 57/133 (42%), Positives = 81/133 (60%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G+KKTAVA    + G G ++I+  P+EL+ PE+ + K  EP  +        VD+ + V+
Sbjct: 6   GKKKTAVARATVREGEGRVRIDSQPVELVDPELAQLKMLEPFRIAEDDLRGEVDVEVSVE 65

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG   Q  A R +IA+ L       VD  +  E++D  + +DR+LLV D R+ EPKK+G
Sbjct: 66  GGGVMGQADAARTAIARGL-------VDHTNDAELRDAFMEFDRSLLVNDVRQSEPKKWG 118

Query: 488 GRGARARFQKSYR 526
           G GARAR+QKSYR
Sbjct: 119 GPGARARYQKSYR 131



>pir|A72558|A72558 probable ribosomal protein S9 APE1749 - Aeropyrum
           pernix  (strain K1)>gb:BA000002_652494 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 157

 Score =  106 bits (264), Expect = 5e-22
 Identities = 58/142 (40%), Positives = 90/142 (63%), Gaps = 9/142 (6%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++K A+A    + GRG + INGVP+E+   E+ R K  EP+L+ G    + VD+R+RV+
Sbjct: 17  GKRKRAIARAVIRPGRGRVWINGVPLEIYPIEMARIKMMEPLLIAGEGVRSLVDIRVRVE 76

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQ---------KYVDEQSKKEIKDILVRYDRTLLVADP 460
           GGG   Q  A+R +IA+ LV F++         + +D+ S ++++   + +DRT+LV DP
Sbjct: 77  GGGVMGQADAVRMAIARGLVEFFRCEESDDELCRMMDKIS-RDLRTAFLEHDRTMLVGDP 135

Query: 461 RRCEPKKFGGRGARARFQKSYR 526
           RR EP+K+    AR R+QKSYR
Sbjct: 136 RRTEPEKYMRYSARRRWQKSYR 157



>sp|Q8TT42|RS9_METAC 30S ribosomal protein S9P.>gb:AE010721_265977
           Methanosarcina acetivorans str. C2A, section 66 of 534
           of the complete genome.>gb:AE010299_906536
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 134

 Score =  106 bits (264), Expect = 5e-22
 Identities = 56/140 (40%), Positives = 83/140 (59%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V+ V   G+ KTA A     +G G ++IN +P+EL  PE+   K  EP+L+ G    +G+
Sbjct: 2   VKVVNSSGKHKTATARATVMKGTGKVRINKIPLELYTPELAMMKISEPLLIAGNDVVSGL 61

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+ + V+GGG   Q  A+R ++A+ +V +        +   I+D    YDR LLV+D R+
Sbjct: 62  DINVDVRGGGIIGQANAVRTAVARGIVEW-------TNDTAIRDNFAAYDRNLLVSDSRQ 114

Query: 467 CEPKKFGGRGARARFQKSYR 526
            E K FGG GARA++QKSYR
Sbjct: 115 KESKNFGGPGARAKYQKSYR 134



>sp|Q9YB48|RS9_AERPE 30S ribosomal protein S9P.
          Length = 151

 Score =  106 bits (264), Expect = 5e-22
 Identities = 58/142 (40%), Positives = 90/142 (63%), Gaps = 9/142 (6%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++K A+A    + GRG + INGVP+E+   E+ R K  EP+L+ G    + VD+R+RV+
Sbjct: 11  GKRKRAIARAVIRPGRGRVWINGVPLEIYPIEMARIKMMEPLLIAGEGVRSLVDIRVRVE 70

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQ---------KYVDEQSKKEIKDILVRYDRTLLVADP 460
           GGG   Q  A+R +IA+ LV F++         + +D+ S ++++   + +DRT+LV DP
Sbjct: 71  GGGVMGQADAVRMAIARGLVEFFRCEESDDELCRMMDKIS-RDLRTAFLEHDRTMLVGDP 129

Query: 461 RRCEPKKFGGRGARARFQKSYR 526
           RR EP+K+    AR R+QKSYR
Sbjct: 130 RRTEPEKYMRYSARRRWQKSYR 151



>sp|Q8PW44|RS9_METMA 30S ribosomal protein S9P.>gb:AE013411_292087
           Methanosarcina mazei strain Goe1, section 193 of 379 of
           the complete genome.>gb:AE008384_966196 Methanosarcina
           mazei strain Goe1, complete genome.
          Length = 134

 Score =  105 bits (263), Expect = 6e-22
 Identities = 54/140 (38%), Positives = 84/140 (60%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           V+ +   G+ KTA A     +G G ++IN +P+EL  PE+   K  EP+L+ G+   +G+
Sbjct: 2   VKVINSSGKHKTATARATVMKGTGKVRINKIPLELYTPELAMMKISEPLLIAGKDVVSGL 61

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+ + V+GGG   Q  A+R ++A+ +V +        +   I+D    YDR LLV+D R+
Sbjct: 62  DINVDVRGGGIVGQANAVRTAVARGIVEW-------TNDTTIRDNFAAYDRNLLVSDSRQ 114

Query: 467 CEPKKFGGRGARARFQKSYR 526
            E K FGG GAR+++QKSYR
Sbjct: 115 KEAKNFGGPGARSKYQKSYR 134



>gb:AP006878_576652 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 135

 Score =  105 bits (261), Expect = 1e-21
 Identities = 57/139 (41%), Positives = 86/139 (61%), Gaps = 2/139 (1%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           +Q  G++KTAVA    + G+G ++IN  P+E+I+PEI R+   EP++L G    + VD+ 
Sbjct: 4   IQTAGKRKTAVARATIREGKGRVRINHKPVEIIEPEIARFTIMEPLILAGEEIVSRVDID 63

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           ++V+GGG   Q  A R +IA+ALV +        +   +K+  ++YDRT+LV D RR EP
Sbjct: 64  VKVEGGGFMGQAEAARVAIARALVEW-------TNDMNLKEKFMKYDRTMLVGDSRRTEP 116

Query: 476 KK--FGGRGARARFQKSYR 526
            K     +G RA+ QKSYR
Sbjct: 117 HKPNRSTKGPRAKRQKSYR 135



>sp|O29136|RS9_ARCFU 30S ribosomal protein S9P.>pir|H69390|H69390
           ribosomal protein S9 [similarity] - Archaeoglobus
           fulgidus>gb:AE001026_30779 Archaeoglobus fulgidus DSM
           4304 section 81 of 172 of the complete
           genome.>gb:AE000782_975015 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 135

 Score =  103 bits (257), Expect = 3e-21
 Identities = 59/133 (44%), Positives = 81/133 (60%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++KTA A    K G+G ++IN VP+E+ QPE+ R K  EP L++ +     VD+ ++  
Sbjct: 11  GKRKTATARAVIKPGKGRVRINSVPVEIHQPELARMKIMEP-LIIAKELAEKVDIEVKTW 69

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG  +Q  A R +IA+AL+ F          +E++   + YDRTLLV D RR  PK  G
Sbjct: 70  GGGFMAQAEAARTAIARALLEF-------SGDEELRKAFLEYDRTLLVNDVRRKLPKIQG 122

Query: 488 GRGARARFQKSYR 526
           GRGARAR Q SYR
Sbjct: 123 GRGARARRQTSYR 135



>gb:BX957222_844578 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 134

 Score =  102 bits (255), Expect = 5e-21
 Identities = 58/139 (41%), Positives = 85/139 (61%), Gaps = 2/139 (1%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           V   G+++TA+A    K G G I+IN  P+EL++P+ ++ K  EP++L G    + +D+ 
Sbjct: 4   VHTVGKRRTAIARATAKEGSGKIRINKKPLELMEPKYIKMKLMEPVILAG-EALSNIDVD 62

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           I VKGGG  SQ+ A R ++ KA+V F         K ++K+  + YDRTLLV+D RR EP
Sbjct: 63  IDVKGGGIVSQMDATRTALGKAIVEF-------TGKMDLKEKFLSYDRTLLVSDARRTEP 115

Query: 476 KK--FGGRGARARFQKSYR 526
            K     +G RA+ QKSYR
Sbjct: 116 HKPSKSSKGPRAKRQKSYR 134



>gb:AK097937_1915012 Homo sapiens cDNA FLJ40618 fis, clone
           THYMU2013089, moderately similar to 40S RIBOSOMAL
           PROTEIN S16.
          Length = 178

 Score =  101 bits (252), Expect = 1e-20
 Identities = 55/108 (50%), Positives = 74/108 (68%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGV 286
           ++SVQ F  K+ A+AV  C+ G G I++N  P+E+I+   L+YK  E  LLL + + AG+
Sbjct: 18  LQSVQIFTYKEMAIAVVLCRCGSGFIRMNEGPLEMIRLLTLQYKLLELGLLLDKEQLAGM 77

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVR 430
           D+ +RVKG GH  QIYA+ Q I+KALV  Y KYVDE S +EIKD L R
Sbjct: 78  DIHVRVKGSGHVVQIYAVLQYISKALVPCYPKYVDEAS-EEIKDTLTR 124



>gb:AE017261_419341 Picrophilus torridus DSM 9790, complete genome.
          Length = 133

 Score =  100 bits (249), Expect = 3e-20
 Identities = 61/133 (45%), Positives = 83/133 (62%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++KTA+A    ++G G   ING PIEL   EILR K  EPI +LG  R   +D+ + V 
Sbjct: 9   GKRKTAIARAIIRKGSGKFLINGYPIELYPIEILREKMLEPIRILG-DRSKEIDIDVNVH 67

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG+T Q  A R ++AKA++ +++   D   + EI+     YDR++LV D RR  PKK  
Sbjct: 68  GGGNTGQADATRTAMAKAIIEYFK---DSDLEAEIR----AYDRSMLVNDVRRKMPKKPM 120

Query: 488 GRGARARFQKSYR 526
           G GARA+ QKSYR
Sbjct: 121 GYGARAKRQKSYR 133



>gb:AE009779_255568 Pyrobaculum aerophilum strain IM2 section 34 of
           201 of the complete genome.>gb:AE009441_898194
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 146

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 58/133 (43%), Positives = 82/133 (61%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G+KKTAVA    K G G ++ING P+EL   E+ R K  EP++L G      VD+ + V 
Sbjct: 22  GKKKTAVARAIIKPGIGRVRINGYPLELWPIEMARIKMSEPLILAG-ELAKKVDIDVNVS 80

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG+  Q  A+R ++A+ LVAF+Q        +E+K++  RYD  +L  DPRR E KK G
Sbjct: 81  GGGYMGQAVAVRIAMARGLVAFFQ-------SQELKELYERYDPYMLKGDPRRTEHKKPG 133

Query: 488 GRGARARFQKSYR 526
            + AR++ QK+YR
Sbjct: 134 IKHARSKRQKAYR 146



>sp|Q8ZYQ0|RS9_PYRAE 30S ribosomal protein S9P.
          Length = 142

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 58/133 (43%), Positives = 82/133 (61%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G+KKTAVA    K G G ++ING P+EL   E+ R K  EP++L G      VD+ + V 
Sbjct: 18  GKKKTAVARAIIKPGIGRVRINGYPLELWPIEMARIKMSEPLILAG-ELAKKVDIDVNVS 76

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG+  Q  A+R ++A+ LVAF+Q        +E+K++  RYD  +L  DPRR E KK G
Sbjct: 77  GGGYMGQAVAVRIAMARGLVAFFQ-------SQELKELYERYDPYMLKGDPRRTEHKKPG 129

Query: 488 GRGARARFQKSYR 526
            + AR++ QK+YR
Sbjct: 130 IKHARSKRQKAYR 142



>gb:AY192166_1309057 Leishmania enriettii ribosomal protein S16
           (Rps16) mRNA, complete cds.
          Length = 151

 Score = 95.9 bits (237), Expect = 7e-19
 Identities = 59/143 (41%), Positives = 83/143 (58%), Gaps = 3/143 (2%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLI-KINGVPIELIQPEILRYKAFEPILLLGRHRFAG 283
           ++ VQ FG+KKTA+   H  +G  +  +  GVP++ I P+ LR K  E I ++G   ++ 
Sbjct: 9   LKQVQTFGKKKTAIDRGHGHQGCPVQHQGEGVPLQQILPDTLRAKIMEAITVVGSKYYSR 68

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL-VADP 460
           + + + V GGG  SQ YA RQ+IAK LVAF+QKY +E  K  +KD  + YD+ LL    P
Sbjct: 69  LRIDVTVHGGGQVSQAYAARQAIAKGLVAFFQKYHNEVEKPRLKDKFLAYDKFLLDRPTP 128

Query: 461 RRCEPKKFGGRGA-RARFQKSYR 526
               PKK+G      A   KSYR
Sbjct: 129 ALVSPKKWGRHSCPHAALPKSYR 151



>sp|Q96YW3|RS9_SULTO 30S ribosomal protein S9P.>gb:BA000023_692746
           Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 137

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 51/134 (38%), Positives = 78/134 (58%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           + R+K A A  +   G+G + +N +P+E+I  E++R K  EP+LL G    + +D +I V
Sbjct: 11  YARRKMARARCYITPGKGRVFVNDIPLEIIPMEVVRMKIMEPLLLAGEKISSSIDAKIYV 70

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           +GGG   Q  A R ++A+ALV F          KE+++I   YDRT+L  DPR+ E +K+
Sbjct: 71  EGGGVMGQADAARMALARALVKF-------TGSKELEEIYKVYDRTMLAGDPRQTESEKW 123

Query: 485 GGRGARARFQKSYR 526
               AR   QK+YR
Sbjct: 124 MRYSARRWRQKAYR 137



>pir|S75420|S75420 ribosomal protein S9 [similarity] - Sulfolobus
           solfataricus>gb:SS56KBFR_190398 S.solfataricus 56 kbp
           DNA fragment.>gb:AE006647_221028 Sulfolobus solfataricus
           P2 section 6 of 272 of the complete
           genome.>gb:AE006641_1106876 Sulfolobus solfataricus P2,
           complete genome.
          Length = 140

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 55/132 (41%), Positives = 75/132 (56%)
 Frame = +2

Query: 131 RKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKG 310
           R+KTA A  +   G+G + +N VPIELI  E++R K  EP+LL G    + +D +I   G
Sbjct: 16  RRKTARATCYIYAGKGRVFVNNVPIELIPIEMVRLKIMEPLLLAGNDIRSKIDAKIITYG 75

Query: 311 GGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGG 490
           GG   Q  A R ++A+ALV F          KE++ I   YDRT+L  DPR+ E +K+  
Sbjct: 76  GGIMGQADAARMALARALVKF-------TGSKELEKIYRAYDRTMLAGDPRQTESEKWMR 128

Query: 491 RGARARFQKSYR 526
             AR   QKSYR
Sbjct: 129 YSARRWRQKSYR 140



>sp|P95992|RS9_SULSO 30S ribosomal protein S9P.
          Length = 137

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 55/132 (41%), Positives = 75/132 (56%)
 Frame = +2

Query: 131 RKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVKG 310
           R+KTA A  +   G+G + +N VPIELI  E++R K  EP+LL G    + +D +I   G
Sbjct: 13  RRKTARATCYIYAGKGRVFVNNVPIELIPIEMVRLKIMEPLLLAGNDIRSKIDAKIITYG 72

Query: 311 GGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGG 490
           GG   Q  A R ++A+ALV F          KE++ I   YDRT+L  DPR+ E +K+  
Sbjct: 73  GGIMGQADAARMALARALVKF-------TGSKELEKIYRAYDRTMLAGDPRQTESEKWMR 125

Query: 491 RGARARFQKSYR 526
             AR   QKSYR
Sbjct: 126 YSARRWRQKSYR 137



>sp|P39468|RS9_SULAC 30S ribosomal protein S9P.>pir|S47026|S47026
           ribosomal protein S9 - Sulfolobus
           acidocaldarius>gb:SARPSO_171873 S.acidocaldarius rps13,
           rps4, rps11, rpoD, rpH129e, rps9, rpl13, rpoN and nsp1
           genes.
          Length = 130

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 50/134 (37%), Positives = 76/134 (56%)
 Frame = +2

Query: 125 FGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           + R+ +A A  + K G G + +N +PIE+I  E++RYK  EP++L      + ++ RI  
Sbjct: 4   YARRSSARASCYIKPGNGKVFVNDIPIEIIPIEVVRYKIMEPLVLAVDKITSSIEARIYT 63

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           +GGG   Q  A R + A+ALV F        + KE+ +I   YDRT+L  DPR+ E +K+
Sbjct: 64  QGGGIMGQADAARMAHARALVKF-------TNSKELVEIYKSYDRTMLAGDPRQTESEKW 116

Query: 485 GGRGARARFQKSYR 526
               AR   QK+YR
Sbjct: 117 MRYSARRWRQKAYR 130



>gb:BX908798_831312 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 129

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 59/141 (41%), Positives = 71/141 (50%), Gaps = 1/141 (0%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAG 283
           +E     GR+KTAVA    + G G I ING  +E   P EI R   F P+  LG +    
Sbjct: 2   LEETVATGRRKTAVASVRLRSGNGKIDINGRSLEEYFPLEIQRRTVFAPLENLGGNN--R 59

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
            DM IRVKGGG  +Q  AIR  +A+ALV       DE  + E K          L  D R
Sbjct: 60  YDMVIRVKGGGVEAQAIAIRLGLARALVE-----NDENLRHEFK------SHGYLTRDSR 108

Query: 464 RCEPKKFGGRGARARFQKSYR 526
           + E KK+G  GAR RFQ S R
Sbjct: 109 KKERKKYGRAGARKRFQFSKR 129



>pir|G84269|G84269 30S ribosomal protein S9P [imported] -
           Halobacterium sp. NRC-1>gb:AE005043_62683 Halobacterium
           sp. NRC-1 section 74 of 170 of the complete
           genome.>gb:AE004437_887602 Halobacterium sp. NRC-1
           complete genome.
          Length = 94

 Score = 75.5 bits (184), Expect = 9e-13
 Identities = 44/99 (44%), Positives = 56/99 (56%)
 Frame = +2

Query: 230 RYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKE 409
           R K  EP  + G      VD+ I V GGG   Q  A+R +IA+ LV  Y          E
Sbjct: 3   RLKMLEPFRISGSDLRGDVDIDIDVAGGGFAGQADAVRTAIARGLVEHY-------GDAE 55

Query: 410 IKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
           ++D    +DR+LLV D R+ E KK+GG GARAR+QKSYR
Sbjct: 56  LRDAFREFDRSLLVNDVRQRESKKWGGPGARARYQKSYR 94



>gb:AE017199_403268 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 136

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 48/136 (35%), Positives = 73/136 (53%), Gaps = 4/136 (2%)
 Frame = +2

Query: 131 RKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAG----VDMRI 298
           ++KT++A  + + G G+I+ING  +E+ Q  + R +  EP L++  +   G    +D+ +
Sbjct: 9   KRKTSIARAYFREGNGIIRINGFLLEVWQNPLARARVKEP-LIIAENIIPGITKEIDINV 67

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
            V GGG  SQ  A+RQ+IA+ LV +           ++K   + YD  LLV DPRR E  
Sbjct: 68  NVFGGGWHSQTEAVRQAIARGLVVW-------TGSDQLKKAFLEYDNWLLVNDPRRKEQN 120

Query: 479 KFGGRGARARFQKSYR 526
           K      RA  Q SYR
Sbjct: 121 KSLRSKPRAWRQTSYR 136



>sp|Q8KBK5|RS9_CHLTE 30S ribosomal protein S9.>gb:AE012931_287245
           Chlorobium tepidum TLS section 152 of 194 of the
           complete genome.>gb:AE006470_934413 Chlorobium tepidum
           TLS complete genome.
          Length = 129

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 53/140 (37%), Positives = 74/140 (52%), Gaps = 1/140 (0%)
 Frame = +2

