BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8628
         (872 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF370515_1792300 Arabidopsis thaliana putative methylenetetra...   311   1e-83   
pir|T00696|T00696 probable methylenetetrahydrofolate reductase [...   311   1e-83   Arabidopsis thaliana [mouse-ear cress]
sp|O80585|MTHR_ARATH|MTHR_ARATH Methylenetetrahydrofolate reductase (EC 1.5...   311   1e-83   Arabidopsis thaliana [mouse-ear cress]
gb:ATH245414_1552112 Arabidopsis thaliana mRNA for methylenetetr...   311   1e-83   
gb:AF174486_1774479 Zea mays methylenetetrahydrofolate reductase...   310   2e-83   
gb:AC135594_1742611 Oryza sativa chromosome 3 BAC OSJNBa0024F18 ...   308   7e-83   
gb:AF441241_2142910 Synthetic construct chimera1 mRNA, complete ...   304   1e-81   
pir|T47821|T47821 methylenetetrahydrofolate reductase MTHFR1 - A...   304   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb:BC046708_2549697 Xenopus laevis 5,10-methylenetetrahydrofolat...   180   4e-44   
gb:AL953897_1933433 Human DNA sequence from clone RP11-56N19 on ...   174   2e-42   
gb:AL953897_1933432 Human DNA sequence from clone RP11-56N19 on ...   174   2e-42   
gb:AB125182_1873859 Macaca fascicularis MTHFR mRNA for 5,10-meth...   173   4e-42   
gb:HSA237672_2000669 Homo sapiens mRNA for methylenetetrahydrofo...   172   1e-41   
gb:BC053509_1984945 Homo sapiens 5,10-methylenetetrahydrofolate ...   172   1e-41   
gb:A47326_1449416 Sequence 1 from Patent WO9533054.>gb:AX356172_...   172   1e-41   
sp|P42898|MTHR_HUMAN|MTHR_HUMAN Methylenetetrahydrofolate reductase (EC 1.5...   172   1e-41   Homo sapiens [man]
gb:AE017352_1759726 Cryptococcus neoformans var. neoformans JEC2...   171   1e-41   
gb:AY854631_1434707 Bos taurus methylenetetrahydrofolate reducta...   170   3e-41   
gb:AK030192_1161875 Mus musculus adult male testis cDNA, RIKEN f...   169   6e-41   
sp|Q9WU20|MTHR_MOUSE|MTHR_MOUSE Methylenetetrahydrofolate reductase (EC 1.5...   169   6e-41   Mus musculus [mouse]
sp|Q10258|MTHR_SCHPO|MTHR_SCHPO Probable methylenetetrahydrofolate reductas...   168   1e-40   Schizosaccharomyces pombe
gb:CR382128_1660360 Yarrowia lipolytica chromosome B of strain C...   157   3e-37   
gb:U39849_1403109 Caenorhabditis elegans cosmid C06A8, complete ...   154   2e-36   
pir|T15423|T15423 hypothetical protein C06A8.1 - Caenorhabditis ...   154   2e-36   Caenorhabditis elegans [roundworm]
sp|Q17693|MTHR_CAEEL|MTHR_CAEEL Probable methylenetetrahydrofolate reductas...   154   2e-36   Caenorhabditis elegans [roundworm]
gb:CR380956_1652399 Candida glabrata strain CBS138 chromosome J ...   143   5e-33   
gb:CR382124_1656868 Kluyveromyces lactis strain NRRL Y-1140 chro...   134   2e-30   
gb:CR382128_1660933 Yarrowia lipolytica chromosome B of strain C...   131   1e-29   
gb:SCSUP44GN_1709600 S.cerevisiae G2882, G2889, and SUP44 genes.      130   3e-29   
gb:BX842620_1643748 Neurospora crassa DNA linkage group V BAC co...   130   3e-29   
sp|P53128|MTHS_YEAST|MTHS_YEAST Methylenetetrahydrofolate reductase 2 (EC 1...   130   3e-29   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017341_1754566 Cryptococcus neoformans var. neoformans JEC2...   130   3e-29   
gb:CR382138_1671083 Debaryomyces hansenii chromosome F of strain...   130   4e-29   
gb:CR380952_1650524 Candida glabrata strain CBS138 chromosome F ...   130   4e-29   
gb:SPO011686_1721933 Schizosaccharomyces pombe MTHFR2 gene.           129   1e-28   
gb:CR382139_1672028 Debaryomyces hansenii chromosome G of strain...   128   1e-28   
sp|O74927|MTHS_SCHPO|MTHS_SCHPO Methylenetetrahydrofolate reductase 2 (EC 1...   128   1e-28   Schizosaccharomyces pombe
gb:CR382126_1658782 Kluyveromyces lactis strain NRRL Y-1140 chro...   128   2e-28   
gb:AE016814_1746001 Ashbya gossypii (= Eremothecium gossypii) AT...   127   3e-28   
gb:AE016819_1749292 Ashbya gossypii (= Eremothecium gossypii) AT...   125   8e-28   
sp|P46151|MTHR_YEAST|MTHR_YEAST Methylenetetrahydrofolate reductase 1 (EC 1...   124   2e-27   Saccharomyces cerevisiae [brewer's yeast]
gb:D89118_1675236 Schizosaccharomyces pombe mRNA, partial cds, c...    53   9e-06   
pir|T42227|T42227 methylenetetrahydrofolate reductase homolog - ...    53   9e-06   Schizosaccharomyces pombe
pir|AE2328|AE2328 hypothetical protein all4180 [imported] - Nost...    35   2.5     Nostoc sp. PCC 7120
gb:AC004523_1874612 Homo sapiens chromosome 19, cosmid F22329, c...    33   9.4     
gb:AE017344_1756480 Cryptococcus neoformans var. neoformans JEC2...    33   9.4     
gb:BA000028_697360 Oceanobacillus iheyensis HTE831 DNA, complete...    33   9.4     
gb:CR543861_103434 Acinetobacter sp. ADP1 complete genome.             33   9.4     
gb:CP000033_89011 Lactobacillus acidophilus NCFM, complete genome.     33   9.4     


>gb:AF370515_1792300 Arabidopsis thaliana putative
            methylenetetrahydrofolate reductase (At2g44160; F6E13.29)
            mRNA, complete cds.
          Length = 594

 Score =  311 bits (797), Expect = 1e-83
 Identities = 148/219 (67%), Positives = 174/219 (79%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            RDKKLQ+EW VPL S EDI E F + CLG L+S+PWSE+DGLQPET+ INEQL  +N KG
Sbjct: 376  RDKKLQQEWVVPLKSVEDIQEKFKELCLGNLKSSPWSELDGLQPETRIINEQLIKVNSKG 435

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQP+VN E+S              YQKAYLEFFCSK+KLDA+VEKCK  PS+TY+
Sbjct: 436  FLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAYLEFFCSKEKLDAVVEKCKALPSITYM 495

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK    VSN  Q DVNAVTWGVFPAKEIIQPT+VDP SF +WKDEAFETWS+ W  LY
Sbjct: 496  AVNKGEQWVSNTAQADVNAVTWGVFPAKEIIQPTIVDPASFNVWKDEAFETWSRSWANLY 555

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIFKDL 175
            PE+D SR LLEEV+ +++LVSLV+NDY++GD+FA+F DL
Sbjct: 556  PEADPSRNLLEEVKNSYYLVSLVENDYINGDIFAVFADL 594



>pir|T00696|T00696 probable methylenetetrahydrofolate reductase
            [imported] - Arabidopsis thaliana
          Length = 606

 Score =  311 bits (797), Expect = 1e-83
 Identities = 148/219 (67%), Positives = 174/219 (79%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            RDKKLQ+EW VPL S EDI E F + CLG L+S+PWSE+DGLQPET+ INEQL  +N KG
Sbjct: 388  RDKKLQQEWVVPLKSVEDIQEKFKELCLGNLKSSPWSELDGLQPETRIINEQLIKVNSKG 447

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQP+VN E+S              YQKAYLEFFCSK+KLDA+VEKCK  PS+TY+
Sbjct: 448  FLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAYLEFFCSKEKLDAVVEKCKALPSITYM 507

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK    VSN  Q DVNAVTWGVFPAKEIIQPT+VDP SF +WKDEAFETWS+ W  LY
Sbjct: 508  AVNKGEQWVSNTAQADVNAVTWGVFPAKEIIQPTIVDPASFNVWKDEAFETWSRSWANLY 567

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIFKDL 175
            PE+D SR LLEEV+ +++LVSLV+NDY++GD+FA+F DL
Sbjct: 568  PEADPSRNLLEEVKNSYYLVSLVENDYINGDIFAVFADL 606



