BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8570
         (1164 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AK175297_1817285 Arabidopsis thaliana mRNA, complete cds, clo...   429   e-119   
gb:AY035063_1559836 Arabidopsis thaliana unknown protein (At2g30...   429   e-119   
pir|C84709|C84709 hypothetical protein At2g30510 [imported] - Ar...   429   e-119   Arabidopsis thaliana [mouse-ear cress]
gb:AF181683_1774861 Arabidopsis thaliana RPT2 (RPT2) mRNA, compl...   428   e-118   
gb:AY144442_1583522 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...   213   8e-54   
gb:BT015362_1642190 Arabidopsis thaliana At5g67385 gene, complet...   196   6e-49   
gb:AC105928_1738265 Oryza sativa (japonica cultivar-group) chrom...   184   3e-45   
gb:AB012242_1511718 Arabidopsis thaliana genomic DNA, chromosome...   182   9e-45   
gb:AC147427_1744693 Oryza sativa chromosome 3 B1394A07 genomic s...   167   3e-40   
gb:AP004591_1842017 Oryza sativa (japonica cultivar-group) genom...   163   5e-39   
gb:AB013389_1512060 Arabidopsis thaliana genomic DNA, chromosome...   163   7e-39   
gb:AY144442_1583524 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...   160   4e-38   
gb:AY049300_1561942 Arabidopsis thaliana AT5g66560/K1F13_23 mRNA...   159   1e-37   
gb:AF466200_1802233 Sorghum bicolor putative protein kinase gene...   156   7e-37   
gb:AC012562_1537723 Arabidopsis thaliana chromosome 3 BAC F17O14...   155   1e-36   
gb:AC012562_1537714 Arabidopsis thaliana chromosome 3 BAC F17O14...   152   2e-35   
gb:AB006704_1509977 Arabidopsis thaliana genomic DNA, chromosome...   152   2e-35   
gb:AC099043_1737016 Oryza sativa chromosome 3 BAC OSJNBa0079B15 ...   150   4e-35   
pir|T45850|T45850 hypothetical protein F3A4.50 - Arabidopsis tha...   150   4e-35   Arabidopsis thaliana [mouse-ear cress]
pir|G86428|G86428 F26G16.2 protein - Arabidopsis thaliana>gb:AE0...   150   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AP003224_1825592 Oryza sativa (japonica cultivar-group) genom...   149   1e-34   
gb:AY094473_1575768 Arabidopsis thaliana AT3g50840/F18B3_120 mRN...   148   2e-34   
pir|T08405|T08405 hypothetical protein F18B3.120 - Arabidopsis t...   148   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AY448010S4_1606587 Ipomoea trifida haplotype S1 self-incompat...   147   3e-34   
gb:AC117988_1739426 Oryza sativa chromosome 3 BAC OSJNBa0057G07 ...   146   9e-34   
gb:OSJN00101_1694921 Oryza sativa genomic DNA, chromosome 4, BAC...   145   1e-33   
pir|D84920|D84920 hypothetical protein At2g47860 [imported] - Ar...   144   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AF180390_1774821 Arabidopsis thaliana non-phototropic hypocot...   143   6e-33   
gb:AB008268_1510462 Arabidopsis thaliana genomic DNA, chromosome...   143   6e-33   
pir|T48346|T48346 photoreceptor-interacting protein-like - Arabi...   139   1e-31   Arabidopsis thaliana [mouse-ear cress]
pir|G86160|G86160 protein F10O3.17 [imported] - Arabidopsis thal...   138   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AB186127_1529351 Oryza sativa (japonica cultivar-group) mRNA ...   133   8e-30   
pir|T51779|T51779 non-phototropic hypocotyl 3-like protein - Ara...   133   8e-30   Arabidopsis thaliana [mouse-ear cress]
pir|G96701|G96701 unknown protein, 76653-74502 [imported] - Arab...   131   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AY084797_1569881 Arabidopsis thaliana clone 118259 mRNA, comp...   130   7e-29   
gb:AB028619_1518048 Arabidopsis thaliana genomic DNA, chromosome...   130   7e-29   
gb:AC135500_1742438 Oryza sativa chromosome 3 BAC OSJNBa0034J04 ...   129   9e-29   
pir|G96568|G96568 probable non-phototropic hypocotyl, 25081-2661...   128   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP006068_1860884 Oryza sativa (japonica cultivar-group) genom...   126   7e-28   
gb:AP005426_1851664 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AY150514_1585079 Arabidopsis thaliana unknown protein (At4g31...   117   3e-25   
gb:AY091021_1574252 Arabidopsis thaliana unknown protein (At4g31...   117   3e-25   
pir|T06304|T06304 hypothetical protein F11C18.20 - Arabidopsis t...   117   3e-25   Arabidopsis thaliana [mouse-ear cress]
pir|T02594|T02594 hypothetical protein At2g14820 [imported] - Ar...   117   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AP005919_1860143 Oryza sativa (japonica cultivar-group) genom...   117   6e-25   
gb:OSJN00002_1693082 Oryza sativa genomic DNA, chromosome 4, BAC...   115   1e-24   
gb:AB016886_1513138 Arabidopsis thaliana genomic DNA, chromosome...   115   2e-24   
gb:AY742301_1179925 Malus x domestica phototropic response-like ...   114   5e-24   
pir|T50813|T50813 non-phototropic hypocotyl 3-like protein - Ara...   113   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AY054668_1563322 Arabidopsis thaliana putative protein (At4g3...   110   5e-23   
pir|T04716|T04716 hypothetical protein F19F18.80 - Arabidopsis t...   110   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AC144738_1744167 Oryza sativa (japonica cultivar-group) chrom...   109   1e-22   
pir|H84619|H84619 hypothetical protein At2g23050 [imported] - Ar...   108   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00035_1693653 Oryza sativa genomic DNA, chromosome 4, BAC...   107   4e-22   
gb:AP001298_1820987 Arabidopsis thaliana genomic DNA, chromosome...   107   5e-22   
gb:AY054694_1563348 Arabidopsis thaliana photoreceptor-interacti...   106   8e-22   
gb:AB007645_1510162 Arabidopsis thaliana genomic DNA, chromosome...   106   8e-22   
gb:AP005903_1859850 Oryza sativa (japonica cultivar-group) genom...   102   2e-20   
gb:BT012660_1641730 Arabidopsis thaliana At3g19850 gene, complet...    96   2e-18   
gb:AB025631_1516560 Arabidopsis thaliana genomic DNA, chromosome...    96   2e-18   
gb:AY080713_1568435 Arabidopsis thaliana unknown protein (At1g50...    95   2e-18   
gb:AP003960_1835723 Oryza sativa (japonica cultivar-group) genom...    92   2e-17   
gb:ATAC009895_1543071 Arabidopsis thaliana chromosome III BAC T2...    89   1e-16   
gb:AY040058_1560556 Arabidopsis thaliana unknown protein (At3g22...    85   3e-15   
gb:AP003747_1832804 Oryza sativa (japonica cultivar-group) genom...    80   6e-14   
pir|T51462|T51462 hypothetical protein K10A8_60 - Arabidopsis th...    80   1e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AB023039_1515419 Arabidopsis thaliana genomic DNA, chromosome...    71   4e-11   
pir|B96539|B96539 hypothetical protein F14I3.11 [imported] - Ara...    67   7e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AP002523_1822365 Oryza sativa (japonica cultivar-group) genom...    66   2e-09   
pir|T46056|T46056 hypothetical protein T16K5.250 - Arabidopsis t...    55   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AY360388_1602177 Oryza sativa (japonica cultivar-group) chrom...    52   3e-05   
gb:AC119291_1739678 Oryza sativa (japonica cultivar-group) chrom...    51   5e-05   
gb:AP004044_1836817 Oryza sativa (japonica cultivar-group) genom...    48   3e-04   
gb:AP005693_1856166 Oryza sativa (japonica cultivar-group) genom...    46   0.001   
gb:AP003985_1835948 Oryza sativa (japonica cultivar-group) genom...    45   0.003   
gb:OSJN00097_1694866 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.041   
gb:AP004023_1836514 Oryza sativa (japonica cultivar-group) genom...    40   0.069   
gb:BC058674_2103406 Mus musculus cDNA sequence BC058674, mRNA (c...    36   1.7     
gb:AK173130_2070064 Mus musculus mRNA for mKIAA1205 protein.           36   1.7     
gb:AK032894_1163119 Mus musculus 12 days embryo male wolffian du...    36   1.7     
sp|P40954|CHI3_CANAL|CHI3_CANAL Chitinase 3 precursor (EC 3.2.1.14).>gb:CAU...    35   2.2     Candida albicans
sp|P53882|YNR6_YEAST|YNR6_YEAST Hypothetical 67.4 kDa protein in RPS3-PSD1 ...    35   2.9     Saccharomyces cerevisiae [brewer's yeast]
gb:AP005292_1850005 Oryza sativa (japonica cultivar-group) genom...    34   5.0     
gb:AP006562_1862441 Oryza sativa (japonica cultivar-group) genom...    34   6.5     
gb:AY545646_1334584 Giardia intestinalis isolate A29 beta-giardi...    34   6.5     
gb:AF294850_1895429 Procolobus badius protamine P1 (Prm1) gene, ...    33   8.5     
gb:AY189822_595973 Ruminococcus flavefaciens heat shock protein ...    33   8.5     
gb:AE017251_416602 Treponema denticola ATCC 35405, section 6 of ...    33   8.5     
sp|O25225|TYPA_HELPY|TYPA_HELPY GTP-binding protein TypA/BipA homolog.>pir|...    33   8.5     Helicobacter pylori
sp|Q9ZLZ3|TYPA_HELPJ|TYPA_HELPJ GTP-binding protein TypA/BipA homolog.>pir|...    33   8.5     Helicobacter pylori


>gb:AK175297_1817285 Arabidopsis thaliana mRNA, complete cds, clone:
            RAFL21-73-G18.
          Length = 545

 Score =  429 bits (1103), Expect = e-119
 Identities = 223/318 (70%), Positives = 257/318 (80%), Gaps = 11/318 (3%)
 Frame = -1

Query: 1158 FPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESV 979
            FP+NFLC LLR A+FL T+  CKNELEKRIS +LEHV+VDDLL+ SFT+DGERL DL+SV
Sbjct: 228  FPVNFLCSLLRCAVFLDTSLTCKNELEKRISVVLEHVSVDDLLIPSFTYDGERLLDLDSV 287

Query: 978  RRIISGFVEKEKSVAVFNGGDF-REVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIA 802
            RRIIS FVEKEK+V VFNGGDF R VCS ++QRV KTVD+YL EIAT+ +L+ISKFN IA
Sbjct: 288  RRIISAFVEKEKNVGVFNGGDFNRGVCSVSLQRVAKTVDSYLAEIATYGDLTISKFNAIA 347

Query: 801  NLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLP 622
            NLVPK ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQNKRLP
Sbjct: 348  NLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQNKRLP 407

Query: 621  VQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTELLQM 457
            V IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+EL++M
Sbjct: 408  VNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSELMKM 467

Query: 456  KMFIADMQ---NXXXXXXXXXXXXXXXXVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD 286
            KM+++DMQ   N                  K TFFSS+SKKLGKLNPFK+GSKDTS++D+
Sbjct: 468  KMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDE 527

Query: 285  --GEVDITKPRRRRFSIS 238
              G VDITKPRRRRFSIS
Sbjct: 528  DLGGVDITKPRRRRFSIS 545



>gb:AY035063_1559836 Arabidopsis thaliana unknown protein (At2g30520)
            mRNA, complete cds.>gb:AY056359_1563667 Arabidopsis
            thaliana unknown protein (At2g30520) mRNA, complete
            cds.>gb:BT000675_1634952 Arabidopsis thaliana clone
            RAFL09-15-A18 (R09304) unknown protein (At2g30520) mRNA,
            complete cds.
          Length = 593

 Score =  429 bits (1103), Expect = e-119
 Identities = 223/318 (70%), Positives = 257/318 (80%), Gaps = 11/318 (3%)
 Frame = -1

Query: 1158 FPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESV 979
            FP+NFLC LLR A+FL T+  CKNELEKRIS +LEHV+VDDLL+ SFT+DGERL DL+SV
Sbjct: 276  FPVNFLCSLLRCAVFLDTSLTCKNELEKRISVVLEHVSVDDLLIPSFTYDGERLLDLDSV 335

Query: 978  RRIISGFVEKEKSVAVFNGGDF-REVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIA 802
            RRIIS FVEKEK+V VFNGGDF R VCS ++QRV KTVD+YL EIAT+ +L+ISKFN IA
Sbjct: 336  RRIISAFVEKEKNVGVFNGGDFNRGVCSVSLQRVAKTVDSYLAEIATYGDLTISKFNAIA 395

Query: 801  NLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLP 622
            NLVPK ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQNKRLP
Sbjct: 396  NLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQNKRLP 455

Query: 621  VQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTELLQM 457
            V IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+EL++M
Sbjct: 456  VNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSELMKM 515

Query: 456  KMFIADMQ---NXXXXXXXXXXXXXXXXVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD 286
            KM+++DMQ   N                  K TFFSS+SKKLGKLNPFK+GSKDTS++D+
Sbjct: 516  KMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDE 575

Query: 285  --GEVDITKPRRRRFSIS 238
              G VDITKPRRRRFSIS
Sbjct: 576  DLGGVDITKPRRRRFSIS 593



>pir|C84709|C84709 hypothetical protein At2g30510 [imported] -
            Arabidopsis thaliana>gb:U93215_1726554 Arabidopsis
            thaliana chromosome 2 BAC T6B20 genomic sequence,
            complete sequence.
          Length = 415

 Score =  429 bits (1103), Expect = e-119
 Identities = 223/318 (70%), Positives = 257/318 (80%), Gaps = 11/318 (3%)
 Frame = -1

Query: 1158 FPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESV 979
            FP+NFLC LLR A+FL T+  CKNELEKRIS +LEHV+VDDLL+ SFT+DGERL DL+SV
Sbjct: 98   FPVNFLCSLLRCAVFLDTSLTCKNELEKRISVVLEHVSVDDLLIPSFTYDGERLLDLDSV 157

Query: 978  RRIISGFVEKEKSVAVFNGGDF-REVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIA 802
            RRIIS FVEKEK+V VFNGGDF R VCS ++QRV KTVD+YL EIAT+ +L+ISKFN IA
Sbjct: 158  RRIISAFVEKEKNVGVFNGGDFNRGVCSVSLQRVAKTVDSYLAEIATYGDLTISKFNAIA 217

Query: 801  NLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLP 622
            NLVPK ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQNKRLP
Sbjct: 218  NLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQNKRLP 277

Query: 621  VQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTELLQM 457
            V IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+EL++M
Sbjct: 278  VNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSELMKM 337

Query: 456  KMFIADMQ---NXXXXXXXXXXXXXXXXVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD 286
            KM+++DMQ   N                  K TFFSS+SKKLGKLNPFK+GSKDTS++D+
Sbjct: 338  KMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDE 397

Query: 285  --GEVDITKPRRRRFSIS 238
              G VDITKPRRRRFSIS
Sbjct: 398  DLGGVDITKPRRRRFSIS 415



>gb:AF181683_1774861 Arabidopsis thaliana RPT2 (RPT2) mRNA, complete
            cds.
          Length = 593

 Score =  428 bits (1100), Expect = e-118
 Identities = 222/318 (69%), Positives = 257/318 (80%), Gaps = 11/318 (3%)
 Frame = -1

Query: 1158 FPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESV 979
            FP+NFLC LLR A+FL T+  CKNELEKRIS +LEHV+VDDLL+ SFT+DGERL DL+SV
Sbjct: 276  FPVNFLCSLLRCAVFLDTSLTCKNELEKRISVVLEHVSVDDLLIPSFTYDGERLLDLDSV 335

Query: 978  RRIISGFVEKEKSVAVFNGGDF-REVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIA 802
            RRIIS FVEKEK+V VFNGGDF R VCS ++QRV KTVD+YL EIAT+ +L+ISKFN IA
Sbjct: 336  RRIISAFVEKEKNVGVFNGGDFNRGVCSVSLQRVAKTVDSYLAEIATYGDLTISKFNAIA 395

Query: 801  NLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLP 622
            NLVPK ARK DDDLYRAIDI+LKAHP LDEIEREKVCS MDPLKLSY+AR+HASQNKRLP
Sbjct: 396  NLVPKSARKSDDDLYRAIDIFLKAHPNLDEIEREKVCSSMDPLKLSYDARLHASQNKRLP 455

Query: 621  VQIVLHALYYDQLKIRSGAEDPKS-----TPNAIATRNQLQADVTLVKENEALRTELLQM 457
            V IVLHALYYDQLK+RSG  + +       P A+ TR+QLQAD TL KENEALR+EL++M
Sbjct: 456  VNIVLHALYYDQLKLRSGVAEQEERAVVVLPEALKTRSQLQADTTLAKENEALRSELMKM 515

Query: 456  KMFIADMQ---NXXXXXXXXXXXXXXXXVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD 286
            KM+++DMQ   N                  K TFFSS+S+KLGKLNPFK+GSKDTS++D+
Sbjct: 516  KMYVSDMQKNKNGAGASSSNSSSLVSSKKSKHTFFSSVSRKLGKLNPFKNGSKDTSHIDE 575