Query: 110 ESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGV 286
           E +   GR+KT+VA      G+G I +N +P+E   + E  R +A +P+ +  +      
Sbjct: 3   EVIDTVGRRKTSVARVFMSPGKGKIVVNKLPVEEYFKDEFKRSQALKPLAVAEKQN--DF 60

Query: 287 DMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRR 466
           D+ I VKGGG T Q  A+  +IA+ALV F     DE  +  +     R DR LL  DPR 
Sbjct: 61  DITINVKGGGLTGQSGAVSLAIARALVEF-----DESIRAAL-----RPDR-LLTRDPRM 109

Query: 467 CEPKKFGGRGARARFQKSYR 526
            E KK+G + AR  FQ S R
Sbjct: 110 VERKKYGKKKARKSFQFSKR 129



>gb:BX842647_823503 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 2/11.
          Length = 132

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 51/134 (38%), Positives = 66/134 (49%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEIL-RYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KT+ A    K G+G I ING   E     +  R    +P+ LL  ++    D +I V
Sbjct: 12  GRRKTSAARVFLKPGKGTITINGKKSEDYLTRMQSRMVIVQPLDLL--NQIGKFDAKITV 69

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  I +AL+AF           E K IL +     +  DPR  E KK+
Sbjct: 70  AGGGESGQAGAIRLGITRALIAF---------NPEFKGILKK--AGFVTRDPRMVERKKY 118

Query: 485 GGRGARARFQKSYR 526
           G  GAR RFQ S R
Sbjct: 119 GKAGARRRFQYSKR 132



>gb:AE017317_440763 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 9 of 12 of the complete
           genome.>gb:AE017285_1073924 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 130

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KTA A T    G G+I+ING P E   P + L+    +P++L         D+++ V
Sbjct: 10  GRRKTATARTRLYPGTGVIEINGRPYEEFFPRKTLQMIIRQPLVL--TKMLEKFDVKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A+R  I++AL+         +   E++ +L R     L  D R+ E KK+
Sbjct: 68  AGGGISGQAEAVRHGISRALL---------ELDAELRPVLKR--AGFLTRDARKKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G R ARAR+Q S R
Sbjct: 117 GLRAARARYQYSKR 130



>sp|Q9PKR2|RS9_CHLMU 30S ribosomal protein S9.>pir|H81705|H81705
           ribosomal protein S9 TC0402 [imported] - Chlamydia
           muridarum (strain Nigg)>gb:AE002307_44990 Chlamydia
           muridarum Nigg section 38 of 85 of the complete
           genome.>gb:AE002160_1149130 Chlamydia muridarum Nigg,
           complete genome.
          Length = 133

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 47/134 (35%), Positives = 67/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AV+    + G G I +NG  +E   P E+ R     P+ +LG       D+ IRV
Sbjct: 13  GRRKQAVSSVRLRSGNGKIDVNGKTLEQYFPLEVQRATILAPLKMLGDVN--SFDLIIRV 70

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG   Q+ A R  +A+A++        E  K+E+K       +  L  DPR+ E KK+
Sbjct: 71  SGGGVQGQVIATRLGLARAVLQ-----EKEDMKQELKS------QGFLTRDPRKKERKKY 119

Query: 485 GGRGARARFQKSYR 526
           G + AR  FQ S R
Sbjct: 120 GRKKARKSFQFSKR 133



>sp|Q822Z3|RS9_CHLCV 30S ribosomal protein S9.>gb:AE016995_374591
           Chlamydophila caviae GPIC section 2 of 4 of the complete
           genome.>gb:AE015925_994270 Chlamydophila caviae GPIC
           complete genome.
          Length = 134

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 53/147 (36%), Positives = 73/147 (49%), Gaps = 2/147 (1%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPIL-LLG 265
           M    +E     GR+K AV+    + G G I +NG   E   P EI R     P++ +LG
Sbjct: 1   MVKNTIEESVATGRRKQAVSSVRLRPGTGKIDVNGKAFEEYFPLEIQRVTILSPLMKVLG 60

Query: 266 RHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTL 445
                  D+ IR+ GGG   Q+ A R  +A+AL+   +K VD  SK+E+K          
Sbjct: 61  TTNEC--DLIIRINGGGIQGQVIATRLGLARALL---KKNVD--SKQELKS------HGF 107

Query: 446 LVADPRRCEPKKFGGRGARARFQKSYR 526
           L  DPR+ E KK+G + AR  FQ S R
Sbjct: 108 LTRDPRKKERKKYGHKKARKSFQFSKR 134



>sp|O84128|RS9_CHLTR 30S ribosomal protein S9.>pir|B71554|B71554
           ribosomal protein S9 [similarity] - Chlamydia
           trachomatis  (serotype D, strain
           UW3/Cx)>gb:AE001286_34052 Chlamydia trachomatis
           D/UW-3/CX section 13 of 87 of the complete
           genome.>gb:AE001273_1098078 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 129

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 47/134 (35%), Positives = 68/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AV+    + G G I +NG  +E   P E+ R     P+ +LG       D+ IRV
Sbjct: 9   GRRKQAVSSVRLRSGNGKIDVNGKTLEQYFPLEVQRATILAPLRMLGDVN--SFDLIIRV 66

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG   Q+ A R  +A+A++         Q K+++K  L    +  L  DPR+ E KK+
Sbjct: 67  SGGGVQGQVIATRLGLARAVL---------QEKEDMKQELKA--QGFLTRDPRKKERKKY 115

Query: 485 GGRGARARFQKSYR 526
           G + AR  FQ S R
Sbjct: 116 GRKKARKSFQFSKR 129



>gb:CP000013_869572 Borrelia garinii PBi, complete genome.
          Length = 136

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 50/137 (36%), Positives = 71/137 (51%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILL---LGRHRFAGVDMR 295
           GR+K++VA  + + G G I++N    +  IQ E LR  A  P++L   LG++     D+ 
Sbjct: 16  GRRKSSVARVYIREGSGNIRVNNRDFDSYIQLENLRTMALSPLVLTNTLGKY-----DLY 70

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           I V GGG + Q  AIR  I++AL       +DE +K      ++      L  D RR E 
Sbjct: 71  INVYGGGISGQSGAIRHGISRALFE-----LDESNK------MILRSNGFLTRDSRRVER 119

Query: 476 KKFGGRGARARFQKSYR 526
           KKFG + AR  FQ S R
Sbjct: 120 KKFGQKKARKSFQFSKR 136



>sp|O51313|RS9_BORBU 30S ribosomal protein S9.>pir|A70142|A70142
           ribosomal protein S9 [similarity] - Lyme disease
           spirochete>gb:AE001140_32318 Borrelia burgdorferi B31
           (section 26 of 70) of the complete
           genome.>gb:AE000783_1119969 Borrelia burgdorferi B31
           complete genome.
          Length = 136

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 50/137 (36%), Positives = 71/137 (51%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILL---LGRHRFAGVDMR 295
           GR+K++VA  + + G G IK+N    +  IQ E LR  A  P++L   LG++     D+ 
Sbjct: 16  GRRKSSVARVYIREGSGNIKVNNRDFDSYIQLENLRTMALSPLVLTNTLGKY-----DLY 70

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           I V GGG + Q  AIR  I++AL       +DE +K      ++      L  D R+ E 
Sbjct: 71  INVYGGGISGQSGAIRHGISRALFK-----LDESNK------MILRSNGFLTRDSRKVER 119

Query: 476 KKFGGRGARARFQKSYR 526
           KKFG + AR  FQ S R
Sbjct: 120 KKFGQKKARKSFQFSKR 136



>gb:AY774849_2149562 Synthetic construct Francisella tularensis
           clone FLH150896.01X NT02FT0230 gene, complete cds.
          Length = 129

 Score = 62.8 bits (151), Expect = 6e-09
 Identities = 46/136 (33%), Positives = 71/136 (52%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELI---QPEILRYKAFEPILLLGRHRFAGVDMRI 298
           GR+K++VA    K+G G   +NG+P+E     + + +  K  +P+ L   +     D ++
Sbjct: 9   GRRKSSVARVFMKKGTGQFIVNGLPLEQYLCRETDCMVVK--QPLELT--NNTDNFDFKV 64

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
            VKGGG T Q  AIR  + +AL+ +     DE+ K  ++      +   +  DPR+ E K
Sbjct: 65  TVKGGGTTGQAGAIRLGVTRALIEY-----DEELKPALR------EAGFVTRDPRKVERK 113

Query: 479 KFGGRGARARFQKSYR 526
           KFG R AR R Q S R
Sbjct: 114 KFGLRKARRRRQFSKR 129



>gb:AJ749949_531731 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 132

 Score = 62.8 bits (151), Expect = 6e-09
 Identities = 46/136 (33%), Positives = 71/136 (52%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELI---QPEILRYKAFEPILLLGRHRFAGVDMRI 298
           GR+K++VA    K+G G   +NG+P+E     + + +  K  +P+ L   +     D ++
Sbjct: 12  GRRKSSVARVFMKKGTGQFIVNGLPLEQYLCRETDCMVVK--QPLELT--NNTDNFDFKV 67

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
            VKGGG T Q  AIR  + +AL+ +     DE+ K  ++      +   +  DPR+ E K
Sbjct: 68  TVKGGGTTGQAGAIRLGVTRALIEY-----DEELKPALR------EAGFVTRDPRKVERK 116

Query: 479 KFGGRGARARFQKSYR 526
           KFG R AR R Q S R
Sbjct: 117 KFGLRKARRRRQFSKR 132



>sp|Q9Z8T8|RS9_CHLPN 30S ribosomal protein S9.>pir|B72101|B72101
           ribosomal protein S9 CP0516  [similarity] -
           Chlamydophila pneumoniae (strains CWL029 and
           AR39)>pir|F86521|F86521 ribosomal protein S9
           [similarity] - Chlamydophila pneumoniae (strain
           J138)>gb:AE001610_37111 Chlamydia pneumoniae section 26
           of 103 of the complete genome.>gb:AE002211_43995
           Chlamydophila pneumoniae AR39, section 40 of 94 of the
           complete genome.>gb:AE017157_393598 Chlamydophila
           pneumoniae TW-183, section 1 of 4 of the complete
           genome.>gb:BA000008_663619 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886120
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_941668 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1027860 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 134

 Score = 62.8 bits (151), Expect = 6e-09
 Identities = 47/146 (32%), Positives = 73/146 (50%), Gaps = 1/146 (0%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGR 268
           MA + ++     GR+K AV+    + G G I +NG   E   P EI R     P+  +  
Sbjct: 1   MAKSTIQESVATGRRKQAVSSVRLRPGSGKIDVNGKSFEDYFPLEIQRTTILSPLKKITE 60

Query: 269 HRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLL 448
            + +  D+ IRV GGG   Q+ A R  +A+AL+       +E++++++K          L
Sbjct: 61  DQ-SQYDLIIRVSGGGIQGQVIATRLGLARALLK-----ENEENRQDLKSC------GFL 108

Query: 449 VADPRRCEPKKFGGRGARARFQKSYR 526
             DPR+ E KK+G + AR  FQ S R
Sbjct: 109 TRDPRKKERKKYGHKKARKSFQFSKR 134



>gb:AE017248_415901 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069497 Treponema
           denticola ATCC 35405, complete genome.
          Length = 124

 Score = 62.4 bits (150), Expect = 8e-09
 Identities = 51/136 (37%), Positives = 70/136 (51%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE--LIQPEILRYKAFEPILLL-GRHRFAGVDMRI 298
           GR+KT+VA  + + G+G + +N   I      PE ++ KA EP+++  G  ++   D+ I
Sbjct: 4   GRRKTSVARVYIRDGKGQLTVNDKDINEYFATPEQVQ-KAKEPLMVTAGESKY---DIII 59

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
            V+GGG T Q  A    IA+AL       VD  +   +K         LL  D R  E K
Sbjct: 60  TVRGGGLTGQAGACSHGIARALAQ-----VDASNHASLKA------NGLLTRDSRMVERK 108

Query: 479 KFGGRGARARFQKSYR 526
           KFG RGAR RFQ S R
Sbjct: 109 KFGQRGARRRFQFSKR 124



>sp|Q9X1G4|RS9_THEMA 30S ribosomal protein S9.>pir|F72250|F72250
           ribosomal protein S9 - Thermotoga maritima (strain
           MSB8)>gb:AE001797_39349 Thermotoga maritima MSB8 section
           109 of 136 of the complete genome.>gb:AE000512_1113822
           Thermotoga maritima MSB8, complete genome.
          Length = 134

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 47/138 (34%), Positives = 71/138 (51%), Gaps = 5/138 (3%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQ-----PEILRYKAFEPILLLGRHRFAGVDM 292
           GR+KTAVA  + + G G +K+NG   E +      P   ++ A EP+ +   +     D+
Sbjct: 11  GRRKTAVARVYLRPGEGKVKVNGKEYESLNDYFKNPAWTKH-AIEPLEVT--NTLGKFDL 67

Query: 293 RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE 472
            IRV GGG + Q  A+R  IA+AL+ + Q          ++ +L +Y   +L  DPR  E
Sbjct: 68  VIRVNGGGLSGQSGAVRLGIARALLQYDQ---------NLRPVLKKY--KMLTRDPREVE 116

Query: 473 PKKFGGRGARARFQKSYR 526
            KK+G + AR   Q S R
Sbjct: 117 RKKYGLKKARRAPQFSKR 134



>sp|Q7VUV9|RS9_BORPE 30S ribosomal protein S9.>gb:BX640420_807361
           Bordetella pertussis strain Tohama I, complete genome;
           segment 10/12.
          Length = 130

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KT+VA    K+G G I +NG P+ E    E  R    +P+ L G       D+++ V
Sbjct: 10  GRRKTSVARVFIKKGSGKIVVNGKPVDEFFARETGRMIVHQPLELTG--HLESFDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  A+R  I +AL+ +     D   K  +           +  D R  E KK 
Sbjct: 68  HGGGETGQAGAVRHGITRALIDY-----DAALKPALS------QAGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GFRKARRRKQFSKR 130



>sp|Q7W3Z2|RS9_BORPA 30S ribosomal protein S9.>gb:BX640435_812118
           Bordetella parapertussis strain 12822, complete genome;
           segment 13/14.
          Length = 130

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KT+VA    K+G G I +NG P+ E    E  R    +P+ L G       D+++ V
Sbjct: 10  GRRKTSVARVFIKKGSGKIVVNGKPVDEFFARETGRMIVCQPLELTG--HLESFDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  A+R  I +AL+ +     D   K  +           +  D R  E KK 
Sbjct: 68  HGGGETGQAGAVRHGITRALIDY-----DAALKPALS------QAGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GFRKARRRKQFSKR 130



>gb:AE017263_421046 Mesoplasma florum L1 complete genome.
          Length = 131

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 48/134 (35%), Positives = 67/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVP-IELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KT+VA      G+G I +NGVP +E      L     +P++  G  +    D+ + V
Sbjct: 11  GRRKTSVAQVILTPGKGNIIVNGVPALEFFPYPTLVQDLEQPLVATGTEK--DFDITVTV 68

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG T Q  A R  IA+AL+   + Y     +K ++ +       LL  D R  E KK+
Sbjct: 69  KGGGFTGQAGATRLGIARALLVASEDY-----RKGLRAV------GLLTRDARIKERKKY 117

Query: 485 GGRGARARFQKSYR 526
           G RGAR   Q S R
Sbjct: 118 GLRGARRAPQYSKR 131



>sp|Q7WFC4|RS9_BORBR 30S ribosomal protein S9.>gb:BX640450_817004
           Bordetella bronchiseptica strain RB50, complete genome;
           segment 14/16.
          Length = 130

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KT+VA    K+G G I +NG P+ E    E  R    +P+ L G       D+++ V
Sbjct: 10  GRRKTSVARVFIKKGSGKIVVNGKPVDEFFARETGRMIVRQPLELTG--HLESFDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  A+R  I +AL+ +     D   K  +           +  D R  E KK 
Sbjct: 68  HGGGETGQAGAVRHGITRALIDY-----DAALKPALS------QAGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GFRKARRRKQFSKR 130



>sp|Q7MX42|RS9_PORGI 30S ribosomal protein S9.>gb:AE017173_396723
           Porphyromonas gingivalis W83 section 2 of 8 of the
           complete genome.>gb:AE015924_1032334 Porphyromonas
           gingivalis W83 complete genome.
          Length = 128

 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 49/141 (34%), Positives = 68/141 (48%), Gaps = 1/141 (0%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPE-ILRYKAFEPILLLGRHRFAG 283
           ++ +   GR+K AVA  +   G G I IN   IE   P  IL+Y   +P+L L     A 
Sbjct: 1   MDYINAIGRRKAAVARVYLSEGSGKIVINKREIEQYFPSSILQYIVKQPLLKLDVA--AK 58

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
            D++I ++GGG   Q  A R +IA+ALV      ++   K  ++          +  DPR
Sbjct: 59  YDIKINLRGGGFKGQSEAARLAIARALVK-----INPDDKPALR------SEGFITRDPR 107

Query: 464 RCEPKKFGGRGARARFQKSYR 526
             E KK G   AR RFQ S R
Sbjct: 108 VVERKKPGRPKARKRFQFSKR 128



>sp|Q9PMI3|RS9_CAMJE 30S ribosomal protein S9.>pir|D81294|D81294 30S
           ribosomal protein S9 Cj1479c [imported] - Campylobacter
           jejuni (strain NCTC 11168)>gb:CJ11168X5_847846
           Campylobacter jejuni subsp. jejuni NCTC 11168 complete
           genome; segment 5/6.>gb:CP000025_879386 Campylobacter
           jejuni RM1221, complete genome.
          Length = 129

 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 44/135 (32%), Positives = 69/135 (51%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE--LIQPEILRYKAFEPILLLGRHRFAGVDMRIR 301
           G++KTA+A    K G G I +NGV +   L   E ++ K  +P+L+  +     +D++  
Sbjct: 8   GKRKTAIAKVWVKPGSGKISVNGVDLNTWLGGHEAIKLKVVQPLLVTKQE--TSMDIKAT 65

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
             GGG+++Q  A+R  I++AL A     +D   +  +K       + LL  D R  E KK
Sbjct: 66  TLGGGYSAQAEALRHGISRALAA-----MDADFRALLK------PKGLLTRDSRTVERKK 114

Query: 482 FGGRGARARFQKSYR 526
           +G R AR   Q S R
Sbjct: 115 YGRRKARRSPQFSKR 129



>gb:AE016942_363242 Bacteroides thetaiotaomicron VPI-5482, section
           17 of 21 of the complete genome.>gb:AE015928_989730
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 128

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAG 283
           +E V   GR+K A+A      G G I IN   + E     IL+Y   +P+  LG      
Sbjct: 1   MEVVNALGRRKRAIARVFVSEGTGKITINKRDLAEYFPSTILQYVVKQPLNKLGAAE--K 58

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
            D+++ + GGG T Q  A+R +IA+AL+           K   +D         +  DPR
Sbjct: 59  YDIKVNLCGGGFTGQSQALRLAIARALI-----------KMNAEDKAALRAEGFMTRDPR 107

Query: 464 RCEPKKFGGRGARARFQKSYR 526
             E KK G   AR RFQ S R
Sbjct: 108 SVERKKPGQPKARRRFQFSKR 128



>gb:AP006841_574531 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 128

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 47/141 (33%), Positives = 67/141 (47%), Gaps = 1/141 (0%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAG 283
           +E V   GR+K A+A      G G I IN   + E     IL+Y   +P+  LG      
Sbjct: 1   MEVVNALGRRKRAIARVFVSEGTGKITINKRDLAEYFPSTILQYVVKQPLNKLGVAE--K 58

