BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8493
         (1072 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC084818_1733850 Oryza sativa (japonica cultivar-group) chrom...   283   5e-75   
gb:AY088365_1573385 Arabidopsis thaliana clone 620 mRNA, complet...   281   2e-74   
sp|Q9ASS6|TL20_ARATH|TL20_ARATH Peptidyl-prolyl cis-trans isomerase TLP20, ...   281   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb:AY217751_1590148 Triticum aestivum cyclophilin-like protein (...   274   2e-72   
gb:AY217753_1590150 Triticum aestivum cyclophilin-like protein (...   273   3e-72   
gb:ATT19L5_1554843 Arabidopsis thaliana DNA chromosome 5, BAC cl...   273   3e-72   
gb:AY086899_1571939 Arabidopsis thaliana clone 29220 mRNA, compl...   222   9e-57   
sp|P34791|CYP4_ARATH|CYP4_ARATH Peptidyl-prolyl cis-trans isomerase, chloro...   222   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AF325026_1786480 Arabidopsis thaliana AT3g62030 (AT3g62030/F2...   220   3e-56   
gb:AP003018_1824194 Oryza sativa (japonica cultivar-group) genom...   217   4e-55   
sp|Q41651|CYPB_VICFA|CYPB_VICFA Peptidyl-prolyl cis-trans isomerase, chloro...   209   1e-52   Vicia faba [broad bean]
sp|Q01490|CYPB_ORPSP|CYPB_ORPSP Peptidyl-prolyl cis-trans isomerase B precu...   204   3e-51   
gb:AY040611_1289020 Brugia malayi R2 (SM7) mRNA, complete cds.        194   3e-48   
gb:AE017347_1757736 Cryptococcus neoformans var. neoformans JEC2...   193   4e-48   
sp|P24367|PPIB_CHICK|PPIB_CHICK Peptidyl-prolyl cis-trans isomerase B precu...   192   1e-47   Gallus gallus [bantam]
gb:BT020966_1436324 Bos taurus peptidylprolyl isomerase B (cyclo...   191   2e-47   
gb:BC084369_2563750 Xenopus laevis hypothetical LOC495270, mRNA ...   190   4e-47   
gb:HUMCYCLO_2030406 Human cyclophilin mRNA, 3' end.                   190   5e-47   
gb:CR456829_1993036 Homo sapiens full open reading frame cDNA cl...   190   5e-47   
gb:BC001125_1967315 Homo sapiens peptidylprolyl isomerase B (cyc...   190   5e-47   
sp|P23284|PPIB_HUMAN|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B precu...   190   5e-47   Homo sapiens [man]
gb:BC059560_2552537 Danio rerio zgc:73214, mRNA (cDNA clone MGC:...   189   1e-46   
sp|P80311|PPIB_BOVIN|PPIB_BOVIN Peptidyl-prolyl cis-trans isomerase B precu...   189   1e-46   Bos taurus [bovine]
pir|A56861|A56861 peptidylprolyl isomerase (EC 5.2.1.8) CyP-S1 p...   188   2e-46   Mus musculus [mouse]
sp|P24369|PPIB_MOUSE|PPIB_MOUSE Peptidyl-prolyl cis-trans isomerase B precu...   188   2e-46   Mus musculus [mouse]
gb:BC061971_2104749 Rattus norvegicus peptidylprolyl isomerase B...   187   2e-46   
pir|T02489|T02489 peptidylprolyl isomerase (EC 5.2.1.8) F23F1.12...   187   2e-46   Arabidopsis thaliana [mouse-ear cress]
sp|P24368|PPIB_RAT|PPIB_RAT Peptidyl-prolyl cis-trans isomerase B precurs...   187   2e-46   Rattus norvegicus [brown rat]
pir|T50837|T50837 peptidylprolyl isomerase (EC 5.2.1.8) CYP5 [si...   187   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb:BC054168_2550823 Xenopus laevis peptidylprolyl isomerase B, m...   187   4e-46   
gb:AF017993_1232987 Entamoeba histolytica cyclophilin (CYP1) mRN...   186   5e-46   
pir|S71547|S71547 peptidylprolyl isomerase (EC 5.2.1.8) B, 20.3K...   186   5e-46   Rattus norvegicus [brown rat]
gb:AY085875_1570939 Arabidopsis thaliana clone 19211 mRNA, compl...   186   9e-46   
sp|P52011|CYP3_CAEEL|CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 (EC 5...   185   1e-45   Caenorhabditis elegans [roundworm]
gb:CR382131_1664413 Yarrowia lipolytica chromosome E of strain C...   184   3e-45   
gb:AF107254_1768413 Emericella nidulans cyclophilin B (cypB) gen...   181   2e-44   
gb:AX024013_1456798 Sequence 2 from Patent WO0018934.>gb:AY00586...   181   3e-44   
gb:AY543004_1334460 Bigelowiella natans cyclophilin mRNA, comple...   181   3e-44   
sp|P24525|CYPH_BRANA|CYPH_BRANA Peptidyl-prolyl cis-trans isomerase (EC 5.2...   181   3e-44   Brassica napus [oilseed rape]