>sp|O80585|MTHR_ARATH Methylenetetrahydrofolate reductase (EC
            1.5.1.20) (MTHFR2).>gb:AC004005_1531327 Arabidopsis
            thaliana chromosome 2 clone F6E13 map CIC10F02, CIC02E07,
            complete sequence.>gb:AY050434_1562211 Arabidopsis
            thaliana At2g44160/F6E13.29 mRNA, complete
            cds.>gb:AF181967_1774896 Arabidopsis thaliana
            methylenetetrahydrofolate reductase MTHFR2 mRNA, complete
            cds.
          Length = 594

 Score =  311 bits (797), Expect = 1e-83
 Identities = 148/219 (67%), Positives = 174/219 (79%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            RDKKLQ+EW VPL S EDI E F + CLG L+S+PWSE+DGLQPET+ INEQL  +N KG
Sbjct: 376  RDKKLQQEWVVPLKSVEDIQEKFKELCLGNLKSSPWSELDGLQPETRIINEQLIKVNSKG 435

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQP+VN E+S              YQKAYLEFFCSK+KLDA+VEKCK  PS+TY+
Sbjct: 436  FLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAYLEFFCSKEKLDAVVEKCKALPSITYM 495

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK    VSN  Q DVNAVTWGVFPAKEIIQPT+VDP SF +WKDEAFETWS+ W  LY
Sbjct: 496  AVNKGEQWVSNTAQADVNAVTWGVFPAKEIIQPTIVDPASFNVWKDEAFETWSRSWANLY 555

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIFKDL 175
            PE+D SR LLEEV+ +++LVSLV+NDY++GD+FA+F DL
Sbjct: 556  PEADPSRNLLEEVKNSYYLVSLVENDYINGDIFAVFADL 594



>gb:ATH245414_1552112 Arabidopsis thaliana mRNA for
            methylenetetrahydrofolate reductase.
          Length = 594

 Score =  311 bits (796), Expect = 1e-83
 Identities = 148/219 (67%), Positives = 174/219 (79%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            RDKKLQ+EW VPL S EDI E F + CLG L+S+PWSE+DGLQPET+ INEQL  +N KG
Sbjct: 376  RDKKLQQEWVVPLKSVEDIQEKFKELCLGNLKSSPWSELDGLQPETRIINEQLIKVNSKG 435

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQP+VN E+S              YQKAYLEFFCSK+KLDA+VEKCK  PS+TY+
Sbjct: 436  FLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAYLEFFCSKEKLDAVVEKCKALPSITYM 495

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK    VSN  Q DVNAVTWGVFPAKEIIQPT+VDP SF +WKDEAFETWS+ W  LY
Sbjct: 496  AVNKGEQWVSNTVQADVNAVTWGVFPAKEIIQPTIVDPASFNVWKDEAFETWSRSWANLY 555

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIFKDL 175
            PE+D SR LLEEV+ +++LVSLV+NDY++GD+FA+F DL
Sbjct: 556  PEADPSRNLLEEVKNSYYLVSLVENDYINGDIFAVFADL 594



>gb:AF174486_1774479 Zea mays methylenetetrahydrofolate reductase
            mRNA, complete cds.
          Length = 593

 Score =  310 bits (794), Expect = 2e-83
 Identities = 151/217 (69%), Positives = 173/217 (79%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            R KKLQEEWAVPL S EDI E F+ +C G+L S+PWSE+DGLQPETK I++QL  IN+KG
Sbjct: 376  RGKKLQEEWAVPLKSVEDISERFTNFCQGKLTSSPWSELDGLQPETKIIDDQLVNINQKG 435

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQPAVNGEKS              YQKAYLEFFC+K+KLD L+EK K FPSLTYI
Sbjct: 436  FLTINSQPAVNGEKSDSPTVGWGGPGGYVYQKAYLEFFCAKEKLDQLIEKIKAFPSLTYI 495

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK+G   SN+    VNAVTWGVFP KEIIQPTVVD  SFM+WKDEAFE W++GWG ++
Sbjct: 496  AVNKDGETFSNISPNAVNAVTWGVFPGKEIIQPTVVDHASFMVWKDEAFEIWTRGWGCMF 555

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIFK 181
            PE D SR+LLE+VQKT++LVSLVDNDYV GDLFA FK
Sbjct: 556  PEGDSSRELLEKVQKTYYLVSLVDNDYVQGDLFAAFK 592



>gb:AC135594_1742611 Oryza sativa chromosome 3 BAC OSJNBa0024F18
            genomic sequence, complete sequence.
          Length = 594

 Score =  308 bits (790), Expect = 7e-83
 Identities = 148/219 (67%), Positives = 174/219 (79%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            R KKLQEEWAVP+ S EDI E F  +C G+L S+PWSE+DGLQPETK I++QL  IN+KG
Sbjct: 376  RGKKLQEEWAVPVKSVEDINERFMNFCQGKLTSSPWSELDGLQPETKIIDDQLVKINQKG 435

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQPAVNGE+S              YQKAYLEFFCSK+KLD L+EK K FPSLTYI
Sbjct: 436  FLTINSQPAVNGERSDSTSVGWGGPGGYVYQKAYLEFFCSKEKLDQLIEKSKAFPSLTYI 495

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK+G   SN+    VNAVTWGVFP KEI+QPTVVD  SFM+WKDEAFE WSKGW  L+
Sbjct: 496  AVNKDGESFSNIPTNAVNAVTWGVFPGKEIVQPTVVDSASFMVWKDEAFEIWSKGWACLF 555

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIFKDL 175
            PE D SR++L++VQK++FLVSLVDNDY++GDLFA FK++
Sbjct: 556  PEGDSSREILDKVQKSYFLVSLVDNDYINGDLFAAFKEI 594



>gb:AF441241_2142910 Synthetic construct chimera1 mRNA, complete cds.
          Length = 594

 Score =  304 bits (779), Expect = 1e-81
 Identities = 143/216 (66%), Positives = 169/216 (78%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            RDKKLQ+EW VPL S ED+ E F + C+G L+S+PWSE+DGLQPETK INEQLG IN  G
Sbjct: 378  RDKKLQQEWVVPLKSIEDVQEKFKELCIGNLKSSPWSELDGLQPETKIINEQLGKINSNG 437

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQP+VN  KS              YQKAYLEFFCSK KLD LVEK K FPS+TY+
Sbjct: 438  FLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLDTLVEKSKAFPSITYM 497

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK    VSN  ++DVNAVTWGVFPAKE+IQPT+VDP SF +WKDEAFE WS+ W  LY
Sbjct: 498  AVNKSENWVSNTGESDVNAVTWGVFPAKEVIQPTIVDPASFKVWKDEAFEIWSRSWANLY 557

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIF 184
            PE D SRKLLEEV+ +++LVSLVDN+Y++GD+F++F
Sbjct: 558  PEDDPSRKLLEEVKNSYYLVSLVDNNYINGDIFSVF 593



>pir|T47821|T47821 methylenetetrahydrofolate reductase MTHFR1 -
            Arabidopsis thaliana>gb:ATF24G16_1549864 Arabidopsis
            thaliana DNA chromosome 3, BAC clone
            F24G16.>gb:AY070034_1566677 Arabidopsis thaliana putative
            methylenetetrahydrofolate reductase MTHFR1 (At3g59970)
            mRNA, complete cds.>gb:AY122922_1579800 Arabidopsis
            thaliana putative methylenetetrahydrofolate reductase
            MTHFR1 (At3g59970) mRNA, complete
            cds.>gb:AF181966_1774895 Arabidopsis thaliana
            methylenetetrahydrofolate reductase MTHFR1 mRNA, complete
            cds.
          Length = 592

 Score =  304 bits (779), Expect = 1e-81
 Identities = 143/216 (66%), Positives = 169/216 (78%)
 Frame = -3

Query: 831  RDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKG 652
            RDKKLQ+EW VPL S ED+ E F + C+G L+S+PWSE+DGLQPETK INEQLG IN  G
Sbjct: 376  RDKKLQQEWVVPLKSIEDVQEKFKELCIGNLKSSPWSELDGLQPETKIINEQLGKINSNG 435

Query: 651  FLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYI 472
            FLTINSQP+VN  KS              YQKAYLEFFCSK KLD LVEK K FPS+TY+
Sbjct: 436  FLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLDTLVEKSKAFPSITYM 495

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            AVNK    VSN  ++DVNAVTWGVFPAKE+IQPT+VDP SF +WKDEAFE WS+ W  LY
Sbjct: 496  AVNKSENWVSNTGESDVNAVTWGVFPAKEVIQPTIVDPASFKVWKDEAFEIWSRSWANLY 555

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIF 184
            PE D SRKLLEEV+ +++LVSLVDN+Y++GD+F++F
Sbjct: 556  PEDDPSRKLLEEVKNSYYLVSLVDNNYINGDIFSVF 591



>gb:BC046708_2549697 Xenopus laevis 5,10-methylenetetrahydrofolate
            reductase (NADPH), mRNA (cDNA clone MGC:53253
            IMAGE:5543666), complete cds.
          Length = 643

 Score =  180 bits (456), Expect = 4e-44
 Identities = 95/216 (43%), Positives = 130/216 (60%), Gaps = 8/216 (3%)
 Frame = -3