Query: 284 VDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPR 463
            D+++ + GGG T Q  A+R +IA+ALV      ++ + K  ++          +  DPR
Sbjct: 59  YDIKVNLCGGGFTGQSQALRLAIARALVK-----INAEDKPALR------SEGFMTRDPR 107

Query: 464 RCEPKKFGGRGARARFQKSYR 526
             E KK G   AR RFQ S R
Sbjct: 108 SVERKKPGQPKARRRFQFSKR 128



>gb:CR555306_105907 Azoarcus sp. EbN1 complete genome.
          Length = 130

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KTAVA    K G G I +NG P+ E    E  R    +P++L      +  D+ + V
Sbjct: 10  GRRKTAVARVFIKPGSGNIVVNGKPVDEFFSRETGRMIVRQPLVL--TENDSRFDIMVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A+R  I +AL+ +           E+K +L +     +  D R  E KK 
Sbjct: 68  TGGGESGQAGAVRHGITRALIEY---------DAELKPVLRK--AGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GFRKARRRKQFSKR 130



>sp|Q8R7Y9|RS9_THETN 30S ribosomal protein S9.>gb:AE013170_289825
           Thermoanaerobacter tengcongensis MB4, section 197 of 244
           of the complete genome.>gb:AE008691_1111890
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 130

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 48/134 (35%), Positives = 67/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G+G I IN   +E   P E LRY   +P++L         D+ ++V
Sbjct: 10  GRRKEAVARVRLMPGKGNIIINNKSLEEYFPLETLRYTVKQPLILT--ETIDKFDVYVKV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  IA+ALV         ++  E++ IL +     L  DPR  E +K+
Sbjct: 68  SGGGLSGQAGAIRHGIARALV---------KADAELRPILKK--AGFLTRDPRMKERRKY 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKAPQFSKR 130



>sp|Q8F0T3|RS9_LEPIN 30S ribosomal protein S9.>gb:AE011499_273643
           Leptospira interrogans serovar lai str. 56601 chromosome
           I, section 308 of 397 of the complete
           sequence.>gb:AE017290_432988 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 4 of 14 of the complete
           sequence.>gb:AE010300_1007042 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1065999 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 139

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 46/148 (31%), Positives = 67/148 (45%), Gaps = 2/148 (1%)
 Frame = +2

Query: 89  RMAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIE--LIQPEILRYKAFEPILLL 262
           R   AP + +   GR+KT+VA    K G G I +N   I+  L   + +  +A  P+ LL
Sbjct: 5   RSDMAPAKEIWAVGRRKTSVARAKIKEGSGKITVNHKDIKDYLQNRKAIIEEAIRPLSLL 64

Query: 263 GRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRT 442
                   D+ + V GGG T Q+ AIR ++A+A+     ++     K+            
Sbjct: 65  NVQD--KYDLNLNVTGGGTTGQVGAIRHALARAICRIKPEFRPAVKKE-----------G 111

Query: 443 LLVADPRRCEPKKFGGRGARARFQKSYR 526
            L  DPR  E KK+G   AR   Q S R
Sbjct: 112 FLTRDPRMVERKKYGLHKARRGTQFSKR 139



>gb:BX842644_822715 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 3/4.
          Length = 132

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 46/134 (34%), Positives = 67/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVP-IELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K+++A      G GLI +NG P +E      L     +P  L+  +     D+ ++V
Sbjct: 12  GRRKSSIAQVILTPGSGLITVNGKPALEFFPYATLVQDLEQP--LVATNTLKDFDIIVKV 69

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  A R  IA+AL+         Q+ ++ + +L   D+ LL  D R  E KK+
Sbjct: 70  IGGGFTGQAGATRLGIARALL---------QASEDYRKLL--RDQGLLTRDARIKERKKY 118

Query: 485 GGRGARARFQKSYR 526
           G RGAR   Q S R
Sbjct: 119 GLRGARRAPQYSKR 132



>sp|P56016|RS9_HELPY 30S ribosomal protein S9.>pir|C64530|C64530
           ribosomal protein S9 - Helicobacter
           pylori>gb:AE000530_24262 Helicobacter pylori 26695
           section 8 of 134 of the complete
           genome.>gb:AE001447_35071 Helicobacter pylori, strain
           J99 section 8 of 132 of the complete
           genome.>gb:AE000511_879701 Helicobacter pylori 26695
           complete genome.>gb:AE001439_883841 Helicobacter pylori,
           strain J99 complete genome.
          Length = 129

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 44/142 (30%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIE--LIQPEILRYKAFEPILLLGRHRFA 280
           +  +   G++KTA+A      G+G + IN   +   L   E ++ K  +P+LL  + +  
Sbjct: 1   MRKIYATGKRKTAIAKVWLTPGKGELSINEQSLNQWLGGHEAIKMKVMQPLLLTKQEQ-- 58

Query: 281 GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP 460
            VD++  V GGG+++Q  A+R  I+KAL A+           +I    +   + LL  D 
Sbjct: 59  SVDIKAVVFGGGYSAQAEALRHGISKALNAY-----------DIAFRAILKPKGLLTRDS 107

Query: 461 RRCEPKKFGGRGARARFQKSYR 526
           R  E KK+G R AR   Q S R
Sbjct: 108 RVVERKKYGKRKARRSPQFSKR 129



>sp|Q7VIV5|RS9_HELHP 30S ribosomal protein S9.>gb:AE017145_390252
           Helicobacter hepaticus ATCC 51449 section 2 of 6 of the
           complete genome.>gb:AE017125_1024514 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 129

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 45/139 (32%), Positives = 68/139 (48%), Gaps = 2/139 (1%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIE--LIQPEILRYKAFEPILLLGRHRFAGVD 289
           V   G++KTA+A      G G + ING  +   L   E ++ K  +P++L  + +   VD
Sbjct: 4   VYATGKRKTAIAKVWLTSGSGKLNINGQSLNDWLGGHEAIKMKVMQPLILTKQEK--SVD 61

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +     GGG+++Q  A+R  I+KAL A+     D   +  +K       + LL  D R  
Sbjct: 62  IHAVTLGGGYSAQAEALRHGISKALNAY-----DVAFRAMLK------PKGLLTRDSRVV 110

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK+G R AR   Q S R
Sbjct: 111 ERKKYGKRKARRSPQFSKR 129



>sp|Q7M7R1|RS9_WOLSU 30S ribosomal protein S9.>gb:BX571662_779387
           Wolinella succinogenes, complete genome; segment 6/7.
          Length = 129

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 43/135 (31%), Positives = 66/135 (48%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE--LIQPEILRYKAFEPILLLGRHRFAGVDMRIR 301
           G++KTA+A      G G + +NG  +   L   E ++ K  +P+LL  + +   VD+   
Sbjct: 8   GKRKTAIAKVWLTPGSGKLTVNGTTLNDWLGGHEAIKMKVMQPLLLTKQEK--SVDIVSV 65

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
             GGG+++Q  A+R  I+KAL A+           +I    +   + LL  D R  E KK
Sbjct: 66  TLGGGYSAQAEALRHGISKALSAY-----------DIAFRAILKPKGLLTRDSRVVERKK 114

Query: 482 FGGRGARARFQKSYR 526
           +G R AR   Q S R
Sbjct: 115 YGKRKARRSPQFSKR 129



>sp|Q82UK1|RS9_NITEU 30S ribosomal protein S9.>gb:BX321861_773811
           Nitrosomonas europaea ATCC 19718, complete genome;
           segment 6/10.
          Length = 130

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 44/134 (32%), Positives = 64/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K+AVA    K G G+I +N  P  E    E  R    +P+ L G    + +D+ + +
Sbjct: 10  GRRKSAVARVFIKPGTGVITVNHKPADEYFSRETGRMIIRQPLELTGNT--SNLDIMVNI 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A+R  I +AL+ +          + +K IL +     +  D R  E KK 
Sbjct: 68  HGGGESGQAGAVRHGITRALIGY---------DETLKPILSK--AGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRKQFSKR 130



>gb:BC057240_1985392 Homo sapiens mitochondrial ribosomal protein
           S9, mRNA (cDNA clone MGC:62135 IMAGE:6495350), complete
           cds.
          Length = 396

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 49/134 (36%), Positives = 67/134 (50%), Gaps = 6/134 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHC-KRGRGLIKINGVPIELIQP-----EILRYKAFEPILLLGRHRFAGVD 289
           G++KTA A     K G G IK+NG+  +L  P     E L +  F  +  LG+H     D
Sbjct: 274 GKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFP-FHFVDRLGKH-----D 327

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   V GGG ++Q  AIR ++AKAL +F    V E   + ++         LL  DPR  
Sbjct: 328 VTCTVSGGGRSAQAGAIRLAMAKALCSF----VTEDEVEWMR------QAGLLTTDPRVR 377

Query: 470 EPKKFGGRGARARF 511
           E KK G  GAR +F
Sbjct: 378 ERKKPGQEGARRKF 391



>gb:BC047784_1984022 Homo sapiens mitochondrial ribosomal protein
           S9, mRNA (cDNA clone IMAGE:6160499), partial cds.
          Length = 302

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 49/134 (36%), Positives = 67/134 (50%), Gaps = 6/134 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHC-KRGRGLIKINGVPIELIQP-----EILRYKAFEPILLLGRHRFAGVD 289
           G++KTA A     K G G IK+NG+  +L  P     E L +  F  +  LG+H     D
Sbjct: 180 GKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFP-FHFVDRLGKH-----D 233

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   V GGG ++Q  AIR ++AKAL +F    V E   + ++         LL  DPR  
Sbjct: 234 VTCTVSGGGRSAQAGAIRLAMAKALCSF----VTEDEVEWMR------QAGLLTTDPRVR 283

Query: 470 EPKKFGGRGARARF 511
           E KK G  GAR +F
Sbjct: 284 ERKKPGQEGARRKF 297



>gb:ABE291783_1529743 Atropa belladonna partial mRNA for 40S
           ribosomal protein (nh1.4 gene).
          Length = 25

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = +2

Query: 455 DPRRCEPKKFGGRGARARFQKSYR 526
           DPRRCEPKKFGGRGAR+RFQKSYR
Sbjct: 2   DPRRCEPKKFGGRGARSRFQKSYR 25



>sp|P82933|RT09_HUMAN 28S ribosomal protein S9, mitochondrial
           precursor (MRP-S9).
          Length = 396

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 49/134 (36%), Positives = 67/134 (50%), Gaps = 6/134 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHC-KRGRGLIKINGVPIELIQP-----EILRYKAFEPILLLGRHRFAGVD 289
           G++KTA A     K G G IK+NG+  +L  P     E L +  F  +  LG+H     D
Sbjct: 274 GKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFP-FHFVDRLGKH-----D 327

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   V GGG ++Q  AIR ++AKAL +F    V E   + ++         LL  DPR  
Sbjct: 328 VTCTVSGGGRSAQAGAIRLAMAKALCSF----VTEDEVEWMR------QAGLLTTDPRVR 377

Query: 470 EPKKFGGRGARARF 511
           E KK G  GAR +F
Sbjct: 378 ERKKPGQEGARRKF 391



>sp|Q87DD4|RS9_XYLFT 30S ribosomal protein S9.>gb:AE012556_284168
           Xylella fastidiosa Temecula1, section 4 of 9 of the
           complete genome.>gb:AE009442_960744 Xylella fastidiosa
           Temecula1, complete genome.
          Length = 130

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 45/134 (33%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    ++G G I +NG P+ E    E  R    +P+ L      +  D+ I  
Sbjct: 10  GRRKSSTARVFLRKGSGNISVNGRPLDEFFGRETARMIVRQPLELT--KNVSNFDILITA 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+ALV +     D   K E++          +  DPR  E KK 
Sbjct: 68  TGGGTTGQAGAIRLGIARALVEY-----DTSLKPELR------KAGFMTRDPREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 117 GLHKARRATQFSKR 130



>sp|Q7UEY4|RS9_RHOBA 30S ribosomal protein S9.>gb:BX294151_770786
           Pirellula sp. strain 1 complete genome; segment 19/24.
          Length = 137

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 47/134 (35%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA    + G G I ING  IE     +  RY   E +   G      VD+ IRV
Sbjct: 17  GRRKSSVARVRVRPGSGKITINGKSIEEYFVNDQHRYAITETLEAAGLTE--SVDLLIRV 74

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  A+R  +A+AL +  +   D              + + L  D R  E KK 
Sbjct: 75  SGGGMTGQAGAVRMGLARALCSHDEALHDPMR-----------EGSFLTRDSRMKERKKP 123

Query: 485 GGRGARARFQKSYR 526
           G RGAR   Q S R
Sbjct: 124 GLRGARRGVQFSKR 137



>sp|Q8Y245|RS9_RALSO 30S ribosomal protein S9.>gb:AL646059_545419
           Ralstonia solanacearum GMI1000 chromosome, complete
           sequence; segment 3/19.
          Length = 130

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 46/139 (33%), Positives = 61/139 (43%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF------AGVD 289
           GR+K+AVA    K G+G I +NG P+         Y A E  L++ R         A  D
Sbjct: 10  GRRKSAVARVFIKSGKGDIIVNGKPVA-------DYFARETSLMMVRQPLELTNHGATFD 62

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +++ V GGG T Q  A+R  I +AL+ +        SK             L+  D R  
Sbjct: 63  IKVNVVGGGETGQAGAVRHGITRALIDYDATLKPTLSK-----------AGLVTRDAREV 111

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK G   AR R Q S R
Sbjct: 112 ERKKVGLHKARRRKQFSKR 130



>sp|Q83AX9|RS9_COXBU 30S ribosomal protein S9.>gb:AE016965_368932
           Coxiella burnetii strain RSA 493, section 6 of 7 of the
           complete genome.>gb:AE016828_1009668 Coxiella burnetii
           strain RSA 493, complete genome.
          Length = 139

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 46/135 (34%), Positives = 64/135 (47%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLG-RHRFAGVDMRIR 301
           GR+KT+ A    + G G I ING+P+ E    E  R    +P++ L  + RF   D+   
Sbjct: 13  GRRKTSSARVFLRSGTGQIIINGLPLDEYFGRETARMVVRQPLVKLDVQSRF---DVYAT 69

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V+GGG + Q  AIR  I +AL+ +     DE+  +             +  DPR  E KK
Sbjct: 70  VQGGGDSGQAGAIRHGITRALIQY-----DEEGGEGGTWRSTLRKAGFVTRDPRMVERKK 124

Query: 482 FGGRGARARFQKSYR 526
            G  GAR   Q S R
Sbjct: 125 VGLHGARRGTQFSKR 139



>sp|Q97EL3|RS9_CLOAB 30S ribosomal protein S9.>pir|B97281|B97281
           ribosomal protein S9 [imported] - Clostridium
           acetobutylicum>gb:AE007806_230398 Clostridium
           acetobutylicum ATCC 824 section 294 of 356 of the
           complete genome.>gb:AE001437_1093353 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 130

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 48/134 (35%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G + IN    E     E LR+   +P+ L G       D+ + V
Sbjct: 10  GRRKEAVARVRLVPGEGKVVINKRSAEDYFGLETLRFIVNQPLNLTGTK--GKFDVLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  I++AL+       DE  K E+K          L  DPR  E KK+
Sbjct: 68  HGGGFTGQAGAIRHGISRALLK-----ADETLKGELK------KAGFLTRDPRMKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARRAPQFSKR 130



>gb:AE014297_1138384 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003676_1220377 Drosophila melanogaster
           chromosome 3R, section 14 of 118 of the complete
           sequence.>gb:AY089671_1297327 Drosophila melanogaster
           RH44312 full insert cDNA.
          Length = 395

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 46/138 (33%), Positives = 63/138 (45%), Gaps = 3/138 (2%)
 Frame = +2

Query: 107 VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPIL---LLGRHRF 277
           + + +C  RK     VT    G G I ING  I   + E  R +   P+    LLG+   
Sbjct: 269 ITTYECL-RKTARADVTVRLPGTGKISINGKDISYFEDENCREQLLFPLQFSELLGK--- 324

Query: 278 AGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVAD 457
             VD+   V+GGG + Q  AIR  IA +L +F  + + E  +             LL  D
Sbjct: 325 --VDVEANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRL----------AGLLTRD 372

Query: 458 PRRCEPKKFGGRGARARF 511
            RR E KKFG  GAR ++
Sbjct: 373 YRRRERKKFGQEGARRKY 390



>gb:CP000009_862478 Gluconobacter oxydans 621H, complete genome.
          Length = 163

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 49/152 (32%), Positives = 68/152 (44%), Gaps = 9/152 (5%)
 Frame = +2

Query: 98  AAPVESVQ--------CFGRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEP 250
           AAPV  V+          GR+K AVA    K G+G I +NG P+       +LR    +P
Sbjct: 25  AAPVHEVKRDAQGRSYATGRRKDAVARVWIKPGKGDIIVNGRPVTTYFARPVLRMLLTQP 84

Query: 251 ILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVR 430
            L+  R+     D+   V GGG + Q  A+R  I++AL  +         +  ++ IL  
Sbjct: 85  FLIADRYN--QFDVYCTVTGGGLSGQAGAVRHGISRALTYY---------EPSLRGILKA 133

Query: 431 YDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
                L  D R  E KK+G   AR  FQ S R
Sbjct: 134 --AGFLTRDSRIVERKKYGRAKARRSFQFSKR 163



>gb:AE004969_61662 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 130

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA     +G G I +NG P+ E    E  R    +P++L        +D+++ V
Sbjct: 10  GRRKSSVARVFLTKGTGQIIVNGRPVDEFFARETSRMVVRQPLVLT--ENAESLDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  I +AL+ F     D   K  +           +  D R  E KK 
Sbjct: 68  VGGGETGQSGAIRHGITRALIDF-----DAALKPALS------QAGFVTRDAREVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G R AR   Q S R
Sbjct: 117 GLRKARRAKQFSKR 130



>sp|O83987|RS9_TREPA 30S ribosomal protein S9.>pir|C71251|C71251
           ribosomal protein S9 [similarity] - syphilis
           spirochete>gb:AE001270_33845 Treponema pallidum subsp.
           pallidum str. Nichols section 86 of 87 of the complete
           genome.>gb:AE000520_1050073 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 129

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 47/135 (34%), Positives = 62/135 (45%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP--EILRYKAFEPILLLGRHRFAGVDMRIR 301
           GR+KTAVA    + G G + +N   +    P  E LR +  EP+      R    D+ + 
Sbjct: 9   GRRKTAVARVCIRMGNGNVTVNRRDVGAYFPTAEQLR-RVREPLFATANER--RYDVIVN 65

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG   Q  A    IA+ALV       D  ++  ++         LL  D R  E KK
Sbjct: 66  VYGGGLDGQAGACAHGIARALVR-----ADASNQASLRA------GGLLTRDSRMVERKK 114

Query: 482 FGGRGARARFQKSYR 526
           +G RGAR RFQ S R
Sbjct: 115 YGQRGARRRFQFSKR 129



>sp|Q7NRT4|RS9_CHRVO 30S ribosomal protein S9.>gb:AE016923_358657
           Chromobacterium violaceum ATCC 12472 section 14 of 16 of
           the complete genome.>gb:AE016825_1043811 Chromobacterium
           violaceum ATCC 12472 complete genome.
          Length = 130

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 44/134 (32%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA    ++G G I +NG P+ E    E  R    +P+ L         D+++ V
Sbjct: 10  GRRKSSVARVFMQKGSGQIIVNGKPVDEYFARETGRMVIRQPLALT--ENLESFDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  I +AL+ F     D   K  +           +  D R  E KK 
Sbjct: 68  VGGGETGQAGAIRHGITRALIDF-----DAALKSALS------AAGYVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR   Q S R
Sbjct: 117 GLRKARRAKQFSKR 130