gb:AF053068_1236807 Dictyostelium discoideum cyclophilin B (CypB...   180   4e-44   
sp|P30405|PPIF_HUMAN|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase, mitoch...   180   4e-44   Homo sapiens [man]
gb:BNACYP_1633431 Brassica napus cyclophilin (CyP) mRNA, 3' end.      179   6e-44   
gb:AY362759_1322644 Chlamys farreri cyclophilin A mRNA, complete...   179   6e-44   
sp|P52010|CYP2_CAEEL|CYP2_CAEEL Peptidyl-prolyl cis-trans isomerase 2 (EC 5...   179   6e-44   Caenorhabditis elegans [roundworm]
gb:AY290733_1595602 Triticum aestivum cyclophilin mRNA, partial ...   179   8e-44   
pir|B39252|CSRP peptidylprolyl isomerase (EC 5.2.1.8) - rape          179   8e-44   
sp|Q39613|CYPH_CATRO|CYPH_CATRO Peptidyl-prolyl cis-trans isomerase (EC 5.2...   179   8e-44   Catharanthus roseus [chatas]
sp|P34790|CYP1_ARATH|CYP1_ARATH Peptidyl-prolyl cis-trans isomerase (EC 5.2...   179   8e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AP003621_1831598 Oryza sativa (japonica cultivar-group) genom...   179   1e-43   
gb:AP003621_1831597 Oryza sativa (japonica cultivar-group) genom...   179   1e-43   
pir|T50838|T50838 peptidylprolyl isomerase (EC 5.2.1.8) ROC7 [si...   179   1e-43   Arabidopsis thaliana [mouse-ear cress]
pir|E84597|E84597 cyclophilin (CYP2) [imported] - Arabidopsis th...   179   1e-43   Arabidopsis thaliana [mouse-ear cress]
sp|P52009|CYP1_CAEEL|CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 (EC 5...   179   1e-43   Caenorhabditis elegans [roundworm]
pir|T50772|T50772 peptidylprolyl isomerase (EC 5.2.1.8) CYP2 [si...   178   1e-43   Arabidopsis thaliana [mouse-ear cress]
sp|P52015|CYP7_CAEEL|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 (EC 5...   178   1e-43   Caenorhabditis elegans [roundworm]
gb:BT016150_1358595 Drosophila melanogaster AT16671 full insert ...   177   3e-43   
gb:AE014296_1136235 Drosophila melanogaster chromosome 3L, compl...   177   3e-43   
pir|S71219|S71219 peptidylprolyl isomerase (EC 5.2.1.8) ROC3 - A...   177   3e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AY392408_1604713 Thellungiella halophila cyclophilin mRNA, co...   177   4e-43   
gb:CEU27559_1368480 Caenorhabditis elegans cyclophilin (cyp-7) m...   176   5e-43   
sp|P29117|PPIF_RAT|PPIF_RAT Peptidyl-prolyl cis-trans isomerase, mitochon...   176   5e-43   Rattus norvegicus [brown rat]
sp|Q99KR7|PPIF_MOUSE|PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase, mitoch...   176   5e-43   Mus musculus [mouse]
sp|Q26551|PPIB_SCHMA|PPIB_SCHMA Peptidyl-prolyl cis-trans isomerase B precu...   176   5e-43   Schistosoma mansoni
sp|P52013|CYP5_CAEEL|CYP5_CAEEL Peptidyl-prolyl cis-trans isomerase 5 precu...   176   5e-43   Caenorhabditis elegans [roundworm]
gb:AF411956_2492676 Takifugu rubripes lck gene locus, partial se...   176   7e-43   
gb:AY678298_1622003 Lycopersicon esculentum clone 56B23 chromoso...   176   7e-43   
gb:DIU47813_1377748 Dirofilaria immitis cyclophilin Dicyp-2 mRNA...   176   7e-43   
gb:CEU31948_1368492 Caenorhabditis elegans cyclophilin isoform 5...   176   7e-43   
sp|Q9QZH3|PPIE_MOUSE|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E (EC 5...   176   7e-43   Mus musculus [mouse]
gb:AF424658_1798993 Phytophthora infestans clone MY-08-C-01 pept...   176   9e-43   
gb:AJ719394_2501581 Gallus gallus mRNA for hypothetical protein,...   175   1e-42   
gb:AY551095_1334919 Crassostrea gigas cyclophilin mRNA, complete...   175   1e-42   
pir|T40819|T40819 peptidylprolyl isomerase (EC 5.2.1.8) SPBP8B7....   175   1e-42   Schizosaccharomyces pombe
sp|Q9UNP9|PPIE_HUMAN|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E (EC 5...   175   1e-42   Homo sapiens [man]
sp|Q27774|PPIB_SCHJA|PPIB_SCHJA Peptidyl-prolyl cis-trans isomerase B precu...   175   1e-42   Schistosoma japonicum
gb:AF042385_1878496 Homo sapiens cyclophilin-33A (CYP-33) mRNA, ...   175   2e-42   
gb:CR382129_1661726 Yarrowia lipolytica chromosome C of strain C...   175   2e-42   
gb:AE013599_1133337 Drosophila melanogaster chromosome 2R, compl...   175   2e-42   