Query: 285  --GEVDITKPRRRRFSIS 238
              G VDITKPRRRRFSIS
Sbjct: 576  DLGGVDITKPRRRRFSIS 593



>gb:AY144442_1583522 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
            partial sequence.
          Length = 665

 Score =  213 bits (541), Expect = 8e-54
 Identities = 126/314 (40%), Positives = 170/314 (54%), Gaps = 31/314 (9%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P +FLC LL  A+    +     +LE R++ +L+  T +DLL ++    GER+ + ++VR
Sbjct: 280  PASFLCRLLHAAVATEASAKACRDLELRVAAVLDQATAEDLLSVALDAAGERVRNTDTVR 339

Query: 975  RIISGFVEKEKSVAVFNGGDFRE----------VCST---------AMQRVGKTVDAYLG 853
            R+++ FVE+  + A       R             +T         A+++V K VD    
Sbjct: 340  RVVTAFVERHAAAAAAAPESERRRSRRASMSGTTAATELGAGTRPGALEKVAKMVDEVAA 399

Query: 852  EIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPL 673
            EIAT   L ISKF G+A  VPK AR   D LYRA+DIYLK HP LDEI+REKVCSVMDPL
Sbjct: 400  EIATEEALPISKFVGVAGAVPKDARPSHDCLYRAVDIYLKTHPALDEIQREKVCSVMDPL 459

Query: 672  KLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA------------T 529
            KLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS A+   S  + +A             
Sbjct: 460  KLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAADAATSMGDVVADTQTQSSSAAGRA 519

Query: 528  RNQLQADVTLVKENEALRTELLQMKMFIADMQNXXXXXXXXXXXXXXXXVRKPTFFSSMS 349
            R Q  AD  L +ENEALR EL +M+ +++                     +K TF  +  
Sbjct: 520  RAQAMADAALARENEALRVELARMRAYMSGTMQHGKGRESSTPASPSRTAKKATFLGTEL 579

Query: 348  KKLGKLNPFKHGSK 307
             ++       H SK
Sbjct: 580  ARMRAYMSGMHHSK 593



>gb:BT015362_1642190 Arabidopsis thaliana At5g67385 gene, complete
            cds.>gb:BT015895_1642513 Arabidopsis thaliana At5g67385
            gene, complete cds.
          Length = 604

 Score =  196 bits (499), Expect = 6e-49
 Identities = 124/332 (37%), Positives = 184/332 (55%), Gaps = 24/332 (7%)
 Frame = -1

Query: 1161 AFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGER-LFDLE 985
            A  ++FL  LLR AIFL T   C+ +LE R+   L    +DDLL+ S++F G+  +FD +
Sbjct: 282  AMSVSFLSMLLRAAIFLETTVACRLDLENRMGLQLGQAVLDDLLIPSYSFTGDHSMFDTD 341

Query: 984  SVRRIISGFVEKE-KSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNG 808
            +V+RI+  ++E E + V + N G      +  M+RVGK ++ Y+ EIA+   +S+ KF G
Sbjct: 342  TVQRILMNYLEFEVEGVRLSNNG---VDLAGDMERVGKLLENYMAEIASDRNVSLQKFIG 398

Query: 807  IANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR 628
            +A L+P+ +R  +D +YRA+DIYLKAHP + ++ER+KVCS+MD  KLS EA  HA+QN R
Sbjct: 399  LAELIPEQSRVTEDGMYRAVDIYLKAHPNMSDVERKKVCSLMDCQKLSREACAHAAQNDR 458

Query: 627  LPVQIVLHALYYDQLKIR--------SGAEDPKSTPNAIATRNQLQAD--VTLVKENEAL 478
            LPVQ ++  LYY+Q ++R        S A  P      +  +     D    L +EN+ L
Sbjct: 459  LPVQTIVQVLYYEQQRLRGEVTNDSDSPAPPPPQPAAVLPPKLSSYTDELSKLKRENQDL 518

Query: 477  RTELLQMKMFIADMQNXXXXXXXXXXXX-------XXXXVRKP-----TFFSSMSKKLGK 334
            + ELL+MKM + + +                          KP     +F +S+SKKLGK
Sbjct: 519  KLELLKMKMKLKEFEKESEKKTSSSTISTNPSSPISTASTGKPPLPRKSFINSVSKKLGK 578

Query: 333  LNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS 238
            LNPF      +    +G      P+ RR SIS
Sbjct: 579  LNPF------SITPYNGRGRTKPPKDRRHSIS 604



>gb:AC105928_1738265 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBa0014O06, complete sequence.
          Length = 626

 Score =  184 bits (467), Expect = 3e-45
 Identities = 126/344 (36%), Positives = 186/344 (54%), Gaps = 39/344 (11%)
 Frame = -1

Query: 1152 INFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERL---FDLES 982
            ++FL  LLR AI L T   C+ +LEKR++  L    +DDLL+ S + D       +D+++
Sbjct: 288  VSFLSMLLRAAIHLDTTLACRLDLEKRMAAQLGQAVLDDLLIPSSSPDAAAATTAYDIDA 347

Query: 981  VRRIISGFVEKEKS------VAVFNGGDFREVCS---TAMQRVGKTVDAYLGEIATHVEL 829
            V+RI++G+++ + +      +      DF    S   + + +VG+ +D+YL EIA+   L
Sbjct: 348  VQRILAGYLDLDYTTDPPPRLDYTTDDDFSSAASPPHSDVAQVGRLMDSYLAEIASDENL 407

Query: 828  SISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARV 649
            S+ KF  +A L+P+ AR  +D +YRAIDIYLKAHP L E ER+KVC  MD  KLS EA  
Sbjct: 408  SVDKFTALAELIPERARFNEDGMYRAIDIYLKAHPSLAEGERKKVCRAMDCQKLSREACA 467

Query: 648  HASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-----------------RNQ 520
            HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+                     R  
Sbjct: 468  HAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYRPTPSFNGRHRPG 527

Query: 519  LQADVT-LVKENEALRTELLQMKMFIADMQNXXXXXXXXXXXXXXXXVRKPT-------- 367
            +  +V+ L +EN+ LR ELL+MKM + D  +                 +KP         
Sbjct: 528  VPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGGVPPSGRPPLPKKPGGGGGGSSG 586

Query: 366  -FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS 238
             F +SMSKKLG+LNPF      +  L  G V    P+ RR SIS
Sbjct: 587  GFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKDRRHSIS 626



>gb:AB012242_1511718 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K24G6.
          Length = 614

 Score =  182 bits (463), Expect = 9e-45
 Identities = 117/309 (37%), Positives = 173/309 (55%), Gaps = 22/309 (7%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            PI+FL  LLR A+ L T+  C+ +LE+R+ + L+  T+DDLL+ SF   G+ LFD+++V 
Sbjct: 288  PISFLFGLLRRAVILDTSVSCRLDLERRLGSQLDMATLDDLLIPSFRHAGDTLFDIDTVH 347

Query: 975  RIISGFVEK-----EKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFN 811
            RI+  F ++     E   +VF          TAM +V K VD+YL EIA    L +SKF 
Sbjct: 348  RILVNFSQQGGDDSEDEESVFECDSPHSPSQTAMFKVAKLVDSYLAEIAPDANLDLSKFL 407

Query: 810  GIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK 631
             IA  +P  AR + D LYRAID+YLKAH  L + +++K+  ++D  KLS EA  HA+QN+
Sbjct: 408  LIAEALPPHARTLHDGLYRAIDLYLKAHQGLSDSDKKKLSKLIDFQKLSQEAGAHAAQNE 467

Query: 630  RLPVQIVLHALYYDQLKIRSGA------EDPK-----------STPNAIATRNQLQADVT 502
            RLP+Q ++  LY++QLK+RS        E+PK           ++    AT +      +
Sbjct: 468  RLPLQSIVQVLYFEQLKLRSSLCSSYSDEEPKPKQQQQQSWRINSGALSATMSPKDNYAS 527

Query: 501  LVKENEALRTELLQMKMFIADMQNXXXXXXXXXXXXXXXXVRKPTFFSSMSKKLGKLNPF 322
            L +EN  L+ EL +++M + D++                  RK  F SS SKK+GKL+ F
Sbjct: 528  LRRENRELKLELARLRMRLNDLEK---EHICMKRDMQRSHSRK--FMSSFSKKMGKLSFF 582

Query: 321  KHGSKDTSN 295
             H S   S+
Sbjct: 583  GHSSSRGSS 591



>gb:AC147427_1744693 Oryza sativa chromosome 3 B1394A07 genomic
            sequence, complete sequence.
          Length = 650

 Score =  167 bits (424), Expect = 3e-40
 Identities = 94/247 (38%), Positives = 152/247 (61%), Gaps = 13/247 (5%)
 Frame = -1

Query: 1134 LLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFV 955
            LLRTA+ L+ +  C + LEKRI   L+H T++DLL+ +F++  E L+++E V+RI+  F+
Sbjct: 330  LLRTAMILKASPTCISNLEKRIGMQLDHATLEDLLLPNFSYTMETLYNVECVQRILDHFL 389

Query: 954  EKEKSVAVFNG--GDFREVCSTA-MQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKG 784
              +++    +    D     S A +  V K +D YL EIA  + L + KF  +A+ VP+ 
Sbjct: 390  AMDQANGAASPCLDDVMASPSLAPITTVAKLIDGYLAEIAPDINLKLPKFQALASAVPEY 449

Query: 783  ARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLH 604
            AR +DD LYRAIDIYLKAH  L E ERE++C +MD  KLS EA  HA+QN+RLP+++V+ 
Sbjct: 450  ARPLDDGLYRAIDIYLKAHSWLSEAEREQLCRLMDCQKLSLEACTHAAQNERLPLRVVVQ 509

Query: 603  ALYYDQLKIRS----------GAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK 454
             L+++QL++R+            E  +   ++I T  +     T V+EN+ L+  +  M+
Sbjct: 510  VLFFEQLQLRTSIAGCLLVSDNLEGSRPLRSSITTSGEAGGWATAVRENQVLKVGMDNMR 569

Query: 453  MFIADMQ 433
            M +++++
Sbjct: 570  MRLSELE 576



>gb:AP004591_1842017 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0582D05.>gb:AP005250_1849561 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OSJNBb0009H02.
          Length = 641

 Score =  163 bits (413), Expect = 5e-39
 Identities = 95/251 (37%), Positives = 148/251 (58%), Gaps = 17/251 (6%)
 Frame = -1

Query: 1134 LLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFV 955
            LLRTAI L+ +  C + LE+RI   L+  T++DLL+ + +   E L+D++ V +I+  F+
Sbjct: 313  LLRTAIILKASPSCVSNLERRIGMQLDKATLEDLLIPNISESVETLYDVDCVHKILDHFL 372

Query: 954  EKEKSVAVFNGG---DFREVCSTAMQ---RVGKTVDAYLGEIATHVELSISKFNGIANLV 793
              ++     + G   D + + S ++     V K +D YL E+A  V L + KF  +A  +
Sbjct: 373  AMDQETGGASPGLGEDAQMLASPSLMPITMVAKLIDGYLAEVAPDVNLKLPKFRSLAAAI 432

Query: 792  PKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQI 613
            P  AR +DD LYRAIDIYLKAHP L E E+E++C VMD  KLS EA  HA+QN+RLP+++
Sbjct: 433  PDYARPIDDGLYRAIDIYLKAHPHLSESEKEELCRVMDCQKLSLEACTHAAQNERLPLRV 492

Query: 612  VLHALYYDQLKIRSG-AEDPKSTPNAIATRNQLQADVT----------LVKENEALRTEL 466
            ++  L+++QL++RS  AE    + N      QL   ++            +EN+ALR  +
Sbjct: 493  IVQVLFFEQLQLRSSIAECLMVSENLEGGSRQLIPTISGEQYRPGWPLASRENQALREGM 552

Query: 465  LQMKMFIADMQ 433
              MK  +AD++
Sbjct: 553  DNMKQRVADLE 563



>gb:AB013389_1512060 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K1F13.
          Length = 597

 Score =  163 bits (412), Expect = 7e-39
 Identities = 97/236 (41%), Positives = 144/236 (61%), Gaps = 5/236 (2%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLRTAI L  A  C++ LE++I + LE  T+DDLLV S+++  E L+D++ V RI+
Sbjct: 301  FLFGLLRTAIILNAAEICRDLLERKIGSQLERATLDDLLVPSYSYLNETLYDVDLVERIL 360

Query: 966  SGFVEK-EKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVP 790
              F++  E+S       D +   S ++  VGK +D +L EIA+   L   KF  +A  +P
Sbjct: 361  GHFLDTLEQSNTAIVEVDGK---SPSLMLVGKLIDGFLAEIASDANLKSDKFYNLAISLP 417

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
              AR  DD LYRA+D+YLKAHP + E EREK+C VMD  KL+ EA  HA+QN+RLP++ V
Sbjct: 418  DQARLYDDGLYRAVDVYLKAHPWVSEAEREKICGVMDCQKLTLEACTHAAQNERLPLRAV 477

Query: 609  LHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADV----TLVKENEALRTELLQMK 454
            +  L+++QL++R        T  A  + ++ Q D       V+EN+ LR ++  M+
Sbjct: 478  VQVLFFEQLQLRHAI---AGTLLAAQSPSKRQVDAGKWKKTVRENQVLRLDMDTMR 530



>gb:AY144442_1583524 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
            partial sequence.
          Length = 614

 Score =  160 bits (406), Expect = 4e-38
 Identities = 91/247 (36%), Positives = 149/247 (60%), Gaps = 7/247 (2%)
 Frame = -1

Query: 1152 INFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRR 973
            ++FL  +LR AI +  +  C+ E+EKRI   LE  ++DDLL+ S T   + +FD+++V R
Sbjct: 294  LSFLFGMLRMAIEVDASLDCRIEVEKRIGLQLEMASLDDLLIPS-TQTSDSMFDVDTVHR 352

Query: 972  IISGFVEK-------EKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKF 814
            I+  F+++       E S   ++    +    +++ +VG+ +D YL E+A    L + KF
Sbjct: 353  ILVNFLQRIDEDSSGELSPCGYDSDGLKSPSHSSVLKVGRLMDGYLAEVAPDPYLKLQKF 412

Query: 813  NGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN 634
              +  L+P  AR VDD LYRAIDIYLKAHP L E E +K+C ++D  KLS +A  HA+QN
Sbjct: 413  MALIELLPDYARIVDDGLYRAIDIYLKAHPSLTESECKKLCKLIDCQKLSQDASSHAAQN 472

Query: 633  KRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMK 454
             RLP+Q+V+  LY++QL+++SG      +P       Q     +L +EN  L+ E+ +M+
Sbjct: 473  DRLPIQMVVRVLYFEQLRLKSGVPSSCVSP-------QRDNYASLRRENRELKLEISRMR 525

Query: 453  MFIADMQ 433
            + + +++
Sbjct: 526  VRLTELE 532



>gb:AY049300_1561942 Arabidopsis thaliana AT5g66560/K1F13_23 mRNA,
            complete cds.>gb:BT001071_1635326 Arabidopsis thaliana
            At5g66560/K1F13_23 mRNA, complete cds.
          Length = 668

 Score =  159 bits (401), Expect = 1e-37
 Identities = 87/194 (44%), Positives = 125/194 (64%), Gaps = 3/194 (1%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLRTAI L  A  C++ LE++I + LE  T+DDLLV S+++  E L+D++ V RI+
Sbjct: 344  FLFGLLRTAIILNAAEICRDLLERKIGSQLERATLDDLLVPSYSYLNETLYDVDLVERIL 403

Query: 966  SGFV---EKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANL 796
              F+   E+  +  V   G      S ++  VGK +D +L EIA+   L   KF  +A  
Sbjct: 404  GHFLGTLEQSNTAIVEVDGK-----SPSLMLVGKLIDGFLAEIASDANLKSDKFYNLAIS 458

Query: 795  VPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQ 616
            +P  AR  DD LYRA+D+YLKAHP + E EREK+C VMD  KL+ EA  HA+QN+RLP++
Sbjct: 459  LPDQARLYDDGLYRAVDVYLKAHPWVSEAEREKICGVMDCQKLTLEACTHAAQNERLPLR 518

Query: 615  IVLHALYYDQLKIR 574
             V+  L+++QL++R
Sbjct: 519  AVVQVLFFEQLQLR 532



>gb:AF466200_1802233 Sorghum bicolor putative protein kinase gene,
            partial cds; putative Cf-2, fertilization-independent
            endosperm proteins, hypothetical protein, putative
            non-LTR retroelement reverse transcriptase, OCL5 protein,
            tryptophan synthase beta-subunit, hypothetical proteins,
            putative AP endonuclease, putative RNA polymerase II
            complex component SRB7, putative beta-1,3-glucanase,
            hypothetical protein, TNP2-like protein, hypothetical
            protein, putative phosphate/phosphoenolpyruvate
            translocator, putative protein, hypothetical proteins,
            putative galactosyltransferase family, hypothetical
            protein, putative cytochrome P450 family, putative lipid
            transfer protein, putative photoreceptor-interacting
            protein, and hypothetical protein genes, complete cds;
            and hypothetical protein gene, partial cds.
          Length = 658

 Score =  156 bits (395), Expect = 7e-37
 Identities = 91/258 (35%), Positives = 145/258 (56%), Gaps = 24/258 (9%)
 Frame = -1