>sp|Q81VP8|RS9_BACAN 30S ribosomal protein S9.>gb:AE017024_380439
           Bacillus anthracis str. Ames section 1 of 18 of the
           complete genome.>gb:AE017225_405557 Bacillus anthracis
           str. Sterne, complete genome.>gb:AE017334_450288
           Bacillus anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE016879_1010144 Bacillus anthracis str. Ames
           complete genome.
          Length = 130

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA      G G + ING   E   P   LR    +P  L+        D+ + V
Sbjct: 10  GRRKSSVARVRLVSGEGRVIINGRDFENYIPFAALREVVKQP--LVATETLGNYDVLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+T Q  AIR  I++AL+       D + +  +K         LL  D R  E KK+
Sbjct: 68  NGGGYTGQAGAIRHGISRALLK-----ADPEYRLTLK------RAGLLTRDARMKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G +GAR   Q S R
Sbjct: 117 GLKGARRAPQFSKR 130



>gb:AY673996_1621428 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 137

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL---IQPEILRYKAFEPILLLGRHRFAGVDMRI 298
           GR+KT++A      G G + ING+P E      P  LR  ++ P+ +LG ++    D+ +
Sbjct: 16  GRRKTSIARVKLVPGSGKLIINGLPGESYLQFSPNYLRV-SYSPLKILGLNK--EYDIYV 72

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
           + +GGG T Q  AIR  +A+AL    +   D ++  + +  L R        D R  E K
Sbjct: 73  KTEGGGLTGQANAIRLGLARALC---RMNPDNRTTLKAEGFLTR--------DARIKERK 121

Query: 479 KFGGRGARARFQKSYR 526
           K+G R AR   Q S R
Sbjct: 122 KYGLRKARKAPQYSKR 137



>gb:AE017332_445926 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 132

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 45/134 (33%), Positives = 67/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKING-VPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA    K G G  KIN  V  E ++ +IL   A +P+ +   +  +  ++R+  
Sbjct: 12  GRRKSSVARVTLKHGNGQFKINNRVAKEYLKSDILIKDALQPLSIT--NTVSEFNIRVNA 69

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  IA+AL+   +   D +   ++  +L R        D R  E KKF
Sbjct: 70  HGGGISGQAGAIRLGIARALL---KVSADYRPGLKVAGMLTR--------DARAKERKKF 118

Query: 485 GGRGARARFQKSYR 526
           G R AR   Q S R
Sbjct: 119 GLRKARRARQFSKR 132



>sp|P80374|RS9_THETH 30S ribosomal protein S9.>gb:TTH409331_198486
           Thermus thermophilus rpsI gene for Ribosomal protein
           S9.>gb:AE017304_436734 Thermus thermophilus HB27 section
           4 of 7 of the complete genome.>gb:AE017221_1078712
           Thermus thermophilus HB27 complete genome.
          Length = 128

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 47/137 (34%), Positives = 63/137 (45%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILL---LGRHRFAGVDMR 295
           GR+K AVA    + G G + +NG    E  Q  +    A EP+     LGR      D  
Sbjct: 8   GRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRF-----DAY 62

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           I V+GGG + QI AI+  IA+ALV +   Y     + ++K +        L  D R  E 
Sbjct: 63  ITVRGGGKSGQIDAIKLGIARALVQYNPDY-----RAKLKPL------GFLTRDARVVER 111

Query: 476 KKFGGRGARARFQKSYR 526
           KK+G   AR   Q S R
Sbjct: 112 KKYGKHKARRAPQYSKR 128



>sp|Q927P3|RS9_LISIN 30S ribosomal protein S9.>pir|AC1775|AC1775
           ribosomal protein S9 [imported] - Listeria innocua
           (strain Clip11262)>gb:AE017331_444985 Listeria
           monocytogenes str. 4b F2365, section 10 of 10 of the
           complete genome.>gb:AL596173_540085 Listeria innocua
           Clip11262 complete genome, segment
           11/12.>gb:AE017262_1077341 Listeria monocytogenes str.
           4b F2365, complete genome.
          Length = 130

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA      G G I IN    E   P   LR    +P  L+        D+ + V
Sbjct: 10  GRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALREVIKQP--LVATETLGNYDVLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+T Q  AIR  +A+AL+    +Y     +  +K         LL  DPR  E KK+
Sbjct: 68  HGGGYTGQAGAIRHGVARALLQVAPEY-----RPALK------SAGLLTRDPRMKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G +GAR   Q S R
Sbjct: 117 GLKGARRAPQFSKR 130



>sp|Q81J12|RS9_BACCR 30S ribosomal protein S9.>gb:AE016998_375201
           Bacillus cereus ATCC 14579 section 1 of 18 of the
           complete genome.>gb:AE017264_421379 Bacillus cereus ATCC
           10987, section 1 of 18 of the complete
           genome.>gb:AE017355_461471 Bacillus thuringiensis
           serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_850774 Bacillus cereus ZK, complete
           genome.>gb:AE016877_1015451 Bacillus cereus ATCC 14579
           complete genome.>gb:AE017194_1059798 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 130

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA      G G + ING   E   P   LR    +P  L+        D+ + V
Sbjct: 10  GRRKSSVARVRLVPGEGRVIINGRDFENYIPFAALREVVKQP--LVATETLGNYDVLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+T Q  AIR  I++AL+       D + +  +K         LL  D R  E KK+
Sbjct: 68  NGGGYTGQAGAIRHGISRALLK-----ADPEYRLTLK------RAGLLTRDARMKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G +GAR   Q S R
Sbjct: 117 GLKGARRAPQFSKR 130



>gb:AP008226_578921 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 128

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA    + G G + +NG    E  Q  +    A EP+  +        D  I V
Sbjct: 8   GRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDA--LGHFDAYITV 65

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           +GGG + QI AI+  IA+ALV +   Y     + ++K +        L  D R  E KK+
Sbjct: 66  RGGGKSGQIDAIKLGIARALVQYNPDY-----RAKLKPL------GFLTRDARVVERKKY 114

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 115 GKHKARRAPQYSKR 128



>sp|Q8D362|RS9_WIGBR 30S ribosomal protein S9.>gb:BA000021_686885
           Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis DNA, complete genome.
          Length = 129

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 48/137 (35%), Positives = 65/137 (47%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPE----ILRYKAFEPILLLGRHRFAGVDMR 295
           GR+KTA A    K G+G IKIN + I+    +     L  K  E I +  +     +D+ 
Sbjct: 9   GRRKTASARVFIKIGKGKIKINYIDIKKYFNQKTYITLIKKPLEIINMTDK-----LDIF 63

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           I VKGGG + Q  AIR  IA+AL+ +     D   K  ++      D   +  D R  E 
Sbjct: 64  ITVKGGGISGQAGAIRHGIARALIKY-----DSSLKTTLR------DSGFITRDSRCVER 112

Query: 476 KKFGGRGARARFQKSYR 526
           KK G + AR R Q S R
Sbjct: 113 KKVGFKKARRRPQFSKR 129



>sp|P51291|RR9_PORPU Chloroplast 30S ribosomal protein
           S9.>pir|S73212|S73212 ribosomal protein S9, chloroplast
           - red alga (Porphyra purpurea)
           chloroplast>gb:PPU38804_1701607 Porphyra purpurea
           chloroplast, complete genome.
          Length = 137

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 43/136 (31%), Positives = 66/136 (48%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL---IQPEILRYKAFEPILLLGRHRFAGVDMRI 298
           GR+K +VA      G G + ING+P E      P  LR  ++ P+ +LG       D+ +
Sbjct: 16  GRRKCSVAQVRLVPGSGNLVINGIPGESYLQFSPNYLRV-SYAPLQVLGL--LNQYDIHV 72

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
             +GGG T Q  AIR  +A+AL +     ++ +++  +K          L  DP+  E K
Sbjct: 73  NARGGGLTGQADAIRLGVARALCS-----INPENRSALK------SEGYLTRDPKVKERK 121

Query: 479 KFGGRGARARFQKSYR 526
           K+G + AR   Q S R
Sbjct: 122 KYGLKKARKAPQFSKR 137



>sp|Q92QR5|RS9_RHIME 30S ribosomal protein S9.>gb:SME591786_185260
           Sinorhizobium meliloti 1021 complete chromosome; segment
           5/12.
          Length = 155

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 50/157 (31%), Positives = 68/157 (43%), Gaps = 9/157 (5%)
 Frame = +2

Query: 83  TTRMAAAPVESVQ--------CFGRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRY 235
           TT   AAPV   +          G++K AVA    K G G I ING P  +     +L+ 
Sbjct: 12  TTAEPAAPVHVKKVDAQGRSYATGKRKDAVARVWIKAGSGKITINGKPFSDYFARPVLQM 71

Query: 236 KAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIK 415
              +P++   R      D+   V GGG + Q  A+R  I+KAL  F         +  ++
Sbjct: 72  ILQQPVVAAARD--GQFDIDATVAGGGLSGQAGAVRHGISKALTYF---------EPGLR 120

Query: 416 DILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
            +L R     L  D R  E KK+G   AR  FQ S R
Sbjct: 121 PVLKR--GGFLTRDSRVVERKKYGRAKARRSFQFSKR 155



>sp|Q9JQZ9|RS9_NEIMA 30S ribosomal protein S9.>pir|A81012|A81012 30S
           ribosomal protein S9 NMB2056 [imported] - Neisseria
           meningitidis (strain MC58 serogroup B, strain Z2491
           serogroup A)>gb:AE002555_47432 Neisseria meningitidis
           serogroup B strain MC58 section 197 of 206 of the
           complete genome.>gb:NMA2Z2491_153334 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 2/7.>gb:AE002098_897545 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 130

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 44/134 (32%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA     +G G I +NG P+ E    E  R    +P++L         D+++ V
Sbjct: 10  GRRKSSVARVFLIKGTGQIIVNGRPVDEFFARETSRMVVRQPLVLT--ENAESFDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  I +AL+ F     D   K  +           +  D R  E KK 
Sbjct: 68  VGGGETGQSGAIRHGITRALIDF-----DAALKPALS------QAGFVTRDAREVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G R AR   Q S R
Sbjct: 117 GLRKARRAKQFSKR 130



>sp|P07842|RS9_BACST 30S ribosomal protein S9
           (BS10).>pir|S08564|R3BS9 ribosomal protein S9 - Bacillus
           stearothermophilus
          Length = 129

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 47/134 (35%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA      G G I +N   I E I  E L     +P++L         D+ + V
Sbjct: 9   GRRKSSVARVRLVPGDGRIIVNKQDIREYIPTEALIEMVKQPLVLT--ETLGSYDVLVNV 66

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG   Q  AIR  IA+AL+         Q   E + +L R    LL  D R  E KK+
Sbjct: 67  HGGGFAGQAGAIRHGIARALL---------QVDPEFRTVLKR--AGLLTRDARVKERKKY 115

Query: 485 GGRGARARFQKSYR 526
           G +GAR   Q S R
Sbjct: 116 GLKGARRAPQFSKR 129



>sp|Q9KGD4|RS9_BACHD 30S ribosomal protein S9.>pir|A83671|A83671
           ribosomal protein S9 (BS10) rpsI [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_654115 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 130

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K +VA      G G I ING  + E    E L+    +P++  G       D+R+ V
Sbjct: 10  GRRKHSVARVRLVPGDGNIVINGRSLDEYFGLETLKLIVKQPLVETGTE--GQYDVRVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+AL+      VD + +  +K          L  D R  E KK+
Sbjct: 68  DGGGFTGQAGAIRHGIARALL-----QVDPEYRPSLK------SAGFLTRDARMKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKAARRAPQFSKR 130



>gb:AP006628_566574 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 130

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K+AVA      G G I IN    E   P    R +  +P+ L  +      D+ + V
Sbjct: 10  GRRKSAVARVILTNGTGKITINTRDFEKYLPLPATRLEMIQPLELTEKRE--AFDVSVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG ++Q  AIR  IA+AL+         +S  E++ IL +    LL  D R  E KK+
Sbjct: 68  NGGGLSAQAGAIRLGIARALI---------ESVPELRAILKK--AGLLTRDARCVERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARRAPQFSKR 130



>sp|Q9PD43|RS9_XYLFA 30S ribosomal protein S9.>pir|E82669|E82669 30S
           ribosomal protein S9 XF1536 [imported] - Xylella
           fastidiosa (strain 9a5c)>gb:AE003983_49174 Xylella
           fastidiosa 9a5c, section 129 of 229 of the complete
           genome.>gb:AE003849_1116384 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 130

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 45/134 (33%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    ++G G I +NG P+ E    E  R    +P+ L      A  D+ I  
Sbjct: 10  GRRKSSKARIFLRKGSGNITVNGRPLDEFFGRETARMIVRQPLELT--KNVANFDILITA 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+ALV +     D   K E++          +  D R  E KK 
Sbjct: 68  TGGGTTGQAGAIRLGIARALVEY-----DASLKPELR------KAGFMTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 117 GLHKARRATQFSKR 130



>gb:BA000043_736717 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 130

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 46/134 (34%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA      G G I +N   I E I  E L     +P++L         D+ + V
Sbjct: 10  GRRKSSVARVRLVPGDGRIIVNKRDIREYIPTEALIEMVKQPLVLT--ETLGSYDVLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           +GGG   Q  AIR  IA+AL+         +   E + +L R    LL  D R  E KK+
Sbjct: 68  QGGGFAGQAGAIRHGIARALL---------EVDPEFRTVLKR--AGLLTRDARVKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G +GAR   Q S R
Sbjct: 117 GLKGARRAPQFSKR 130



>gb:AY773199_2148681 Synthetic construct 30S ribosomal RNA protein
           operon, complete sequence.
          Length = 157

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+       +D+ I V
Sbjct: 34  GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDM--VEKLDLYITV 91

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 92  KGGGISGQAGAIRHGITRALMEY-----DESLRSELR------KAGFVTRDARQVERKKV 140

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 141 GLRKARRRPQFSKR 154



>gb:BX572601_802382 Rhodopseudomonas palustris CGA009 complete
           genome; segment 9/16.
          Length = 160

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/135 (33%), Positives = 63/135 (46%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAG-VDMRIR 301
           G++K AVA    K G G I +N   +E      +LR    +P++   R   AG  D+   
Sbjct: 40  GKRKDAVARVWIKPGAGKITVNSREVETYFARPVLRMMIQQPLVAAAR---AGQYDVICT 96

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG + Q  A+R  I+KAL  F         + E++ +L +     L  D R  E KK
Sbjct: 97  VAGGGLSGQAGAVRHGISKALTNF---------EPELRSVLKK--GGFLTRDSRVVERKK 145

Query: 482 FGGRGARARFQKSYR 526
           +G   AR  FQ S R
Sbjct: 146 YGKAKARRSFQFSKR 160



>gb:CR378673_96519 Photobacterium profundum SS9; segment 11/12.
          Length = 135

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E+    E  R    +P++LL        D+ I V
Sbjct: 15  GRRKSSAARVFIKPGTGKIVINKRSLEVYFGRETARMVVNQPLVLLDM--VDKFDLNITV 72

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG T Q  AIR  I +AL+ +     DE  +  ++          +  D R+ E KK 
Sbjct: 73  KGGGITGQSGAIRHGITRALMEY-----DETLRPTLR------SAGYVTRDARKVERKKV 121

Query: 485 GGRGARARFQKSYR 526
           G R AR + Q S R
Sbjct: 122 GLRKARRKPQFSKR 135



>pir|H65114|R3EC9 ribosomal protein S9 [validated] - Escherichia
           coli (strain K-12)>pir|G91141|G91141 ribosomal protein
           S9 [similarity] - Escherichia coli (strain O157:H7,
           substrain RIMD 0509952)>pir|B85987|B85987 ribosomal
           protein S9 [similarity] - Escherichia coli (strain
           O157:H7, substrain EDL933)>gb:AE005174_68357 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:ECOUW67_130792
           Escherichia coli K-12 chromosomal region from 67.4 to
           76.0 minutes.>gb:ECRPSI_132592 E. coli genes rpsI and
           rplM for ribosomal proteins S9 and L13.>gb:U00096_202239
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE016767_327962 Escherichia coli CFT073
           section 13 of 18 of the complete
           genome.>gb:AE016989_372992 Shigella flexneri 2a str.
           2457T section 12 of 16 of the complete
           genome.>gb:BA000007_662115 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_958546 Escherichia coli
           CFT073 complete genome.>gb:AE014073_997742 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 130

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+       +D+ I V
Sbjct: 10  GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDM--VEKLDLYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALMEY-----DESLRSELR------KAGFVTRDARQVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRPQFSKR 130



>sp|Q7N079|RS9_PHOLL 30S ribosomal protein S9.>gb:BX571872_788869
           Photorhabdus luminescens subsp. laumondii TTO1 complete
           genome; segment 14/17.
          Length = 130

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/134 (33%), Positives = 64/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E+    E  R    +P+ L+       +D+ I V
Sbjct: 10  GRRKSSSARVFIKPGSGNIVINKRSLEVYFGRETARMVVRQPLELVDM--LGKLDLYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+A+     DE  + +++          +  D R  E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALMAY-----DETLRSDLR------KAGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRPQFSKR 130



>sp|P02363|RS9_ECOLI 30S ribosomal protein S9.
          Length = 129

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+       +D+ I V
Sbjct: 9   GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDM--VEKLDLYITV 66

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 67  KGGGISGQAGAIRHGITRALMEY-----DESLRSELR------KAGFVTRDARQVERKKV 115

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 116 GLRKARRRPQFSKR 129



>sp|P59514|RS9_BUCBP 30S ribosomal protein S9.>gb:AE014017_302756
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 2 of 2 of the complete
           genome.>gb:AE016826_981357 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 130

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +         R    +PI  +   +    D+ I V
Sbjct: 10  GRRKSSSARVFLKTGTGNITINNRKLNNYFSRRTARLIILQPIEFVNMSKKC--DLYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q+ AIR  I++AL+ +     D   + E++ +        +  D R+ E KK 
Sbjct: 68  KGGGISGQVGAIRHGISRALIKY-----DSSFRNELRKL------GFITRDSRQVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GFRKARKRPQFSKR 130



>gb:BC088242_2110438 Rattus norvegicus cDNA clone IMAGE:7366193,
           partial cds.
          Length = 338

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 46/130 (35%), Positives = 62/130 (47%), Gaps = 2/130 (1%)
 Frame = +2

Query: 128 GRKKTAVA-VTHCKRGRGLIKINGVPIELIQPEIL-RYKAFEPILLLGRHRFAGVDMRIR 301
           GR+K+A A V   + G G I +NGV   L  P +  R +   P   L R      D+   
Sbjct: 216 GRRKSATARVVVYQHGSGKIHVNGVDYLLYFPILQDREQLMFPFHFLDR--LEKHDVTCT 273

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG ++Q  AIR ++AKAL +F  +   E  ++            LL  DPR  E KK
Sbjct: 274 VSGGGRSAQAGAIRLAMAKALCSFITEDEVEWMRQ----------AGLLTPDPRIRERKK 323

Query: 482 FGGRGARARF 511
            G  GAR +F
Sbjct: 324 PGQEGARRKF 333



>gb:AE013598_297853 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 130

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    ++G G I +N  P+ E    E  R    +P+ L         D+ +  
Sbjct: 10  GRRKSSTARVFLRKGTGKITVNDRPLDEFFGRETARMIVRQPLELTKNTE--SFDILVTA 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+ALV +     DE  K E++          +  D R  E KK 
Sbjct: 68  SGGGTTGQAGAIRLGIARALVEY-----DETLKSELR------KAGFMTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 117 GLHKARRATQFSKR 130



>gb:AE005674_72854 Shigella flexneri 2a str. 301, complete genome.
          Length = 130

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+       +D+ I V
Sbjct: 10  GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPMELVDM--VEKLDLYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALMEY-----DESLRSELR------KAGFVTRDARQVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRPQFSKR 130