sp|Q9P3X9|PPID_NEUCR|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase ...   175   2e-42   
sp|P54985|CYPH_BLAGE|CYPH_BLAGE Peptidyl-prolyl cis-trans isomerase (EC 5.2...   174   2e-42   Blattella germanica
gb:AB019518_1514317 Trichophyton mentagrophytes mRNA for cycloph...   174   3e-42   
gb:LMFL2581_1387885 Leishmania major Friedlin chromosome 23 cosm...   174   3e-42   
gb:CR860299_1184382 Pongo pygmaeus mRNA; cDNA DKFZp459B225 (from...   174   3e-42   
gb:OVU47812_1391506 Onchocerca volvulus cyclophilin Ovcyp-2 mRNA...   174   4e-42   
gb:NC18F11_1688433 Neurospora crassa DNA linkage group V Cosmid ...   173   5e-42   
gb:AF182825_2058112 Mus musculus cyclophilin-33 (Cyp33) mRNA, pa...   173   6e-42   
gb:PAB271126_1698633 Picea abies mRNA for putative cyclosporin A...   173   6e-42   
gb:ATU40400_1556976 Arabidopsis thaliana cytosolic cyclophilin (...   173   6e-42   
pir|T47724|T47724 peptidylprolyl isomerase (EC 5.2.1.8) ROC2 - A...   173   6e-42   Arabidopsis thaliana [mouse-ear cress]
pir|T50769|T50769 peptidylprolyl isomerase (EC 5.2.1.8) CYP18 [s...   173   6e-42   Digitalis lanata [Grecian foxglove]
gb:BVE311666_1643105 Betula verrucosa mRNA for peptidylprolyl is...   172   8e-42   
gb:AY150052_1584922 Kandelia candel cyclophilin (Cyp1) mRNA, com...   172   8e-42   
gb:BX294148_769820 Pirellula sp. strain 1 complete genome; segme...   172   8e-42   
pir|T50768|T50768 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   172   8e-42   Digitalis lanata [Grecian foxglove]
sp|P45877|PPIC_HUMAN|PPIC_HUMAN Peptidyl-prolyl cis-trans isomerase C (EC 5...   172   1e-41   Homo sapiens [man]
sp|P21569|CYPH_MAIZE|CYPH_MAIZE Peptidyl-prolyl cis-trans isomerase (EC 5.2...   172   1e-41   Zea mays [maize]
sp|P30412|PPIC_MOUSE|PPIC_MOUSE Peptidyl-prolyl cis-trans isomerase C (EC 5...   172   1e-41   Mus musculus [mouse]
gb:CEU34354_1368504 Caenorhabditis elegans cyclophilin isoform 2...   171   2e-41   
pir|S48017|S48017 peptidylprolyl isomerase (EC 5.2.1.8) Cyp2 - r...   171   2e-41   Oryza sativa [red rice]
pir|A39252|CSTO peptidylprolyl isomerase (EC 5.2.1.8) - tomato        171   2e-41   
gb:BC059741_2552686 Xenopus tropicalis hypothetical protein MGC7...   171   3e-41   
gb:BC059470_2552447 Danio rerio peptidylprolyl isomerase A, like...   171   3e-41   
gb:AY088764_1573777 Arabidopsis thaliana clone 94608 mRNA, compl...   171   3e-41   
pir|B38388|B38388 peptidylprolyl isomerase (EC 5.2.1.8) (cycloph...   171   3e-41   Drosophila melanogaster
pir|S25443|CSBY peptidylprolyl isomerase (EC 5.2.1.8), cytosolic...   171   3e-41   
sp|P14832|CYPH_YEAST|CYPH_YEAST Peptidyl-prolyl cis-trans isomerase (EC 5.2...   171   3e-41   Saccharomyces cerevisiae [brewer's yeast]
sp|P25007|CYPH_DROME|CYPH_DROME Peptidyl-prolyl cis-trans isomerase (EC 5.2...   171   3e-41   Drosophila melanogaster
sp|P52014|CYP6_CAEEL|CYP6_CAEEL Peptidyl-prolyl cis-trans isomerase 6 precu...   171   3e-41   Caenorhabditis elegans [roundworm]
gb:RCO245940_1703385 Ricinus communis mRNA for cyclophilin (cyp1...   170   5e-41   
pir|S54833|S54833 peptidylprolyl isomerase (EC 5.2.1.8) Cyp - ki...   170   5e-41   Phaseolus vulgaris [French bean]
sp|P21568|CYPH_LYCES|CYPH_LYCES Peptidyl-prolyl cis-trans isomerase (EC 5.2...   170   5e-41   Solanum lycopersicum
gb:BC081399_2562278 Danio rerio peptidylprolyl isomerase F (cycl...   169   7e-41   
gb:BC078949_2107095 Rattus norvegicus peptidylprolyl isomerase C...   169   7e-41   
gb:AP006067_1860854 Oryza sativa (japonica cultivar-group) genom...   169   7e-41   
gb:AF456323_1801173 Glycine max cyclophilin (Cyp) mRNA, complete...   169   7e-41   
gb:AF078071_1766252 Griffithsia japonica cyclophilin (cypA) mRNA...   169   7e-41   
gb:SMU30265_1397849 Schistosoma mansoni cyclophylin-like protein...   169   7e-41   
pir|T50767|T50767 peptidylprolyl isomerase (EC 5.2.1.8) ATCYP4 [...   169   7e-41   Arabidopsis thaliana [mouse-ear cress]
gb:RICCYP2R_1703598 Oryza sativa cyclophilin 2 (Cyp2) mRNA, comp...   169   9e-41   