Query: 1134 LLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFV 955
            LLRTAIFL+ +  C + LE+RI   L+  +++DLL+ + +   E L+D++  +RI+  F+
Sbjct: 313  LLRTAIFLKASPSCVSNLERRIGMQLDKASLEDLLIPNVSDSVETLYDVDCAQRILDHFL 372

Query: 954  EKEKSVAVFNGG---DFREVCSTAMQ---RVGKTVDAYLGEIATHVELSISKFNGIANLV 793
              ++     + G   D + + S ++     V K +D YL E+A  + L + KF  +A  +
Sbjct: 373  AMDQETGGASPGIGEDGQMLASPSLMPIMMVAKLIDGYLAEVAPDMNLKLPKFRSLAAAI 432

Query: 792  PKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQI 613
            P  AR +DD LYRAIDIYLKAHP L E E+E++C VMD  KLS EA  HA+QN+RLP++I
Sbjct: 433  PDYARPIDDGLYRAIDIYLKAHPHLSESEKEELCRVMDCQKLSLEACTHAAQNERLPLRI 492

Query: 612  VLHALYYDQLKIRSG------AEDPKSTPNAIATRNQL------------QADVTLVKEN 487
            ++  L+++QL++RS         +P      +    QL                   +EN
Sbjct: 493  IVQVLFFEQLQLRSSIAECLMISEPLDGGGGVGPSRQLGGLPVSGEHHRGAGWPLAAREN 552

Query: 486  EALRTELLQMKMFIADMQ 433
            + LR  +  MK  +A+++
Sbjct: 553  QTLREGMDSMKQRVAELE 570



>gb:AC012562_1537723 Arabidopsis thaliana chromosome 3 BAC F17O14
            genomic sequence, complete sequence.
          Length = 582

 Score =  155 bits (393), Expect = 1e-36
 Identities = 103/308 (33%), Positives = 169/308 (54%), Gaps = 8/308 (2%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P+ FL  +L+    +     C+ ELE+RI   LE  ++DDLL+ S   + + ++D+++V 
Sbjct: 275  PLGFLFGMLKVGTIIDIEISCRLELERRIGHQLETASLDDLLIPSVQNE-DSMYDVDTVH 333

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCS-TAMQRVGKTVDAYLGEIATHVELSISKFNGIAN 799
            RI++ F+E+ +      G D       +++ +VG+ +DAYL EIA    LS+ KF  I  
Sbjct: 334  RILTFFLERIEEEDDECGYDSDSTGQHSSLLKVGRIMDAYLVEIAPDPYLSLHKFTAIIE 393

Query: 798  LVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPV 619
             +P+ +R VDD +YRAID+YLKAHP L E ER+K+C+ +D  KLS EA  H +QN RLPV
Sbjct: 394  TLPEHSRIVDDGIYRAIDMYLKAHPLLTEEERKKLCNFIDCKKLSQEASNHVAQNDRLPV 453

Query: 618  QIVLHALYYDQLKIR---SGAEDPKS--TPNAIATRNQLQAD--VTLVKENEALRTELLQ 460
            Q+V+  LY +QL+++   SG  +  S   P+ + +R     D    L +EN  L+ E+ +
Sbjct: 454  QMVVRVLYTEQLRLKKALSGDSEEGSWVLPSGVQSRAVSPRDTYAALRRENRELKLEISR 513

Query: 459  MKMFIADMQNXXXXXXXXXXXXXXXXVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGE 280
            M++ +++++                     TF +S+SK +G++  F   ++   N     
Sbjct: 514  MRVRVSELEK--EHNLMKHEMMEKSGNNGGTFLTSLSKGIGRIATFGGETRQKVNRKSRS 571

Query: 279  VDITKPRR 256
            V   K  R
Sbjct: 572  VSERKSSR 579



>gb:AC012562_1537714 Arabidopsis thaliana chromosome 3 BAC F17O14
            genomic sequence, complete sequence.
          Length = 612

 Score =  152 bits (383), Expect = 2e-35
 Identities = 96/301 (31%), Positives = 165/301 (54%), Gaps = 20/301 (6%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P++FL  +LR  I +  A  C+ ELE+RI+  LE V++DDLL+     DG+ ++D+++V 
Sbjct: 286  PLSFLFGMLRVGITINVAISCRLELERRIAQQLETVSLDDLLI-PVVRDGDSMYDVDTVH 344

Query: 975  RIISGFVEKEKSVAVFNGGDFRE---------VCSTAMQRVGKTVDAYLGEIATHVELSI 823
            RI+  F++K +    ++     E         +C +++ +VG+ +DAYL EIA    LS+
Sbjct: 345  RILVCFLKKIEEEEEYDEDCCYENETENLTGSMCHSSLLKVGRIMDAYLAEIAPDPCLSL 404

Query: 822  SKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHA 643
             KF  +  ++P  AR +DD LYRAID++LK HP L+E E + +C  +D  KLS EA  H 
Sbjct: 405  HKFMALIEILPDYARVMDDGLYRAIDMFLKGHPSLNEQECKSLCKFIDTQKLSQEACNHV 464

Query: 642  SQNKRLPVQIVLHALYYDQLKIR---SG--------AEDPKSTPNAIATRNQLQADVTLV 496
            +QN RLP+Q+V+  LY +QL+++   SG        +    S+ N     +      +L 
Sbjct: 465  AQNDRLPMQMVVRVLYSEQLRMKNVMSGESGEGLLLSSQKHSSENPSRAVSPRDTYASLR 524

Query: 495  KENEALRTELLQMKMFIADMQNXXXXXXXXXXXXXXXXVRKPTFFSSMSKKLGKLNPFKH 316
            +EN  L+ E+ ++++ + +++                     T  +S+SK +G+++ F  
Sbjct: 525  RENRELKLEISRVRVRLTELEKEQILMKQGMMEKSGHGG---TLLTSLSKGIGRISIFGG 581

Query: 315  G 313
            G
Sbjct: 582  G 582



>gb:AB006704_1509977 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MSH12.
          Length = 591

 Score =  152 bits (383), Expect = 2e-35
 Identities = 88/244 (36%), Positives = 141/244 (57%), Gaps = 13/244 (5%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLRT++ L  +   +  LEKRI   L+   ++DLL+ +  + GE L+D +SV+RI+
Sbjct: 304  FLLRLLRTSMVLHASQVTQETLEKRIGMQLDEAALEDLLIPNMKYSGETLYDTDSVQRIL 363

Query: 966  SGFVEKEKSVAVFNG---GDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANL 796
              F+    S  V      GD   + S  + +V   +D YL E+A+   L +SKF  +  L
Sbjct: 364  DHFMLTFDSSIVEEKQMMGDSHPLKS--ITKVASLIDGYLAEVASDENLKLSKFQALGAL 421

Query: 795  VPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQ 616
            +P+  R +DD +YRAIDIY+KAHP L E ERE++C +M+  KLS EA  HA+QN+RLP++
Sbjct: 422  IPEDVRPMDDGIYRAIDIYIKAHPWLTESEREQLCLLMNCQKLSLEACTHAAQNERLPLR 481

Query: 615  IVLHALYYDQLKIRS-------GAEDPKSTPNAIATRNQLQADVTLVKENE---ALRTEL 466
            +++  L+++Q+++R+       G+E+   T  A+       A++ +    E    L  E 
Sbjct: 482  VIVQVLFFEQMRLRTSIAGWLFGSEENNDTSGALEGNKNTNANMVMHGMRERVFELEKEC 541

Query: 465  LQMK 454
            + MK
Sbjct: 542  MSMK 545



>gb:AC099043_1737016 Oryza sativa chromosome 3 BAC OSJNBa0079B15
            genomic sequence, complete sequence.>gb:AC107207_1738374
            Oryza sativa chromosome 3 BAC OSJNBb0106M04 genomic
            sequence, complete sequence.
          Length = 725

 Score =  150 bits (380), Expect = 4e-35
 Identities = 85/192 (44%), Positives = 122/192 (63%), Gaps = 5/192 (2%)
 Frame = -1

Query: 1134 LLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFV 955
            LLRT   L+ +   ++ LE+RI+  L    +DDLL+ S+++  E L+D+E V RI+  F+
Sbjct: 407  LLRTTSILQASESARDMLERRIAARLPDAALDDLLIPSYSYLVETLYDVECVERIVRYFL 466

Query: 954  E-KEKSVAVFNGGDF----REVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVP 790
            E ++      +G +     RE    AM  VG+ +DAYLGEIA    L   KF  +A  +P
Sbjct: 467  EGRDADDGNDDGSELETPGREASRRAMLAVGRLMDAYLGEIAADANLKPDKFCDLAWALP 526

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
             GAR  DD LYRA+DIYLKAHP L E E+EKV  V+D  KL+ EA  HA+QN+RLP++ V
Sbjct: 527  DGARVYDDGLYRAVDIYLKAHPGLREEEKEKVSGVVDGRKLTLEACTHAAQNERLPLRTV 586

Query: 609  LHALYYDQLKIR 574
            +  L+++QL++R
Sbjct: 587  VQVLFFEQLQLR 598



>pir|T45850|T45850 hypothetical protein F3A4.50 - Arabidopsis
            thaliana>gb:ATF3A4_1550551 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F3A4.
          Length = 526

 Score =  150 bits (380), Expect = 4e-35
 Identities = 107/316 (33%), Positives = 165/316 (52%), Gaps = 11/316 (3%)
 Frame = -1

Query: 1152 INFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGER-LFDLESVR 976
            ++FL  LLR AI+L T   C+ +LEKR+   L    +DDLL+  ++F+G+  + D+++V+
Sbjct: 244  VSFLSILLRAAIYLETTVACRLDLEKRMGLQLRQAVIDDLLIPYYSFNGDNTMLDVDTVQ 303

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANL 796
            RI+  ++E E      N  DF          +G+ ++ YL EIA+   ++ +KF G A  
Sbjct: 304  RILMNYLEFEVEG---NSADFAS-------DIGELMETYLAEIASDRNINFAKFIGFAEC 353

Query: 795  VPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQ 616
            +PK +R     +YRAIDI+LK HP + E+E++KVCS+MD  KLS +   HA+QN R    
Sbjct: 354  IPKQSR-----MYRAIDIFLKTHPNISEVEKKKVCSLMDCKKLSRDVYAHAAQNDRFQ-- 406

Query: 615  IVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADM 436
                 L        + AE   S P   + +N+L     L +EN+ L+ ELL++KM   ++
Sbjct: 407  ---ENLSNSDSPAPATAEKTLSPPELSSYKNELS---KLNRENQYLKLELLKVKMKFKEL 460

Query: 435  QNXXX----XXXXXXXXXXXXXVRKP-----TFFSSMSKKLGKL-NPFKHGSKDTSNLDD 286
            +                     V KP     +F +S+S+KLGKL NPF         L  
Sbjct: 461  EKEKAFEVMSGSDCSSSVSTASVAKPRLPRKSFINSVSQKLGKLINPF--------GLKQ 512

Query: 285  GEVDITKPRRRRFSIS 238
            G+    +P+ RR SIS
Sbjct: 513  GQT--KQPKSRRHSIS 526



>pir|G86428|G86428 F26G16.2 protein - Arabidopsis
            thaliana>gb:AE005172_891887 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:F26G16_1678079 Arabidopsis thaliana
            chromosome 1 BAC F26G16 sequence, complete sequence.
          Length = 662

 Score =  150 bits (379), Expect = 5e-35
 Identities = 92/268 (34%), Positives = 144/268 (53%), Gaps = 27/268 (10%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P  F   +LR A  L+ +  C   LEKRI   L+   ++DL++ SF+   E L+D++SV+
Sbjct: 304  PTKFFVDMLRIAKILKASPDCIANLEKRIGMQLDQAALEDLVMPSFSHTMETLYDVDSVQ 363

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCS----------TAMQRVGKTVDAYLGEIATHVELS 826
            RI+  F+  ++ +    G     V            T M  V K +D YL E+A  V L 
Sbjct: 364  RILDHFLGTDQIMPGGVGSPCSSVDDGNLIGSPQSITPMTAVAKLIDGYLAEVAPDVNLK 423

Query: 825  ISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVH 646
            + KF  +A  +P+ AR +DD LYRAIDIYLK HP L E ERE +C ++D  KLS EA  H
Sbjct: 424  LPKFQALAASIPEYARLLDDGLYRAIDIYLKHHPWLAETERENLCRLLDCQKLSLEACTH 483

Query: 645  ASQNKRLPVQIVLHALYYDQLKIRSGAEDP-KSTPNAIATRNQLQAD------------- 508
            A+QN+RLP++I++  L+++QL++R+        + N      QL++              
Sbjct: 484  AAQNERLPLRIIVQVLFFEQLQLRTSVAGCFLVSDNLDGGSRQLRSGGYVGGPNEGGGGG 543

Query: 507  ---VTLVKENEALRTELLQMKMFIADMQ 433
                T V+EN+ L+  +  M+M + +++
Sbjct: 544  GGWATAVRENQVLKVGMDSMRMRVCELE 571



>gb:AP003224_1825592 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0010B10.
          Length = 659

 Score =  149 bits (375), Expect = 1e-34
 Identities = 82/208 (39%), Positives = 123/208 (59%), Gaps = 16/208 (7%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  +LRTA+ L  +  C+  LE+RI   LE   +DDLLV +  +  E L+D++ V+RI+
Sbjct: 341  FLLGMLRTAMLLHASPLCRENLERRIGAQLEDACLDDLLVPNLGYTVETLYDIDCVQRIL 400

Query: 966  SGF----------------VEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHV 835
              F                VE+   +   + G    +    M  V K +D YL E+A   
Sbjct: 401  DYFMSSTDGLGTGYTSPAVVEEGSQLGALHAGSPSSLSPITM--VAKLMDGYLAEVAPDT 458

Query: 834  ELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEA 655
             L + KF  +A +VP  AR VDD +YRA+DIYLK+HP L E ERE++C +M+  KLS EA
Sbjct: 459  NLKLPKFQALAAVVPDYARPVDDGIYRAMDIYLKSHPWLSESEREQLCRLMNCQKLSLEA 518

Query: 654  RVHASQNKRLPVQIVLHALYYDQLKIRS 571
              HA+QN+RLP+++V+  L+++QL++R+
Sbjct: 519  CTHAAQNERLPLRVVVQVLFFEQLRLRT 546



>gb:AY094473_1575768 Arabidopsis thaliana AT3g50840/F18B3_120 mRNA,
            complete cds.>gb:BT004531_1637565 Arabidopsis thaliana
            At3g50840/F18B3_120 gene, complete cds.
          Length = 569

 Score =  148 bits (374), Expect = 2e-34
 Identities = 90/235 (38%), Positives = 137/235 (58%), Gaps = 1/235 (0%)
 Frame = -1

Query: 1134 LLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFV 955
            LLR AI L  +  C+  LEK+I + LE  T+DDLL+ S+++  E L+D++ V R++  F+
Sbjct: 287  LLRAAIILNASENCRKFLEKKIGSNLEKATLDDLLIPSYSYLNETLYDIDLVERLLRRFL 346

Query: 954  EKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARK 775
            E   +VAV          S+++  VG+ +D  LGEIA+   L   +F  +A L+P  AR 
Sbjct: 347  E---NVAV---------SSSSLTVVGRLIDGVLGEIASDANLKPEQFYNLAVLLPVQARV 394

Query: 774  VDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALY 595
             DD LYRA+DIY K H  + E E+EK+CSVMD  KL+ E   HA+QN+RLP++ V+  L+
Sbjct: 395  YDDGLYRAVDIYFKTHSWILEEEKEKICSVMDCRKLTVEGCTHAAQNERLPLRAVVQVLF 454

Query: 594  YDQLKIRSGAEDPKST-PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ 433
             +QL++R        T  +   T   L      VKEN+ LR ++  M+  +  ++
Sbjct: 455  LEQLQLRQVITGTLLTEEDGDKTVVDLGRWKEAVKENQVLRLDMDTMRTRVNQLE 509



>pir|T08405|T08405 hypothetical protein F18B3.120 - Arabidopsis
            thaliana>gb:ATF18B3_1549088 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F18B3.
          Length = 567

 Score =  148 bits (374), Expect = 2e-34
 Identities = 90/235 (38%), Positives = 137/235 (58%), Gaps = 1/235 (0%)
 Frame = -1

Query: 1134 LLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFV 955
            LLR AI L  +  C+  LEK+I + LE  T+DDLL+ S+++  E L+D++ V R++  F+
Sbjct: 285  LLRAAIILNASENCRKFLEKKIGSNLEKATLDDLLIPSYSYLNETLYDIDLVERLLRRFL 344

Query: 954  EKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARK 775
            E   +VAV          S+++  VG+ +D  LGEIA+   L   +F  +A L+P  AR 
Sbjct: 345  E---NVAV---------SSSSLTVVGRLIDGVLGEIASDANLKPEQFYNLAVLLPVQARV 392

Query: 774  VDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALY 595
             DD LYRA+DIY K H  + E E+EK+CSVMD  KL+ E   HA+QN+RLP++ V+  L+
Sbjct: 393  YDDGLYRAVDIYFKTHSWILEEEKEKICSVMDCRKLTVEGCTHAAQNERLPLRAVVQVLF 452