>sp|Q8PD66|RS9_XANCP 30S ribosomal protein S9.>gb:AE012145_279751
           Xanthomonas campestris pv. campestris str. ATCC 33913,
           section 53 of 460 of the complete
           genome.>gb:AE008922_913033 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 130

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    ++G G I +N  P+ E    E  R    +P+ L         D+ +  
Sbjct: 10  GRRKSSTARVFLRKGTGNITVNNRPLDEFFGRETARMIVRQPLELTKNTE--SFDILVTA 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+ALV +     DE  K E++          +  D R  E KK 
Sbjct: 68  SGGGTTGQAGAIRLGIARALVEY-----DETLKSELR------KAGFMTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 117 GLHKARRATQFSKR 130



>sp|Q8PQ41|RS9_XANAC 30S ribosomal protein S9.>gb:AE011675_275450
           Xanthomonas axonopodis pv. citri str. 306, section 53 of
           469 of the complete genome.>gb:AE008923_917225
           Xanthomonas axonopodis pv. citri str. 306, complete
           genome.
          Length = 130

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    ++G G I +N  P+ E    E  R    +P+ L         D+ +  
Sbjct: 10  GRRKSSTARVFLRKGTGNITVNDRPLDEFFGRETARMIVRQPLELTKNTE--SFDIMVTA 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+ALV +     DE  K E++          +  D R  E KK 
Sbjct: 68  SGGGTTGQAGAIRLGIARALVEY-----DETLKSELR------KAGFMTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 117 GLHKARRATQFSKR 130



>sp|Q83Q07|RS9_SHIFL 30S ribosomal protein S9.
          Length = 129

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+       +D+ I V
Sbjct: 9   GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPMELVDM--VEKLDLYITV 66

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 67  KGGGISGQAGAIRHGITRALMEY-----DESLRSELR------KAGFVTRDARQVERKKV 115

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 116 GLRKARRRPQFSKR 129



>sp|Q8EAG3|RS9_SHEON 30S ribosomal protein S9.>gb:AE015825_318253
           Shewanella oneidensis MR-1 section 374 of 457 of the
           complete genome.>gb:AE014299_953850 Shewanella
           oneidensis MR-1 complete genome.
          Length = 130

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KT+ A    K G G I +N  P++     E  R    +P+ L+       +D+ + V
Sbjct: 10  GRRKTSTARVFAKAGSGNIVVNQRPLDQYFGRETARMVVRQPLELV--EMTDKLDIYVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG T Q  AIR  I +AL+      +DE  +  ++          +  D R+ E KK 
Sbjct: 68  KGGGITGQAGAIRHGITRALM-----QLDEALRPSLR------SAGFVTRDARKVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR + Q S R
Sbjct: 117 GLRKARRKPQFSKR 130



>sp|Q890R7|RS9_CLOTE 30S ribosomal protein S9.>gb:AE015945_321590
           Clostridium tetani E88, section 10 of 10 of the complete
           genome.>gb:AE015927_964379 Clostridium tetani E88,
           complete genome.
          Length = 130

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 46/135 (34%), Positives = 64/135 (47%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLG-RHRFAGVDMRIR 301
           GR+K ++A      G G + IN    E     E LR    +P++L G + +F   D+ + 
Sbjct: 10  GRRKKSIARVRLVPGEGKVLINKRDEEEYFGLETLRVIVNQPLVLTGTKDKF---DVLVN 66

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG T Q  AIR  I++AL+       DE  + E+K          L  DPR  E KK
Sbjct: 67  VYGGGLTGQAGAIRHGISRALLK-----ADESLRPELK------KAGFLTRDPRMKERKK 115

Query: 482 FGGRGARARFQKSYR 526
           +G + AR   Q S R
Sbjct: 116 YGLKKARRAPQFSKR 130



>gb:CP000010_866515 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 130

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 42/134 (31%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K+AVA    K G+G I +NG PI +    E       +P+ L    +    D+++ V
Sbjct: 10  GRRKSAVARVFIKAGKGDIVVNGKPISDYFSRETSLMIVRQPLELTNHAQT--FDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  A+R  I +AL+ +     D   K  +       +   +  D R  E KK 
Sbjct: 68  SGGGETGQAGAVRHGITRALIDY-----DATLKPALS------NAGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 117 GLHKARRAKQFSKR 130



>gb:BX897700_828894 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 161

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 45/134 (33%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           G++K AVA    K G G I IN    +      +LR    +PI+ + R      D+   V
Sbjct: 41  GKRKGAVARVWLKPGFGKITINNKEFDKYFARPVLRMILRQPIVAINRD--TQFDIIATV 98

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A+R  I+KAL  +         + E + IL +  R  L  D R  E KK+
Sbjct: 99  TGGGLSGQAGAVRHGISKALTYY---------EPEFRTILKK--RGFLTRDSRVVERKKY 147

Query: 485 GGRGARARFQKSYR 526
           G   AR  FQ S R
Sbjct: 148 GKAKARRSFQFSKR 161



>gb:BX571965_792708 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 130

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 42/134 (31%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K+AVA    K G+G I +NG PI +    E       +P+ L    +    D+++ V
Sbjct: 10  GRRKSAVARVFIKAGKGDIVVNGKPISDYFSRETSLMIVRQPLELTNHAQT--FDIKVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  A+R  I +AL+ +        SK              +  D R  E KK 
Sbjct: 68  SGGGETGQAGAVRHGITRALIDYDATLKPALSK-----------AGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR   Q S R
Sbjct: 117 GLHKARRAKQFSKR 130



>gb:AE017180_401164 Geobacter sulfurreducens PCA, complete genome.
          Length = 130

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           G++K++VA    K G G I IN  PI E    E  +    +P+ L+   +    D+ + V
Sbjct: 10  GKRKSSVARVWLKPGTGAIVINNKPIDEYFGRETSKMIVKQPLELV--EKVGAFDIYVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           +GGG + Q  AI+  I KAL+      VD   +  +K          +  D R  E KK+
Sbjct: 68  RGGGDSGQAGAIKHGITKALLE-----VDVALRGTLK------KAGFITRDSRIKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G R AR   Q S R
Sbjct: 117 GKRAARRSCQFSKR 130



>gb:AE013614_298469 Yersinia pestis KIM section 14 of 415 of the
           complete genome.>gb:AE017141_389541 Yersinia pestis
           biovar Medievalis str. 91001 section 15 of 16 of the
           complete genome.>gb:AE009952_928652 Yersinia pestis KIM
           complete genome.>gb:AE017042_1146107 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 132

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E+    E  R    +P+ L+        DM I V
Sbjct: 12  GRRKSSSARVFLKPGSGKIVINQRSLEVYFGRETARMVVNQPLELVDM--VTKFDMYITV 69

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R  E KK 
Sbjct: 70  KGGGISGQAGAIRHGITRALMEY-----DESLRGELR------KAGFVTRDAREVERKKV 118

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 119 GLRKARRRPQFSKR 132



>gb:CR543861_104814 Acinetobacter sp. ADP1 complete genome.
          Length = 128

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 48/135 (35%), Positives = 60/135 (44%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLG-RHRFAGVDMRIR 301
           GR+KTA A      G G + IN   +E     E  R    +P+ LL    +F   D+ I 
Sbjct: 8   GRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMVVRQPLELLEVTEKF---DLYIT 64

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           VKGGG   Q  AIR  I +AL+A      DE  K  ++          +  D R  E KK
Sbjct: 65  VKGGGIGGQAGAIRHGITRALIA-----ADETLKPVLR------QAGFVTRDAREVERKK 113

Query: 482 FGGRGARARFQKSYR 526
            G R AR R Q S R
Sbjct: 114 LGLRKARKRPQFSKR 128



>pir|AF0908|AF0908 ribosomal protein S9 [similarity] - Salmonella
           enterica subsp. enterica serovar Typhi (strain
           CT18)>gb:CP000026_77919 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008854_244985 Salmonella typhimurium LT2,
           section 158 of 220 of the complete
           genome.>gb:AE016845_347251 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 12 of 16 of the
           complete genome.>gb:AL627278_543582 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 14/20.>gb:AE014613_984583 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1002067 Salmonella typhimurium LT2,
           complete genome.
          Length = 130

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+       +D+ I V
Sbjct: 10  GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDM--VEKLDLYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALMEY-----DESLRGELR------KAGFVTRDARQVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRPQFSKR 130



>sp|Q8ZB62|RS9_YERPE 30S ribosomal protein S9.>pir|AC0433|AC0433
           ribosomal protein S9 [similarity] - Yersinia pestis
           (strain CO92)>gb:AJ414157_525320 Yersinia pestis strain
           CO92 complete genome; segment 17/20.>gb:BX936398_838150
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.
          Length = 130

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E+    E  R    +P+ L+        DM I V
Sbjct: 10  GRRKSSSARVFLKPGSGKIVINQRSLEVYFGRETARMVVNQPLELVDM--VTKFDMYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R  E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALMEY-----DESLRGELR------KAGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRPQFSKR 130



>sp|Q8XFX5|RS9_SALTY 30S ribosomal protein S9.
          Length = 129

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 45/134 (33%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+       +D+ I V
Sbjct: 9   GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDM--VEKLDLYITV 66

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 67  KGGGISGQAGAIRHGITRALMEY-----DESLRGELR------KAGFVTRDARQVERKKV 115

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 116 GLRKARRRPQFSKR 129



>sp|Q9RXY0|RS9_DEIRA 30S ribosomal protein S9.>pir|F75552|F75552
           ribosomal protein S9 - Deinococcus radiodurans (strain
           R1)>gb:AE001879_40460 Deinococcus radiodurans R1 section
           16 of 229 of the complete chromosome
           1.>gb:AE000513_881355 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 133

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 48/149 (32%), Positives = 65/149 (43%), Gaps = 4/149 (2%)
 Frame = +2

Query: 92  MAAAPVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILR----YKAFEPILL 259
           MA    E     GR+K AVA    + G G I +NG   +     +LR     + F     
Sbjct: 1   MAIQQPEQYYGTGRRKAAVARVFLRPGEGKIVVNGKEFQTYFRGLLRAVNALQGFRETGT 60

Query: 260 LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR 439
            GR      D  I V GGG + Q  AI+  IA+AL+      V+   + ++K       +
Sbjct: 61  AGR-----FDAVITVTGGGPSGQADAIKLGIARALLK-----VNPDFRAQMK------PK 104

Query: 440 TLLVADPRRCEPKKFGGRGARARFQKSYR 526
            LL  DPR  E KK+G + AR   Q S R
Sbjct: 105 GLLTRDPREVERKKYGLKKARRAPQFSKR 133



>gb:CR628336_112878 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_115839 Legionella pneumophila str.
           Lens complete genome.>gb:AE017354_461050 Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1,
           complete genome.
          Length = 143

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 45/138 (32%), Positives = 68/138 (49%), Gaps = 5/138 (3%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPE---ILRYKAFEPILLLGRHRFAGVDMR 295
           GR+K+++A    + G+G IK+N   + E    E   ++  +  E + LL +      D+ 
Sbjct: 11  GRRKSSIARVFLRPGKGDIKVNDRTLQEYFCRETSCMIVMQPLETVDLLNKF-----DVY 65

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRY-DRTLLVADPRRCE 472
           I V GGG + Q  A+R  IA+ALVA+ +  + E ++        +   R LL  D RR E
Sbjct: 66  ITVTGGGISGQAGAVRLGIARALVAYDEDGLAEGAEPSPDSFRRKLRARGLLTRDSRRVE 125

Query: 473 PKKFGGRGARARFQKSYR 526
            KK G   AR   Q S R
Sbjct: 126 RKKVGLHKARRATQYSKR 143



>sp|Q9A8H6|RS9_CAUCR 30S ribosomal protein S9.>pir|B87420|B87420
           ribosomal protein S9 [imported] - Caulobacter
           crescentus>gb:AE005812_212521 Caulobacter crescentus
           CB15 section 138 of 359 of the complete
           genome.>gb:AE005673_922420 Caulobacter crescentus CB15
           complete genome.
          Length = 157

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 47/152 (30%), Positives = 66/152 (43%), Gaps = 8/152 (5%)
 Frame = +2

Query: 95  AAAPVES-------VQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEP 250
           AAAP E            G++K A+A    K G+G I ING   E+     +LR    +P
Sbjct: 19  AAAPAEPKIDAQGRAYATGKRKNAIARVWIKPGKGSITINGRDQEVYFARPVLRMMIAQP 78

Query: 251 ILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVR 430
           + +  R      D+ + V+G G + Q  AIR  ++KAL      Y +   +  +K     
Sbjct: 79  LEVTDR--LGQFDVVVTVEGSGLSGQAGAIRHGLSKALT-----YYEPGLRPVLK----- 126

Query: 431 YDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
                L  D R  E KK+G   AR  FQ S R
Sbjct: 127 -PHGFLTRDSRVVERKKYGKAKARRSFQFSKR 157



>sp|Q89KE5|RS9_BRAJA 30S ribosomal protein S9.>gb:BA000040_733222
           Bradyrhizobium japonicum USDA 110 DNA, complete genome.
          Length = 159

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 42/134 (31%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           G++K AVA    K G G + +N   +E+     +LR    +P  +    R    D+   V
Sbjct: 39  GKRKDAVARVWIKPGAGKVTVNSREVEVYFARPVLRMMIEQPFSVA--QRSGQYDVICTV 96

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A+R  I+KAL  F         + E++ +L +     L  D R  E KK+
Sbjct: 97  AGGGLSGQAGAVRHGISKALTYF---------EPELRTVLKK--GGFLTRDSRVVERKKY 145

Query: 485 GGRGARARFQKSYR 526
           G   AR  FQ S R
Sbjct: 146 GKAKARRSFQFSKR 159



>gb:BX950851_839064 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 130

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E     E  R    +P+ L+        D+ I V
Sbjct: 10  GRRKSSAARVFIKPGSGNIVINQRSLEQYFGRETARMVVRQPLELVDM--VGKFDLYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  + E++          +  D R+ E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALMEY-----DESLRGELR------KAGFVTRDARQVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRPQFSKR 130



>gb:AP006618_557261 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 167

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 43/137 (31%), Positives = 61/137 (44%)
 Frame = +2

Query: 116 VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           VQ  GR+K AV       G G   +NG  IE   P  +  +  +  L+    R    D+ 
Sbjct: 43  VQTVGRRKEAVVRVRLVPGTGQFVLNGRSIEDYFPNKVHQQLVKSPLVTVE-RTESFDIH 101

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
            R+ GGG + Q  A+R +IA+AL+      V  + +  +K          L  DPR  E 
Sbjct: 102 ARLVGGGPSGQAGALRLAIARALIE-----VTPEDRPALKRA------GFLTRDPRATER 150

Query: 476 KKFGGRGARARFQKSYR 526
           KK+G + AR   Q S R
Sbjct: 151 KKYGLKKARKAPQYSKR 167



>gb:AP006627_562511 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 130

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K +VA      G G I +NG  + E    E L+    +P++  G       D+ + V
Sbjct: 10  GRRKHSVARVRLIPGEGKIVVNGRDLDEYFGLETLKLIVKQPLVETGVT--GQYDVHVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+AL+      VD  ++  +K          L  D R  E KK+
Sbjct: 68  NGGGFTGQAGAIRHGIARALL-----QVDPDNRATLK------AAGFLTRDARMKERKKY 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKAARRAPQFSKR 130



>gb:CP000046_92295 Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000033_712428 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome, strain:MW2.
          Length = 132

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 45/139 (32%), Positives = 60/139 (43%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF------AGVD 289
           GR+K +VA      G G I +N         ++  Y  FE ++L     F         D
Sbjct: 12  GRRKNSVARVRLVPGEGNITVNN-------RDVREYLPFESLILDLNQPFDVTETKGNYD 64

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           + + V GGG T Q  AIR  IA+AL+         ++  E +  L R    LL  DPR  
Sbjct: 65  VLVNVHGGGFTGQAQAIRHGIARALL---------EADPEYRGSLKR--AGLLTRDPRMK 113

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK G + AR   Q S R
Sbjct: 114 ERKKPGLKAARRSPQFSKR 132



>sp|Q83IA3|RS9_TROW8 30S ribosomal protein S9.>sp|Q83GU6|RS9_TROWT
           30S ribosomal protein S9.>gb:AE016850_348669 Tropheryma
           whipplei str. Twist, section 1 of 3 of the complete
           genome.>gb:BX251410_764361 Tropheryma whipplei TW08/27,
           complete genome; segment 1/3.>gb:AE014184_1028865
           Tropheryma whipplei str. Twist, complete genome.
          Length = 154

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 48/164 (29%), Positives = 71/164 (43%), Gaps = 11/164 (6%)
 Frame = +2

Query: 68  PRQRRTTRMAAAP----------VESVQCFGRKKTAVAVTHCKRGRGLIKINGVPI-ELI 214
           P QR     ++AP          V S    GR+K+A A  +   G G+  +NG  I E  
Sbjct: 3   PPQRAKNDTSSAPDSAAETRGPLVSSGSGLGRRKSATARVYLSPGEGVFVVNGRDINEYF 62

Query: 215 QPEILRYKAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDE 394
             ++ R  A +P+ +L        D+++ + GGG + Q  A+R  IA+AL         E
Sbjct: 63  TSKLHRQFACQPLKILDL--LGSYDVKVTLHGGGASGQAGAVRLGIARAL----NTIDPE 116

Query: 395 QSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
            ++K +K          L  D R  E KK G + AR   Q S R
Sbjct: 117 NNRKPLK------SAGFLTRDSRVKERKKAGLKKARKAPQYSKR 154



>sp|Q99S52|RS9_STAAM 30S ribosomal protein S9.>pir|D90018|D90018
           ribosomal protein S9 [similarity] - Staphylococcus
           aureus  (strain N315)>gb:BA000017_677902 Staphylococcus
           aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_680491 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BX571856_781725 Staphylococcus aureus subsp.
           aureus strain MRSA252, complete
           genome.>gb:BX571857_784339 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 130

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 45/139 (32%), Positives = 60/139 (43%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF------AGVD 289
           GR+K +VA      G G I +N         ++  Y  FE ++L     F         D
Sbjct: 10  GRRKNSVARVRLVPGEGNITVNN-------RDVREYLPFESLILDLNQPFDVTETKGNYD 62

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           + + V GGG T Q  AIR  IA+AL+         ++  E +  L R    LL  DPR  
Sbjct: 63  VLVNVHGGGFTGQAQAIRHGIARALL---------EADPEYRGSLKR--AGLLTRDPRMK 111

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK G + AR   Q S R
Sbjct: 112 ERKKPGLKAARRSPQFSKR 130



>sp|Q7UZW9|RS9_PROMP 30S ribosomal protein S9.>gb:BX572094_797157
           Prochlorococcus marinus MED4 complete genome; segment
           5/5.
          Length = 136

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 47/137 (34%), Positives = 62/137 (45%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVP----IELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           GR+KT+VA      G G IKING      +      +   KA  P+L LG       D+ 
Sbjct: 15  GRRKTSVARVRLIPGNGQIKINGRSGDDYLNFNPSHLNSVKA--PLLTLGLEN--SYDIF 70

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           + V GGG T Q  AI+Q  A+AL       +   ++K +K          L  DPR  E 
Sbjct: 71  VNVFGGGLTGQADAIKQGAARALCG-----LSPDNRKPLK------TEGHLSRDPRSKER 119

Query: 476 KKFGGRGARARFQKSYR 526
           KK+G + AR   Q S R
Sbjct: 120 KKYGLKKARKAGQFSKR 136



>gb:CP000023_874071 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_875958 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 130

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 45/134 (33%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I +N   +E   P   LR    +P  +         D+ + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITVNKKDLEEYIPHADLRLVINQPFAVTSTE--GSYDVHVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+  Q  AIR  IA+AL+         Q   + +D L R    LL  D R  E KK 
Sbjct: 68  VGGGYAGQSGAIRHGIARALL---------QVDPDFRDSLKR--AGLLTRDARMVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>gb:BX897699_827400 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 161