gb:AY705800_1179907 Pinus halepensis clone 17r cyclophilin mRNA,...   169   9e-41   
pir|T50771|T50771 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   169   9e-41   Solanum tuberosum [potatoes]
gb:AY391451_2531587 Danio rerio peptidylprolyl isomerase A (PPIA...   169   1e-40   
gb:CR382129_1661993 Yarrowia lipolytica chromosome C of strain C...   169   1e-40   
gb:AY229877_1591321 Populus tremuloides cyclophilin mRNA, comple...   169   1e-40   
gb:TVU68269_1401293 Trypanosoma vivax cyclophilin A (cypA) mRNA,...   169   1e-40   
gb:BMU47811_1355691 Brugia malayi cyclophilin Bmcyp-2 mRNA, comp...   169   1e-40   
gb:AY442290_2532577 Bitis gabonica venom gland cyclophilin mRNA,...   168   1e-40   
gb:CR382137_1670320 Debaryomyces hansenii chromosome E of strain...   168   1e-40   
gb:AY594335_1431715 Bos taurus cyclophilin F mRNA, complete cds.      168   1e-40   
pir|S07597|CSHYAC peptidylprolyl isomerase (EC 5.2.1.8) A - Chin...   168   1e-40   
sp|P14851|PPIA_CRILO|PPIA_CRILO Peptidyl-prolyl cis-trans isomerase A (EC 5...   168   1e-40   Cricetulus longicaudatus [lesser long-tailed hamster]
gb:BC059458_2552435 Danio rerio peptidylprolyl isomerase A (cycl...   168   2e-40   
gb:BC049009_2550082 Danio rerio peptidylprolyl isomerase A (cycl...   168   2e-40   
gb:AK003402_1151842 Mus musculus 18-day embryo whole body cDNA, ...   168   2e-40   
sp|Q9CR16|PPID_MOUSE|PPID_MOUSE 40 kDa peptidyl-prolyl cis-trans isomerase ...   168   2e-40   Mus musculus [mouse]
gb:BC068613_2555121 Xenopus laevis hypothetical protein LOC39863...   167   3e-40   
gb:BC054186_2550840 Xenopus laevis hypothetical protein LOC39863...   167   3e-40   
gb:AY646834_2541524 Xenopus laevis cyclophilin A (CypA) mRNA, co...   167   3e-40   
gb:BC005982_1969983 Homo sapiens peptidylprolyl isomerase A (cyc...   167   3e-40   
gb:AY646200_1958003 Aotus trivirgatus cyclophilin A mRNA, comple...   167   3e-40   
gb:AY346337_1321667 Branchiostoma belcheri tsingtaunese cyclophi...   167   3e-40   
gb:BC062863_2553452 Danio rerio peptidylprolyl isomerase A (cycl...   167   3e-40   
gb:AY652862_1620183 Populus balsamifera subsp. trichocarpa pepti...   167   3e-40   
gb:SMU50388_1397865 Schistosoma mansoni cyclophilin A mRNA, comp...   167   3e-40   
pir|A46579|A46579 estrogen receptor-binding cyclophilin - bovine...   167   3e-40   Bos taurus [bovine]
pir|A29819|CSRTA peptidylprolyl isomerase (EC 5.2.1.8) A - rat>g...   167   3e-40   
sp|P26882|PPID_BOVIN|PPID_BOVIN 40 kDa peptidyl-prolyl cis-trans isomerase ...   167   3e-40   Bos taurus [bovine]
sp|P10111|PPIA_RAT|PPIA_RAT Peptidyl-prolyl cis-trans isomerase A (EC 5.2...   167   3e-40   Rattus norvegicus [brown rat]
sp|P91791|CYPH_HEMPU|CYPH_HEMPU Peptidyl-prolyl cis-trans isomerase (EC 5.2...   167   3e-40   Hemicentrotus pulcherrimus
gb:AY391452_2531588 Danio rerio 2-peptidylprolyl isomerase A (PP...   167   4e-40   
gb:BC076386_2106753 Rattus norvegicus peptidylprolyl isomerase D...   167   4e-40   
gb:CR456707_1992914 Homo sapiens full open reading frame cDNA cl...   167   4e-40   
gb:AP004741_1844182 Oryza sativa (japonica cultivar-group) genom...   167   4e-40   
gb:AF542516_1810034 Beauveria bassiana cyclophilin A mRNA, compl...   167   4e-40   
gb:AF262982_1781650 Triticum aestivum cyclophilin A-1 (CyP1) mRN...   167   4e-40   
gb:AF242312_1780142 Euphorbia esula cyclophilin mRNA, partial cds.    167   4e-40   
gb:AE016818_1748302 Ashbya gossypii (= Eremothecium gossypii) AT...   167   4e-40   
gb:CR380954_1651241 Candida glabrata strain CBS138 chromosome H ...   167   4e-40   
gb:AY456122_1607156 Triticum aestivum cyclophilin A (CYP18-2) ge...   167   4e-40   
gb:AB020612_1514551 Vigna radiata mRNA for CYP1, complete cds.        167   4e-40   
gb:AF222790_1252586 Theileria parva cyclophilin 1 mRNA, complete...   167   4e-40   
gb:AF158368_1246025 Leishmania donovani cyclophilin (CYP) gene, ...   167   4e-40   
gb:AF121347_1242874 Dictyostelium discoideum cyclophilin D (cypD...   167   4e-40   