Query: 594  YDQLKIRSGAEDPKST-PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ 433
             +QL++R        T  +   T   L      VKEN+ LR ++  M+  +  ++
Sbjct: 453  LEQLQLRQVITGTLLTEEDGDKTVVDLGRWKEAVKENQVLRLDMDTMRTRVNQLE 507



>gb:AY448010S4_1606587 Ipomoea trifida haplotype S1
            self-incompatibility (S-) locus, contig SR4.
          Length = 652

 Score =  147 bits (372), Expect = 3e-34
 Identities = 89/255 (34%), Positives = 146/255 (57%), Gaps = 17/255 (6%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLR A+ L     C+  LE+RI   L   T+D LL+ S++ D + L++ + V R+I
Sbjct: 327  FLLGLLRVALILGINHSCQETLERRIGMQLHLATLDSLLIPSYS-DSDTLYNTDCVERMI 385

Query: 966  SGFVEKEKSVAVFNGGDF---REVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANL 796
              F+  E +V   +   F       S  + RV K +D+Y+ EIA+ V L   +   +A  
Sbjct: 386  HHFIS-EPAVTTVSPSSFDLGTSPSSEPLCRVAKLMDSYIAEIASDVNLKPERIRALAEA 444

Query: 795  VPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQ 616
            +P  +R + D LYRA+DIY KAHP L + ++E++C+++D  KLS +A  HASQN+RLP++
Sbjct: 445  LPDSSRSLHDGLYRAVDIYFKAHPWLPDRDKEQLCNIIDFQKLSIDACAHASQNERLPLR 504

Query: 615  IVLHALYYDQLKIR-------------SGAEDPKSTPNAIATR-NQLQADVTLVKENEAL 478
            I+L  L+++QL++R             S    P + P+ +A    Q    VT+V+EN+ L
Sbjct: 505  IILQVLFFEQLQLRTALAGCLHVLDTESANAAPAAGPSDMAGHIVQRDGWVTVVRENQVL 564

Query: 477  RTELLQMKMFIADMQ 433
            R +L +M+  + +++
Sbjct: 565  RVDLERMRSRVRELE 579



>gb:AC117988_1739426 Oryza sativa chromosome 3 BAC OSJNBa0057G07
            genomic sequence, complete sequence.
          Length = 632

 Score =  146 bits (368), Expect = 9e-34
 Identities = 83/208 (39%), Positives = 122/208 (58%), Gaps = 17/208 (8%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLRTA  LR +      LE++ +T LEH T++D+L+ S++   E L+D++ V R++
Sbjct: 273  FLFALLRTAHILRASDAACAALERKAATQLEHATLEDVLIPSYSGATETLYDVDCVERVV 332

Query: 966  SGFVEKEKSVAVFNGGDFREVCST-----------------AMQRVGKTVDAYLGEIATH 838
              F+ +E+               T                 AM  VGK VD+YL EIA+ 
Sbjct: 333  RHFLAEEEDHGEAEASTSAAAAITEEAPAPAATTLSRPSAVAMVHVGKLVDSYLAEIASD 392

Query: 837  VELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYE 658
              L  +KF  +A  +P  AR  DD +YRA+DIYLKAHP+L   ER++VC V+D  KL+ E
Sbjct: 393  ANLKPAKFCELALALPDHARVYDDGVYRAVDIYLKAHPRLAAEERDRVCGVVDCRKLTVE 452

Query: 657  ARVHASQNKRLPVQIVLHALYYDQLKIR 574
            A  HA+QN+RLP++ VL  L+++QL++R
Sbjct: 453  ACTHAAQNERLPLRAVLQVLFFEQLQLR 480



>gb:OSJN00101_1694921 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0034I13, complete sequence.
          Length = 644

 Score =  145 bits (367), Expect = 1e-33
 Identities = 82/202 (40%), Positives = 119/202 (58%), Gaps = 10/202 (4%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLRTA  L     C++ LE+     LE   ++DLL+ +  +  E L+D++ V+R++
Sbjct: 309  FLLGLLRTATILNAGAACRDALERMAGNQLEEAALEDLLIPNTGYAVETLYDVDCVQRML 368

Query: 966  SGFVEKEKSV----------AVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISK 817
              FV    S           A    G   E+    +  V K VD YL E+AT   + +SK
Sbjct: 369  EQFVAANTSAFAASPEITDEAQLVDGPSGELMP--ISTVAKLVDGYLAEVATDTNVKLSK 426

Query: 816  FNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQ 637
            F  IA LVP  AR +DD +YRAIDIYLKAH  L   ERE++C +M+  KLS EA  HA+Q
Sbjct: 427  FQSIAELVPDYARAIDDGIYRAIDIYLKAHSWLTASEREQLCRLMNCQKLSLEACTHAAQ 486

Query: 636  NKRLPVQIVLHALYYDQLKIRS 571
            N+RLP+++V+  L+++QL++R+
Sbjct: 487  NERLPLRVVVQVLFFEQLRLRT 508



>pir|D84920|D84920 hypothetical protein At2g47860 [imported] -
            Arabidopsis thaliana>gb:AC005309_1532462 Arabidopsis
            thaliana chromosome 2 clone F17A22 map CIC06C03, complete
            sequence.>gb:AC006072_1533395 Arabidopsis thaliana
            chromosome 2 clone T9J23 map CIC06C03, complete sequence.
          Length = 635

 Score =  144 bits (363), Expect = 3e-33
 Identities = 106/359 (29%), Positives = 175/359 (48%), Gaps = 50/359 (13%)
 Frame = -1

Query: 1164 AAFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLE 985
            ++ PI+FL  LL+TAI   T+  C+++LE+RIS +L+   ++D+L+ +   +   ++D +
Sbjct: 286  SSIPISFLSSLLKTAIGSGTSVSCRSDLERRISHLLDQAILEDILIPA---NIGAMYDTD 342

Query: 984  SVRRIISGFV-------------------EKEKSVAVFNGGDFREVCSTAMQRVGKTVDA 862
            SV+RI S F+                   E E ++  F G +  +   +++ +V K +D+
Sbjct: 343  SVQRIFSMFLNLDECEYRDDDDDEEDAVDESEMAMYDFEGAESPK--QSSIFKVSKLMDS 400

Query: 861  YLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM 682
            YL E+A    L  SKF  +A L+P  AR V D LYRA+DI+LK HP + + ER ++C  +
Sbjct: 401  YLAEVALDSSLPPSKFIALAELLPDHARVVCDGLYRAVDIFLKVHPHMKDSERYRLCKTV 460

Query: 681  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST-----------PN-- 541
               KLS +A  HA+QN+RLPVQI +  L+Y+Q ++++       T           PN  
Sbjct: 461  SCKKLSQDASSHAAQNERLPVQIAVQVLFYEQTRLKNAMTSGGGTGGSNQSQFFLFPNRS 520

Query: 540  -------AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNXXXXXXXXXXXXXXXX 382
                   AI+ R+      ++ +EN  LR E+ +M+M + D++                 
Sbjct: 521  GSGMASGAISPRDNY---ASVRRENRELRLEVARMRMRLTDLEK-DHVSMKRDFVKPQSR 576

Query: 381  VRKPTFFSSMSKKLGKLNPF-----------KHGSKDTSNLDDGEVDITKPRRRRFSIS 238
             R+      +S+ L KLN               G K T    + E      +RR  S+S
Sbjct: 577  RRRYGMLRKLSRGLNKLNAIVLRFRSSQSVASSGKKHTEEKTNSERRFMFQKRRCHSVS 635



>gb:AF180390_1774821 Arabidopsis thaliana non-phototropic hypocotyl 3
            (NPH3) mRNA, complete cds.
          Length = 745

 Score =  143 bits (361), Expect = 6e-33
 Identities = 83/213 (38%), Positives = 124/213 (58%), Gaps = 22/213 (10%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRI 970
            +FL  LLR A  L+ A     ELEKR+    E  T+ DLL+  +   GE ++D++ V+R+
Sbjct: 393  SFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDLLIPGYNNKGETMYDVDLVQRL 452

Query: 969  ISGFVEKEK-------------SVAVF---------NGGDFREVCSTAMQRVGKTVDAYL 856
            +  F+ +E+             S +++         NGG        A  RV + VD+YL
Sbjct: 453  LEHFLVQEQTEGSSPSRMSPSPSQSMYADIPRGNNNNGGGGGGNNQNAKMRVARLVDSYL 512

Query: 855  GEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP 676
             E+A    L ++KF  +A  +P+ AR  DD LYRAID YLKAHP L E ER+++C VMD 
Sbjct: 513  TEVARDRNLPLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDC 572

Query: 675  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKI 577
             KLS +A +HA+QN+RLP+++V+  L+ +Q+KI
Sbjct: 573  QKLSMDACMHAAQNERLPLRVVVQVLFSEQVKI 605



>gb:AB008268_1510462 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MSJ1.
          Length = 745

 Score =  143 bits (361), Expect = 6e-33
 Identities = 83/213 (38%), Positives = 124/213 (58%), Gaps = 22/213 (10%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRI 970
            +FL  LLR A  L+ A     ELEKR+    E  T+ DLL+  +   GE ++D++ V+R+
Sbjct: 393  SFLLRLLRAANMLKVAPALITELEKRVGMQFEQATLQDLLIPGYNNKGETMYDVDLVQRL 452

Query: 969  ISGFVEKEK-------------SVAVF---------NGGDFREVCSTAMQRVGKTVDAYL 856
            +  F+ +E+             S +++         NGG        A  RV + VD+YL
Sbjct: 453  LEHFLVQEQTEGSSPSRMSPSPSQSMYADIPRGNNNNGGGGGGNNQNAKMRVARLVDSYL 512

Query: 855  GEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP 676
             E+A    L ++KF  +A  +P+ AR  DD LYRAID YLKAHP L E ER+++C VMD 
Sbjct: 513  TEVARDRNLPLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDC 572

Query: 675  LKLSYEARVHASQNKRLPVQIVLHALYYDQLKI 577
             KLS +A +HA+QN+RLP+++V+  L+ +Q+KI
Sbjct: 573  QKLSMDACMHAAQNERLPLRVVVQVLFSEQVKI 605



>pir|T48346|T48346 photoreceptor-interacting protein-like -
            Arabidopsis thaliana>gb:AB005240_1509473 Arabidopsis
            thaliana genomic DNA, chromosome 5, P1
            clone:MOK16.>gb:ATF15A17_1548661 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F15A17 (ESSA project).
          Length = 592

 Score =  139 bits (350), Expect = 1e-31
 Identities = 79/208 (37%), Positives = 119/208 (57%), Gaps = 13/208 (6%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P  FL  LL+TA+ L  +   +  LE+RI   L+   + DLL+ +  +  E L+D+E V 
Sbjct: 303  PTKFLLRLLQTAMVLHASQSSRENLERRIGNQLDQAALVDLLIPNMGYS-ETLYDVECVL 361

Query: 975  RIISGFVEK-------------EKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHV 835
            R+I  FV               E+   V +G D      T    V   VD YL E+A  V
Sbjct: 362  RMIEQFVSSTEQAGIVPSPCIIEEGHLVKDGADLL----TPTTLVATLVDGYLAEVAPDV 417

Query: 834  ELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEA 655
             L ++KF  IA  +P  AR +DD +Y AID+YLKAHP + + ERE +C +M+  KLS EA
Sbjct: 418  NLKLAKFEAIAAAIPDYARPLDDGVYHAIDVYLKAHPWITDSEREHICRLMNCQKLSLEA 477

Query: 654  RVHASQNKRLPVQIVLHALYYDQLKIRS 571
              HA+QN+RLP+++++  L+++QL++R+
Sbjct: 478  STHAAQNERLPLRVIVQVLFFEQLRLRT 505



>pir|G86160|G86160 protein F10O3.17 [imported] - Arabidopsis
            thaliana>gb:AE005172_889320 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:F10O3_1677295
            Arabidopsis thaliana chromosome 1 BAC F10O3 sequence,
            complete sequence.
          Length = 634

 Score =  138 bits (347), Expect = 2e-31
 Identities = 95/349 (27%), Positives = 165/349 (47%), Gaps = 40/349 (11%)
 Frame = -1

Query: 1164 AAFPINFLCCLLRTAIFLRTATG---CKNELEKRISTILEHVTVDDLLV-LSFTFDGERL 997
            ++ P+ FL  LL+  I   ++     C+++LE+RI   L+   ++D+L+ ++       +
Sbjct: 290  SSVPMAFLSSLLKMVIATSSSASTGSCRSDLERRIGLQLDQAILEDVLIPINLNGTNNTM 349

Query: 996  FDLESVRRIISGFVE---------------KEKSVAVFNGGDFREVCSTAMQRVGKTVDA 862
            +D++S+ RI S F+                ++++  +++         +++ +V K +D 
Sbjct: 350  YDIDSILRIFSIFLNLDEDDEEEEHHHLQFRDETEMIYDFDSPGSPKQSSILKVSKLMDN 409

Query: 861  YLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVM 682
            YL EIA    L+ SKF  +A L+P  AR + D LYRA+DIYLK HP + + ER ++C  +
Sbjct: 410  YLAEIAMDPNLTTSKFIALAELLPDHARIISDGLYRAVDIYLKVHPNIKDSERYRLCKTI 469

Query: 681  DPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD-- 508
            D  KLS EA  HA+QN+RLPVQ+ +  LY++Q+++R+           +   N  Q    
Sbjct: 470  DSQKLSQEACSHAAQNERLPVQMAVQVLYFEQIRLRNAMSSSIGPTQFLFNSNCHQFPQR 529

Query: 507  ----------------VTLVKENEALRTELLQMKMFIADMQNXXXXXXXXXXXXXXXXVR 376
                             ++ +EN  L+ E+ +M+M + D++                   
Sbjct: 530  SGSGAGSGAISPRDNYASVRRENRELKLEVARMRMRLTDLEKDHISIKQELVKSNPGT-- 587

Query: 375  KPTFFSSMSKKLGKLN---PFKHGSKDTSNLDDGEVDITKPRRRRFSIS 238
                F S +KK+ KLN    F       S     E      R+RR S+S
Sbjct: 588  --KLFKSFAKKISKLNSLFSFSSLKPSLSGKASSESRFLFQRKRRHSVS 634



>gb:AB186127_1529351 Oryza sativa (japonica cultivar-group) mRNA for
            NPH3, complete cds.
          Length = 762

 Score =  133 bits (334), Expect = 8e-30
 Identities = 98/291 (33%), Positives = 147/291 (50%), Gaps = 52/291 (17%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDG-ERLFDLESVRRI 970
            FL  LLR AI LR A     ELEKR+   LE   + DLL+ S+     +  +D++ V+R+
Sbjct: 389  FLLRLLRLAIMLRAAPALVTELEKRVGMQLEQAALADLLIPSYGGRAADTAYDVDLVQRL 448

Query: 969  ISGF-VEKEKSVAVFNG---GD---------------------FREVCST----AMQRVG 877
            +  F V+++  +AV +    GD                          ST    A  RV 
Sbjct: 449  VEHFLVQEQTEMAVASSPGRGDPPPPPQPEYYSGRMPPSSAAAASASASTGGLNAKARVA 508

Query: 876  KTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREK 697
            + +D+YL E++    LS++KF  +A  +P+ AR  DD LYRA+D YLKAHP L E ER++
Sbjct: 509  RLLDSYLSEVSRDRNLSLTKFQVLAESLPESARACDDGLYRAVDSYLKAHPTLTEHERKR 568

Query: 696  VCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKI-------------RSGAEDP 556
            +C VMD  KLS++A +HA+QN+RLP+++V+  L+ +Q+KI              S A   
Sbjct: 569  LCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFTEQVKISNALASSSAALRSSSSAPGA 628

Query: 555  KSTPNAIATRNQL---------QADVTLVKENEALRTELLQMKMFIADMQN 430
             + P    TR QL         +      K+   L+ EL  MK    ++Q+
Sbjct: 629  DAAPAMPTTRRQLLDGTPQSFQEGWAAAKKDINTLKFELESMKAKYLELQH 679



>pir|T51779|T51779 non-phototropic hypocotyl 3-like protein -
            Arabidopsis thaliana>gb:ATF28D10_1550295 Arabidopsis
            thaliana DNA chromosome 3, BAC clone F28D10.
          Length = 661

 Score =  133 bits (334), Expect = 8e-30
 Identities = 81/251 (32%), Positives = 138/251 (54%), Gaps = 13/251 (5%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLR A  L     C  +LEKRI   LE  T+D+LL+L+++ D E L++++ V RI+
Sbjct: 358  FLLGLLRVAFILGVDGNCVKKLEKRIGMQLELATLDNLLILNYS-DSETLYNVDCVERIV 416

Query: 966  SGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPK 787
              F                           + VD+Y+ E+A+ V L   K   +A  +P+
Sbjct: 417  RHF--------------------------WRLVDSYMAEVASDVNLKPDKMRSLAAALPE 450

Query: 786  GARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVL 607
             +R + D LYRA DIY K HP L + ++E++C++MD  +LS +A  HAS N RLP+++VL
Sbjct: 451  SSRPLYDGLYRAFDIYFKEHPWLSDRDKEQLCNIMDYQRLSIDACAHASHNDRLPLRVVL 510