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 44/134 (32%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           G++K AVA    K G G I IN    +      +LR    +PI+   R      D+   V
Sbjct: 41  GKRKDAVARVWIKPGSGKITINNKEFDKYFARPVLRMILRQPIVATNRD--TQFDIIATV 98

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A+R  I+KAL  +         + E++ IL +     L  D R  E KK+
Sbjct: 99  AGGGLSGQAGAVRHGISKALTYY---------EPELRTILKK--GGFLTRDSRVVERKKY 147

Query: 485 GGRGARARFQKSYR 526
           G   AR  FQ S R
Sbjct: 148 GKAKARRSFQFSKR 161



>sp|Q8CWU4|RS9_STRR6 30S ribosomal protein S9.>pir|H97905|H97905 30S
           ribosomal protein S9 [imported] - Streptococcus
           pneumoniae (strain R6)>gb:AE008408_236593 Streptococcus
           pneumoniae R6 section 24 of 184 of the complete
           genome.>gb:AE007317_942751 Streptococcus pneumoniae R6,
           complete genome.
          Length = 130

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 45/134 (33%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I +N   +E   P   LR    +P  +         D+ + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTST--VGSYDVFVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+  Q  AIR  IA+AL+         Q   + +D L R    LL  D R+ E KK 
Sbjct: 68  VGGGYAGQSGAIRHGIARALL---------QVDPDFRDSLKR--AGLLTRDSRKVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>gb:AP006840_570227 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 128

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 42/134 (31%), Positives = 61/134 (45%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KTA+A      G G   +NG  + E    + L+     P  + G       D+ + V
Sbjct: 8   GRRKTAIARARLLPGTGNFVVNGRTLQEYFGLQTLQMMVESPFTVTGTT--GKFDVYLNV 65

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A R +IA+ALV +     D + +  +K          L  DPR  E +K+
Sbjct: 66  IGGGISGQAGACRHAIARALVKY-----DPELRPALK------QAGFLTRDPRMKERRKY 114

Query: 485 GGRGARARFQKSYR 526
           G + AR R Q S R
Sbjct: 115 GLKKARKRPQFSKR 128



>gb:CP000031_85729 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 160

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 47/139 (33%), Positives = 62/139 (44%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF--AGV----D 289
           G++K AVA    K G G + +NG   +        Y A   + L+ R  F  AGV    D
Sbjct: 40  GKRKDAVARVWIKPGSGKVVVNGKDQDA-------YFARPVLQLILRQPFQVAGVEGQFD 92

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   VKGGG T Q  A++  I+KAL  +     D   +  +K          L  D R  
Sbjct: 93  VMATVKGGGLTGQAGAVKHGISKALQLY-----DPSLRGALK------AAGFLTRDSRVV 141

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK+G R AR  FQ S R
Sbjct: 142 ERKKYGKRKARRSFQFSKR 160



>sp|Q97SN4|RS9_STRPN 30S ribosomal protein S9.>pir|H95034|H95034
           ribosomal protein S9 [imported] - Streptococcus
           pneumoniae  (strain TIGR4)>gb:AE007342_225534
           Streptococcus pneumoniae TIGR4 section 25 of 194 of the
           complete genome.>gb:AE005672_1103302 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 130

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 45/134 (33%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I +N   +E   P   LR    +P  +         D+ + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTST--VGSYDVFVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+  Q  AIR  IA+AL+         Q   + +D L R    LL  D R+ E KK 
Sbjct: 68  IGGGYAGQSGAIRHGIARALL---------QVDPDFRDSLKR--AGLLTRDSRKVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>sp|Q8CRJ0|RS9_STAEP 30S ribosomal protein S9.>gb:CP000029_82389
           Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016750_323440 Staphylococcus epidermidis
           ATCC 12228, section 7 of 9 of the complete
           genome.>gb:AE015929_1148109 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 130

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 45/139 (32%), Positives = 61/139 (43%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRF------AGVD 289
           GR+K +VA      G G I +N       + ++  Y  FE ++L     F         D
Sbjct: 10  GRRKNSVARVRLVPGEGNITVN-------ERDVRDYLPFESLILDLNQPFDVTETKGNYD 62

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           + + V GGG T Q  AIR  IA+AL+         ++  E +  L R    LL  DPR  
Sbjct: 63  VLVNVHGGGFTGQAQAIRHGIARALL---------EADPEYRGSLKR--AGLLTRDPRMK 111

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK G + AR   Q S R
Sbjct: 112 ERKKPGLKKARRSPQFSKR 130



>sp|Q8EWW8|RS9_MYCPE 30S ribosomal protein S9.>gb:BA000026_693432
           Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 130

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 40/126 (31%), Positives = 60/126 (47%), Gaps = 1/126 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKING-VPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA      G G I IN   P E     ++     +P+++    +    D+ ++V
Sbjct: 10  GRRKSSVAHVKLVPGTGKILINQRKPNEYFPNSLVIQDMEQPLVITDTRK--NFDVFVKV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  IA+AL+       +   +K +K         +L  DPR  E KK+
Sbjct: 68  VGGGFTGQAGAIRLGIARALLV-----ANNDFRKTLK------VSKMLTRDPRAKERKKY 116

Query: 485 GGRGAR 502
           G  GAR
Sbjct: 117 GLYGAR 122



>gb:AE017333_446104 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_855926 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 130

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 47/135 (34%), Positives = 63/135 (46%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGV-DMRIR 301
           GR+K++VA      G G I +N   I E I    L     +P+ L      AG  D+ + 
Sbjct: 10  GRRKSSVARVRLVPGEGRIIVNNREISEHIPSAALIEDIKQPLTLT---ETAGTYDVLVN 66

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG + Q  AIR  IA+AL+         ++  E +  L R    LL  D R  E KK
Sbjct: 67  VHGGGFSGQAGAIRHGIARALL---------EADPEYRSTLKR--AGLLTRDARMKERKK 115

Query: 482 FGGRGARARFQKSYR 526
           +G +GAR   Q S R
Sbjct: 116 YGLKGARRAPQFSKR 130



>gb:AE017242_414951 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 16 of 16 of the complete
           genome.>gb:AE016958_1058355 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 166

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 45/149 (30%), Positives = 64/149 (42%), Gaps = 6/149 (4%)
 Frame = +2

Query: 98  AAPVES------VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILL 259
           A P ES      +Q  GR+K AV       G G   +NG  +E   P  +  +  +  L+
Sbjct: 30  AVPAESYVFERPIQTVGRRKEAVVRVRLVPGTGKFNLNGRTLEGYFPNKVHQQLVKAPLV 89

Query: 260 LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR 439
               R  G D+   + GGG + Q  A+R  IA+AL+       D++   +    L R   
Sbjct: 90  TV-DRVDGFDIYAHLHGGGPSGQAGALRLGIARALILASP---DDRPALKKAGFLTR--- 142

Query: 440 TLLVADPRRCEPKKFGGRGARARFQKSYR 526
                DPR  E KK+G + AR   Q S R
Sbjct: 143 -----DPRATERKKYGLKKARKAPQYSKR 166



>sp|Q8XHV7|RS9_CLOPE 30S ribosomal protein S9.>gb:BA000016_675409
           Clostridium perfringens str. 13 DNA, complete genome.
          Length = 130

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 44/134 (32%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K +VA      G G + +N   IE     E LR    +P++L         D+ + V
Sbjct: 10  GRRKKSVARVRLVPGEGRVIVNNREIETYFGLETLRVVVNQPLVLTETKD--KYDVLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  I++AL+       DE  + E+K          L  DPR  E KK 
Sbjct: 68  HGGGLSGQAGAIRHGISRALLK-----ADENLRPELK------KAGFLTRDPRMVERKKC 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARRSPQFSKR 130



>gb:AE017282_427687 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 130

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELI----QPEILRYKAFEPILLLGRHRFAGVDMR 295
           GR+K+A+A  + + G G I+IN   +E         ++  +A E + +  +     +D+ 
Sbjct: 10  GRRKSAIARVYTRTGTGQIRINDKSLEEYFGRKTDRMIVMQALEAVEMTDK-----LDVN 64

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           ++V GGG + Q  AIR  +A+AL+      +DE  +  ++          +  D R  E 
Sbjct: 65  VKVIGGGPSGQAGAIRHGLARALIE-----LDEAMRPVLR------KAGYVTRDAREVER 113

Query: 476 KKFGGRGARARFQKSYR 526
           KK G   AR R Q S R
Sbjct: 114 KKVGLHKARRRPQYSKR 130



>gb:AE016827_342911 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 131

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 44/134 (32%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +++    E  R    +P+ L+       +D+ I V
Sbjct: 11  GRRKSSSARVFIKPGSGKITINQRELDVYFGRETSRMIVRQPLELV--EMTEKLDLYITV 68

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D RR E KK 
Sbjct: 69  KGGGISGQAGAIRHGITRALMEY-----DESLRPVLR------AAGFVTRDARRVERKKV 117

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 118 GLRKARRRPQFSKR 131



>sp|P40828|RS9_MYCLE 30S ribosomal protein S9.>pir|S72982|S72982
           ribosomal protein S9 - Mycobacterium
           leprae>gb:MLEPRTN2_146165 Mycobacterium leprae strain TN
           complete genome; segment 2/10.>gb:U00020_199025
           Mycobacterium leprae cosmid B229.
          Length = 153

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 41/139 (29%), Positives = 62/139 (44%), Gaps = 1/139 (0%)
 Frame = +2

Query: 113 SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFE-PILLLGRHRFAGVD 289
           S+Q  GR+K AV       G G   +NG  +E   P  +  +  + P++ + R R    D
Sbjct: 28  SIQTVGRRKEAVVRVRLVLGTGKFDLNGRSLEDYFPNKVHQQLIKAPLVTVERTR--NFD 85

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   + GGG + Q  A+R  IA+AL+         + +  +K          L  DPR  
Sbjct: 86  IFALLHGGGPSGQAGALRLGIARALI-----LASPEDRPALK------KAGFLTRDPRST 134

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK+G + AR   Q S R
Sbjct: 135 ERKKYGLKKARKAPQYSKR 153



>sp|Q8Y459|RS9_LISMO 30S ribosomal protein S9.>pir|AD1399|AD1399
           ribosomal protein S9 [imported] - Listeria monocytogenes
            (strain EGD-e)>gb:AL591983_537087 Listeria
           monocytogenes strain EGD, complete genome segment 11/12.
          Length = 130

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 45/134 (33%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++VA      G G I IN    E   P   LR    +P  L+        D+ + V
Sbjct: 10  GRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALREVIKQP--LVATETLGNYDVLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+T Q  AIR  +A+AL+    +Y     +  +K         LL  D R  E KK 
Sbjct: 68  HGGGYTGQAGAIRHGVARALLQVAPEY-----RPALK------SAGLLTRDSRMKERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G +GAR   Q S R
Sbjct: 117 GLKGARRAPQFSKR 130



>gb:CR522870_100171 Desulfotalea psychrophila LSv54 chromosome.
          Length = 130

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 38/133 (28%), Positives = 62/133 (46%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           G++K A+A      G G + +N +       +I +    E         F   D+   +K
Sbjct: 10  GKRKNAIARVWLTPGTGKVIVNKMATTEYFGKIFKEHLIEKPFKT-TDTFEKYDVIATLK 68

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG ++Q+ A+   I++AL+       D +++  +K         LL  D R  E KK+G
Sbjct: 69  GGGKSAQVDALAHGISRALLE-----TDPENRTPLKQA------GLLRRDQRVKERKKYG 117

Query: 488 GRGARARFQKSYR 526
            +GARA+FQ S R
Sbjct: 118 QKGARAKFQFSKR 130



>pir|H69699|H69699 ribosomal protein S9 [similarity] - Bacillus
           subtilis>gb:D64126_120270 Bacillus subtilis genes for
           ribosomal proteins L13 and S9, putative cell wall
           hydrolase CwlD, gerD protein, 16S ribosomal RNA and 23S
           ribosomal RNA.>gb:BSUB0001_752115 Bacillus subtilis
           complete genome (section 1 of 21): from 1 to 213080.
          Length = 130

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 47/135 (34%), Positives = 63/135 (46%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGV-DMRIR 301
           GR+K++VA      G G I +N   I E I    L     +P+ L      AG  D+ + 
Sbjct: 10  GRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPLTLT---ETAGTYDVLVN 66

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG + Q  AIR  IA+AL+         ++  E +  L R    LL  D R  E KK
Sbjct: 67  VHGGGLSGQAGAIRHGIARALL---------EADPEYRTTLKR--AGLLTRDARMKERKK 115

Query: 482 FGGRGARARFQKSYR 526
           +G +GAR   Q S R
Sbjct: 116 YGLKGARRAPQFSKR 130



>sp|Q8DW97|RS9_STRMU 30S ribosomal protein S9.>gb:AE014868_312619
           Streptococcus mutans UA159 section 16 of 185 of the
           complete genome.>gb:AE014133_939620 Streptococcus mutans
           UA159 complete genome.
          Length = 130

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 44/134 (32%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I +N   +E   P   LR    +P  +         D+ + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLVINQPFAVTSTE--GSYDVFVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+  Q  AIR  IA+AL+         +   + +D L R    LL  D R  E KK 
Sbjct: 68  VGGGYAGQSGAIRHGIARALL---------EVDPDFRDALKR--AGLLTRDARMVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>sp|Q9CNB1|RS9_PASMU 30S ribosomal protein S9.>gb:AE006087_215409
           Pasteurella multocida subsp. multocida str. Pm70 section
           54 of 204 of the complete genome.>gb:AE004439_1118139
           Pasteurella multocida subsp. multocida str. Pm70,
           complete genome.
          Length = 130

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +++    E  R    +P+ L+       +D+ + V
Sbjct: 10  GRRKSSSARVFIKPGSGKITINQRDLDVYFGRETARMIVRQPLELV--EMTEKLDLYVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D R+ E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALIEY-----DESLRSVLR------AAGFVTRDARQVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARRRPQFSKR 130



>sp|O06259|RS9_MYCTU 30S ribosomal protein S9.>pir|H70976|H70976
           probable ribosomal protein S9 rpsI - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_23659
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248346_760828 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           13/14.>gb:BX842583_821549 Mycobacterium tuberculosis
           H37Rv complete genome; segment 12/13.
          Length = 151

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 44/155 (28%), Positives = 65/155 (41%), Gaps = 6/155 (3%)
 Frame = +2

Query: 80  RTTRMAAAPVES------VQCFGRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKA 241
           +T    A P +S      +Q  GR+K AV       G G   +NG  +E   P  +  + 
Sbjct: 9   QTPAAPAGPAQSFVLERPIQTVGRRKEAVVRVRLVPGTGKFDLNGRSLEDYFPNKVHQQL 68

Query: 242 FEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDI 421
            +  L+    R    D+   + GGG + Q  A+R  IA+AL+      V  + +  +K  
Sbjct: 69  IKAPLVTV-DRVESFDIFAHLGGGGPSGQAGALRLGIARALIL-----VSPEDRPALKKA 122

Query: 422 LVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
                   L  DPR  E KK+G + AR   Q S R
Sbjct: 123 ------GFLTRDPRATERKKYGLKKARKAPQYSKR 151



>sp|Q7VLF7|RS9_HAEDU 30S ribosomal protein S9.>gb:AE017155_392895
           Haemophilus ducreyi strain 35000HP section 5 of 6 of the
           complete genome.>gb:AE017143_1027157 Haemophilus ducreyi
           strain 35000HP complete genome.
          Length = 131

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 44/134 (32%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +E+    E  R    +P+ L+       +D+ I V
Sbjct: 11  GRRKSSSARVFIKPGSGNITINQRSLEVYFGRETSRMVVRQPLELV--ELLDKLDLYITV 68

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D RR E KK 
Sbjct: 69  KGGGISGQAGAIRHGITRALMEY-----DETLRPALR------AAGFVTRDARRVERKKV 117

Query: 485 GGRGARARFQKSYR 526
           G   AR R Q S R
Sbjct: 118 GLHKARRRPQYSKR 131



>sp|P21470|RS9_BACSU 30S ribosomal protein S9 (BS10).
          Length = 129

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 47/135 (34%), Positives = 63/135 (46%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGV-DMRIR 301
           GR+K++VA      G G I +N   I E I    L     +P+ L      AG  D+ + 
Sbjct: 9   GRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPLTLT---ETAGTYDVLVN 65

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG + Q  AIR  IA+AL+         ++  E +  L R    LL  D R  E KK
Sbjct: 66  VHGGGLSGQAGAIRHGIARALL---------EADPEYRTTLKR--AGLLTRDARMKERKK 114

Query: 482 FGGRGARARFQKSYR 526
           +G +GAR   Q S R
Sbjct: 115 YGLKGARRAPQFSKR 129



>sp|Q8YPK7|RS9_ANASP 30S ribosomal protein S9.>pir|AD2329|AD2329
           ribosomal protein S9 [similarity] - Nostoc sp. (strain
           PCC 7120)>gb:BA000019_685176 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 138

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 41/135 (30%), Positives = 61/135 (45%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAF--EPILLLGRHRFAGVDMRIR 301
           GR+K+AVA      G G + +NG P +L       Y      P+  LG       D+ ++
Sbjct: 17  GRRKSAVARVRLVPGTGQLIVNGKPGDLYFQFNANYLGVIKAPLETLGLEN--EYDILVK 74

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
            +GGG T Q  ++R  +A+AL       +D +++  +K          L  DPR  E KK
Sbjct: 75  AEGGGLTGQADSVRLGVARALC-----QLDPENRPPLK------TEGYLTRDPRAKERKK 123

Query: 482 FGGRGARARFQKSYR 526
           +G   AR   Q S R
Sbjct: 124 YGLHKARKAPQYSKR 138



>sp|Q9TL29|RR9_NEPOL Chloroplast 30S ribosomal protein
           S9.>gb:AF137379_1771233 Nephroselmis olivacea
           chloroplast DNA, complete genome.
          Length = 134

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 45/138 (32%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKIN---GVPIELIQPEIL--RYKAFEPILLLGRHRFAGVDM 292
           GR+K AVA      G G + IN   GVP     P  L     A +   L  R+     D 
Sbjct: 13  GRRKCAVAQVRIIEGTGQLTINQRPGVPYLQYNPAYLLAAQGALDVTELTNRY-----DT 67

Query: 293 RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCE 472
            ++ KGGG T Q  AI+  +A+AL + + K+     +K +K       +  L  +P R E
Sbjct: 68  IVKTKGGGLTGQAEAIKLGLARALCSLHIKH-----RKALK------PQGYLTRNPLRKE 116

Query: 473 PKKFGGRGARARFQKSYR 526
            KK+G + AR   Q S R
Sbjct: 117 RKKYGLKKARKAPQFSKR 134



>sp|P19459|RR9_GUITH Chloroplast 30S ribosomal protein
           S9.>gb:AF041468_1763595 Guillardia theta complete
           plastid genome.
          Length = 134

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL---IQPEILRYKAFEPILLLGRHRFAGVDMRI 298
           G +K A+A  +   G GLI++NG+  EL     P  +R     P+  LG       ++ +
Sbjct: 13  GHRKQAIARVYLTPGSGLIEVNGIKGELYFQYSPNYIRLSK-SPLTTLGLEN--KYNIYV 69

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
              GGG T Q+ AIR  +A+AL       ++ +++  +K          L  D R  E K
Sbjct: 70  NAHGGGLTGQVEAIRLGLARALCK-----LNPENRTALK------FEGYLTRDSRITERK 118