Query: 834  PRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQ 676
            PR++ L+  W   LNS E + E+F+ Y  GE   N       PW++ D L PET  +  +
Sbjct: 407  PREELLKM-WGQELNSEESVFEVFTYYISGEPNPNGHKVNCLPWND-DPLAPETNLLKNE 464

Query: 675  LGVINKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCK 496
            L  +NK+G LTINSQP VNG+ S              +QKAYLEFF S + + AL++  K
Sbjct: 465  LQKVNKRGILTINSQPNVNGKPSTDPIVGWGPSRGYVFQKAYLEFFTSSEMVSALIKVLK 524

Query: 495  TF-PSLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFET 319
             + P + Y  VN  G  ++N      NAVTWG+FP +EIIQPTVVDPVSF+ WKDEAF  
Sbjct: 525  RYEPRVNYHIVNVHGQNITNAADLQPNAVTWGIFPGREIIQPTVVDPVSFVYWKDEAFAL 584

Query: 318  WSKGWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
            W + W +LY E   SR +++ +   ++LV+LVDND+
Sbjct: 585  WIEQWAKLYEEESPSRMIIQYIHDNYYLVNLVDNDF 620



>gb:AL953897_1933433 Human DNA sequence from clone RP11-56N19 on
            chromosome 1 Contains the 3' end of a novel gene, the
            AGTRAP gene for angiotensin II receptor-associated
            protein, two novel genes, the MTHFR gene for
            5,10-methylenetetrahydrofolate reductase (NADPH), the 5'
            end of the CLCN6 gene for chloride channel 6 and a CpG
            island, complete sequence.>gb:AY338232_1944170 Homo
            sapiens 5,10-methylenetetrahydrofolate reductase (NADPH)
            (MTHFR) gene, complete cds.
          Length = 656

 Score =  174 bits (441), Expect = 2e-42
 Identities = 91/213 (42%), Positives = 129/213 (60%), Gaps = 8/213 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGV 667
            ++L + W   L S E + E+F  Y  GE   N       PW++ + L  ET  + E+L  
Sbjct: 415  EELLKMWGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLR 473

Query: 666  INKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP 487
            +N++G LTINSQP +NG+ S              +QKAYLEFF S++  +AL++  K + 
Sbjct: 474  VNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYE 533

Query: 486  -SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSK 310
              + Y  VN +G  ++N  +   NAVTWG+FP +EIIQPTVVDPVSFM WKDEAF  W +
Sbjct: 534  LRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIE 593

Query: 309  GWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             WG+LY E   SR +++ +   +FLV+LVDND+
Sbjct: 594  RWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 626



>gb:AL953897_1933432 Human DNA sequence from clone RP11-56N19 on
            chromosome 1 Contains the 3' end of a novel gene, the
            AGTRAP gene for angiotensin II receptor-associated
            protein, two novel genes, the MTHFR gene for
            5,10-methylenetetrahydrofolate reductase (NADPH), the 5'
            end of the CLCN6 gene for chloride channel 6 and a CpG
            island, complete sequence.
          Length = 697

 Score =  174 bits (441), Expect = 2e-42
 Identities = 91/213 (42%), Positives = 129/213 (60%), Gaps = 8/213 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGV 667
            ++L + W   L S E + E+F  Y  GE   N       PW++ + L  ET  + E+L  
Sbjct: 456  EELLKMWGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLR 514

Query: 666  INKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP 487
            +N++G LTINSQP +NG+ S              +QKAYLEFF S++  +AL++  K + 
Sbjct: 515  VNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYE 574

Query: 486  -SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSK 310
              + Y  VN +G  ++N  +   NAVTWG+FP +EIIQPTVVDPVSFM WKDEAF  W +
Sbjct: 575  LRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIE 634

Query: 309  GWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             WG+LY E   SR +++ +   +FLV+LVDND+
Sbjct: 635  RWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 667



>gb:AB125182_1873859 Macaca fascicularis MTHFR mRNA for
            5,10-methylenetetrahydrofolate reductase, complete cds.
          Length = 656

 Score =  173 bits (438), Expect = 4e-42
 Identities = 90/211 (42%), Positives = 127/211 (60%), Gaps = 8/211 (3%)
 Frame = -3

Query: 819  LQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGVIN 661
            L + W   L S E + E+F  Y  GE   N       PW++ + L  ET  + E+L  +N
Sbjct: 417  LLKMWGEELTSEESVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLRVN 475

Query: 660  KKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP-S 484
            ++G LTINSQP +NG+ S              +QKAYLEFF S++  +AL++  K +   
Sbjct: 476  RQGILTINSQPNINGKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELR 535

Query: 483  LTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGW 304
            + Y  VN +G  ++N  +   NAVTWG+FP +EIIQPTVVDP+SFM WKDEAF  W + W
Sbjct: 536  VNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFALWIEQW 595

Query: 303  GQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
            G+LY E   SR +++ +   +FLV+LVDND+
Sbjct: 596  GKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 626



>gb:HSA237672_2000669 Homo sapiens mRNA for methylenetetrahydrofolate
            reductase.
          Length = 679

 Score =  172 bits (435), Expect = 1e-41
 Identities = 90/213 (42%), Positives = 128/213 (60%), Gaps = 8/213 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGV 667
            ++L + W   L S   + E+F  Y  GE   N       PW++ + L  ET  + E+L  
Sbjct: 438  EELLKMWGEELTSEASVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLR 496

Query: 666  INKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP 487
            +N++G LTINSQP +NG+ S              +QKAYLEFF S++  +AL++  K + 
Sbjct: 497  VNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYE 556

Query: 486  -SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSK 310
              + Y  VN +G  ++N  +   NAVTWG+FP +EIIQPTVVDPVSFM WKDEAF  W +
Sbjct: 557  LRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIE 616

Query: 309  GWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             WG+LY E   SR +++ +   +FLV+LVDND+
Sbjct: 617  RWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 649



>gb:BC053509_1984945 Homo sapiens 5,10-methylenetetrahydrofolate
            reductase (NADPH), mRNA (cDNA clone MGC:59799
            IMAGE:6374885), complete cds.
          Length = 656

 Score =  172 bits (435), Expect = 1e-41
 Identities = 90/213 (42%), Positives = 128/213 (60%), Gaps = 8/213 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGV 667
            ++L + W   L S   + E+F  Y  GE   N       PW++ + L  ET  + E+L  
Sbjct: 415  EELLKMWGEELTSEASVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLR 473

Query: 666  INKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP 487
            +N++G LTINSQP +NG+ S              +QKAYLEFF S++  +AL++  K + 
Sbjct: 474  VNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYE 533

Query: 486  -SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSK 310
              + Y  VN +G  ++N  +   NAVTWG+FP +EIIQPTVVDPVSFM WKDEAF  W +
Sbjct: 534  LRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIE 593

Query: 309  GWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             WG+LY E   SR +++ +   +FLV+LVDND+
Sbjct: 594  QWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 626



>gb:A47326_1449416 Sequence 1 from Patent
            WO9533054.>gb:AX356172_1466137 Sequence 1 from Patent
            WO0196598.
          Length = 660

 Score =  172 bits (435), Expect = 1e-41
 Identities = 90/213 (42%), Positives = 128/213 (60%), Gaps = 8/213 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGV 667
            ++L + W   L S   + E+F  Y  GE   N       PW++ + L  ET  + E+L  
Sbjct: 419  EELLKMWGEELTSEASVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLR 477

Query: 666  INKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP 487
            +N++G LTINSQP +NG+ S              +QKAYLEFF S++  +AL++  K + 
Sbjct: 478  VNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYE 537

Query: 486  -SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSK 310
              + Y  VN +G  ++N  +   NAVTWG+FP +EIIQPTVVDPVSFM WKDEAF  W +
Sbjct: 538  LRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIE 597

Query: 309  GWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             WG+LY E   SR +++ +   +FLV+LVDND+
Sbjct: 598  RWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 630



>sp|P42898|MTHR_HUMAN Methylenetetrahydrofolate reductase (EC
            1.5.1.20).>gb:A47328_1449417 Sequence 3 from Patent
            WO9533054.>gb:AX356174_1466138 Sequence 3 from Patent
            WO0196598.>gb:H007464S11_1996014 Homo sapiens
            methylenetetrahydrofolate reductase (MTHFR) gene, exon 11
            and complete cds.>gb:HSU09806_2152598 Synthetic construct
            methylenetetrahydrofolate reductase (MTHFR) mRNA,
            complete cds.
          Length = 656

 Score =  172 bits (435), Expect = 1e-41
 Identities = 90/213 (42%), Positives = 128/213 (60%), Gaps = 8/213 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGV 667
            ++L + W   L S   + E+F  Y  GE   N       PW++ + L  ET  + E+L  
Sbjct: 415  EELLKMWGEELTSEASVFEVFVLYLSGEPNRNGHKVTCLPWND-EPLAAETSLLKEELLR 473