pir|A94496|CSHUA peptidylprolyl isomerase (EC 5.2.1.8) A - human...   167   4e-40   
sp|P05092|PPIA_HUMAN|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A (EC 5...   167   4e-40   Homo sapiens [man]
gb:AB002814_1192815 Tachypleus tridentatus mRNA for cyclophilin ...   166   6e-40   
gb:AF139893_1414924 Oryctolagus cuniculus cyclophilin 18 mRNA, c...   166   7e-40   
sp|P35627|CYP2_ARATH|CYP2_ARATH Peptidyl-prolyl cis-trans isomerase (EC 5.2...   166   7e-40   Arabidopsis thaliana [mouse-ear cress]
gb:BC071388_2556129 Danio rerio zgc:86711, mRNA (cDNA clone MGC:...   166   1e-39   
gb:BC041536_2547984 Xenopus laevis CYcloPhilin (18.4 kD) (cyp-7)...   166   1e-39   
gb:SCMCLCLPHN_1397186 Schistosoma japonicum (blood fluke) cyclop...   166   1e-39   
gb:LRU238310_1389050 Lumbricus rubellus mRNA for cyclophilin A.       166   1e-39   
gb:AF025804_1234141 Drosophila subobscura cyclophilin 1 (Cyp1) m...   166   1e-39   
sp|P18253|CYPH_SCHPO|CYPH_SCHPO Peptidyl-prolyl cis-trans isomerase (EC 5.2...   166   1e-39   Schizosaccharomyces pombe
gb:AP003621_1831596 Oryza sativa (japonica cultivar-group) genom...   165   1e-39   
gb:AE016820_1749778 Ashbya gossypii (= Eremothecium gossypii) AT...   165   1e-39   
gb:CR382122_1654998 Kluyveromyces lactis strain NRRL Y-1140 chro...   165   1e-39   
gb:CR380954_1651124 Candida glabrata strain CBS138 chromosome H ...   165   1e-39   
gb:CR380951_1649984 Candida glabrata strain CBS138 chromosome E ...   165   1e-39   
gb:AY266299_1428139 Sus scrofa peptidyl-prolyl cis-trans isomera...   165   1e-39   
gb:AK010649_1155910 Mus musculus ES cells cDNA, RIKEN full-lengt...   165   1e-39   
pir|S10327|CSMSA peptidylprolyl isomerase (EC 5.2.1.8) A - mouse...   165   1e-39   
sp|P17742|PPIA_MOUSE|PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A (EC 5...   165   1e-39   Mus musculus [mouse]
sp|P04374|PPIA_BOVIN|PPIA_BOVIN Peptidyl-prolyl cis-trans isomerase A (EC 5...   165   1e-39   Bos taurus [bovine]
gb:AP006618_560249 Nocardia farcinica IFM 10152 DNA, complete ge...   165   2e-39   
gb:CR542081_1994307 Homo sapiens full open reading frame cDNA cl...   164   2e-39   
gb:AY684994_1958784 Aotus trivirgatus TRIM5/cyclophilin A V4 fus...   164   2e-39   
gb:AY646199_1958002 Aotus trivirgatus TRIM5/cyclophilin A fusion...   164   2e-39   
gb:AY646198_1958001 Aotus trivirgatus TRIM5/cyclophilin A fusion...   164   2e-39   
gb:AF252388_1893057 Macaca mulatta cyclophilin mRNA, partial cds.     164   2e-39   
gb:CR382133_1666890 Debaryomyces hansenii chromosome A of strain...   164   2e-39   
gb:AY029366_1424135 Felis catus cyclophilin A (cypA) mRNA, compl...   164   2e-39   
gb:AF025803_1234140 Drosophila pseudoobscura cyclophilin 1 (Cyp1...   164   2e-39   
gb:CR859672_1183778 Pongo pygmaeus mRNA; cDNA DKFZp459I0834 (fro...   164   2e-39   
pir|A45981|A45981 peptidylprolyl isomerase (EC 5.2.1.8) CyP-40 -...   164   2e-39   Homo sapiens [man]
sp|Q08752|PPID_HUMAN|PPID_HUMAN 40 kDa peptidyl-prolyl cis-trans isomerase ...   164   2e-39   Homo sapiens [man]
gb:AX887972_1483425 Sequence 3835 from Patent EP1033401.              164   3e-39   
gb:AY232025_1177318 Drosophila yakuba clone yak-ad_Cyp1 mRNA seq...   164   3e-39   
pir|T50770|T50770 peptidylprolyl isomerase (EC 5.2.1.8) vcCyP [s...   164   3e-39   Vicia faba [broad bean]
pir|S48018|S48018 peptidylprolyl isomerase (EC 5.2.1.8) Cyp1 - r...   164   3e-39   Oryza sativa [red rice]
gb:XLA496795_2582598 Xenopus laevis partial mRNA for peptidylpro...   164   4e-39   
gb:MFU011956_1686054 Malassezia sympodialis mRNA for allergen Ma...   164   4e-39   
gb:AY773481_1628186 Amanita muscaria 40 kDa cyclophilin (Cyp40) ...   164   4e-39   
gb:TBU68270_1399479 Trypanosoma brucei brucei cyclophilin A (cyp...   164   4e-39   
gb:BC007104_1970526 Homo sapiens peptidylprolyl isomerase A (cyc...   163   5e-39   
sp|P73789|PPI2_SYNY3|PPI2_SYNY3 Peptidyl-prolyl cis-trans isomerase slr1251...   163   5e-39   Synechocystis sp.