Query: 479 KFGGRGARARFQKSYR 526
           K+G + AR   Q S R
Sbjct: 119 KYGLKKARKAPQFSKR 134



>gb:AY657385_2146395 Synthetic construct Peudomonas aeruginosa clone
           FLH042916.01F PA4432 gene, partial cds.
          Length = 131

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 43/134 (32%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KTA A    + G G I IN   ++     E  R    +P+ L         D+ + V
Sbjct: 10  GRRKTATARVFLRPGTGKISINNRGLDQFFGRETARMVVRQPLELT--ETVEKFDIFVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  I +ALV +     DE  +  ++          +  D R  E KK 
Sbjct: 68  VGGGVSGQASAIRHGITRALVEY-----DETLRSSLR------KAGYVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARKRPQYSKR 130



>gb:BC069980_2106231 Mus musculus mitochondrial ribosomal protein
           S9, mRNA (cDNA clone IMAGE:6510652), partial cds.
          Length = 274

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 6/134 (4%)
 Frame = +2

Query: 128 GRKKTAVA-VTHCKRGRGLIKINGVPIELIQP-----EILRYKAFEPILLLGRHRFAGVD 289
           GR+K+A A     + G G I +NGV   +  P     E L +  F  +  L RH     D
Sbjct: 152 GRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPITQDREQLMFP-FHFLDRLERH-----D 205

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   V GGG ++Q  AIR ++A+AL +F    V E   + ++         LL  DPR  
Sbjct: 206 VTCTVSGGGRSAQAGAIRLAMARALCSF----VTEDEVEWMR------QAGLLTPDPRIR 255

Query: 470 EPKKFGGRGARARF 511
           E KK G  GAR +F
Sbjct: 256 ERKKPGQEGARRKF 269



>gb:BC051936_2100842 Mus musculus mitochondrial ribosomal protein
           S9, mRNA (cDNA clone IMAGE:5688677), partial cds.
          Length = 307

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 6/134 (4%)
 Frame = +2

Query: 128 GRKKTAVA-VTHCKRGRGLIKINGVPIELIQP-----EILRYKAFEPILLLGRHRFAGVD 289
           GR+K+A A     + G G I +NGV   +  P     E L +  F  +  L RH     D
Sbjct: 185 GRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPITQDREQLMFP-FHFLDRLERH-----D 238

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   V GGG ++Q  AIR ++A+AL +F    V E   + ++         LL  DPR  
Sbjct: 239 VTCTVSGGGRSAQAGAIRLAMARALCSF----VTEDEVEWMR------QAGLLTPDPRIR 288

Query: 470 EPKKFGGRGARARF 511
           E KK G  GAR +F
Sbjct: 289 ERKKPGQEGARRKF 302



>gb:BC022587_2093799 Mus musculus mitochondrial ribosomal protein
           S9, mRNA (cDNA clone IMAGE:4036755), complete cds.
          Length = 130

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 6/134 (4%)
 Frame = +2

Query: 128 GRKKTAVA-VTHCKRGRGLIKINGVPIELIQP-----EILRYKAFEPILLLGRHRFAGVD 289
           GR+K+A A     + G G I +NGV   +  P     E L +  F  +  L RH     D
Sbjct: 8   GRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPITQDREQLMFP-FHFLDRLERH-----D 61

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   V GGG ++Q  AIR ++A+AL +F    V E   + ++         LL  DPR  
Sbjct: 62  VTCTVSGGGRSAQAGAIRLAMARALCSF----VTEDEVEWMR------QAGLLTPDPRIR 111

Query: 470 EPKKFGGRGARARF 511
           E KK G  GAR +F
Sbjct: 112 ERKKPGQEGARRKF 125



>gb:AK009082_1154936 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310002A08
           product:similar to 28S RIBOSOMAL PROTEIN S9,
           MITOCHONDRIAL PRECURSOR (MRP-S9) [Homo sapiens], full
           insert sequence.
          Length = 390

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 6/134 (4%)
 Frame = +2

Query: 128 GRKKTAVA-VTHCKRGRGLIKINGVPIELIQP-----EILRYKAFEPILLLGRHRFAGVD 289
           GR+K+A A     + G G I +NGV   +  P     E L +  F  +  L RH     D
Sbjct: 268 GRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPITQDREQLMFP-FHFLDRLERH-----D 321

Query: 290 MRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
           +   V GGG ++Q  AIR ++A+AL +F    V E   + ++         LL  DPR  
Sbjct: 322 VTCTVSGGGRSAQAGAIRLAMARALCSF----VTEDEVEWMR------QAGLLTPDPRIR 371

Query: 470 EPKKFGGRGARARF 511
           E KK G  GAR +F
Sbjct: 372 ERKKPGQEGARRKF 385



>gb:CP000033_88631 Lactobacillus acidophilus NCFM, complete genome.
          Length = 131

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 44/133 (33%), Positives = 57/133 (42%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRVK 307
           GR+K +VA      G G I +NG  I+   P     K  +  L L        D+ + V 
Sbjct: 11  GRRKDSVARVRLVPGNGKITVNGKDIDQYIPFPNLVKDLKQPLTLTETE-GQYDIHVNVN 69

Query: 308 GGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFG 487
           GGG + Q  AIR  IA+AL+      VD   +  +K          L  DPR  E KK G
Sbjct: 70  GGGFSGQAGAIRLGIARALLE-----VDPDFRGPLK------KAGFLTRDPRMKERKKPG 118

Query: 488 GRGARARFQKSYR 526
            + AR   Q S R
Sbjct: 119 LKKARKASQFSKR 131



>sp|Q99Y08|RS9_STRPY 30S ribosomal protein S9.>gb:AE006617_220755
           Streptococcus pyogenes M1 GAS, section 146 of 167 of the
           complete genome.>gb:AE010104_259366 Streptococcus
           pyogenes strain MGAS8232, section 152 of 173 of the
           complete genome.>gb:AE014168_305140 Streptococcus
           pyogenes MGAS315, section 33 of 37 of the complete
           genome.>gb:BA000034_714588 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:CP000003_861579 Streptococcus
           pyogenes MGAS10394, complete genome.>gb:AE009949_905748
           Streptococcus pyogenes strain MGAS8232, complete
           genome.>gb:AE014074_928319 Streptococcus pyogenes
           MGAS315, complete genome.>gb:AE004092_1106601
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 130

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 45/134 (33%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I +N   +E   P   LR    +P  +         D+ + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLRLIINQPFAVTSTE--GSYDVFVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+  Q  AIR  IA+AL+         Q   + +D L R    LL  D R  E KK 
Sbjct: 68  VGGGYGGQSGAIRHGIARALL---------QVDPDFRDSLKR--AGLLTRDARMVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>sp|Q7V520|RS9_PROMM 30S ribosomal protein S9.>gb:BX572100_799101
           Prochlorococcus marinus MIT9313 complete genome; segment
           6/7.
          Length = 135

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 45/137 (32%), Positives = 62/137 (45%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVP----IELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           GR+KT+VA      G G I ING P    +      +   KA  P+  LG +     D+ 
Sbjct: 14  GRRKTSVARVRLVPGSGTITINGRPGDHYLNFNPAYLAAVKA--PLQTLGLNE--QYDVL 69

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           + V GGG T Q  AI+Q  A+AL       +   ++K +K          L  DPR  E 
Sbjct: 70  VNVHGGGLTGQADAIKQGAARALCE-----LSADNRKPLK------TEGHLSRDPRAKER 118

Query: 476 KKFGGRGARARFQKSYR 526
           +K+G + AR   Q S R
Sbjct: 119 RKYGLKKARKAPQFSKR 135



>sp|Q8YGJ0|RS9_BRUME 30S ribosomal protein S9.>pir|AC3398|AC3398 SSU
           ribosomal protein S9P [imported] - Brucella melitensis
           (strain 16M)>gb:AE009556_253087 Brucella melitensis 16M
           chromosome I, section 113 of 195 of the complete
           sequence.>gb:AE008917_978999 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 158

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 48/153 (31%), Positives = 65/153 (42%), Gaps = 9/153 (5%)
 Frame = +2

Query: 95  AAAPVE--------SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFE 247
           AAAPV+             G++K AVA    K G G I +N    E      +L+    +
Sbjct: 19  AAAPVDVQKLDAQGRAYATGKRKDAVARVWVKPGTGKITVNDKEFEKYFARPVLQMILQQ 78

Query: 248 PILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILV 427
           PI+    +R    D+   V GGG + Q  A+R  I+KAL  +Y+  +    KK       
Sbjct: 79  PIV--ASNRAGQFDIVATVAGGGLSGQAGAVRHGISKAL-TYYEPGLRTVLKK------- 128

Query: 428 RYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
                 L  D R  E KK+G   AR  FQ S R
Sbjct: 129 ---GGFLTRDSRVVERKKYGKAKARRSFQFSKR 158



>gb:BAP239043_746989 Buchnera aphidicola partial yhbz; rpsI; rplM;
           aroQ/pheA; ffh and partial rpsP genes.
          Length = 130

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 44/139 (31%), Positives = 59/139 (42%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM----- 292
           GR+K++ A    + G G I +N       +  +  Y   E   ++ R     VDM     
Sbjct: 10  GRRKSSSARVFLRSGNGEIVVN-------KRSLNEYFGRETSCMIVRQPLELVDMVDKFN 62

Query: 293 -RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
             I VKGGG + Q  AIRQ I +AL+ + Q    E  K              +  D R+ 
Sbjct: 63  IYITVKGGGISGQAGAIRQGITRALIKYNQTLRFELRK-----------AGFITRDSRQV 111

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK G R AR R Q S R
Sbjct: 112 ERKKVGFRKARKRPQFSKR 130



>gb:AE017340_456180 Idiomarina loihiensis L2TR, complete genome.
          Length = 130

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K + A    + G G IKIN   + E    E  +    +P+ L+        DM I V
Sbjct: 10  GRRKNSTARVFLRPGSGNIKINNRELNEYFGRETAQMVVRQPLELV--EMTEKFDMYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG T Q  AIR  I +AL+ +     DE  +  ++          +  D R+ E KK 
Sbjct: 68  SGGGTTGQAGAIRHGITRALMQY-----DEALRGPLR------KEGYVTRDARQVERKKI 116

Query: 485 GGRGARARFQKSYR 526
           G   AR R Q S R
Sbjct: 117 GLHKARKRPQFSKR 130



>sp|Q7U4H4|RS9_SYNPX 30S ribosomal protein S9.>gb:BX569694_776996
           Synechococcus sp. WH8102 complete genome; segment 6/7.
          Length = 133

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 46/137 (33%), Positives = 60/137 (43%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVP----IELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           GR+KT+VA      G G I ING P    +      I   KA    L LG       D+ 
Sbjct: 12  GRRKTSVARVRLVPGNGTITINGRPGDNYLNYNPAYIAAVKAPLETLGLGTE----YDIL 67

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           + V GGG T Q  AI+Q  A+AL       +   ++K +K          L  DPR  E 
Sbjct: 68  VNVHGGGLTGQSGAIKQGAARALCE-----LSADNRKPLK------TEGHLSRDPRAKER 116

Query: 476 KKFGGRGARARFQKSYR 526
           +K+G + AR   Q S R
Sbjct: 117 RKYGLKKARKAPQFSKR 133



>sp|Q7NBH4|RS9_MYCGA 30S ribosomal protein S9.>gb:AE016968_369563
           Mycoplasma gallisepticum strain R section 2 of 4 of the
           complete genome.>gb:AE015450_1034212 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 131

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 42/127 (33%), Positives = 63/127 (49%), Gaps = 2/127 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQP-EILRYKAFEPILLLGRHRFAGV-DMRIR 301
           GR+K++ A+     G G + IN    E   P +I+     +P+ +    + A + D+ + 
Sbjct: 11  GRRKSSTALVKLTPGSGKLVINNRKAEDYFPNKIVIQDMRQPLEVT---KTASIYDINVV 67

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG T Q  AIR  IA+ALV      ++ + KK++K         L+  D R  E KK
Sbjct: 68  VNGGGFTGQAGAIRLGIARALV-----NMNPELKKQLK------QHKLVTRDARVKERKK 116

Query: 482 FGGRGAR 502
           FG  GAR
Sbjct: 117 FGLYGAR 123



>sp|Q9CDG7|RS9_LACLA 30S ribosomal protein S9.>pir|E86906|E86906
           ribosomal protein S9 [similarity] - Lactococcus lactis
           subsp. lactis (strain IL1403)>gb:AE006454_219155
           Lactococcus lactis subsp. lactis IL1403 section 216 of
           218 of the complete genome.>gb:AE005176_1096228
           Lactococcus lactis subsp. lactis IL1403, complete
           genome.
          Length = 130

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 44/134 (32%), Positives = 56/134 (41%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I +NG  +E   P   +R    +P            D  + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITVNGREVESYIPHADMRLVINQPFAATQTE--GSYDTLVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  IA+AL+      VD   +  +K         LL  D R  E KK 
Sbjct: 68  NGGGVSGQAGAIRHGIARALL-----QVDPDFRSALK------RAGLLTRDARMVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>sp|Q8E7E4|RS9_STRA3 30S ribosomal protein S9.>sp|Q8E1Y6|RS9_STRA5
           30S ribosomal protein S9.>gb:SAG766844_169738
           Streptococcus agalactiae NEM316 complete genome, segment
           2.>gb:AE014201_305556 Streptococcus agalactiae 2603V/R
           section 11 of 100 of the complete
           genome.>gb:AE009948_935669 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 130

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 44/134 (32%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I IN   +E   P   LR    +P  +         D+ + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITINKKDVEEYIPHADLRLVINQPFAVTSTQ--GSYDVFVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+  Q  AIR  I++AL+         +   + +D L R    LL  D R  E KK 
Sbjct: 68  VGGGYAGQSGAIRHGISRALL---------EVDPDFRDSLKR--AGLLTRDARMVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>sp|Q9HVY3|RS9_PSEAE 30S ribosomal protein S9.>pir|H83092|H83092 30S
           ribosomal protein S9 PA4432 [imported] - Pseudomonas
           aeruginosa (strain PAO1)>gb:AE004857_58667 Pseudomonas
           aeruginosa PAO1, section 418 of 529 of the complete
           genome.>gb:AE004091_972767 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 130

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 42/134 (31%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KTA A    + G G I IN   ++     E  R    +P+ L         D+ + V
Sbjct: 10  GRRKTATARVFLRPGTGKISINNRGLDQFFGRETARMVVRQPLELT--ETVEKFDIFVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  I +AL+ +     DE  +  ++          +  D R  E KK 
Sbjct: 68  VGGGVSGQAGAIRHGITRALIEY-----DETLRSSLR------KAGYVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARKRPQYSKR 130



>sp|P57470|RS9_BUCAI 30S ribosomal protein S9.>pir|E84975|E84975
           ribosomal protein S9 [similarity] - Buchnera sp. (strain
           APS)>gb:BA000003_653747 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 130

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 44/139 (31%), Positives = 59/139 (42%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDM----- 292
           GR+K++ A    + G G I +N       +  +  Y   E   ++ R     VDM     
Sbjct: 10  GRRKSSSARVFLRSGNGEIVVN-------KRSLNEYFGRETSCMIVRQPLELVDMVDKFN 62

Query: 293 -RIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
             I VKGGG + Q  AIRQ I +AL+ + Q    E  K              +  D R+ 
Sbjct: 63  IYITVKGGGISGQAGAIRQGITRALIKYNQTLRFELRK-----------AGFVTRDSRQV 111

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK G R AR R Q S R
Sbjct: 112 ERKKVGFRKARKRPQFSKR 130



>sp|Q8G1C9|RS9_BRUSU 30S ribosomal protein S9.>gb:AE014291_308231
           Brucella suis 1330 chromosome I, complete sequence.
          Length = 158

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           G++K AVA    K G G I +N    E      +L+    +PI+    +R    D+   V
Sbjct: 38  GKRKDAVARVWVKPGTGKITVNDKEFEKYFARPVLQMILQQPIV--ASNRAGQFDIVATV 95

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  A+R  I+KAL  +Y+  +    KK             L  D R  E KK+
Sbjct: 96  AGGGLSGQAGAVRHGISKAL-TYYEPGLRTVLKK----------GGFLTRDSRVVERKKY 144

Query: 485 GGRGARARFQKSYR 526
           G   AR  FQ S R
Sbjct: 145 GKAKARRSFQFSKR 158



>sp|O67723|RS9_AQUAE 30S ribosomal protein S9.>pir|A70462|A70462
           ribosomal protein S09 - Aquifex
           aeolicus>gb:AE000761_27078 Aquifex aeolicus VF5 section
           93 of 109 of the complete genome.>gb:AE000657_977609
           Aquifex aeolicus VF5 complete genome.
          Length = 147

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 45/149 (30%), Positives = 64/149 (42%), Gaps = 8/149 (5%)
 Frame = +2

Query: 104 PVESVQCFGRKKTAVAVTHCKRGRGLIKINGVPI--------ELIQPEILRYKAFEPILL 259
           P  +    G++K AVA     R R    I G           E +Q E L  K   P  +
Sbjct: 12  PENTYYATGKRKEAVARVWLLRDRPNTFIVGSDKTNKEYDLREYVQRETLYNKIMYPFKV 71

Query: 260 LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR 439
            G     G+   +R  GGG ++Q  AI   +AKAL+         Q   +++  L +   
Sbjct: 72  TGHEGKFGIYATVR--GGGISAQAEAIMYGVAKALL---------QHNPDLRPTLKKAG- 119

Query: 440 TLLVADPRRCEPKKFGGRGARARFQKSYR 526
            LL  D R  E KK+G  GARA+++ S R
Sbjct: 120 -LLTRDAREKERKKYGQMGARAKYRWSKR 147



>gb:S75161_169035 rplM=ribosomal protein L13 homolog...stringent
           starvation protein (Ssp) homolog [Haemophilus somnus,
           HS25, Genomic, 3 genes, 1842 nt].
          Length = 130

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +++    E  R    +P+ L+       +D+ + V
Sbjct: 10  GRRKSSSARVFIKPGSGKIVINQRELDVYFGRETSRMIVRQPLELV--ELTDKLDLYVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D RR E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALIEY-----DETLRPALR------AAGFVTRDARRVERKKI 116

Query: 485 GGRGARARFQKSYR 526
           G   AR R Q S R
Sbjct: 117 GLHKARRRPQYSKR 130



>pir|F64123|F64123 ribosomal protein S9 - Haemophilus influenzae
           (strain Rd KW20)>gb:U32823_205103 Haemophilus influenzae
           Rd KW20 section 138 of 163 of the complete
           genome.>gb:L42023_1097652 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 130

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +++    E  R    +P+ L+       +D+ I V
Sbjct: 10  GRRKSSSARVFIKPGSGKITINQRELDVYFGRETARMVVRQPLELVXLTD--KLDLYITV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D RR E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALMEY-----DETLRPALR------AAGFVTRDARRVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G   AR R Q S R
Sbjct: 117 GLHKARRRPQYSKR 130



>pir|B43310|B43310 ribosomal protein S9 - Haemophilus somnus
          Length = 130

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +++    E  R    +P+ L+       +D+ + V
Sbjct: 10  GRRKSSSARVFIKPGSGKIVINQRELDVYFGRETSRMIVRQPLELV--ELTDKLDLYVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D RR E KK 
Sbjct: 68  KGGGISGQAGAIRHGITRALIEY-----DETLRPALR------AAGFVTRDARRVERKKI 116

Query: 485 GGRGARARFQKSYR 526
           G   AR R Q S R
Sbjct: 117 GLHKARRRPQYSER 130



>sp|P31782|RS9_HAESO 30S ribosomal protein S9.
          Length = 129

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +++    E  R    +P+ L+       +D+ + V
Sbjct: 9   GRRKSSSARVFIKPGSGKIVINQRELDVYFGRETSRMIVRQPLELV--ELTDKLDLYVTV 66