Query: 666  INKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP 487
            +N++G LTINSQP +NG+ S              +QKAYLEFF S++  +AL++  K + 
Sbjct: 474  VNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYE 533

Query: 486  -SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSK 310
              + Y  VN +G  ++N  +   NAVTWG+FP +EIIQPTVVDPVSFM WKDEAF  W +
Sbjct: 534  LRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIE 593

Query: 309  GWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             WG+LY E   SR +++ +   +FLV+LVDND+
Sbjct: 594  RWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 626



>gb:AE017352_1759726 Cryptococcus neoformans var. neoformans JEC21
           chromosome 12, complete sequence.
          Length = 617

 Score =  171 bits (434), Expect = 1e-41
 Identities = 95/205 (46%), Positives = 123/205 (60%), Gaps = 3/205 (1%)
 Frame = -3

Query: 807 WAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQP---ETKTINEQLGVINKKGFLTIN 637
           W  P  S  D+  +F+++C G+L   PWS     QP   ET  I EQL  +N+ G+LTIN
Sbjct: 381 WGHPTTS-SDLHALFARFCRGDLAKLPWST----QPPASETSLIIEQLAKMNELGYLTIN 435

Query: 636 SQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYIAVNKE 457
           SQPAV+G +S              YQKAYLEFF S   L  L+ + +  P +TY AVNK+
Sbjct: 436 SQPAVDGVRSDDKVHGWGPPGGYVYQKAYLEFFVSPDLLSPLIRRIEKDPRITYYAVNKQ 495

Query: 456 GTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYPESDL 277
           G L +N      NAVTWGVFP KEI+QPT+V+ VSF+ WKDEAFE   + W  LYP    
Sbjct: 496 GDLRTNTHSESPNAVTWGVFPGKEIVQPTIVEAVSFIAWKDEAFELGLQ-WAHLYPAESP 554

Query: 276 SRKLLEEVQKTFFLVSLVDNDYVHG 202
           SRKL+ +   T +LV++V ND+  G
Sbjct: 555 SRKLITDTMNTSYLVNIVANDFRDG 579



>gb:AY854631_1434707 Bos taurus methylenetetrahydrofolate reductase
            (MTHFR) mRNA, complete cds.
          Length = 655

 Score =  170 bits (431), Expect = 3e-41
 Identities = 87/213 (40%), Positives = 131/213 (61%), Gaps = 8/213 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQLGV 667
            ++L + W   L S E + ++F+ +  GE   N       PW++ + L  ET  + E+L  
Sbjct: 414  EELLKMWGEELTSEESVFQVFAHHLSGEPNQNGYKVTCLPWND-EPLAAETSLMKEELLR 472

Query: 666  INKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFP 487
            +N++G LTINSQP +NG+ S              +QKAYLEFF S++ ++AL++  K + 
Sbjct: 473  VNRRGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKKYE 532

Query: 486  -SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSK 310
              + Y  V+ +G  ++N  +   NAVTWG+FP +EIIQPTVVDPVSFM WKDEAF  W +
Sbjct: 533  LRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIE 592

Query: 309  GWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             WG+LY E   SR +++ +   +FLV+LVDN++
Sbjct: 593  QWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEF 625



>gb:AK030192_1161875 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4933415G03
            product:5,10-methylenetetrahydrofolate reductase, full
            insert sequence.>gb:BC051017_2100581 Mus musculus
            5,10-methylenetetrahydrofolate reductase, mRNA (cDNA
            clone MGC:54647 IMAGE:6308248), complete
            cds.>gb:BC052466_2101137 Mus musculus
            5,10-methylenetetrahydrofolate reductase, mRNA (cDNA
            clone MGC:63414 IMAGE:6834886), complete cds.
          Length = 654

 Score =  169 bits (428), Expect = 6e-41
 Identities = 89/216 (41%), Positives = 131/216 (60%), Gaps = 8/216 (3%)
 Frame = -3

Query: 834  PRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQ 676
            PR++ L+  W   L S E + E+F  Y  GE   +       PW++ + L  ET  + E+
Sbjct: 412  PREELLKM-WGEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWND-EPLAAETSLMKEE 469

Query: 675  LGVINKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCK 496
            L  +N+ G LTINSQP +N + S              +QKAYLEFF S++ ++AL++  K
Sbjct: 470  LLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLK 529

Query: 495  TFP-SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFET 319
            T+   + Y  V+ +G  ++N  +   NAVTWG+FP +EIIQPTVVDP+SFM WKDEAF  
Sbjct: 530  TYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFAL 589

Query: 318  WSKGWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
            W + WG+LY E   SR +++ +   +FLV+LVDN++
Sbjct: 590  WIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEF 625



>sp|Q9WU20|MTHR_MOUSE Methylenetetrahydrofolate reductase (EC
            1.5.1.20).>gb:MMMTHFR11_2116612 Mus musculus
            methylenetetrahydrofolate reductase gene, exon 11 and
            complete cds.
          Length = 654

 Score =  169 bits (428), Expect = 6e-41
 Identities = 89/216 (41%), Positives = 131/216 (60%), Gaps = 8/216 (3%)
 Frame = -3

Query: 834  PRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSN-------PWSEIDGLQPETKTINEQ 676
            PR++ L+  W   L S E + E+F  Y  GE   +       PW++ + L  ET  + E+
Sbjct: 412  PREELLKM-WGEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWND-EPLAAETSLMKEE 469

Query: 675  LGVINKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCK 496
            L  +N+ G LTINSQP +N + S              +QKAYLEFF S++ ++AL++  K
Sbjct: 470  LLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLK 529

Query: 495  TFP-SLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFET 319
            T+   + Y  V+ +G  ++N  +   NAVTWG+FP +EIIQPTVVDP+SFM WKDEAF  
Sbjct: 530  TYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFAL 589

Query: 318  WSKGWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
            W + WG+LY E   SR +++ +   +FLV+LVDN++
Sbjct: 590  WIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEF 625



>sp|Q10258|MTHR_SCHPO Probable methylenetetrahydrofolate reductase 1
            (EC 1.5.1.20).>pir|T38920|T38920
            methylenetetrahydrofolate reductase 2 - fission yeast
            (Schizosaccharomyces pombe)>gb:CQ795548_1453153 Sequence
            21 from Patent WO2004024931.>gb:SPAC56F8_1718056 S.pombe
            chromosome I cosmid c56F8.
          Length = 603

 Score =  168 bits (426), Expect = 1e-40
 Identities = 94/228 (41%), Positives = 132/228 (57%), Gaps = 7/228 (3%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFL 646
            K++   W  P  S+ +IG++F++YC  ++ S PWS++  +  E   I +QL  +N+  FL
Sbjct: 373  KEITTSWGSP-KSYSEIGDLFARYCEKKISSLPWSDLP-ISDEADLIRDQLLSMNRNAFL 430

Query: 645  TINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYIAV 466
            TINSQPA+NGEKS              +QK Y+EFF     L+ L E  K   S++Y   
Sbjct: 431  TINSQPALNGEKSSHPVFGWGPPNGYVFQKPYVEFFVHPSLLNELKETVKKLNSVSYFVT 490

Query: 465  NKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYPE 286
            NK G L +N +    NAVTWGVFP +EIIQPT+V+  SF+ WKDEA+    + W   Y  
Sbjct: 491  NKNGDLDTNSQYEIPNAVTWGVFPNREIIQPTIVESTSFLAWKDEAYSLGME-WANAYSP 549

Query: 285  SDLSRKLLEEVQKTFFLVSLVDNDYVHG-DLFAIF------KDL*PSL 163
              +SRKLL  + K +FL  +VDND+ +G  LF +F      KD+ P L
Sbjct: 550  DSISRKLLVSMMKEWFLCVIVDNDFQNGQSLFDVFNKMRSLKDIHPEL 597



>gb:CR382128_1660360 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 583

 Score =  157 bits (396), Expect = 3e-37
 Identities = 87/218 (39%), Positives = 129/218 (59%), Gaps = 1/218 (0%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFL 646
            +K+ E W  P  + +D+  +   Y  G+L S PWS++  +  E +TI  Q+  +N +G L
Sbjct: 370  QKVLELWGEP-KTVDDLKTLLVNYLNGKLASLPWSDVP-ISNEIETIKPQILELNNRGIL 427

Query: 645  TINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYIAV 466
            TINSQPAVNG KS              YQKAYLE   + +  + LV+K +    +T+ AV
Sbjct: 428  TINSQPAVNGAKSTHPVHGWGPKNGYVYQKAYLELLVTPEVAEKLVKKLENQSEITFYAV 487

Query: 465  NKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYPE 286
            NK G L +N      NAVTWG++P KE+IQPT+V+ +SF+ WK+EAF   S+ W + YP 
Sbjct: 488  NKTGNLQTNAPGGP-NAVTWGIYPGKEVIQPTIVEKISFLAWKEEAFRLGSE-WAKCYPA 545