Query: 606  HALYYDQLKIR---SGAEDPKSTPNAIAT--------RNQLQAD--VTLVKENEALRTEL 466
              L+++Q+ +R   +G  +  +T  A A         +  +Q D  VT+V++N+ L+ ++
Sbjct: 511  QVLFFEQMHLRTALAGGLNVANTETAHAVTIPGGRTGQEIVQRDGWVTVVRQNQVLKVDM 570

Query: 465  LQMKMFIADMQ 433
             +M+  + +++
Sbjct: 571  QKMRSRVGELE 581



>pir|G96701|G96701 unknown protein, 76653-74502 [imported] -
            Arabidopsis thaliana>gb:AE005173_894412 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC012563_1537764 Arabidopsis thaliana
            chromosome 1 BAC T23K23 genomic sequence, complete
            sequence.>gb:AY120729_1579611 Arabidopsis thaliana
            unknown protein (At1g67900) mRNA, complete
            cds.>gb:BT008787_1639983 Arabidopsis thaliana At1g67900
            gene, complete cds.
          Length = 631

 Score =  131 bits (329), Expect = 3e-29
 Identities = 82/221 (37%), Positives = 124/221 (56%), Gaps = 27/221 (12%)
 Frame = -1

Query: 1161 AFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLES 982
            A   +FL  LL+ A  L  +T  K EL +R++  LE  TV DLL+   ++  E L+D++ 
Sbjct: 289  AVSCSFLLKLLKAANILNASTSSKMELARRVALQLEEATVSDLLIPPMSYKSELLYDVDI 348

Query: 981  VRRIISGFV--------------------EKEKSVAVFNGG-DFRE------VCSTAMQR 883
            V  I+  F+                     + +S +  N   +F+E         ++  +
Sbjct: 349  VATILEQFMVQGQTSPPTSPLRGKKGMMDRRRRSRSAENIDLEFQESRRSSSASHSSKLK 408

Query: 882  VGKTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIER 703
            V K VD YL +IA  V L +SKF  +A  VP+ +R   DDLYRAIDIYLKAH  L++ ER
Sbjct: 409  VAKLVDGYLQQIARDVNLPLSKFVTLAESVPEFSRLDHDDLYRAIDIYLKAHKNLNKSER 468

Query: 702  EKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK 580
            ++VC V+D  KLS EA +HA+QN+ LP+++V+  L+Y+Q +
Sbjct: 469  KRVCRVLDCKKLSMEACMHAAQNEMLPLRVVVQVLFYEQAR 509



>gb:AY084797_1569881 Arabidopsis thaliana clone 118259 mRNA, complete
            sequence.
          Length = 429

 Score =  130 bits (326), Expect = 7e-29
 Identities = 81/216 (37%), Positives = 124/216 (57%), Gaps = 1/216 (0%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P NFL  LLRTA  +        ELE R+S  L+  ++ +L++ SF++    L D+E V 
Sbjct: 103  PCNFLLRLLRTAKMVGANPNYLTELETRVSWQLDQASLKELMIPSFSYTSGTLLDIELVT 162

Query: 975  RIISGFVEKEKSVAVFNGGDFREV-CSTAMQRVGKTVDAYLGEIATHVELSISKFNGIAN 799
            R+++ F          +G D   V  + A+ +V K VD+YL E A    L++ +F  +  
Sbjct: 163  RLVNKF----------SGLDSEGVKTAAALVKVAKLVDSYLAEAAVDGGLALPEFISLIT 212

Query: 798  LVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPV 619
             +P  AR  +D LYRAID YLKAHPQ+ + ER+++C ++D  KLS EA +HA+QN RLPV
Sbjct: 213  ALPSHARTTEDGLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPV 272

Query: 618  QIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA 511
            + ++  L+ +Q K+ S   D  S+  +  TR+   A
Sbjct: 273  RAIIGVLFTEQTKL-SRHIDCNSSSISSTTRSPTNA 307



>gb:AB028619_1518048 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone:MQD17.>gb:AK175160_1817148 Arabidopsis thaliana
            mRNA for putative non-phototropic hypocotyl protein,
            complete cds, clone: RAFL21-57-M15.>gb:AK175176_1817164
            Arabidopsis thaliana mRNA for putative non-phototropic
            hypocotyl protein, complete cds, clone:
            RAFL21-59-C24.>gb:AK175473_1817461 Arabidopsis thaliana
            mRNA for putative non-phototropic hypocotyl protein,
            complete cds, clone: RAFL21-90-M07.>gb:AK175544_1817532
            Arabidopsis thaliana mRNA for putative non-phototropic
            hypocotyl protein, complete cds, clone: RAFL21-96-G18.
          Length = 452

 Score =  130 bits (326), Expect = 7e-29
 Identities = 81/216 (37%), Positives = 124/216 (57%), Gaps = 1/216 (0%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P NFL  LLRTA  +        ELE R+S  L+  ++ +L++ SF++    L D+E V 
Sbjct: 126  PCNFLLRLLRTAKMVGANPNYLTELETRVSWQLDQASLKELMIPSFSYTSGTLLDIELVT 185

Query: 975  RIISGFVEKEKSVAVFNGGDFREV-CSTAMQRVGKTVDAYLGEIATHVELSISKFNGIAN 799
            R+++ F          +G D   V  + A+ +V K VD+YL E A    L++ +F  +  
Sbjct: 186  RLVNKF----------SGLDSEGVKTAAALVKVAKLVDSYLAEAAVDGGLALPEFISLIT 235

Query: 798  LVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPV 619
             +P  AR  +D LYRAID YLKAHPQ+ + ER+++C ++D  KLS EA +HA+QN RLPV
Sbjct: 236  ALPSHARTTEDGLYRAIDTYLKAHPQVLKQERKELCRLIDSRKLSPEAALHAAQNDRLPV 295

Query: 618  QIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQA 511
            + ++  L+ +Q K+ S   D  S+  +  TR+   A
Sbjct: 296  RAIIGVLFTEQTKL-SRHIDCNSSSISSTTRSPTNA 330



>gb:AC135500_1742438 Oryza sativa chromosome 3 BAC OSJNBa0034J04
            genomic sequence, complete sequence.>gb:AC136972_1743280
            Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic
            sequence, complete sequence.
          Length = 634

 Score =  129 bits (325), Expect = 9e-29
 Identities = 75/198 (37%), Positives = 112/198 (56%), Gaps = 9/198 (4%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LL+ A  L     C + L KRI T L+  +V DLL+ + T +   L+++  +  I+
Sbjct: 294  FLLKLLKAACLLEAGESCHDILIKRIGTQLDGASVSDLLIPANTSENT-LYNVNLIIAIV 352

Query: 966  SGFVEKEKSVAVFNGGDFRE---------VCSTAMQRVGKTVDAYLGEIATHVELSISKF 814
              FV ++         D  E         V ST+   V   +D YL EIA    L +SKF
Sbjct: 353  EEFVSRQSDTGKMKFQDDDEIVEVENLTPVSSTSNLAVANLIDGYLAEIAKDTNLPLSKF 412

Query: 813  NGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQN 634
              IA +VP  +RK  D LYRAID+YLK HP L + E++ +C +MD  KLS +A +HA QN
Sbjct: 413  IAIAEMVPPASRKNHDGLYRAIDMYLKEHPSLSKSEKKALCRLMDCKKLSQDACLHAVQN 472

Query: 633  KRLPVQIVLHALYYDQLK 580
            +RLP+++V+  L+++Q++
Sbjct: 473  ERLPLRVVVQVLFFEQIR 490



>pir|G96568|G96568 probable non-phototropic hypocotyl, 25081-26618
            [imported] - Arabidopsis thaliana>gb:AE005173_893188
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC019018_1538484 Arabidopsis thaliana
            chromosome 1 BAC F14G24 genomic sequence, complete
            sequence.>gb:BT002492_1636095 Arabidopsis thaliana
            putative non-phototropic hypocotyl (At1g52770) mRNA,
            complete cds.>gb:BT008757_1639953 Arabidopsis thaliana
            At1g52770 mRNA, complete cds.
          Length = 454

 Score =  128 bits (322), Expect = 2e-28
 Identities = 76/194 (39%), Positives = 114/194 (58%), Gaps = 1/194 (0%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P +FL  LLRTA  +      K ELE RIS  L+  ++ +L++ SF+     L D+E + 
Sbjct: 121  PCDFLLRLLRTANMVGADANYKAELEARISWQLDQASLKELMIPSFSHTCGTLLDVELMT 180

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCSTA-MQRVGKTVDAYLGEIATHVELSISKFNGIAN 799
            R++  F           G D   V S A + +V K VD+YL E A   +L++S+F  +  
Sbjct: 181  RLVKKFA----------GLDNEGVKSGASLIKVAKLVDSYLAEAALDGDLTLSEFISLVE 230

Query: 798  LVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPV 619
             +P  AR  +D LYRAID YLKAHP + + ER+++C ++D  KLS EA +HA+QN RLPV
Sbjct: 231  ALPNHARVTEDGLYRAIDTYLKAHPNVTKQERKRLCGLIDSNKLSMEASLHAAQNDRLPV 290

Query: 618  QIVLHALYYDQLKI 577
            + ++  L+ +Q K+
Sbjct: 291  RTIIQVLFSEQAKL 304



>gb:AP006068_1860884 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0020D05.>gb:AP006069_1860892 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0025F02.
          Length = 771

 Score =  126 bits (317), Expect = 7e-28
 Identities = 98/297 (32%), Positives = 147/297 (49%), Gaps = 58/297 (19%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDG-ERLFDLESVRRI 970
            FL  LLR AI LR A     ELEKR+   LE   + DLL+ S+     +  +D++ V+R+
Sbjct: 392  FLLRLLRLAIMLRAAPALVTELEKRVGMQLEQAALADLLIPSYGGRAADTAYDVDLVQRL 451

Query: 969  ISGF-VEKEKSVAVFNG---GD---------------------FREVCST----AMQRVG 877
            +  F V+++  +AV +    GD                          ST    A  RV 
Sbjct: 452  VEHFLVQEQTEMAVASSPGRGDPPPPPQPEYYSGRMPPSSAAAASASASTGGLNAKARVA 511

Query: 876  KTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLK------AHPQLD 715
            + +D+YL E++    LS++KF  +A  +P+ AR  DD LYRA+D YLK      AHP L 
Sbjct: 512  RLLDSYLSEVSRDRNLSLTKFQVLAESLPESARACDDGLYRAVDSYLKVTSTLQAHPTLT 571

Query: 714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKI-------------R 574
            E ER+++C VMD  KLS++A +HA+QN+RLP+++V+  L+ +Q+KI              
Sbjct: 572  EHERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFTEQVKISNALASSSAALRSS 631

Query: 573  SGAEDPKSTPNAIATRNQL---------QADVTLVKENEALRTELLQMKMFIADMQN 430
            S A    + P    TR QL         +      K+   L+ EL  MK    ++Q+
Sbjct: 632  SSAPGADAAPAMPTTRRQLLDGTPQSFQEGWAAAKKDINTLKFELESMKAKYLELQH 688



>gb:AP005426_1851664 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0668D04.>gb:AP005579_1854402 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1740_D06.
          Length = 618

 Score =  121 bits (304), Expect = 2e-26
 Identities = 73/202 (36%), Positives = 112/202 (55%), Gaps = 10/202 (4%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LL+ AI +      K EL +RIS  L   +V DLL L      +   D++ V  ++
Sbjct: 290  FLLKLLKVAILVGAGQHVKEELMRRISFQLHKASVKDLL-LPAASPSDGAHDVKLVHNLV 348

Query: 966  SGFVEKEKSVAVFNGGDFREVCSTAMQRV----------GKTVDAYLGEIATHVELSISK 817
              FV +    A+ + G F E     M  +          G+ VD YL E+A+  +LS+S 
Sbjct: 349  QRFVAR---TAMSHNGGFVEKSDDKMIELNFEQESTLALGELVDGYLSEVASDPDLSLST 405

Query: 816  FNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQ 637
            F  +A  VP+ AR V D LY A+D YLK HP + + +++K+C ++D  KLS +A +HA+Q
Sbjct: 406  FVELATAVPEAARPVHDSLYSAVDAYLKEHPNISKADKKKICGLIDVKKLSTDASMHATQ 465

Query: 636  NKRLPVQIVLHALYYDQLKIRS 571
            N RLP+++V+  L++ QL+  S
Sbjct: 466  NDRLPLRLVVQVLFFQQLRAGS 487



>gb:AY150514_1585079 Arabidopsis thaliana unknown protein (At4g31820)
            mRNA, complete cds.
          Length = 571

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/190 (34%), Positives = 114/190 (60%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRI 970
            +FL  LL+ +I +      + +L + +S  L   +V DLL+           ++E V RI
Sbjct: 292  SFLLKLLKVSILVGADETVREDLVENVSLKLHEASVKDLLI----------HEVELVHRI 341

Query: 969  ISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVP 790
            +  F+  EK V+  +      + +  +  VG+ +DAYL   A + EL++S F  ++ LVP
Sbjct: 342  VDQFMADEKRVSEDDRYKEFVLGNGILLSVGRLIDAYL---ALNSELTLSSFVELSELVP 398

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
            + AR + D LY+AID ++K HP+L + E++++C +MD  KL+ EA  HA+QN+RLP+++V
Sbjct: 399  ESARPIHDGLYKAIDTFMKEHPELTKSEKKRLCGLMDVRKLTNEASTHAAQNERLPLRVV 458

Query: 609  LHALYYDQLK 580
            +  LY++QL+
Sbjct: 459  VQVLYFEQLR 468



>gb:AY091021_1574252 Arabidopsis thaliana unknown protein (At4g31820)
            mRNA, complete cds.
          Length = 571

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/190 (34%), Positives = 114/190 (60%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRI 970
            +FL  LL+ +I +      + +L + +S  L   +V DLL+           ++E V RI
Sbjct: 292  SFLLKLLKVSILVGADETVREDLVENVSLKLHEASVKDLLI----------HEVELVHRI 341

Query: 969  ISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVP 790
            +  F+  EK V+  +      + +  +  VG+ +DAYL   A + EL++S F  ++ LVP
Sbjct: 342  VDQFMADEKRVSEDDRYKEFVLGNGILLSVGRLIDAYL---ALNSELTLSSFVELSELVP 398

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
            + AR + D LY+AID ++K HP+L + E++++C +MD  KL+ EA  HA+QN+RLP+++V
Sbjct: 399  ESARPIHDGLYKAIDTFMKEHPELTKSEKKRLCGLMDVRKLTNEASTHAAQNERLPLRVV 458

Query: 609  LHALYYDQLK 580
            +  LY++QL+
Sbjct: 459  VQVLYFEQLR 468



>pir|T06304|T06304 hypothetical protein F11C18.20 - Arabidopsis
            thaliana>gb:ATCHRIV75_1547103 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 75.>gb:ATF11C18_1548261
            Arabidopsis thaliana DNA chromosome 4, BAC clone F11C18
            (ESSA project).
          Length = 498

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/190 (34%), Positives = 114/190 (60%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRI 970
            +FL  LL+ +I +      + +L + +S  L   +V DLL+           ++E V RI
Sbjct: 219  SFLLKLLKVSILVGADETVREDLVENVSLKLHEASVKDLLI----------HEVELVHRI 268

Query: 969  ISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVP 790
            +  F+  EK V+  +      + +  +  VG+ +DAYL   A + EL++S F  ++ LVP
Sbjct: 269  VDQFMADEKRVSEDDRYKEFVLGNGILLSVGRLIDAYL---ALNSELTLSSFVELSELVP 325

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
            + AR + D LY+AID ++K HP+L + E++++C +MD  KL+ EA  HA+QN+RLP+++V
Sbjct: 326  ESARPIHDGLYKAIDTFMKEHPELTKSEKKRLCGLMDVRKLTNEASTHAAQNERLPLRVV 385

Query: 609  LHALYYDQLK 580
            +  LY++QL+
Sbjct: 386  VQVLYFEQLR 395



>pir|T02594|T02594 hypothetical protein At2g14820 [imported] -
            Arabidopsis thaliana>gb:AC004705_1532116 Arabidopsis
            thaliana chromosome 2 clone F26C24 map mi398, complete
            sequence.
          Length = 634

 Score =  117 bits (294), Expect = 3e-25
 Identities = 73/214 (34%), Positives = 120/214 (56%), Gaps = 12/214 (5%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LL+    + +    K +L +RI   LE  ++ +LL+ S     E L+D++ V++I+
Sbjct: 289  FLLKLLKAVTMVNSGEVVKEQLVRRIGQQLEEASMAELLIKSHQ-GSETLYDVDLVQKIV 347

Query: 966  SGFVEKEKSVAVF-----NGGDFREV-------CSTAMQRVGKTVDAYLGEIATHVELSI 823
              F+ ++K+  +      +G + +EV          +   V K +D+YL EIA    L  
Sbjct: 348  MEFMRRDKNSEIEVQDDEDGFEVQEVRKLPGILSEASKLMVAKVIDSYLTEIAKDPNLPA 407

Query: 822  SKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHA 643
            SKF  +A  V    R   D LYRAID++LK HP + + E++++C +MD  KLS EA +HA
Sbjct: 408  SKFIDVAESVTSIPRPAHDALYRAIDMFLKEHPGITKGEKKRMCKLMDCRKLSVEACMHA 467

Query: 642  SQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPN 541
             QN RLP+++V+  L+++Q  +R+ A    STP+
Sbjct: 468  VQNDRLPLRVVVQVLFFEQ--VRAAASSGSSTPD 499