gb:AP004159_1838390 Oryza sativa (japonica cultivar-group) genom...   163   6e-39   
gb:TCR010066_1399749 Trypanosoma cruzi cyp gene.                      163   6e-39   
pir|S50141|S50141 peptidylprolyl isomerase (EC 5.2.1.8) - Arabid...   163   6e-39   Arabidopsis thaliana [mouse-ear cress]
pir|T07950|T07950 peptidylprolyl isomerase (EC 5.2.1.8) 1 - Chla...   163   6e-39   Chlamydomonas reinhardtii
sp|Q9V3G3|PPIE_DROME|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E (EC 5...   163   6e-39   Drosophila melanogaster
gb:CR382129_1661735 Yarrowia lipolytica chromosome C of strain C...   162   8e-39   
gb:AK012491_1156989 Mus musculus 11 days embryo whole body cDNA,...   162   8e-39   
sp|P25719|CYPC_YEAST|CYPC_YEAST Peptidyl-prolyl cis-trans isomerase C, mito...   162   8e-39   Saccharomyces cerevisiae [brewer's yeast]
gb:TCU68268_1399925 Trypanosoma congolense cyclophilin A (cypA) ...   162   1e-38   
gb:AY775573_1628283 Codonopsis lanceolata cyclophilin 1 (CyP1) m...   162   1e-38   
gb:HMU36797_1386253 Hirudo medicinalis cyclophilin-A mRNA (hcyp)...   162   1e-38   
pir|T05766|T05766 peptidylprolyl isomerase (EC 5.2.1.8) M4E13.20...   162   1e-38   Arabidopsis thaliana [mouse-ear cress]
sp|O49886|CYPH_LUPLU|CYPH_LUPLU Peptidyl-prolyl cis-trans isomerase (EC 5.2...   162   1e-38   Lupinus luteus
sp|P22011|CYPH_CANAL|CYPH_CANAL Peptidyl-prolyl cis-trans isomerase (EC 5.2...   162   1e-38   Candida albicans
gb:CR382124_1657059 Kluyveromyces lactis strain NRRL Y-1140 chro...   161   2e-38   
gb:LMCYCL_1387675 Leishmania major mRNA for cyclophilin.              161   2e-38   
gb:AY429574_1605886 Populus alba x Populus tremula clone INRA 71...   161   2e-38   
gb:PFMAL3P7_1394593 Plasmodium falciparum MAL3P7, complete seque...   161   2e-38   
gb:SCU92087_1710610 Solanum commersonii stress responsive cyclop...   160   3e-38   
gb:BC082380_2562617 Xenopus laevis MGC81732 protein, mRNA (cDNA ...   160   4e-38   
gb:BT019342_2151301 Synthetic construct Homo sapiens peptidyl pr...   160   4e-38   
gb:AY231990_1177283 Drosophila yakuba clone yak-ad_CG7768 mRNA s...   160   4e-38   
sp|O43447|PPIH_HUMAN|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H (EC 5...   160   4e-38   Homo sapiens [man]
gb:AF180337_1774807 Filobasidiella neoformans var. neoformans cy...   160   5e-38   
gb:AB125939_1528236 Malassezia pachydermatis CYP mRNA for cyclop...   160   5e-38   
gb:AF243140_1416671 Canis familiaris cyclophilin A mRNA, partial...   160   5e-38   
pir|JT0686|JT0686 peptidylprolyl isomerase (EC 5.2.1.8) a, cytos...   160   5e-38   Fusarium sporotrichioides
gb:AF042386_1878497 Homo sapiens cyclophilin-33B (CYP-33) mRNA, ...   159   7e-38   
gb:CR382134_1667277 Debaryomyces hansenii chromosome B of strain...   159   7e-38   
gb:CR541899_1994126 Homo sapiens full open reading frame cDNA cl...   159   9e-38   
gb:CR382126_1658575 Kluyveromyces lactis strain NRRL Y-1140 chro...   159   9e-38   
sp|P35176|CYPD_YEAST|CYPD_YEAST Peptidyl-prolyl cis-trans isomerase D precu...   159   9e-38   Saccharomyces cerevisiae [brewer's yeast]
gb:BC061335_2553111 Xenopus tropicalis hypothetical protein MGC7...   159   1e-37   
gb:AE017342_1754779 Cryptococcus neoformans var. neoformans JEC2...   159   1e-37   
gb:CR382123_1655917 Kluyveromyces lactis strain NRRL Y-1140 chro...   159   1e-37   
gb:AC006438_1534276 Arabidopsis thaliana chromosome 2 clone F19G...   159   1e-37   
pir|D84533|D84533 hypothetical protein At2g15790 [imported] - Ar...   159   1e-37   Arabidopsis thaliana [mouse-ear cress]
pir|S68357|S52760 peptidylprolyl isomerase (EC 5.2.1.8) precurso...   159   1e-37   
gb:PME132763_1700771 Pseudotsuga menziesii mRNA for cyclophilin.      158   2e-37   
gb:AB098778_1410147 Bos taurus mRNA for similar to peptidylproly...   158   2e-37   
sp|P34887|CYPH_ALLCE|CYPH_ALLCE Peptidyl-prolyl cis-trans isomerase (EC 5.2...   158   2e-37   Allium cepa
gb:AY394969_2531712 Danio rerio clone RK058A3D03 peptidyl prolyl...   158   2e-37   
gb:AF191832_1249603 Trypanosoma cruzi cyclophilin A (CYP A) mRNA...   157   3e-37   