Query: 285  SDLSRKLLEEVQKTFFLVSLVDNDYVHG-DLFAIFKDL 175
               SRK L+++   ++LV++V ND+     +F +F DL
Sbjct: 546  ESESRKFLDDIFNNWYLVNIVHNDFHDSTGIFDLFSDL 583



>gb:U39849_1403109 Caenorhabditis elegans cosmid C06A8, complete
            sequence.
          Length = 642

 Score =  154 bits (389), Expect = 2e-36
 Identities = 88/206 (42%), Positives = 120/206 (58%), Gaps = 11/206 (5%)
 Frame = -3

Query: 795  LNSFEDIGEIFSKYCLGELRSN-------PWSEID-GLQPETKTINEQLGVINKKGFLTI 640
            + SFED+  +F  Y      ++       PW+E + G+QPET  I+EQL   N+ G LT+
Sbjct: 418  IESFEDVKRVFINYITQAPNADGVKVTVLPWTEAETGVQPETSLISEQLVWCNENGILTV 477

Query: 639  NSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKC-KTFP-SLTYIAV 466
            NSQP+VNG  S              YQKAYLE F + +  D L++   + FP  + Y A+
Sbjct: 478  NSQPSVNGAPSTDPLVGWGKPGGYCYQKAYLECFMTAELSDKLIQIIEREFPVRVNYHAI 537

Query: 465  NKEGTL-VSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYP 289
            NK+ T   +N E+T   AVTWGVFP  EI QPTVVDP+SF  W+DEA++ W   WG  YP
Sbjct: 538  NKDSTFDKTNSEETTPIAVTWGVFPGSEIAQPTVVDPLSFRAWRDEAYQMWMAQWGDFYP 597

Query: 288  ESDLSRKLLEEVQKTFFLVSLVDNDY 211
            +   S  +++ V   F LV+LVDND+
Sbjct: 598  KESKSYGVIKAVHDEFRLVTLVDNDF 623



>pir|T15423|T15423 hypothetical protein C06A8.1 - Caenorhabditis
            elegans
          Length = 615

 Score =  154 bits (389), Expect = 2e-36
 Identities = 88/206 (42%), Positives = 120/206 (58%), Gaps = 11/206 (5%)
 Frame = -3

Query: 795  LNSFEDIGEIFSKYCLGELRSN-------PWSEID-GLQPETKTINEQLGVINKKGFLTI 640
            + SFED+  +F  Y      ++       PW+E + G+QPET  I+EQL   N+ G LT+
Sbjct: 391  IESFEDVKRVFINYITQAPNADGVKVTVLPWTEAETGVQPETSLISEQLVWCNENGILTV 450

Query: 639  NSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKC-KTFP-SLTYIAV 466
            NSQP+VNG  S              YQKAYLE F + +  D L++   + FP  + Y A+
Sbjct: 451  NSQPSVNGAPSTDPLVGWGKPGGYCYQKAYLECFMTAELSDKLIQIIEREFPVRVNYHAI 510

Query: 465  NKEGTL-VSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYP 289
            NK+ T   +N E+T   AVTWGVFP  EI QPTVVDP+SF  W+DEA++ W   WG  YP
Sbjct: 511  NKDSTFDKTNSEETTPIAVTWGVFPGSEIAQPTVVDPLSFRAWRDEAYQMWMAQWGDFYP 570

Query: 288  ESDLSRKLLEEVQKTFFLVSLVDNDY 211
            +   S  +++ V   F LV+LVDND+
Sbjct: 571  KESKSYGVIKAVHDEFRLVTLVDNDF 596



>sp|Q17693|MTHR_CAEEL Probable methylenetetrahydrofolate reductase (EC
            1.5.1.20).>gb:U39849_1403108 Caenorhabditis elegans
            cosmid C06A8, complete sequence.
          Length = 663

 Score =  154 bits (389), Expect = 2e-36
 Identities = 88/206 (42%), Positives = 120/206 (58%), Gaps = 11/206 (5%)
 Frame = -3

Query: 795  LNSFEDIGEIFSKYCLGELRSN-------PWSEID-GLQPETKTINEQLGVINKKGFLTI 640
            + SFED+  +F  Y      ++       PW+E + G+QPET  I+EQL   N+ G LT+
Sbjct: 439  IESFEDVKRVFINYITQAPNADGVKVTVLPWTEAETGVQPETSLISEQLVWCNENGILTV 498

Query: 639  NSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKC-KTFP-SLTYIAV 466
            NSQP+VNG  S              YQKAYLE F + +  D L++   + FP  + Y A+
Sbjct: 499  NSQPSVNGAPSTDPLVGWGKPGGYCYQKAYLECFMTAELSDKLIQIIEREFPVRVNYHAI 558

Query: 465  NKEGTL-VSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYP 289
            NK+ T   +N E+T   AVTWGVFP  EI QPTVVDP+SF  W+DEA++ W   WG  YP
Sbjct: 559  NKDSTFDKTNSEETTPIAVTWGVFPGSEIAQPTVVDPLSFRAWRDEAYQMWMAQWGDFYP 618

Query: 288  ESDLSRKLLEEVQKTFFLVSLVDNDY 211
            +   S  +++ V   F LV+LVDND+
Sbjct: 619  KESKSYGVIKAVHDEFRLVTLVDNDF 644



>gb:CR380956_1652399 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 645

 Score =  143 bits (360), Expect = 5e-33
 Identities = 75/213 (35%), Positives = 119/213 (55%), Gaps = 3/213 (1%)
 Frame = -3

Query: 828  DKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGF 649
            +K+  E W  P  S  D+  +F KY  G ++S PW ++ GL PET  I E+L  +N +G+
Sbjct: 428  NKRAYELWGSP-TSIRDLKAVFVKYLEGSIQSLPWCDL-GLSPETALIQEELIQLNYRGY 485

Query: 648  LTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTF---PSLT 478
            LT+ SQP  N   S              YQKA++E F  +Q+   +++    +      +
Sbjct: 486  LTLASQPCTNASSSTDKIFGWGPSKGHVYQKAFIEMFVHRQQWKTILKPKLDYYGRRKFS 545

Query: 477  YIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQ 298
            Y A + +G+  +N++    N VTWGVFP  ++IQ T+++  SF  W+DEAF  WS+ W +
Sbjct: 546  YYAGDSKGSFETNLDPHSSNVVTWGVFPNSQVIQTTIIEEESFKAWRDEAFSIWSE-WAK 604

Query: 297  LYPESDLSRKLLEEVQKTFFLVSLVDNDYVHGD 199
            L+P +  S  LL EV   ++LVS+V +D++  D
Sbjct: 605  LFPRNTPSNTLLREVHSDYYLVSIVHHDFIETD 637



>gb:CR382124_1656868 Kluyveromyces lactis strain NRRL Y-1140
            chromosome D of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 649

 Score =  134 bits (337), Expect = 2e-30
 Identities = 72/207 (34%), Positives = 121/207 (58%), Gaps = 2/207 (0%)
 Frame = -3

Query: 813  EEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFLTINS 634
            E W  P+ S EDI  IF +Y  G +++ PWS++ GL  ET  I E+L  +N++G+L++ S
Sbjct: 438  ELWDHPV-SLEDIKNIFIRYLEGSMKALPWSDL-GLSAETAFIQEELIELNQRGYLSLAS 495

Query: 633  QPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPS--LTYIAVNK 460
            QPA NG +S              YQKA++E F  K++ + +++      +   +Y   + 
Sbjct: 496  QPATNGSQSTDNIFGWGPANGLIYQKAFVEIFVRKEEWNQVLKPKIESKNGEFSYYLGDY 555

Query: 459  EGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYPESD 280
             G   +N++    NAVTWGVFP  E++Q T+V+  SF  W+DEAF  W + W +L+P++ 
Sbjct: 556  TGYFETNLQPKSSNAVTWGVFPNSEVVQTTIVEEESFKAWRDEAFSIWIE-WSKLFPKNT 614

Query: 279  LSRKLLEEVQKTFFLVSLVDNDYVHGD 199
                 L ++ + ++LVS+V +D+++ D
Sbjct: 615  PENTFLRKMHRDYYLVSIVHHDFINPD 641



>gb:CR382128_1660933 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 625

 Score =  131 bits (330), Expect = 1e-29
 Identities = 80/215 (37%), Positives = 117/215 (54%), Gaps = 1/215 (0%)
 Frame = -3

Query: 840  HVPRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVIN 661
            HVP  + L E W  P++   D+ ++F+   +G+L   PWS+   L PET  I EQL  +N
Sbjct: 406  HVPPARAL-ELWGYPVDD-ADLSKLFADTIVGKLPFMPWSD-QTLSPETMLIQEQLMELN 462

Query: 660  KKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSL 481
            +KG  T+ SQPA N  KS              +QK++ EFF S ++   L         L
Sbjct: 463  QKGIWTVASQPACNALKSDDNIFGWGPKGGYVFQKSFAEFFISPEQWKKLKPLLDAQEDL 522