>gb:AP005919_1860143 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0554A06.
          Length = 644

 Score =  117 bits (292), Expect = 6e-25
 Identities = 70/213 (32%), Positives = 113/213 (53%), Gaps = 10/213 (4%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            F   LL+ A+ + +    K EL  R+   L   +V DLL+ +        +D++ V  ++
Sbjct: 294  FFLKLLKVAVLIGSGEMLKEELMDRVILQLHKASVCDLLIPARP-PALTTYDIQLVLTLV 352

Query: 966  SGFVEKEKSVAVFNGGDF----------REVCSTAMQRVGKTVDAYLGEIATHVELSISK 817
              F+ +     V   G F           +V   ++  + K VD YL E+A+   LS+S 
Sbjct: 353  GRFMRR---AGVTEDGIFLNNLDQEMFETDVDDESLLALSKIVDGYLAEVASDPNLSVSS 409

Query: 816  FNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQ 637
            F  +A  +P  AR   D LY AID++LK HP L + E+ K+ S+MD  KLS EA +HA+Q
Sbjct: 410  FVAVATSMPDAARATHDGLYTAIDVFLKLHPNLPKAEKRKISSLMDVKKLSKEACIHAAQ 469

Query: 636  NKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA 538
            N RLP+++V+  L+++QL+  +G  +P +   A
Sbjct: 470  NDRLPLRVVVQVLFFEQLRAAAGGNNPAAAAAA 502



>gb:OSJN00002_1693082 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0018M05, complete sequence.
          Length = 566

 Score =  115 bits (289), Expect = 1e-24
 Identities = 81/257 (31%), Positives = 131/257 (50%), Gaps = 14/257 (5%)
 Frame = -1

Query: 1161 AFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLES 982
            AF    L  +LR    +  +  C+++LE+ +  +L+  T+DDLLV     D   ++D+  
Sbjct: 282  AFSCRGLFWVLRIVSAVGLSKECRHKLERLMGLMLDQATLDDLLVSG---DDGGVYDVNL 338

Query: 981  VRRIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIA 802
            V R++  FV  E+           ++ S  M++VG+ VD YLGEI+    L +SKF  +A
Sbjct: 339  VMRLVRVFVGSEEEA---------DLPSQRMRKVGRLVDKYLGEISPDHGLRVSKFLAVA 389

Query: 801  NLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLP 622
              +P  AR+  D +YRA+DIYL++HP L   ER  +C  ++  KL+ EA    ++N+R+P
Sbjct: 390  ESLPDSARECYDGVYRALDIYLESHPTLTIEERTTLCRCLNYEKLTLEACKDLAKNRRIP 449

Query: 621  VQIVLHALYYDQ--LKIRSGA----------EDPKSTPNAIATRNQ--LQADVTLVKENE 484
              I + AL   Q  L+IR  A           DP  TP  I          D+  + E E
Sbjct: 450  PGIAVQALASQQSKLQIRPAAAAAKGTGGCRPDPSQTPRKIIVSGSRARSVDLDAMDEKE 509

Query: 483  ALRTELLQMKMFIADMQ 433
             L+  L +M+  + +++
Sbjct: 510  LLKLNLQKMQNRVVELE 526



>gb:AB016886_1513138 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MCA23.>gb:BT005761_1638685 Arabidopsis thaliana
            clone RAFL15-17-A20 (R20741) putative
            photoreceptor-interacting protein (At5g47800) mRNA,
            complete cds.>gb:BT006083_1638977 Arabidopsis thaliana
            clone U20741 putative photoreceptor-interacting protein
            (At5g47800) mRNA, complete cds.
          Length = 559

 Score =  115 bits (288), Expect = 2e-24
 Identities = 68/211 (32%), Positives = 123/211 (58%), Gaps = 2/211 (0%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  L+  A ++R +   K EL ++ S  LE  T++DLL+ S +      +D + V  ++
Sbjct: 288  FLLRLVSIASYVRASLTTKTELIRKSSLQLEEATLEDLLLPSHSSSHLHRYDTDLVATVL 347

Query: 966  SGFVE--KEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLV 793
              F+   + +S A  +  + + + S  +++V K +D+YL  +A  V + +SKF  ++  V
Sbjct: 348  ESFLMLWRRQSSAHLSSNNTQLLHS--IRKVAKLIDSYLQAVAQDVHMPVSKFVSLSEAV 405

Query: 792  PKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQI 613
            P  AR+  D LY+AI+I+LK HP++ + E++++C  +D  KLS + R HA +N+R+P++ 
Sbjct: 406  PDIARQSHDRLYKAINIFLKVHPEISKEEKKRLCRSLDCQKLSAQVRAHAVKNERMPLRT 465

Query: 612  VLHALYYDQLKIRSGAEDPKSTPNAIATRNQ 520
            V+ AL++DQ     GA   +S    + TR +
Sbjct: 466  VVQALFFDQESGSKGASS-RSESQELFTRGK 495



>gb:AY742301_1179925 Malus x domestica phototropic response-like
           protein mRNA, partial cds.
          Length = 114

 Score =  114 bits (284), Expect = 5e-24
 Identities = 60/109 (55%), Positives = 73/109 (66%), Gaps = 1/109 (0%)
 Frame = -1

Query: 561 DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNXXXXXXXXXXXXXXXX 382
           D     +AI TR+Q+Q DV+L +ENE LRTELL+MKM+I D+                  
Sbjct: 6   DENDVQDAITTRSQVQHDVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGG 65

Query: 381 V-RKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS 238
             +K  FFS +SKKLG+LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct: 66  GPKKAKFFSYVSKKLGRLNPFKQGSKDTSNIVDEDVDITKPRRRRFSIS 114



>pir|T50813|T50813 non-phototropic hypocotyl 3-like protein -
            Arabidopsis thaliana>gb:ATF18D22_1549102 Arabidopsis
            thaliana DNA chromosome 5, BAC clone F18D22 (ESSA
            project).
          Length = 607

 Score =  113 bits (283), Expect = 6e-24
 Identities = 81/251 (32%), Positives = 132/251 (52%), Gaps = 7/251 (2%)
 Frame = -1

Query: 1161 AFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLES 982
            A   +FL  +L+T+I    +    ++LEKR+   LE   V DLL+ +F  + ++    E 
Sbjct: 311  AVSCHFLLRMLKTSIVYSASPALISDLEKRVGMALEDANVCDLLIPNFKNEEQQ----ER 366

Query: 981  VRRIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIA 802
            VR I   F+  E+   +                + K +D YL EIA    L I+KF  +A
Sbjct: 367  VR-IFEFFLMHEQQQVL------------GKPSISKLLDNYLAEIAKDPYLPITKFQVLA 413

Query: 801  NLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLP 622
             ++P+ A K  D LYRAID++LK HP L + +R ++C  M+  KLS +A +HA+QN RLP
Sbjct: 414  EMLPENAWKCHDGLYRAIDMFLKTHPSLSDHDRRRLCKTMNCEKLSLDACLHAAQNDRLP 473

Query: 621  ----VQIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRT---ELL 463
                VQI    L+ +Q+K+R   +D    P      +  + D  + ++NE ++T   EL 
Sbjct: 474  LRTIVQINTQVLFSEQVKMRMMMQD--KLPEKEEENSGGREDKRMSRDNEIIKTLKEELE 531

Query: 462  QMKMFIADMQN 430
             +K  ++++Q+
Sbjct: 532  NVKKKMSELQS 542



>gb:AY054668_1563322 Arabidopsis thaliana putative protein (At4g37590;
            F19F18.80) mRNA, complete cds.>gb:AY081497_1568757
            Arabidopsis thaliana putative protein (At4g37590) mRNA,
            complete cds.
          Length = 580

 Score =  110 bits (275), Expect = 5e-23
 Identities = 77/244 (31%), Positives = 129/244 (52%), Gaps = 11/244 (4%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNE--LEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            +FL  LLR +IFL    GC     L+ R+   L+   + D+L          L+D+E ++
Sbjct: 296  SFLTKLLRASIFL----GCDEVAGLKNRVGERLDEANLGDVL----------LYDVELMQ 341

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVE-LSISKFNGIAN 799
             ++  F++           D RE   TA   V K VD YL E +   + L + KF  +A 
Sbjct: 342  SLVEVFLKSR---------DPREDDVTAKASVAKLVDGYLAEKSRDSDNLPLQKFLSLAE 392

Query: 798  LVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPV 619
            +V    R+  D +YRAID++LK HP++++ E++++C +MD  KLS EA  HA QN+RLP+
Sbjct: 393  MVSSFPRQSHDGVYRAIDMFLKEHPEMNKSEKKRICRLMDCRKLSAEACAHAVQNERLPM 452

Query: 618  QIVLHALYYDQLKIRSGAEDP--KSTPNAIA------TRNQLQADVTLVKENEALRTELL 463
            ++V+  L+++Q++  +        STP  I       T +Q   +    ++ +ALR EL 
Sbjct: 453  RVVVQVLFFEQVRANNNGSSSTGNSTPEVIPASRSTNTTDQEDTECWDTEDIKALRGELA 512

Query: 462  QMKM 451
             +++
Sbjct: 513  NLRL 516



>pir|T04716|T04716 hypothetical protein F19F18.80 - Arabidopsis
            thaliana>gb:ATCHRIV87_1547713 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.>gb:ATF19F18_1549299
            Arabidopsis thaliana DNA chromosome 4, BAC clone F19F18
            (ESSA project).
          Length = 586

 Score =  110 bits (275), Expect = 5e-23
 Identities = 77/244 (31%), Positives = 129/244 (52%), Gaps = 11/244 (4%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNE--LEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            +FL  LLR +IFL    GC     L+ R+   L+   + D+L          L+D+E ++
Sbjct: 302  SFLTKLLRASIFL----GCDEVAGLKNRVGERLDEANLGDVL----------LYDVELMQ 347

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVE-LSISKFNGIAN 799
             ++  F++           D RE   TA   V K VD YL E +   + L + KF  +A 
Sbjct: 348  SLVEVFLKSR---------DPREDDVTAKASVAKLVDGYLAEKSRDSDNLPLQKFLSLAE 398

Query: 798  LVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPV 619
            +V    R+  D +YRAID++LK HP++++ E++++C +MD  KLS EA  HA QN+RLP+
Sbjct: 399  MVSSFPRQSHDGVYRAIDMFLKEHPEMNKSEKKRICRLMDCRKLSAEACAHAVQNERLPM 458

Query: 618  QIVLHALYYDQLKIRSGAEDP--KSTPNAIA------TRNQLQADVTLVKENEALRTELL 463
            ++V+  L+++Q++  +        STP  I       T +Q   +    ++ +ALR EL 
Sbjct: 459  RVVVQVLFFEQVRANNNGSSSTGNSTPEVIPASRSTNTTDQEDTECWDTEDIKALRGELA 518

Query: 462  QMKM 451
             +++
Sbjct: 519  NLRL 522



>gb:AC144738_1744167 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0029B02, complete sequence.
          Length = 501

 Score =  109 bits (272), Expect = 1e-22
 Identities = 67/192 (34%), Positives = 96/192 (50%), Gaps = 7/192 (3%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFD-------GERLFD 991
            +FL  LLR             +LE R +  L+  ++  +++ +F          G  L D
Sbjct: 159  DFLLRLLRAGSMAGADAALLADLEARAARRLDQASLGAVMIPAFRAAAGDAPGAGATLLD 218

Query: 990  LESVRRIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFN 811
            +  V R++ GF+ +        GG     C     RV + VDAYL E A    L  ++F 
Sbjct: 219  VPLVLRLVRGFLREGGKAGAGGGGGAAAAC-----RVARLVDAYLAEAALEAGLRPAEFE 273

Query: 810  GIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNK 631
             +A  VP  AR  DD LYRA+D YLKAHP   + ER  +C ++D  KL+ EA  HA QN+
Sbjct: 274  ELARAVPAHARAADDGLYRAVDTYLKAHPHAGKEERRSLCRLIDARKLTAEAAAHAVQNE 333

Query: 630  RLPVQIVLHALY 595
            RLPV+ V+  L+
Sbjct: 334  RLPVRCVVQVLF 345



>pir|H84619|H84619 hypothetical protein At2g23050 [imported] -
            Arabidopsis thaliana>gb:AC004401_1531653 Arabidopsis
            thaliana chromosome 2 clone F21P24 map CIC06C07, complete
            sequence.>gb:AY102541_1577770 Arabidopsis thaliana
            hypothetical protein (At2g23050/F21P24.11) mRNA, complete
            cds.>gb:BT005613_1638553 Arabidopsis thaliana clone
            U50388 unknown protein (At2g23050) mRNA, complete
            cds.>gb:AK117486_1815518 Arabidopsis thaliana At2g23050
            mRNA for unknown protein, complete cds, clone:
            RAFL17-11-E06.
          Length = 481

 Score =  108 bits (270), Expect = 2e-22
 Identities = 67/214 (31%), Positives = 112/214 (52%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRI 970
            +FL  L R +IFL      K +L+KR+S  LE  TV+D+L          ++DL+ V+ +
Sbjct: 284  SFLTKLHRASIFLGCEETVKEKLKKRVSEQLEETTVNDIL----------MYDLDMVQSL 333

Query: 969  ISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVP 790
            +  F+ ++               + +   V K +D YL E +    L +  F  +A  + 
Sbjct: 334  VKEFMNRDPK-------------THSKVSVAKLIDGYLAEKSRDPNLPLQNFLSLAETLS 380

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
               R   D LYRAID++LK H  + + E+++VC +MD  KLS EA  HA QN+RLP++++
Sbjct: 381  SFPRHSHDVLYRAIDMFLKEHSGISKSEKKRVCGLMDCRKLSAEACEHAVQNERLPMRVI 440

Query: 609  LHALYYDQLKIRSGAEDPKSTPNAIATRNQLQAD 508
            +  L+++Q++  +G+    STP    T    + D
Sbjct: 441  VQVLFFEQIR-ANGSSTGYSTPELTTTTLNTEDD 473



>gb:OSJN00035_1693653 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0044K18, complete sequence.
          Length = 627

 Score =  107 bits (268), Expect = 4e-22
 Identities = 72/222 (32%), Positives = 116/222 (52%), Gaps = 28/222 (12%)
 Frame = -1

Query: 1161 AFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFT-FDGERLFDLE 985
            A    FL  LL+ A  L  +   K EL +R+++ LE   V DLL+ +     G  L+D++
Sbjct: 279  AVSCGFLLKLLKAANILGASPASKAELTRRVASQLEDANVSDLLIPAPPPCAGGVLYDVD 338

Query: 984  SVRRIISGFVEKE------------------KSVAVFNGG--------DFREVCSTAMQR 883
            +V  I+  F  ++                  +S++  +G             V   AM R
Sbjct: 339  AVVTILEEFALRQAAASGSPKGSPARAGRHRRSMSAESGELEGARRSTSMAAVSHGAMVR 398

Query: 882  VGKTVDAYLGEIATH-VELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIE 706
            VG+ VD +L  +AT      + K   +A  VP  AR   DDLYRAID YL+AHP++D+  
Sbjct: 399  VGRLVDGFLAMVATKDARTPLDKMIAVAEAVPDFARPEHDDLYRAIDTYLRAHPEMDKSS 458

Query: 705  REKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK 580
            R+K+C V++  KLS +A +HA+QN+ LP+++V+  L+++  +
Sbjct: 459  RKKLCRVLNCRKLSEKASMHAAQNELLPLRVVVQVLFFENAR 500



>gb:AP001298_1820987 Arabidopsis thaliana genomic DNA, chromosome 3,
            BAC clone:F20C19.
          Length = 588

 Score =  107 bits (267), Expect = 5e-22
 Identities = 71/236 (30%), Positives = 122/236 (51%), Gaps = 25/236 (10%)
 Frame = -1

Query: 1164 AAFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLE 985
            ++ P +FL  LL+ A  +  +   K EL  +    L+  TV +LL+      G  L+D++
Sbjct: 289  SSVPCSFLLQLLKMANVMNVSHSSKMELAIKAGNQLDKATVSELLIPLSDKSG-MLYDVD 347

Query: 984  SVRRIISGFVE----------------KEKSVAVFNGGDFREV---CSTA------MQRV 880
             V+ ++  F+                 + +S    N  + +EV    ST+      + +V
Sbjct: 348  VVKMMVKQFLSHISPEIRPTRTRTEHRRSRSEENINLEEIQEVRGSLSTSSSPPPLLSKV 407

Query: 879  GKTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIERE 700
             K VD+YL EIA  V L++SKF  +A  +P  +R   DDLY AID+YL+ H ++++ ER+
Sbjct: 408  AKLVDSYLQEIARDVNLTVSKFVELAETIPDTSRICHDDLYNAIDVYLQVHKKIEKCERK 467

Query: 699  KVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIA 532
            ++C ++D  KLS EA   A+QN+ LP+++++  L+ +Q +          T N  A
Sbjct: 468  RLCRILDCKKLSVEASKKAAQNELLPLRVIVQILFVEQARATLATTRNNITTNETA 523



>gb:AY054694_1563348 Arabidopsis thaliana photoreceptor-interacting
            protein-like (At5g67440; K8K14.18) mRNA, complete
            cds.>gb:AY128721_1580801 Arabidopsis thaliana
            photoreceptor-interacting protein-like (At5g67440) mRNA,
            complete cds.
          Length = 579