pir|F84808|F84808 probable peptidyl-prolyl cis-trans isomerase [...   157   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb:CR380956_1652375 Candida glabrata strain CBS138 chromosome J ...   157   4e-37   
gb:TGU04634_1400203 Toxoplasma gondii Rh 20 kDa cyclophilin prec...   156   6e-37   
pir|B53522|B53522 20k cyclophilin - Toxoplasma gondii (fragment)      156   6e-37   Toxoplasma gondii
gb:HS118J21_1996988 Human DNA sequence from clone RP1-118J21 on ...   155   1e-36   
gb:AE017350_1759182 Cryptococcus neoformans var. neoformans JEC2...   155   1e-36   
gb:AF222791_1252587 Theileria parva cyclophilin 1 gene, partial ...   155   1e-36   
pir|T31517|T31517 hypothetical protein Y116A8C.34 - Caenorhabdit...   155   1e-36   Caenorhabditis elegans [roundworm]
gb:BC064250_2553803 Xenopus tropicalis hypothetical protein MGC7...   155   2e-36   
gb:AY684992_1958782 Aotus trivirgatus TRIM5/cyclophilin A V2 fus...   154   2e-36   
gb:POS417659_1701052 Pleurotus ostreatus partial mRNA for putati...   154   2e-36   
gb:AY389742_1178349 Hyacinthus orientalis cyclophilin mRNA, comp...   154   2e-36   
gb:AC137507_1743426 Oryza sativa chromosome 3 BAC OSJNBb0033J23 ...   154   3e-36   
gb:AB099010_1410333 Bos taurus mRNA for similar to peptidylproly...   154   3e-36   
pir|A45000|A45000 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   154   3e-36   Echinococcus granulosus
sp|P14088|CYPH_ECHGR|CYPH_ECHGR Peptidyl-prolyl cis-trans isomerase (EC 5.2...   154   3e-36   Echinococcus granulosus
gb:AF333997_1787435 Filobasidiella neoformans var. neoformans cy...   154   4e-36   
gb:U40938_1403481 Caenorhabditis elegans cosmid D1009, complete ...   154   4e-36   
sp|P52016|CYP8_CAEEL|CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 (EC 5...   154   4e-36   Caenorhabditis elegans [roundworm]
gb:AF336984_1787623 Vaucheria litorea cyclophilin mRNA, partial ...   153   5e-36   
gb:BX842633_1644033 Neurospora crassa DNA linkage group I cosmid...   153   5e-36   
gb:BT001578_1356351 Drosophila melanogaster RE23622 full insert ...   153   5e-36   
gb:AY134669_1302795 Drosophila melanogaster peptidylprolyl cis-t...   153   5e-36   
gb:AE014297_1141825 Drosophila melanogaster chromosome 3R, compl...   153   5e-36   
gb:SCO939131_181176 Streptomyces coelicolor A3(2) complete genom...   153   6e-36   
gb:AF180336_1774806 Filobasidiella neoformans var. neoformans cy...   152   8e-36   
gb:AY568527_1615465 Arabidopsis thaliana multidomain cyclophilin...   152   8e-36   
pir|T49181|T49181 cyclophylin-like protein - Arabidopsis thalian...   152   8e-36   Arabidopsis thaliana [mouse-ear cress]
gb:CR382139_1672459 Debaryomyces hansenii chromosome G of strain...   152   1e-35   
sp|P53691|CYP6_YEAST|CYP6_YEAST Peptidyl-prolyl cis-trans isomerase CPR6 (E...   152   1e-35   Saccharomyces cerevisiae [brewer's yeast]
gb:AY557959_1614186 Saccharomyces cerevisiae clone FLH004814.01X...   152   1e-35   
gb:AY231912_1177205 Drosophila yakuba clone yak-em_Cyp1 mRNA seq...   152   1e-35   
sp|P52018|CYPB_CAEEL|CYPB_CAEEL Peptidyl-prolyl cis-trans isomerase 11 (EC ...   151   2e-35   
gb:BC071449_2556189 Danio rerio peptidyl-prolyl isomerase G (cyc...   150   3e-35   
gb:AF333996_1787434 Filobasidiella neoformans var. neoformans cy...   150   5e-35   
gb:AF293848_1783878 Pyricularia grisea cyclophilin (CYP1) gene, ...   150   5e-35   
gb:AE017150_1029659 Trypanosoma brucei chromosome 2, complete se...   150   5e-35   
gb:AE017150_1029647 Trypanosoma brucei chromosome 2, complete se...   150   5e-35   
sp|Q06118|PPIA_STRCH|PPIA_STRCH Peptidyl-prolyl cis-trans isomerase A (EC 5...   150   5e-35   
sp|O00060|CYPH_UROFA|CYPH_UROFA Peptidyl-prolyl cis-trans isomerase (EC 5.2...   150   5e-35   
sp|O00845|CYPH_PARPR|CYPH_PARPR Peptidyl-prolyl cis-trans isomerase (EC 5.2...   150   5e-35   
gb:BC072740_2556670 Xenopus laevis hypothetical protein LOC44358...   149   9e-35   
gb:BC067931_2554916 Xenopus tropicalis hypothetical protein MGC6...   149   1e-34   
gb:AE017345_1756685 Cryptococcus neoformans var. neoformans JEC2...   149   1e-34   
gb:AB084917_1871991 Homo sapiens mRNA for Cyclophilin-LC, comple...   148   2e-34   
sp|P10255|CYPH_NEUCR|CYPH_NEUCR Peptidyl-prolyl cis-trans isomerase, mitoch...   148   2e-34   