Query: 480  TYIAVNKEGTLV-SNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGW 304
                V K   LV +NV +   N VTWGVFP +EI+Q T++   SF  W++EAF  WS+ W
Sbjct: 523  VSYYVAKSDKLVDTNVSERASNGVTWGVFPNREIVQTTIIQEDSFDAWREEAFSIWSE-W 581

Query: 303  GQLYPESDLSRKLLEEVQKTFFLVSLVDNDYVHGD 199
              LY ++  S KLL+++   + LV+++ +DYV  D
Sbjct: 582  RALYKKNTASFKLLDKIINEYLLVTVIHHDYVEED 616



>gb:SCSUP44GN_1709600 S.cerevisiae G2882, G2889, and SUP44 genes.
          Length = 599

 Score =  130 bits (328), Expect = 3e-29
 Identities = 76/212 (35%), Positives = 113/212 (53%), Gaps = 4/212 (1%)
 Frame = -3

Query: 822  KLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFLT 643
            K  E W+ P  S  D+  +   Y  G L+  PWS+I  +  E   I   L  +N+   +T
Sbjct: 382  KCLELWSTP-TSINDVAFLVINYLNGNLKCLPWSDIP-INDEINPIKAHLIELNQHSIIT 439

Query: 642  INSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYIAVN 463
            INSQP VNG +S              YQK YLEF   K KL  L++  K    LTY A++
Sbjct: 440  INSQPQVNGIRSNDKIHGWGPKDGYVYQKQYLEFMLPKTKLPKLIDTLKNNEFLTYFAID 499

Query: 462  KEGTLVSN-VEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAF---ETWSKGWGQL 295
             +G L+SN  + +  NAVTWG+FP +EI+QPT+V+ +SF+ WK+E +     W     + 
Sbjct: 500  SQGDLLSNHPDNSKSNAVTWGIFPGREILQPTIVEKISFLAWKEEFYHILNEWKLNMNKY 559

Query: 294  YPESDLSRKLLEEVQKTFFLVSLVDNDYVHGD 199
              +   S + ++ +   + LV++VDNDY+  D
Sbjct: 560  --DKPHSAQFIQSLIDDYCLVNIVDNDYISPD 589



>gb:BX842620_1643748 Neurospora crassa DNA linkage group V BAC contig
            B11E5.
          Length = 681

 Score =  130 bits (328), Expect = 3e-29
 Identities = 80/239 (33%), Positives = 128/239 (53%), Gaps = 25/239 (10%)
 Frame = -3

Query: 840  HVPRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVIN 661
            HV   + LQ  W  P  + EDI +IF ++  GEL + PWSE +G   ET+ I + L  +N
Sbjct: 439  HVTVPQALQL-WGSPKTT-EDINKIFIRHLKGELSAIPWSE-EGFNDETEAIRDNLIELN 495

Query: 660  KKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSK---QKLDALVEKCKTF 490
             +G+ ++ SQPAVNG +S              +QKA++EFF      + L+A +++    
Sbjct: 496  SRGWWSLASQPAVNGLRSDDGTFGWGPENGFVFQKAFVEFFIPSADWRVLEAKLKQPDMK 555

Query: 489  PSLTYIAVNKEGTLVSN----------------------VEQTDVNAVTWGVFPAKEIIQ 376
             ++ + A N  G  VS                         +   NAVTWGVFP KEI+ 
Sbjct: 556  DTVCFFATNAAGDFVSTDTINFRARMAAEAEGTAEADHRPHEPSTNAVTWGVFPGKEILT 615

Query: 375  PTVVDPVSFMIWKDEAFETWSKGWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDYVHGD 199
            PT+++ VSF  W +EAF  WS+ W ++Y +   ++KLLE++++  +LV+++ +DY+  D
Sbjct: 616  PTIIEEVSFRAWSEEAFGIWSE-WAKIYGKGSDTQKLLEDLKEDLWLVNVIHHDYLEKD 673



>sp|P53128|MTHS_YEAST Methylenetetrahydrofolate reductase 2 (EC
            1.5.1.20).>pir|S64136|S64136 methylenetetrahydrofolate
            reductase (NADPH2) (EC 1.5.1.20) MET13 - yeast
            (Saccharomyces cerevisiae)>gb:CQ795550_1453154 Sequence
            23 from Patent WO2004024931.>gb:SCYGL125W_1712050
            S.cerevisiae chromosome VII reading frame ORF YGL125w.
          Length = 599

 Score =  130 bits (328), Expect = 3e-29
 Identities = 76/212 (35%), Positives = 113/212 (53%), Gaps = 4/212 (1%)
 Frame = -3

Query: 822  KLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFLT 643
            K  E W+ P  S  D+  +   Y  G L+  PWS+I  +  E   I   L  +N+   +T
Sbjct: 382  KCLELWSTP-TSINDVAFLVINYLNGNLKCLPWSDIP-INDEINPIKAHLIELNQHSIIT 439

Query: 642  INSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYIAVN 463
            INSQP VNG +S              YQK YLEF   K KL  L++  K    LTY A++
Sbjct: 440  INSQPQVNGIRSNDKIHGWGPKDGYVYQKQYLEFMLPKTKLPKLIDTLKNNEFLTYFAID 499

Query: 462  KEGTLVSN-VEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAF---ETWSKGWGQL 295
             +G L+SN  + +  NAVTWG+FP +EI+QPT+V+ +SF+ WK+E +     W     + 
Sbjct: 500  SQGDLLSNHPDNSKSNAVTWGIFPGREILQPTIVEKISFLAWKEEFYHILNEWKLNMNKY 559

Query: 294  YPESDLSRKLLEEVQKTFFLVSLVDNDYVHGD 199
              +   S + ++ +   + LV++VDNDY+  D
Sbjct: 560  --DKPHSAQFIQSLIDDYCLVNIVDNDYISPD 589



>gb:AE017341_1754566 Cryptococcus neoformans var. neoformans JEC21
            chromosome 1, complete sequence.
          Length = 633

 Score =  130 bits (327), Expect = 3e-29
 Identities = 74/207 (35%), Positives = 121/207 (58%), Gaps = 6/207 (2%)
 Frame = -3

Query: 813  EEWAVPLNSFEDIGEIFSKYCLGELR--SNPWSEIDGLQPETKTINEQLGVINKKGFL-- 646
            +EW VP+++  D+  +F+ Y   + +  + P+ ++  L PE+  I   L  +N       
Sbjct: 415  KEWGVPVST-SDLSALFTAYLHSDPKHLTTPFCDLP-LSPESHMILPHLLALNSANVQHW 472

Query: 645  TINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPS--LTYI 472
            T+ SQPAV+  KS              +QKA++EFF ++ +++ L EK +      +T  
Sbjct: 473  TVGSQPAVDAAKSEDEVVGWGPRGGYVFQKAFVEFFVTEDEVNRLKEKVEREGKGLITMY 532

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            A N++G   +N ++  VNAVTWGVFP +EI Q T+++  SF+ WK+EAF+ W++ W  LY
Sbjct: 533  AANRKGDFKTNTDKDSVNAVTWGVFPGQEIAQSTIIEETSFLAWKEEAFDIWAE-WSLLY 591

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDY 211
            P +  SRKLLE +   ++LVSL+ +DY
Sbjct: 592  PRNTPSRKLLEGIANEWWLVSLIHHDY 618



>gb:CR382138_1671083 Debaryomyces hansenii chromosome F of strain
            CBS767 of Debaryomyces hansenii.
          Length = 642

 Score =  130 bits (326), Expect = 4e-29
 Identities = 76/209 (36%), Positives = 114/209 (54%), Gaps = 9/209 (4%)
 Frame = -3

Query: 810  EWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFLTINSQ 631
            +W  P  S  +I ++F  Y  G++ S PW +   L PET  I E+L  +N KG+ ++ SQ
Sbjct: 423  KWGAP-ESVNEIIKVFVSYLSGKIDSLPWVDA-ALSPETALIQEELFEVNNKGWFSLASQ 480

Query: 630  PAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQ----KLDALVEKCKTFPSLTYIAVN 463
            PAVNG  S              YQKA++E F  K     KL   ++K     ++TY   +
Sbjct: 481  PAVNGCLSSDKIFGWGPGNGIIYQKAFIEIFIPKDTWTNKLLPGLQKYLDDQTITYYCGD 540

Query: 462  KEGTLVSNVE-----QTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQ 298
             EG L SN+          NA+TWGVFP KE++QPT++D  SF  W +EAF  W + W +
Sbjct: 541  AEGRLTSNLNIDQEHYNSKNAITWGVFPLKEVLQPTIIDLESFKAWNEEAFILWLE-WAR 599

Query: 297  LYPESDLSRKLLEEVQKTFFLVSLVDNDY 211
             Y ++  + +LL  + K ++LVSL+ +D+
Sbjct: 600  CYKKTSKTYELLNSIYKDYYLVSLISHDF 628