 Score =  106 bits (265), Expect = 8e-22
 Identities = 67/200 (33%), Positives = 110/200 (55%), Gaps = 1/200 (0%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LL++++        + EL +RI   LE   V DLL+ +    GE ++D++ V  +I
Sbjct: 290  FLIKLLKSSVSFECGEEERKELSRRIGEKLEEANVGDLLIRA-PEGGETVYDIDIVETLI 348

Query: 966  SGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIAT-HVELSISKFNGIANLVP 790
              FV + +     +  D  ++  ++   V K +D YL EI+     LS +KF  IA  V 
Sbjct: 349  DEFVTQTEKRDELDCSD--DINDSSKANVAKLIDGYLAEISRIETNLSTTKFITIAEKVS 406

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
               R+  D +YRAID++LK HP + + E++    +MD  KLS EA  HA QN+RLP+++V
Sbjct: 407  TFPRQSHDGVYRAIDMFLKQHPGITKSEKKSSSKLMDCRKLSPEACAHAVQNERLPLRVV 466

Query: 609  LHALYYDQLKIRSGAEDPKS 550
            +  L+++Q++  +    P S
Sbjct: 467  VQILFFEQVRATTKPSLPPS 486



>gb:AB007645_1510162 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K8K14.
          Length = 579

 Score =  106 bits (265), Expect = 8e-22
 Identities = 67/200 (33%), Positives = 110/200 (55%), Gaps = 1/200 (0%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LL++++        + EL +RI   LE   V DLL+ +    GE ++D++ V  +I
Sbjct: 290  FLIKLLKSSVSFECGEEERKELSRRIGEKLEEANVGDLLIRA-PEGGETVYDIDIVETLI 348

Query: 966  SGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIAT-HVELSISKFNGIANLVP 790
              FV + +     +  D  ++  ++   V K +D YL EI+     LS +KF  IA  V 
Sbjct: 349  DEFVTQTEKRDELDCSD--DINDSSKANVAKLIDGYLAEISRIETNLSTTKFITIAEKVS 406

Query: 789  KGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIV 610
               R+  D +YRAID++LK HP + + E++    +MD  KLS EA  HA QN+RLP+++V
Sbjct: 407  TFPRQSHDGVYRAIDMFLKQHPGITKSEKKSSSKLMDCRKLSPEACAHAVQNERLPLRVV 466

Query: 609  LHALYYDQLKIRSGAEDPKS 550
            +  L+++Q++  +    P S
Sbjct: 467  VQILFFEQVRATTKPSLPPS 486



>gb:AP005903_1859850 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:B1012G11.>gb:AP005969_1860420 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1119_C03.
          Length = 594

 Score =  102 bits (253), Expect = 2e-20
 Identities = 62/209 (29%), Positives = 106/209 (50%), Gaps = 4/209 (1%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL  LLR A ++  +   + +L ++    L+     DLLV   +      +D+ +   ++
Sbjct: 318  FLLRLLRVASYVGASPSTRAQLVRQAGAQLDEARAVDLLVPMPSSSDPPAYDVGAAEAVL 377

Query: 966  SGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPK 787
              F+   +  A     D R   S AM++V +T D YL  +A H +  + KF  +A  +P 
Sbjct: 378  EHFLALFQRPAP---PDERRRMSAAMEKVARTFDEYLRAVALHADFPVGKFVDLAECLPD 434

Query: 786  GARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVL 607
             AR   D LY AID YLK HP+L + +++++C ++D  KLS + R  A  N R+P++ ++
Sbjct: 435  IARNDHDGLYHAIDTYLKEHPELSKADKKRLCRMIDCRKLSPDVRAQAISNDRMPLRTIV 494

Query: 606  HALYYDQLKIRSG----AEDPKSTPNAIA 532
              L+ +Q +   G      +    P+AIA
Sbjct: 495  QLLFVEQERAMGGGGASGSNSAVAPDAIA 523



>gb:BT012660_1641730 Arabidopsis thaliana At3g19850 gene, complete
            cds.
          Length = 521

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 61/185 (32%), Positives = 102/185 (55%), Gaps = 2/185 (1%)
 Frame = -1

Query: 1083 LEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFVEKEKSVAVFNGGDFREV 904
            LE+ I  +L+  T+DDLL+ +     + ++D++ V R++  FV     +     GD    
Sbjct: 273  LERVIGEMLDQATLDDLLIPAGGKGEKGVYDVDLVIRLLKVFVR----IGNTEEGDQ--- 325

Query: 903  CSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHP 724
             +  M+R+GK +D YL EI+    L +SKF  +A  +P  AR   D LYRAI+IYL++HP
Sbjct: 326  -NLRMRRIGKLIDKYLREISPDQNLKVSKFLEVAESLPDSARDWFDGLYRAINIYLESHP 384

Query: 723  QLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL--KIRSGAEDPKS 550
            +L   +R K+C  ++  KL+ +     ++N ++P  I + AL   QL  + R  + + K+
Sbjct: 385  KLSSEDRTKLCRCLNYKKLTLDTCKQLAKNPKIPPNIAVQALKSQQLSNETRPHSREDKN 444

Query: 549  TPNAI 535
              N I
Sbjct: 445  KVNKI 449



>gb:AB025631_1516560 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MPN9.>gb:AK175315_1817303 Arabidopsis thaliana
            mRNA for hypothetical protein, complete cds, clone:
            RAFL21-75-H23.>gb:AK176753_1818741 Arabidopsis thaliana
            mRNA for hypothetical protein, complete cds, clone:
            RAFL25-29-E14.>gb:AK176817_1818805 Arabidopsis thaliana
            mRNA for hypothetical protein, complete cds, clone:
            RAFL25-37-F21.
          Length = 554

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 61/185 (32%), Positives = 102/185 (55%), Gaps = 2/185 (1%)
 Frame = -1

Query: 1083 LEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFVEKEKSVAVFNGGDFREV 904
            LE+ I  +L+  T+DDLL+ +     + ++D++ V R++  FV     +     GD    
Sbjct: 306  LERVIGEMLDQATLDDLLIPAGGKGEKGVYDVDLVIRLLKVFVR----IGNTEEGDQ--- 358

Query: 903  CSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHP 724
             +  M+R+GK +D YL EI+    L +SKF  +A  +P  AR   D LYRAI+IYL++HP
Sbjct: 359  -NLRMRRIGKLIDKYLREISPDQNLKVSKFLEVAESLPDSARDWFDGLYRAINIYLESHP 417

Query: 723  QLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL--KIRSGAEDPKS 550
            +L   +R K+C  ++  KL+ +     ++N ++P  I + AL   QL  + R  + + K+
Sbjct: 418  KLSSEDRTKLCRCLNYKKLTLDTCKQLAKNPKIPPNIAVQALKSQQLSNETRPHSREDKN 477

Query: 549  TPNAI 535
              N I
Sbjct: 478  KVNKI 482



>gb:AY080713_1568435 Arabidopsis thaliana unknown protein (At1g50280)
            mRNA, complete cds.>gb:BT003005_1636587 Arabidopsis
            thaliana clone U18076 unknown protein (At1g50280) mRNA,
            complete cds.
          Length = 525

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 57/187 (30%), Positives = 99/187 (52%)
 Frame = -1

Query: 1083 LEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFVEKEKSVAVFNGGDFREV 904
            LE  I  +LE  T+DDLL+ +        ++++ V R++  FV+  +        +  E 
Sbjct: 306  LETLIGEMLEQATLDDLLISARGSRESGFYNVDLVIRLLKVFVKNREE-------EEEES 358

Query: 903  CSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKAHP 724
                M+ +GK +D YL EI+    L + KF G+A  +P  AR   D +YRAIDIYL++HP
Sbjct: 359  RERNMKEIGKLIDKYLREISPDQNLKVPKFLGVAESLPDSARDCFDGVYRAIDIYLQSHP 418

Query: 723  QLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTP 544
             L   +R ++C  ++  KL+ E     ++N ++P +I + A     LK R G ++  ++ 
Sbjct: 419  NLTPQDRTEICRCLNYKKLTMETCKQLARNPKIPPEIAIEA-----LKSRCGNQEHTTSD 473

Query: 543  NAIATRN 523
              +A ++
Sbjct: 474  VKVANKS 480



>gb:AP003960_1835723 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1612_A04.>gb:AP004235_1839102 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0006G05.
          Length = 473

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 65/205 (31%), Positives = 102/205 (49%), Gaps = 4/205 (1%)
 Frame = -1

Query: 1134 LLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFV 955
            +LR +  L+  T C + L   I   L+H T+D+LLV +       L+D+  V R +  F+
Sbjct: 184  ILRISSPLKLPTSCHDSLVAMIGAKLDHATLDNLLVPAPPGTTSSLYDVTLVLRFLDAFL 243

Query: 954  EKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARK 775
                + A    G+     +  +++VGK VD YL E+A    L  + F  +A  +P  AR 
Sbjct: 244  HH--AAATGARGE-----TPRLKKVGKLVDLYLAEVAPDPSLRPAMFVELATALPAAARD 296

Query: 774  VDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHAL- 598
              D LYRAID+Y + H +L E E+ ++C  ++  KLS E   H ++N   P +  + AL 
Sbjct: 297  CHDALYRAIDVYFQVHTRLTEEEKMRICKGINYEKLSPECCKHLARNAGFPTRAAVQALA 356

Query: 597  -YYDQLK--IRSGAEDPKSTPNAIA 532
              +  LK  +R G  D    P + A
Sbjct: 357  SQHTVLKSLLRGGGPDEHLRPVSAA 381



>gb:ATAC009895_1543071 Arabidopsis thaliana chromosome III BAC T21P5
            genomic sequence, complete sequence.
          Length = 484

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 68/236 (28%), Positives = 116/236 (49%), Gaps = 4/236 (1%)
 Frame = -1

Query: 1146 FLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRII 967
            FL   L+ +IFL   + C+   E RIS  L+     DL +LS T DG   +D+E ++ I+
Sbjct: 211  FLFKSLKESIFLGACSDCRKGFEVRISNQLDMARAKDLQILSPTEDGS--YDIELLKTIL 268

Query: 966  SGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIA-THVELSISKFNGIANLVP 790
              F   +    +           +    V + ++ +L E A +   L +  F  +A +  
Sbjct: 269  KSFYSNDSVPDL-----------SRFVSVARMLEEFLLEAAASDAGLRVGTFKELAEIAV 317

Query: 789  KGARKV---DDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPV 619
              +  V    D +YRAID+YL+ H  L E E+ + C  +   KLS EA  HAS+N++LP+
Sbjct: 318  AASCDVLSYSDGIYRAIDVYLERHRDLIESEKMEACRFLHCKKLSPEACEHASKNEKLPL 377

Query: 618  QIVLHALYYDQLKIRSGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKM 451
            +IV+  L+  Q++IR   +        +  R + Q D     E E++  +LL++++
Sbjct: 378  RIVMQVLFVSQMQIR---DKVAREMKGVVERTENQVD-----EVESMSKKLLKLEI 425



>gb:AY040058_1560556 Arabidopsis thaliana unknown protein (At3g22104)
            mRNA, complete cds.>gb:AF360210_1791164 Arabidopsis
            thaliana unknown protein (At3g22104) mRNA, complete cds.
          Length = 506

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 56/176 (31%), Positives = 88/176 (50%)
 Frame = -1

Query: 1155 PINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVR 976
            P   L  +LR A+ L     C N+LE  I   L+  T+D+LLV S +     L+ +  V 
Sbjct: 258  PCKSLFAVLRLALGLNINKSCMNKLEVMIGHQLDQATLDNLLVPSPS-KSSHLYYVNLVL 316

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANL 796
            R    F++  +S                +++V   +D Y+ E+A    L  SKF  +  L
Sbjct: 317  RFTKAFLDGARS-------------GLQLKKVSSLIDQYIAEVAPDPCLKPSKFLSLITL 363

Query: 795  VPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKR 628
            VP  AR+  +D+YRAID+YL+AH    + E+  +   +   KLS E+R H S+N++
Sbjct: 364  VPDSARESHEDIYRAIDMYLEAHTGTTDGEKLNLIRTLSYEKLSGESRAHISRNQK 419



>gb:AP003747_1832804 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1127_E01.
          Length = 547

 Score = 80.5 bits (197), Expect = 6e-14
 Identities = 56/198 (28%), Positives = 95/198 (47%), Gaps = 5/198 (2%)
 Frame = -1

Query: 1161 AFPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFD--GERLFDL 988
            A P++F   LL  +I L  +   +  L + +++ L+   VDDL +     D  G+ +   
Sbjct: 312  AIPVSFYFALLARSITLELSDESQTRLRELVASNLQFARVDDLPLPEPEQDAGGQSIAGS 371

Query: 987  ESVRR---IISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISK 817
              VR    I++  V  ++  A               + V +  D Y+ +I    +L   +
Sbjct: 372  PEVRAMESIVASHVSMQRRGA---------------EAVAELWDRYIAQIVGDPKLRPDR 416

Query: 816  FNGIANLVPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQ 637
               +  +VP G RK  D LY AID Y+  HP L   E+  +C  ++  KLS+EA + A Q
Sbjct: 417  LAELIGVVPAGDRKSHDHLYEAIDTYIVEHPGLSGDEKASLCGHLECRKLSHEACIQAVQ 476

Query: 636  NKRLPVQIVLHALYYDQL 583
            N R+P+++++ AL+  QL
Sbjct: 477  NDRMPLRLIVQALFVQQL 494



>pir|T51462|T51462 hypothetical protein K10A8_60 - Arabidopsis
            thaliana>gb:ATK10A8_1553509 Arabidopsis thaliana DNA
            chromosome 5, BAC clone K10A8 (ESSA project).
          Length = 548

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 64/234 (27%), Positives = 121/234 (51%), Gaps = 7/234 (2%)
 Frame = -1

Query: 1131 LRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFTFD--GERLFDLESVRRIISGF 958
            L+ +I+L  ++ C+N    RI   L+     DL +LS  +    E   ++E V+ ++   
Sbjct: 262  LKHSIWLEASSECQNGFMIRICKQLDMAKSTDLKILSRGYGEKAEGFENIELVKTVV--- 318

Query: 957  VEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANL---VPK 787
                KS   +   +  E  S  + +V K  + +L   A+   L +  F  +A +   V +
Sbjct: 319  ----KSFYTYYANEDSETVSHFV-KVAKLSEEFLFLAASEASLKLEAFVELAEMTVAVSQ 373

Query: 786  GARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVL 607
            G     D +YRAID++L++H  L E E+ +VC V++  KLS E    A++N++LP++IV+
Sbjct: 374  GILSYSDGIYRAIDVFLESHRYLTESEKMEVCKVLECGKLSQEGFERAAKNQKLPLRIVV 433

Query: 606  HALYYDQLKIR-SGAEDPKSTPNAIATRNQLQADVTLVK-ENEALRTELLQMKM 451
            + L   QL+IR + A++ K     +    + + +V+  + E E +  +LL +++
Sbjct: 434  NVLCVSQLQIRDTVAKEIKGMEEKVDEEEEEEIEVSSDEDEMEKMSNKLLGLEI 487



>gb:AB023039_1515419 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIF21.
          Length = 625

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 37/128 (28%), Positives = 68/128 (53%)
 Frame = -1

Query: 942 SVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDD 763
           SV V    +     S++  RVGK  D +L  +    E+  ++F  +   VP   R+  D 
Sbjct: 349 SVYVSTESERHLTSSSSNVRVGKLWDIFLSRLPYDQEMKTTRFIELIETVPMSFRESHDQ 408

Query: 762 LYRAIDIYLKAHPQLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL 583
           LY A++ +L+ H  + + E+  +CS ++  KLS EA +   +N+++P+++V+ AL+  QL
Sbjct: 409 LYLAVNAFLQVHTNISQEEKGSICSYLNCQKLSQEASLELVKNEKMPLRLVVQALFIQQL 468

Query: 582 KIRSGAED 559
                 +D
Sbjct: 469 NTHQAFKD 476



>pir|B96539|B96539 hypothetical protein F14I3.11 [imported] -
            Arabidopsis thaliana>gb:AE005173_892950 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC007980_1536384 Arabidopsis thaliana
            chromosome I BAC F14I3 genomic sequence, complete
            sequence.
          Length = 409

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 40/117 (34%), Positives = 62/117 (52%)
 Frame = -1

Query: 1083 LEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFVEKEKSVAVFNGGDFREV 904
            LE  I  +LE  T+DDLL+ +        ++++ V R++  FV+  +        +  E 
Sbjct: 273  LETLIGEMLEQATLDDLLISARGSRESGFYNVDLVIRLLKVFVKNREE-------EEEES 325

Query: 903  CSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLK 733
                M+ +GK +D YL EI+    L + KF G+A  +P  AR   D +YRAIDIYL+
Sbjct: 326  RERNMKEIGKLIDKYLREISPDQNLKVPKFLGVAESLPDSARDCFDGVYRAIDIYLQ 382



>gb:AP002523_1822365 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0013F10.
          Length = 307

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 48/145 (33%), Positives = 69/145 (47%), Gaps = 6/145 (4%)
 Frame = -1