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D RR E KK 
Sbjct: 67  KGGGISGQAGAIRHGITRALIEY-----DETLRPALR------AAGFVTRDARRVERKKI 115

Query: 485 GGRGARARFQKSYR 526
           G   AR R Q S R
Sbjct: 116 GLHKARRRPQYSKR 129



>sp|P44388|RS9_HAEIN 30S ribosomal protein S9.
          Length = 129

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    K G G I IN   +++    E  R    +P+ L+       +D+ I V
Sbjct: 9   GRRKSSSARVFIKPGSGKITINQRELDVYFGRETARMVVRQPLELVXLTD--KLDLYITV 66

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           KGGG + Q  AIR  I +AL+ +     DE  +  ++          +  D RR E KK 
Sbjct: 67  KGGGISGQAGAIRHGITRALMEY-----DETLRPALR------AAGFVTRDARRVERKKV 115

Query: 485 GGRGARARFQKSYR 526
           G   AR R Q S R
Sbjct: 116 GLHKARRRPQYSKR 129



>sp|P73293|RS9_SYNY3 30S ribosomal protein S9.>pir|S77474|S77474
           ribosomal protein S9 - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_688100 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 137

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRY--KAFEPILLLGRHRFAGVDMRIR 301
           GR+K A+A      G+G + +NG P E+    I  Y      P+  LG       ++ + 
Sbjct: 16  GRRKAAIARVRLVPGQGEVIVNGKPGEIYFNRIANYIQSLKAPLETLGLE--GEYNILVN 73

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
             GGG T Q  A++  +A+AL       +  ++++ +K          L  DPR  E KK
Sbjct: 74  AHGGGLTGQADAVKLGVARALC-----QLSPENRQPLK------AEGYLTRDPRAKERKK 122

Query: 482 FGGRGARARFQKSYR 526
           +G   AR   Q S R
Sbjct: 123 YGLHKARKAPQYSKR 137



>sp|Q8DMK7|RS9_SYNEL 30S ribosomal protein S9.>gb:BA000039_725894
           Thermosynechococcus elongatus BP-1 DNA, complete genome.
          Length = 137

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 44/135 (32%), Positives = 62/135 (45%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVP-IELIQPEILRYKAFE-PILLLGRHRFAGVDMRIR 301
           GR+K+AVA      G G + ING    + +Q   +     + P+  LG       D+ + 
Sbjct: 16  GRRKSAVARVRLIPGSGQLWINGRNGADYLQNNPIYLNLVKAPLETLGLEN--SYDIYVN 73

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
             GGG T Q  AIR  IA+AL       +D +++K +K          L  DPR  E +K
Sbjct: 74  ATGGGLTGQADAIRLGIARALC-----QLDIENRKPLK------TEGYLTRDPRAKERRK 122

Query: 482 FGGRGARARFQKSYR 526
           +G R AR   Q S R
Sbjct: 123 YGLRKARKAPQYSKR 137



>sp|Q982W9|RS9_RHILO 30S ribosomal protein S9.>gb:BA000012_672624
           Mesorhizobium loti MAFF303099 DNA, complete genome.
          Length = 160

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 47/157 (29%), Positives = 64/157 (40%), Gaps = 9/157 (5%)
 Frame = +2

Query: 83  TTRMAAAPVE--------SVQCFGRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRY 235
           T   AAAPV              G++K A+A    K G G I +N           +L+ 
Sbjct: 17  TNTQAAAPVHVQKLDKSGRAYATGKRKNAIARVWVKPGSGKIVVNDKEFATYFARPVLQM 76

Query: 236 KAFEPILLLGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIK 415
              +PI+    +R    D+   V GGG + Q  A+R  I+KAL  +Y+  +    KK   
Sbjct: 77  ILNQPII--ASNRSGQYDIVATVVGGGLSGQAGAVRHGISKAL-TYYEPALRAVLKK--- 130

Query: 416 DILVRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 526
                     L  D R  E KK+G   AR  FQ S R
Sbjct: 131 -------GGFLTRDSRVVERKKYGKAKARRSFQFSKR 160



>sp|Q88N96|RS9_PSEPK 30S ribosomal protein S9.>gb:AE016778_330754
           Pseudomonas putida KT2440 section 5 of 21 of the
           complete genome.>gb:AE015451_945831 Pseudomonas putida
           KT2440 complete genome.
          Length = 130

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 42/134 (31%), Positives = 59/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELI-QPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KTA A    + G G I IN   +++    E  R    +P+ L         D+ + V
Sbjct: 10  GRRKTATARVFLRPGTGNISINNRSLDVFFGRETARMVVRQPLELT--ESVEKFDIYVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  I +AL+ +     DE  +  ++          +  D R  E KK 
Sbjct: 68  SGGGVSGQAGAIRHGITRALMEY-----DETLRGALR------RAGYVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARKRPQYSKR 130



>sp|Q8RGG8|RS9_FUSNN 30S ribosomal protein S9.>gb:AE010545_264235
           Fusobacterium nucleatum subsp. nucleatum ATCC 25586,
           section 87 of 197 of the complete
           genome.>gb:AE009951_911403 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 133

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 42/136 (30%), Positives = 65/136 (47%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPI-ELIQPEILRYKAFEPILLLGR--HRFAGVDMRI 298
           GR+KT+VA      G   ++ING  + E      +  +  E  L L    ++FA   +++
Sbjct: 12  GRRKTSVARVRLIPGGQGVEINGKAMDEYFGGRAILSRIVEQPLALTETLNKFA---VKV 68

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
            V GGG++ Q  AIR  +A+AL+       DE  K+ ++      +   L  D R  E K
Sbjct: 69  NVVGGGNSGQAGAIRHGVARALL-----LADESLKEALR------EAGFLTRDSRMVERK 117

Query: 479 KFGGRGARARFQKSYR 526
           K+G + AR   Q S R
Sbjct: 118 KYGKKKARRSPQFSKR 133



>sp|O07828|RS9_PROMA 30S ribosomal protein S9.>gb:AE017166_396140
           Prochlorococcus marinus subsp. marinus str. CCMP1375
           section 6 of 6 of the complete
           genome.>gb:AE017126_1031809 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 136

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 46/137 (33%), Positives = 61/137 (44%), Gaps = 4/137 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVP----IELIQPEILRYKAFEPILLLGRHRFAGVDMR 295
           GR+KT+VA      G G I ING P    +      +   KA    L LG       D+ 
Sbjct: 15  GRRKTSVARVRLIPGTGKITINGRPGDHYLNFNPAYLSAVKAPLHTLGLGE----AYDVL 70

Query: 296 IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEP 475
           + V GGG T Q  AI+Q  A+AL    +  VD +   + +  L R        DPR  E 
Sbjct: 71  VNVYGGGLTGQSDAIKQGAARALC---ELSVDNRKPLKTEGHLSR--------DPRAKER 119

Query: 476 KKFGGRGARARFQKSYR 526
           +K+G + AR   Q S R
Sbjct: 120 RKYGLKKARKAPQFSKR 136



>sp|Q8UFZ8|RS9_AGRT5 30S ribosomal protein S9.>pir|AI2729|AI2729 30S
           ribosomal protein S9 [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>pir|B97511|B97511 30S
           ribosomal protein S9 [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>gb:AE008052_232983
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 110 of 254 of the complete
           sequence.>gb:AE009087_248282 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 113 of 256 of the
           complete sequence.>gb:AE007869_1082652 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1086125 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 155

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 43/135 (31%), Positives = 61/135 (45%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIEL-IQPEILRYKAFEPILLLGRHRFAG-VDMRIR 301
           G++K AVA    K G G I ING          +L+    +P++   R   AG  D+   
Sbjct: 35  GKRKNAVARVWVKAGSGKIIINGRDFTTYFARPVLQMILQQPLVAAAR---AGQFDIIAT 91

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG + Q  A+R  ++KAL  F         +  ++ +L +     L  D R  E KK
Sbjct: 92  VAGGGLSGQAGAVRHGVSKALTYF---------EPGLRPVLKK--GGFLTRDSRVVERKK 140

Query: 482 FGGRGARARFQKSYR 526
           +G   AR  FQ S R
Sbjct: 141 YGKAKARRSFQFSKR 155



>gb:AP008231_581587 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 135

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 46/136 (33%), Positives = 60/136 (44%), Gaps = 3/136 (2%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELI---QPEILRYKAFEPILLLGRHRFAGVDMRI 298
           GR+KTAVA      G G + ING   +      P  L      P+  LG       D+  
Sbjct: 14  GRRKTAVARVRLVPGSGKLVINGREGDNYLNYNPAYLNATRL-PLETLGLE--GDYDILA 70

Query: 299 RVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPK 478
            V GGG T Q  AIR  +A+AL       +  +++K +K          L  DPRR E K
Sbjct: 71  NVHGGGLTGQADAIRLGVARALCE-----LAPENRKPLK------VEGFLSRDPRRKERK 119

Query: 479 KFGGRGARARFQKSYR 526
           K+G + AR   Q S R
Sbjct: 120 KYGLKKARKAPQFSKR 135



>gb:CP000027_79511 Dehalococcoides ethenogenes 195, complete genome.
          Length = 132

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 45/135 (33%), Positives = 60/135 (44%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPIL--LLGRHRFAGVDMRIR 301
           GR+KTAVA      G G+I I+G PIE       R +    IL  ++        +  I+
Sbjct: 12  GRRKTAVATVKLTSGNGVIVIDGKPIE---ERFTRVQERNVILNPMMVTDTMGKYNAVIK 68

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
           V GGG   Q  AI   IA+AL         E+S  +++  L      LL  D R  E KK
Sbjct: 69  VLGGGVAGQSGAIAHGIARAL---------EKSDDKLRATL--KSNGLLTRDDRTKERKK 117

Query: 482 FGGRGARARFQKSYR 526
            G + AR   Q + R
Sbjct: 118 PGLKRARKAPQYTKR 132



>sp|O94150|RT09_CANAL 40S ribosomal protein S9, mitochondrial
           precursor.>gb:AF067962_1765628 Candida albicans
           ribosomal protein S9 small subunit precursor (MRPS9)
           mRNA, nuclear gene encoding mitochondrial protein,
           complete cds.
          Length = 336

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 42/141 (29%), Positives = 63/141 (44%), Gaps = 10/141 (7%)
 Frame = +2

Query: 110 ESVQCFGRKKT------AVAVTHCKRGRGLIKINGVPIELIQPEILRYK----AFEPILL 259
           +++ CFGR KT      ++A  +  +G G + +NG  +    P I   K     F+ +  
Sbjct: 204 KTLDCFGRAKTQAKRKSSIAKIYLVKGEGEVLVNGKSLIEFFPNIYARKNLLYPFQVVEQ 263

Query: 260 LGRHRFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDR 439
            G++     ++  +V GGG+T Q  AI  +IAKALV F        SK            
Sbjct: 264 EGKY-----NVFAQVTGGGYTGQSEAIMYAIAKALVVFNPLLKPRLSK-----------A 307

Query: 440 TLLVADPRRCEPKKFGGRGAR 502
            L+ +D R  E KK G   AR
Sbjct: 308 GLMKSDTRIVERKKPGKVKAR 328



>sp|Q87WW8|RS9_PSESM 30S ribosomal protein S9.>gb:AE016871_353786
           Pseudomonas syringae pv. tomato str. DC3000 section 16
           of 21 of the complete genome.>gb:AE016853_1038961
           Pseudomonas syringae pv. tomato str. DC3000 complete
           genome.
          Length = 130

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 42/134 (31%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIE-LIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+KTA A    + G G I IN   ++     E  R    +P+ L         D+ + V
Sbjct: 10  GRRKTATARVFLRPGTGNISINNRSLDNFFGRETARMVVRQPLELT--ETVEKFDIYVTV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG + Q  AIR  I +AL+ +     DE  +  ++          +  D R  E KK 
Sbjct: 68  IGGGVSGQAGAIRHGITRALMQY-----DETLRGALR------KAGFVTRDAREVERKKV 116

Query: 485 GGRGARARFQKSYR 526
           G R AR R Q S R
Sbjct: 117 GLRKARKRPQYSKR 130



>sp|Q82Z47|RS9_ENTFA 30S ribosomal protein S9.>gb:AE016957_367160
           Enterococcus faecalis V583, section 11 of 11 of the
           complete genome.>gb:AE016830_993648 Enterococcus
           faecalis V583, complete genome.
          Length = 130

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 44/134 (32%), Positives = 57/134 (42%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEI-LRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K AVA      G G I +N   +E   P   LR    +P  +         D+ + V
Sbjct: 10  GRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFGVTETK--GAYDVIVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
            GGG+  Q  AIR  IA+AL+      VD   +  +K         LL  D R  E KK 
Sbjct: 68  NGGGYAGQSGAIRHGIARALL-----QVDPDFRSALK------RAGLLTRDARMVERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKASQFSKR 130



>gb:AE017308_437852 Mycoplasma mobile 163K complete genome.
          Length = 130

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKING-VPIELIQPEILRYKAFEPILLLGRHRFAGVDMRIRV 304
           GR+K++ A    + G+G   IN  V  + +  +IL   A +PI++  +      D+ + V
Sbjct: 10  GRRKSSSARVILRPGKGEFLINKRVARDYLMSDILLKDALQPIVISDQKE--KFDITVNV 67

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           +GGG + Q  AIR  IA+AL+      V    +K +K         +L  D R  E KK 
Sbjct: 68  RGGGLSGQAGAIRLGIARALLE-----VSVDFRKNLK------TAGMLTRDARVKERKKP 116

Query: 485 GGRGARARFQKSYR 526
           G + AR   Q S R
Sbjct: 117 GLKKARKARQFSKR 130



>sp|Q92IV4|RS9_RICCN 30S ribosomal protein S9.>pir|D97739|D97739 30S
           ribosomal protein S9 [imported] - Rickettsia conorii
           (strain Malish 7)>gb:AE008597_238680 Rickettsia conorii
           str. Malish 7, section 29 of 114 of the complete
           genome.>gb:AE006914_1120798 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 159

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 43/134 (32%), Positives = 60/134 (44%), Gaps = 1/134 (0%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAF-EPILLLGRHRFAGVDMRIRV 304
           G++K A+A    K G+G I +N   I    P     K   +P +L         D+   V
Sbjct: 39  GKRKNAIARVWLKVGKGKIVVNNKTIAQYFPSETYVKTILQPFVLT--KTIDQYDIICTV 96

Query: 305 KGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKF 484
           +GGG + Q  AI   I+KAL         ++S  +   IL +    LL  D R  E KK+
Sbjct: 97  RGGGISGQKGAILHGISKAL---------DKSAPDFHAILRK--GGLLTRDSRVVERKKY 145

Query: 485 GGRGARARFQKSYR 526
           G R AR + Q S R
Sbjct: 146 GQRKARKKTQFSKR 159



>sp|Q8K9G0|RS9_BUCAP 30S ribosomal protein S9.>gb:AE014114_303289
           Buchnera aphidicola str. Sg (Schizaphis graminum)
           section 39 of 57 of the complete
           genome.>gb:AE013218_935267 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 130

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 42/139 (30%), Positives = 58/139 (41%), Gaps = 6/139 (4%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAFEPILLLGRHRFAGVDMR---- 295
           GR+K++ A    + G G I +N       +  +  Y   E   ++ R     VDM     
Sbjct: 10  GRRKSSSARVFLRSGDGEITVN-------KRSLKDYFGRETSCMVVRQPLELVDMMNNFN 62

Query: 296 --IRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRC 469
             I VKGGG + Q  AIRQ I +AL+ +      E  K              +  D R+ 
Sbjct: 63  IYITVKGGGVSGQAGAIRQGITRALIKYNHLLRSELRKS-----------GFVTRDSRQV 111

Query: 470 EPKKFGGRGARARFQKSYR 526
           E KK G R +R R Q S R
Sbjct: 112 ERKKVGFRKSRKRTQFSKR 130



>gb:AY548459_627483 Fremyella diplosiphon clone 3098E8 30S ribosomal
           subunit S9, 50S ribosomal subunit L13, putative t-RNA
           pseudouridine synthase I, putative 50S ribosomal subunit
           L17, and putative RNA polymerase alpha subunit genes,
           complete cds.
          Length = 139

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 43/135 (31%), Positives = 59/135 (43%), Gaps = 2/135 (1%)
 Frame = +2

Query: 128 GRKKTAVAVTHCKRGRGLIKINGVPIELIQPEILRYKAF--EPILLLGRHRFAGVDMRIR 301
           GR+K+AVA      G G + +NG    L       Y      P+  LG       D+ ++
Sbjct: 18  GRRKSAVARVRLIPGSGQLTVNGKDGNLYFQFNANYLGVIKGPLETLGLEN--EYDILVK 75

Query: 302 VKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKK 481
            +GGG T Q  +IR  +A+AL    Q   D +S  + +  L R        DPR  E KK
Sbjct: 76  AEGGGLTGQADSIRLGVARALC---QLDPDNRSPLKTEGYLTR--------DPRAKERKK 124

Query: 482 FGGRGARARFQKSYR 526
           +G   AR   Q S R
Sbjct: 125 YGLHKARKAPQYSKR 139



>pir|H72557|H72557 hypothetical protein APE1748 - Aeropyrum pernix
           (strain K1)>gb:BA000002_652493 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 181

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 46/126 (36%), Positives = 54/126 (42%), Gaps = 8/126 (6%)
 Frame = -1

Query: 480 FFGSQRLGSATSKVLS*RTR--------ISLISFFDCSSTYFW*NATRALAMD*RMA*I* 325
           F GS  LGS TS VLS   +        +S+I     S +    N+TR  A+    A   
Sbjct: 3   FSGSVLLGSPTSMVLSCSRKAVLRSLLILSIILQSSSSLSSHRKNSTRPRAIAILTASAW 62

Query: 324 EV*PPPLTRMRMSTPAKRCRPNRRMGSNAL*RRISGWISSIGTPLILMSPRPRLQ*VTAT 145
            + PPP T   MST      P  R GS      IS    S GTPLI   P P L    A 
Sbjct: 63  PITPPPSTLTLMSTRLLTPSPAIRRGSIIFILAISIGYISRGTPLIQTLPLPGLITALAI 122

Query: 144 AVFLRP 127
           A+FL P
Sbjct: 123 ALFLLP 128



>sp|P75179|RS9_MYCPN 30S ribosomal protein S9.>pir|S73552|S73552
           ribosomal protein S9 - Mycoplasma pneumoniae (strain
           ATCC 29342)>gb:AE000022_19105 Mycoplasma pneumoniae M129
           section 58 of 63 of the complete
           genome.>gb:U00089_1101656 Mycoplasma pneumoniae M129,
           complete genome.
          Length = 132

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 3/134 (2%)
 Frame = +2

Query: 110 ESVQCFGRKKTAVAVTHCK--RGRGLIKINGV-PIELIQPEILRYKAFEPILLLGRHRFA 280
           +S    GR+K++ A  +    + +G I +N   P E    +++     +P+ L    +  
Sbjct: 4   QSYYGLGRRKSSSAKVYLTPTQDKGKITVNRRDPSEYFPNKLVIQDMEQPLDLTDLKK-- 61

Query: 281 GVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADP 460
             D+ + VKGGG T Q  AIR  I +AL+ F           E+K IL    + L   D 
Sbjct: 62  NFDINVVVKGGGFTGQAGAIRLGIVRALLQF---------NPELKKIL--KSKKLTTRDK 110

Query: 461 RRCEPKKFGGRGAR 502
           R  E KKFG  GAR
Sbjct: 111 RVKERKKFGLYGAR 124


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 739,855,700
Number of Sequences: 1806583
Number of extensions: 15005191
Number of successful extensions: 46978
Number of sequences better than 10.0: 304
Number of HSP's better than 10.0 without gapping: 44444
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46699
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 44325214704
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)