>gb:CR380952_1650524 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 600

 Score =  130 bits (326), Expect = 4e-29
 Identities = 74/210 (35%), Positives = 115/210 (54%), Gaps = 4/210 (1%)
 Frame = -3

Query: 825 KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFL 646
           KK  E W+ P  + ED+ ++   Y  G+++  PWS+   L  E   I + L  +N+K  +
Sbjct: 382 KKSLELWSTP-KTIEDVSQLVISYLTGQIKCLPWSDTS-LDEEIDPILDHLLDLNRKMII 439

Query: 645 TINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSLTYIAV 466
           TINSQP +NG +S              YQK YLEF    +K++ L ++      LTY AV
Sbjct: 440 TINSQPQINGIRSNHKVHGWGPKDGYVYQKQYLEFLLPNEKVEKLEKQLAGNEMLTYFAV 499

Query: 465 NKEGTLVSN-VEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAF---ETWSKGWGQ 298
           + +  L SN  + +  NAVTWG+FP +E++QPT+V+ VSF+ WK+E +   E W   W  
Sbjct: 500 DNKDNLKSNHPDGSKANAVTWGIFPGREVLQPTIVEKVSFLAWKEEFYRILEEWK--WNF 557

Query: 297 LYPESDLSRKLLEEVQKTFFLVSLVDNDYV 208
                  S + ++ +   + LV++VDNDY+
Sbjct: 558 QENNELKSAEFIQHIIDNYMLVNIVDNDYI 587



>gb:SPO011686_1721933 Schizosaccharomyces pombe MTHFR2 gene.
          Length = 641

 Score =  129 bits (323), Expect = 1e-28
 Identities = 71/211 (33%), Positives = 117/211 (55%)
 Frame = -3

Query: 840  HVPRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVIN 661
            H P  + L+  W  P++   DI  +F K+ + ++ + PW + + ++ ETKTI + L  +N
Sbjct: 422  HFPPSEALKL-WGYPVDE-SDITSLFQKHIMSDISAIPWID-EPVEVETKTIAKYLLKLN 478

Query: 660  KKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSL 481
               + T+ SQPAVNG  S              +QKA++E F + + L   + K    P +
Sbjct: 479  GNSWWTVGSQPAVNGAPSADPVFGWGPKGGRVFQKAFVECFVNGKDLKDFITKWHDNPQV 538

Query: 480  TYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWG 301
            TY A N +   ++N  +   +AVTWGV+P +EIIQ T++  VSF  W  E+F+ W + W 
Sbjct: 539  TYYAGNNKSEFLTNAPKDGASAVTWGVYPGREIIQSTIIAEVSFKAWLSESFQVWGE-WA 597

Query: 300  QLYPESDLSRKLLEEVQKTFFLVSLVDNDYV 208
             LY ++  SRKLLE      +LV+++ +D++
Sbjct: 598  NLYSKNTPSRKLLENCLNDRWLVTVIHHDFM 628



>gb:CR382139_1672028 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 617

 Score =  128 bits (322), Expect = 1e-28
 Identities = 80/236 (33%), Positives = 125/236 (52%), Gaps = 21/236 (8%)
 Frame = -3

Query: 825  KKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFL 646
            KK  + W  P  + +   +I   +  G+L S PWS+   +  +++ I + L  +NKKGF 
Sbjct: 375  KKAFDLWGHP-GTLKQFSDIIISFLSGKLNSLPWSD-SAIGQDSEIIVDNLIALNKKGFF 432

Query: 645  TINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPS------ 484
            T+NSQP++N  KS              YQK YLEFF  K  + AL+ +   +        
Sbjct: 433  TLNSQPSLNAIKSNDKVYGWGPKNGYVYQKQYLEFFVHKDIIPALLHQIDNYNRGQGDSN 492

Query: 483  ---LTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWS 313
               LTY AV+++G L SN +  D+NAVTWGVFP +EI+QPT+V+ VSF+ WKDE +   +
Sbjct: 493  SSVLTYYAVDQKGKLFSNTKDDDINAVTWGVFPGEEILQPTIVEKVSFLAWKDEVYRLIT 552

Query: 312  KGWGQLY------------PESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLFAIFK 181
            + W +++             + D   KL+      + L ++V+N+++  D   IFK
Sbjct: 553  E-WIKIFQSDFVKDVNITKEDVDAFVKLMTNFNDEYVLCNVVNNNFI-DDNQTIFK 606



>sp|O74927|MTHS_SCHPO Methylenetetrahydrofolate reductase 2 (EC
            1.5.1.20).>pir|T38659|T38659 methylenetetrahydrofolate
            reductase 2 - fission yeast  (Schizosaccharomyces
            pombe)>gb:SPAC343_1717758 S.pombe chromosome I cosmid
            c343.
          Length = 641

 Score =  128 bits (322), Expect = 1e-28
 Identities = 71/211 (33%), Positives = 117/211 (55%)
 Frame = -3

Query: 840  HVPRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVIN 661
            H P  + L+  W  P++   DI  +F K+ + ++ + PW + + ++ ETKTI + L  +N
Sbjct: 422  HFPPSEALKL-WGYPVDE-SDITSLFQKHIMSDISAIPWID-EPVEVETKTIAKYLLKLN 478

Query: 660  KKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPSL 481
               + T+ SQPAVNG  S              +QKA++E F + + L   + K    P +
Sbjct: 479  GNSWWTVGSQPAVNGAPSADPVFGWGPKGGRVFQKAFVECFVNGKDLKDFITKWHDNPQV 538

Query: 480  TYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWG 301
            TY A N +   ++N  +   +AVTWGV+P +EIIQ T++  VSF  W  E+F+ W + W 
Sbjct: 539  TYYAGNNKSEFLTNAPKDGASAVTWGVYPGREIIQSTIIAEVSFKAWLSESFQVWGE-WA 597

Query: 300  QLYPESDLSRKLLEEVQKTFFLVSLVDNDYV 208
             LY ++  SRKLLE      +LV+++ +D++
Sbjct: 598  NLYSKNTPSRKLLENCINDRWLVTVIHHDFM 628



>gb:CR382126_1658782 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 604

 Score =  128 bits (321), Expect = 2e-28
 Identities = 81/220 (36%), Positives = 117/220 (53%), Gaps = 7/220 (3%)
 Frame = -3

Query: 846  CGHV---PRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQ 676
            CGH       KK  E W+ P  + +D+  + + Y  G+L+  PWS++  L  E   I + 
Sbjct: 374  CGHSLIRQSVKKSIELWSTP-QTLDDMSNLVTSYLEGKLKCLPWSDVP-LNHEVDDILKH 431

Query: 675  LGVINKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCK 496
            L  +NK    TINSQP VNG+ S              YQK YLEF   ++KL    E C+
Sbjct: 432  LIDLNKHHIFTINSQPKVNGKPSTDPVVGWGPTKGYVYQKEYLEFLLPREKLPLFQEICQ 491

Query: 495  TFPS-LTYIAVNKEGTLVSN-VEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFE 322
                 LTY A++ +  L +N  E +  NAVTWGVFP  EI+QPT+V+  SF+ WK+E F 
Sbjct: 492  EHSDHLTYFAIDSQDNLATNHPEDSRANAVTWGVFPGSEILQPTIVEKASFLAWKEEFF- 550

Query: 321  TWSKGWGQLYPE--SDLSRKLLEEVQKTFFLVSLVDNDYV 208
            T  K W   + E  +  S  L+  +   + L+++VDND++
Sbjct: 551  TILKEWKLTFVEHKATESVNLVNHIIDNYVLINVVDNDFI 590



>gb:AE016814_1746001 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome I, complete sequence.
          Length = 603

 Score =  127 bits (319), Expect = 3e-28
 Identities = 81/220 (36%), Positives = 113/220 (51%), Gaps = 7/220 (3%)
 Frame = -3

Query: 846  CGHVPRDKKLQ---EEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQ 676
            CGH    +  Q   E W+ P  +  D+  +   Y  G+L+  PWS++  L  E   + + 
Sbjct: 373  CGHTVLRQTYQRSLELWSTP-RTLLDLAALVISYLKGDLKCLPWSDVP-LHQEADALLDS 430

Query: 675  LGVINKKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDAL-VEKC 499
            L  +N+   LTINSQP VNG  S              YQK YLEF   K  L A      
Sbjct: 431  LIRLNEHLVLTINSQPKVNGAPSADPIVGWGPANGYVYQKQYLEFLLPKHHLPAFHAALT 490

Query: 498  KTFPSLTYIAVNKEGTLVSN-VEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFE 322
              FP+LTY AV+ +  L SN  + T  NAVTWG+FP +E++QPT+V+  SF+ WKDE + 
Sbjct: 491  ADFPTLTYFAVDADDNLASNHPDDTQANAVTWGIFPGREVLQPTIVEKASFLAWKDEFYR 550