Query: 1149 NFLCCLLRTAIFLRTATGCKNELEKRISTILEHVTVDDLLVLSFT--FDGERLFDLESVR 976
            +FL  LLR    +        ELE R +  L+  T+  +++ +F   +    L D+  V 
Sbjct: 157  DFLLKLLRAGSMVGADAALLQELESRAARRLDQATLGAVMIPAFGHGYACGTLLDVPLVL 216

Query: 975  RIISGFVEKEKS----VAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNG 808
            R++ GF++   +     A   GG        A  RV + VDAYL E A    L  ++F  
Sbjct: 217  RLVRGFLKDAGAGGGGAAKAGGGG-----GAAAARVARLVDAYLAEAALEAGLRPAEFEE 271

Query: 807  IANLVPKGARKVDDDLYRAIDIYLK 733
            +A  VP  AR  DD LYRA+D YLK
Sbjct: 272  LARAVPAHARPADDALYRAVDTYLK 296



>pir|T46056|T46056 hypothetical protein T16K5.250 - Arabidopsis
           thaliana>gb:ATT16K5_1554603 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T16K5.
          Length = 517

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 36/113 (31%), Positives = 63/113 (55%), Gaps = 3/113 (2%)
 Frame = -1

Query: 903 CSTAMQRVGK--TVDAYLGEIATHVELSISKFNGIANLVPKGARKVDDDLYRAIDIYLKA 730
           C  A+  +G    V+ +L E    V+L    FN +A+ V +   +  D LYR +D Y+K 
Sbjct: 201 CVEALMEIGDGDCVNEFLEEA---VKLPAGDFNVVADAVQQRFPR-HDLLYRIVDAYVKE 256

Query: 729 HP-QLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR 574
           H  ++ E E+ ++C+ +D  KLS    +HA QN ++P++ ++ A+  +QL  R
Sbjct: 257 HDGEMTEEEKVQICNSIDCDKLSPPLLLHAVQNPKMPLRFIVRAMLQEQLNTR 309



>gb:AY360388_1602177 Oryza sativa (japonica cultivar-group)
           chromosome 8 BAC OSJNBa0038J12, complete
           sequence.>gb:AY360389_1602182 Oryza sativa (japonica
           cultivar-group) chromosome 8 BAC OSJNBa0024A05, complete
           sequence.
          Length = 158

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 24/48 (50%), Positives = 35/48 (72%)
 Frame = -1

Query: 708 EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA 565
           E  K+ S+MD  KLS EA +HA+QN RLP+++VL  L+++QL+   GA
Sbjct: 13  EDPKISSLMDVKKLSKEACIHAAQNDRLPLRVVLQVLFFEQLRAAVGA 60



>gb:AC119291_1739678 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0052K01, complete sequence.
          Length = 166

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 28/74 (37%), Positives = 45/74 (60%), Gaps = 7/74 (9%)
 Frame = -1

Query: 684 MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPN-------AIATR 526
           MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+       A++ R
Sbjct: 1   MDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYAGGESPALSYR 60

Query: 525 NQLQADVTLVKENE 484
             L  +  +V+ +E
Sbjct: 61  PTLSFNGAVVEHDE 74



>gb:AP004044_1836817 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1125_C01.>gb:AP005480_1852636 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0439B07.
          Length = 137

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 23/53 (43%), Positives = 36/53 (67%)
 Frame = -1

Query: 684 MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIATR 526
           MD  KLS EA +HA+QN RLP+++V+  ++++QL+  +GA  P +    IA R
Sbjct: 1   MDVKKLSKEACIHAAQNNRLPLRVVMQVVFFEQLRAAAGA-SPAAATGGIARR 52



>gb:AP005693_1856166 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBa0061E21.>gb:AP006480_1862086 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone: B1052H09.
          Length = 138

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 21/40 (52%), Positives = 30/40 (75%)
 Frame = -1

Query: 684 MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA 565
           MD  KLS EA +HA+QN RLP+++VL  L+++QL+   GA
Sbjct: 1   MDVKKLSKEACIHAAQNDRLPLRVVLQVLFFEQLRAAVGA 40



>gb:AP003985_1835948 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1047_C01.
          Length = 258

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 24/63 (38%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = -1

Query: 768 DDLYRAIDIYLKAHP-QLDEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYY 592
           D +Y  +D YL+ H  +L E E+ +VC  ++  KLS+   +H  QN RLP++ V+ A+  
Sbjct: 10  DLMYTIVDHYLQNHRGKLTEEEKSRVCYNVNCTKLSHHLFMHLVQNPRLPLRFVVQAMLV 69

Query: 591 DQL 583
           +QL
Sbjct: 70  EQL 72



>gb:OSJN00097_1694866 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0015D13, complete sequence.
          Length = 3307

 Score = 41.2 bits (95), Expect = 0.041
 Identities = 27/100 (27%), Positives = 47/100 (47%)
 Frame = -1

Query: 975  RIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVELSISKFNGIANL 796
            RI++G+++ E   A             A  R+  T D       +     +++F  +A L
Sbjct: 768  RILAGYLDHEGDAAA------------APPRLDCTTDDDFSSAVSPPHNDVAQFTALAEL 815

Query: 795  VPKGARKVDDDLYRAIDIYLKAHPQLDEIEREKVCSVMDP 676
            +P+ AR  +D +Y AIDIYLK   Q+   E+ ++ +   P
Sbjct: 816  IPEHARFNEDGMYHAIDIYLKTVVQVLYHEQRRLRAPSQP 855



>gb:AP004023_1836514 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1126_D09.>gb:AP004079_1837379 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1067_B01.
          Length = 185

 Score = 40.4 bits (93), Expect = 0.069
 Identities = 23/91 (25%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = -1

Query: 705 REKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK---IRSGAEDPKSTPNAI 535
           R+++C V++  KLS +A  HA+QN+ LP+++V+  L+++  +   +  GA      P +I
Sbjct: 6   RKRLCRVINCRKLSDKACAHAAQNELLPLRVVVQVLFFEHARAAAMAGGAHAAAELPGSI 65

Query: 534 ATRNQLQADVTLVKENEALRTELLQMKMFIA 442
               Q ++  +  +++ A R +  +++   A
Sbjct: 66  RALLQSKSSGSDQEDDAADRVDEQRLRALAA 96



>gb:BC058674_2103406 Mus musculus cDNA sequence BC058674, mRNA (cDNA
            clone IMAGE:6831208), partial cds.
          Length = 1581

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 19/57 (33%), Positives = 26/57 (45%)
 Frame = -3

Query: 640  PEQAFTSADSPPRPILRSAENQKRRGRSKEHPKRHCNEEPVAGGRNIGEGERSFANG 470
            PE       SPPRP+ +  E +K + + KE   R    E    GR +   +RS A G
Sbjct: 1264 PEPPAPEKPSPPRPVEKEKEKEKEKEKEKERVTRPLRSERATSGRQM-RTDRSLATG 1319



>gb:AK173130_2070064 Mus musculus mRNA for mKIAA1205 protein.
          Length = 1848

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 19/57 (33%), Positives = 26/57 (45%)
 Frame = -3

Query: 640  PEQAFTSADSPPRPILRSAENQKRRGRSKEHPKRHCNEEPVAGGRNIGEGERSFANG 470
            PE       SPPRP+ +  E +K + + KE   R    E    GR +   +RS A G
Sbjct: 1531 PEPPAPEKPSPPRPVEKEKEKEKEKEKEKERVTRPLRSERATSGRQM-RTDRSLATG 1586



>gb:AK032894_1163119 Mus musculus 12 days embryo male wolffian duct
           includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6720469B10 product:hypothetical
           protein, full insert sequence.>gb:BC025846_2095175 Mus
           musculus cDNA sequence BC058674, mRNA (cDNA clone
           MGC:32383 IMAGE:5036822), complete cds.
          Length = 333

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 19/57 (33%), Positives = 26/57 (45%)
 Frame = -3

Query: 640 PEQAFTSADSPPRPILRSAENQKRRGRSKEHPKRHCNEEPVAGGRNIGEGERSFANG 470
           PE       SPPRP+ +  E +K + + KE   R    E    GR +   +RS A G
Sbjct: 16  PEPPAPEKPSPPRPVEKEKEKEKEKEKEKERVTRPLRSERATSGRQM-RTDRSLATG 71



>sp|P40954|CHI3_CANAL Chitinase 3 precursor (EC
            3.2.1.14).>gb:CAU15801_1645496 Candida albicans chitinase
            (cht3) gene, complete cds.
          Length = 567

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 44/141 (31%), Positives = 62/141 (43%), Gaps = 1/141 (0%)
 Frame = +2

Query: 650  TLASYESFSGSITLQTFSLSISSSWG*AFK*ISIAL*RSSSTFLAPLGTKFAIPLNLEIL 829
            T +S  S + S T  T S S SSS              SSST  + + T    P +   L
Sbjct: 353  TSSSISSTTSSTTSSTSSSSTSSSTSST---------TSSSTTSSQISTTSTAPTSSTSL 403

Query: 830  SSTWVAISPR*ASTVLPTLCIAVEQTSLKSPPLNTATLFSFSTNPEIILRT-LSKSNSLS 1006
            SS+ ++ S   AST   T   + E T + +P    ++L S  T P     T +SKS+S  
Sbjct: 404  SSSTISTS---ASTSDTTSVTSSETTPVVTP----SSLSSAITIPGDSTTTGISKSSSTK 456

Query: 1007 PSKVNDNTRRSSTVTCSRIVD 1069
            P+    +   SST T + I D
Sbjct: 457  PATSTTSALSSSTTTVATIPD 477



>sp|P53882|YNR6_YEAST Hypothetical 67.4 kDa protein in RPS3-PSD1
            intergenic region.>pir|S63131|S63131 probable membrane
            protein YNL176c - yeast (Saccharomyces
            cerevisiae)>gb:SCYNL176C_1713778 S.cerevisiae chromosome
            XIV reading frame ORF YNL176c.
          Length = 636

 Score = 35.0 bits (79), Expect = 2.9
 Identities = 43/149 (28%), Positives = 67/149 (44%), Gaps = 5/149 (3%)
 Frame = +2

Query: 656  ASYESFSGSITLQTFSLSISSSWG*----AFK*ISIAL*RSSSTFLAPLGTKFAIPLNLE 823
            +S  S S  +   + SLS+SSS+      +F   S     S+ T ++P  T  +      
Sbjct: 162  SSLSSPSSLLVSSSLSLSLSSSYSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATS 221

Query: 824  ILSSTWVAISPR*ASTVLPTLCIAVEQTSLKSPPLNTATLF-SFSTNPEIILRTLSKSNS 1000
               ST   +S    ST+     I+ + T+  S   NT+T F S S +      T+SKS+ 
Sbjct: 222  FQISTTSELSSSWFSTISSPSTISNKDTTCPSSSRNTSTSFYSSSLSSTNDFSTISKSSK 281

Query: 1001 LSPSKVNDNTRRSSTVTCSRIVDILFSSS 1087
            LSPS  + +T   ST++      +  SSS
Sbjct: 282  LSPS-ASSSTVSISTISVPTSSSVSSSSS 309



>gb:AP005292_1850005 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1340_C08.
          Length = 440

 Score = 34.3 bits (77), Expect = 5.0
 Identities = 14/47 (29%), Positives = 32/47 (68%)
 Frame = -1

Query: 1083 LEKRISTILEHVTVDDLLVLSFTFDGERLFDLESVRRIISGFVEKEK 943
            L ++ +T LEH T++D+L+ S++   + L+D++ V R++   + +E+
Sbjct: 280  LGQKAATQLEHATLEDVLIPSYSGGMKTLYDVDCVERVVRHVLAEEE 326



>gb:AP006562_1862441 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:B1175F05.
          Length = 242

 Score = 33.9 bits (76), Expect = 6.5
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 6/65 (9%)
 Frame = -2

Query: 1004 RGCSIWRACGG------LSPGLWRKRRAWRCLTAATLEKFARRRCRELARPSMLISARLP 843
            RGC      GG      +  G WR+RR  R   AAT     R RC +L+   + +S    
Sbjct: 45   RGCRATEPAGGARRQRQIEGGTWRERRRSRAALAATAPAANRERCAKLSLSLLFLSLSFF 104

Query: 842  PTLSS 828
              LSS
Sbjct: 105  LCLSS 109



>gb:AY545646_1334584 Giardia intestinalis isolate A29 beta-giardin
            gene, partial cds.
          Length = 170

 Score = 33.9 bits (76), Expect = 6.5
 Identities = 20/42 (47%), Positives = 25/42 (59%)
 Frame = -3

Query: 1132 PQNGHLPQNRHRLQERAGEEDIDDPRARDGGRPSGVVVHLRR 1007
            PQ    P++RHR  ER  EED+  P  R+G R  G+  HLRR
Sbjct: 105  PQEPERPRDRHRHGERREEEDV-RPAQREGRR--GIRPHLRR 143



>gb:AF294850_1895429 Procolobus badius protamine P1 (Prm1) gene,
            complete cds.
          Length = 51

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 20/52 (38%), Positives = 23/52 (44%)
 Frame = -2

Query: 1028 CCRSPSTARGCSIWRACGGLSPGLWRKRRAWRCLTAATLEKFARRRCRELAR 873
            CCRS S +R C   R C        R+RR  RC    T  +  RRR R   R
Sbjct: 6    CCRSQSRSRCCRRRRRC--------RRRRRQRCRARRTAMRCCRRRYRRRCR 49



>gb:AY189822_595973 Ruminococcus flavefaciens heat shock protein 70
            (dnaK) gene, complete cds.
          Length = 622

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 11/83 (13%)
 Frame = -1

Query: 1029 VLSFTFDGERLFDLESVRRIISGFVEKEKSVAVFNGGDFR-----------EVCSTAMQR 883
            V++FT +GERL    + R+ I+       S+    G D++           E+ +  +Q+
Sbjct: 39   VVAFTNNGERLVGQVAKRQAITNHDRTVSSIKRHMGSDYKVAIDGKNYTPQEISAMILQK 98

Query: 882  VGKTVDAYLGEIATHVELSISKF 814
            +    +AYLGE  T   +++  +
Sbjct: 99   LKADAEAYLGETVTEAVITVPAY 121



>gb:AE017251_416602 Treponema denticola ATCC 35405, section 6 of 10 of
            the complete genome.>gb:AE017226_1070198 Treponema
            denticola ATCC 35405, complete genome.
          Length = 3320

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 9/86 (10%)
 Frame = -1

Query: 873  TVDAYLGEIATHVELSISKFNGIANLVPKG-ARKVDDDLYRAI--------DIYLKAHPQ 721
            TV     EI T  E    K+  +  L  KG     +DD+   I        + Y KAHP+
Sbjct: 2063 TVREGYSEIKTESEYEYDKYGNVTKLYDKGDVTNTNDDIIAEITYWKGGNRETYFKAHPE 2122

Query: 720  LDEIEREKVCSVMDPLKLSYEARVHA 643
              ++   K  +++   + SY+AR  A
Sbjct: 2123 KIQVLHGKTGTLLRKREGSYDARTGA 2148



>sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA
            homolog.>pir|H64579|H64579 GTP-binding protein,
            fusA-homolog - Helicobacter pylori  (strain
            26695)>gb:AE000562_24657 Helicobacter pylori 26695
            section 40 of 134 of the complete
            genome.>gb:AE000511_880096 Helicobacter pylori 26695
            complete genome.
          Length = 599

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 6/115 (5%)
 Frame = -1

Query: 1158 FPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHV-----TVDDLLVLS-FTFDGERL 997
            FP+ +     R    +++    K  LE    TILEHV     +VD+ L +  FT D +  
Sbjct: 159  FPVVYAAA--RDGYAMKSLDDEKKNLEPLFETILEHVPSPSGSVDEPLQMQIFTLDYDNY 216

Query: 996  FDLESVRRIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVE 832
                 + R+ +G V+K +SV +      +E       R+ K +  +LG   T +E
Sbjct: 217  VGKIGIARVFNGSVKKNESVLLMKSDGSKE-----NGRITKLI-GFLGLARTEIE 265



>sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA
            homolog.>pir|H71932|H71932 hypothetical protein jhp0432 -
            Helicobacter pylori (strain J99)>gb:AE001477_35423
            Helicobacter pylori, strain J99 section 38 of 132 of the
            complete genome.>gb:AE001439_884193 Helicobacter pylori,
            strain J99 complete genome.
          Length = 599

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 6/115 (5%)
 Frame = -1

Query: 1158 FPINFLCCLLRTAIFLRTATGCKNELEKRISTILEHV-----TVDDLLVLS-FTFDGERL 997
            FP+ +     R    +++    K  LE    TILEHV     +VD+ L +  FT D +  
Sbjct: 159  FPVVYAAA--RDGYAMKSLDDEKKNLEPLFETILEHVPSPSGSVDEPLQMQIFTLDYDNY 216

Query: 996  FDLESVRRIISGFVEKEKSVAVFNGGDFREVCSTAMQRVGKTVDAYLGEIATHVE 832
                 + R+ +G V+K +SV +      +E       R+ K +  +LG   T +E
Sbjct: 217  VGKIGIARVFNGSVKKNESVLLMKSDGSKE-----NGRITKLI-GFLGLARTEIE 265


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,087,154,663
Number of Sequences: 1806583
Number of extensions: 21847089
Number of successful extensions: 116021
Number of sequences better than 10.0: 90
Number of HSP's better than 10.0 without gapping: 110743
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 115864
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 92469302937
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)