Query: 321  TWSKGWGQLYPESDL--SRKLLEEVQKTFFLVSLVDNDYV 208
                 W   + E+    S  LL  +   + LV++VDND+V
Sbjct: 551  ILD-DWRLSFDENGAADSAALLAHLTSDYALVNIVDNDFV 589



>gb:AE016819_1749292 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 635

 Score =  125 bits (315), Expect = 8e-28
 Identities = 70/208 (33%), Positives = 110/208 (52%), Gaps = 2/208 (0%)
 Frame = -3

Query: 828  DKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGF 649
            +KK  + W  P ++  DI  +F  Y  G + + PW ++ GL PET  I E+L  +N++GF
Sbjct: 419  NKKAYQIWGYP-STLNDIKSLFIGYLEGSIEALPWCDL-GLSPETALIQEELIGLNQRGF 476

Query: 648  LTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEKCKTFPS--LTY 475
            LT+ SQPA N   S              YQKA++E F  K + +A ++     P    +Y
Sbjct: 477  LTLASQPATNSTPSADKIFGWGPPGGVVYQKAFVELFVEKARWEAELKPRLEGPDSKFSY 536

Query: 474  IAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQL 295
               +  G+  SN+     + VTWGVFP  +I+Q T+++  SF  W+DEAF  W   W +L
Sbjct: 537  YFGDSAGSFASNMAPESSSVVTWGVFPNSQILQTTIIEEESFKAWRDEAFSIW-LSWSKL 595

Query: 294  YPESDLSRKLLEEVQKTFFLVSLVDNDY 211
            +P +      L  + + + LVS+V +D+
Sbjct: 596  FPRNSPHNAFLRGIHRDYCLVSIVHHDF 623



>sp|P46151|MTHR_YEAST Methylenetetrahydrofolate reductase 1 (EC
            1.5.1.20).>pir|S63459|S63459 methylenetetrahydrofolate
            reductase (NADPH2) (EC 1.5.1.20) MET12 - yeast
            (Saccharomyces cerevisiae)>gb:SCU36624_1710208
            Saccharomyces cerevisiae chromosome XVI, left arm cosmid
            9901.
          Length = 657

 Score =  124 bits (311), Expect = 2e-27
 Identities = 73/211 (34%), Positives = 114/211 (54%), Gaps = 3/211 (1%)
 Frame = -3

Query: 822  KLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVINKKGFLT 643
            K  E W +P  +  D+ +IF KY  G   + PWS++ GL  ET  I E+L  +N +G+LT
Sbjct: 440  KALELWGIP-KTIGDLKDIFIKYLEGSTDAIPWSDL-GLSAETALIQEELIQLNYRGYLT 497

Query: 642  INSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVE-KCKTFP--SLTYI 472
            + SQPA N   S              YQKA++E F  +Q+ +  ++ K   +     +Y 
Sbjct: 498  LASQPATNATLSSDKIFGWGPAKGRLYQKAFVEMFIHRQQWETTLKPKLDHYGRRKFSYY 557

Query: 471  AVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLY 292
            A +  G+  +N++    + VTWGVFP   + Q T+++  SF  W+DEAF  WS+ W +L+
Sbjct: 558  AGDSSGSFETNLDPHSSSVVTWGVFPNSPVKQTTIIEEESFKAWRDEAFSIWSE-WAKLF 616

Query: 291  PESDLSRKLLEEVQKTFFLVSLVDNDYVHGD 199
            P +  +  LL  V K + LVS+V +D+   D
Sbjct: 617  PRNTPANILLRLVHKDYCLVSIVHHDFKETD 647



>gb:D89118_1675236 Schizosaccharomyces pombe mRNA, partial cds,
           clone: SY 0433.
          Length = 566

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 34/113 (30%), Positives = 57/113 (50%)
 Frame = -3

Query: 840 HVPRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVIN 661
           H P  + L+  W  P++   DI  +F K+ + ++   PW + + ++ ETKTI + L  +N
Sbjct: 412 HFPPSEALKL-WGYPVDE-SDITSLFQKHIMSDISVIPWID-EPVEVETKTIAKYLLKLN 468

Query: 660 KKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEK 502
              + T+ SQPAVNG  S              +QKA++E F + + L   + K
Sbjct: 469 GNSWWTVGSQPAVNGAPSADPVFGWGPKGGRVFQKAFVECFVNGKDLKDFITK 521



>pir|T42227|T42227 methylenetetrahydrofolate reductase homolog -
           fission yeast  (Schizosaccharomyces pombe) (fragment)
          Length = 566

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 34/113 (30%), Positives = 57/113 (50%)
 Frame = -3

Query: 840 HVPRDKKLQEEWAVPLNSFEDIGEIFSKYCLGELRSNPWSEIDGLQPETKTINEQLGVIN 661
           H P  + L+  W  P++   DI  +F K+ + ++   PW + + ++ ETKTI + L  +N
Sbjct: 412 HFPPSEALKL-WGYPVDE-SDITSLFQKHIMSDISVIPWID-EPVEVETKTIAKYLLKLN 468

Query: 660 KKGFLTINSQPAVNGEKSXXXXXXXXXXXXXXYQKAYLEFFCSKQKLDALVEK 502
              + T+ SQPAVNG  S              +QKA++E F + + L   + K
Sbjct: 469 GNSWWTVGSQPAVNGAPSADPVFGWGPKGGRVFQKAFVECFVNGKDLKDFITK 521



>pir|AE2328|AE2328 hypothetical protein all4180 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_685169 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 249

 Score = 34.7 bits (78), Expect = 2.5
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = -3

Query: 456 GTLVSNVEQTDVNAVTWGVFPAK-EIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYP 289
           G   S V  TDV  + W  FP +  I QP +++     IW D  F T  + W    P
Sbjct: 74  GDYFSQVATTDVGYLVWSQFPVRVHIKQPQLINAQQAQIWVDSVFTTVQE-WANYLP 129



>gb:AC004523_1874612 Homo sapiens chromosome 19, cosmid F22329,
           complete sequence.
          Length = 458

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%)
 Frame = +1

Query: 664 NNTQL---FVDGFCLWLKPIYFRPRVTSEFSKTVLGKYLTNIFKAIQRNSPLFLKFLIPW 834
           N+TQ+   +  GF +WL PI   P +      T+  + +TN   AI     LF++FL PW
Sbjct: 10  NSTQMSATYSQGFTIWLGPII--PFIVLCHPDTI--RSITNASAAIAPKDNLFIRFLKPW 65



>gb:AE017344_1756480 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 1149

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 20/53 (37%), Positives = 29/53 (54%)
 Frame = -3

Query: 420 NAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFETWSKGWGQLYPESDLSRKLL 262
           N +T+  F    I  PTVVD V+ ++  +E F TWS G+  LY  +   R L+
Sbjct: 536 NRLTFQTF----IESPTVVDDVNIILRYNELFFTWSTGYRLLYALAMYRRALV 584



>gb:BA000028_697360 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 238

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 23/105 (21%), Positives = 48/105 (45%)
 Frame = -3

Query: 507 EKCKTFPSLTYIAVNKEGTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEA 328
           EK  T  S+ Y+  N   T         ++ +   + P +   Q  V+       W +E 
Sbjct: 73  EKKSTEKSIIYLFKNDHKT-------NGLDVLYKVILPTESSSQAEVIALFEGADWSEEV 125

Query: 327 FETWSKGWGQLYPESDLSRKLLEEVQKTFFLVSLVDNDYVHGDLF 193
            E++      L  ++++  KL  ++ +++  ++ VDND ++GD+F
Sbjct: 126 KESY------LITKNEIVHKLFTKLAQSYTCLTSVDNDIINGDVF 164



>gb:CR543861_103434 Acinetobacter sp. ADP1 complete genome.
          Length = 147

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -2

Query: 637 QPTSS*WRKIWLTFCWLGWPWWLCISEGIFGVFL 536
           QP S   R +W  + ++G  W LCI+ GI G+F+
Sbjct: 21  QPVSKLARSVWARWVFIGLAW-LCIALGILGIFI 53



>gb:CP000033_89011 Lactobacillus acidophilus NCFM, complete genome.
          Length = 663

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 2/66 (3%)
 Frame = -3

Query: 495 TFPSLTYIAVNKE--GTLVSNVEQTDVNAVTWGVFPAKEIIQPTVVDPVSFMIWKDEAFE 322
           T+P++  +A +K   GTL +          T+   P   +   + V PV F +W     E
Sbjct: 188 TYPTMVQLAASKTVLGTLFAGTPFASQIHTTFFGIPVITMNYTSTVLPVLFAVWFASIIE 247

Query: 321 TWSKGW 304
            WSK W
Sbjct: 248 HWSKKW 253


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 938,611,139
Number of Sequences: 1806583
Number of extensions: 20223385
Number of successful extensions: 54550
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 51087
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54459
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 60071280422
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)