gb:BC044189_2548577 Danio rerio peptidyl-prolyl isomerase G (cyc...   148   2e-34   
gb:EMU292367_1384651 Echinococcus multilocularis mRNA for putati...   148   2e-34   
gb:AY349021_1321768 Trypanosoma cruzi 21 kDa cyclophilin mRNA, c...   148   2e-34   
pir|S51497|S51497 peptidylprolyl isomerase (EC 5.2.1.8) A - cycl...   148   2e-34   
gb:AE016814_1745774 Ashbya gossypii (= Eremothecium gossypii) AT...   147   3e-34   
gb:AY277722_1594492 Botryotinia fuckeliana cyclophilin 1 (BCP1) ...   147   3e-34   
gb:BC030915_2096917 Mus musculus RAN binding protein 2, mRNA (cD...   147   4e-34   
gb:LRCYCLOP_1389041 Lumbricus rubellus mRNA for cyclophilin B.        147   4e-34   
gb:AE013599_1130261 Drosophila melanogaster chromosome 2R, compl...   147   4e-34   
gb:TNCYCABPR_1725339 T.niveum gene for cyclophilin A-binding pro...   147   5e-34   
pir|S71849|S71849 peptidylprolyl isomerase (EC 5.2.1.8) A precur...   147   5e-34   
gb:AF279458_2061297 Mus musculus Ran-binding protein 2 gene, com...   146   6e-34   
gb:AB062457_1522124 Magnaporthe grisea CYP1 mRNA for cyclophilin...   146   8e-34   
gb:AE016817_1747471 Ashbya gossypii (= Eremothecium gossypii) AT...   145   1e-33   
gb:AY277722_1594493 Botryotinia fuckeliana cyclophilin 1 (BCP1) ...   145   1e-33   
gb:AJ698392_1283782 Euplotes vannus macronuclear gene for peptid...   145   1e-33   
gb:AC116986_1207446 Dictyostelium discoideum chromosome 2 map 22...   145   1e-33   
pir|T49204|T49204 peptidylprolyl isomerase (EC 5.2.1.8) F27K19.1...   145   1e-33   
gb:NCCYCGEN_1690504 Neurospora crassa cyclophilin gene.               145   1e-33   
gb:AE016959_1021004 Oryza sativa (japonica cultivar-group) chrom...   145   1e-33   
gb:BC085963_2564558 Xenopus laevis hypothetical LOC495525, mRNA ...   145   2e-33   
gb:BC085723_2109296 Rattus norvegicus cDNA clone MGC:93333 IMAGE...   145   2e-33   
gb:BC048905_2099865 Mus musculus peptidyl-prolyl isomerase G (cy...   145   2e-33   
gb:BC073875_1989152 Homo sapiens peptidyl-prolyl isomerase G (cy...   145   2e-33   
gb:BC063711_1986345 Homo sapiens peptidyl-prolyl isomerase G (cy...   145   2e-33   
gb:BC001555_1967676 Homo sapiens peptidyl-prolyl isomerase G (cy...   145   2e-33   
gb:AE017342_1754785 Cryptococcus neoformans var. neoformans JEC2...   145   2e-33   
sp|O55035|PPIG_RAT|PPIG_RAT Peptidyl-prolyl cis-trans isomerase G (EC 5.2...   145   2e-33   
sp|Q13427|PPIG_HUMAN|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G (EC 5...   145   2e-33   
gb:AY123113_1579981 Griffithsia japonica peptidylprolyl isomeras...   144   2e-33   
gb:BOVCYC40B_1435373 Cow cyclophilin-40 mRNA, partial cds.            143   5e-33   
gb:BOVRSC_1435820 Bos taurus (clone C14) retina-specific cycloph...   143   7e-33   
sp|P48820|RBP2_BOVIN|RBP2_BOVIN Ran-binding protein 2 (RanBP2) (Nuclear por...   143   7e-33   
gb:SCCYPRE_1707469 Yeast gene for cyclophilin-related protein.        142   9e-33   
pir|T39632|T39632 peptidylprolyl isomerase (EC 5.2.1.8) u-snrnp-...   142   9e-33   
sp|Q9D868|PPIH_MOUSE|PPIH_MOUSE Peptidyl-prolyl cis-trans isomerase H (EC 5...   142   9e-33   
sp|P23285|CYPB_YEAST|CYPB_YEAST Peptidyl-prolyl cis-trans isomerase B precu...   142   9e-33   
gb:TAU55771_1398413 Theileria annulata cyclophilin homolog Ta cy...   142   1e-32   
gb:OVU70827_1391510 Onchocerca volvulus cyclophilin (Ovcyp-1) mR...   141   2e-32   
sp|Q26565|CYPH_SCHMA|CYPH_SCHMA Peptidyl-prolyl cis-trans isomerase (EC 5.2...   141   2e-32   
gb:AF096318_1767819 Aspergillus niger cyclophilin-like peptidyl ...   141   3e-32   
gb:AY585929_1616336 Paxillus involutus strain ATCC 200175 putati...   140   3e-32   
sp|P28517|CYPR_CALVI|CYPR_CALVI Peptidyl-prolyl cis-trans isomerase, rhodop...   140   3e-32   
sp|Q27450|CYP1_BRUMA|CYP1_BRUMA Peptidylprolyl isomerase 1 (EC 5.2.1.8) (Pe...   140   3e-32   
gb:BC045448_2549285 Danio rerio zgc:55766, mRNA (cDNA clone MGC:...   140   4e-32   
gb:AY170823_1937714 Homo sapiens transformation-related protein ...   140   4e-32   
pir|S58884|S58884 Ran-binding protein 2 - human>gb:HUMRANBP2_203...   140   4e-32   
sp|P49792|RBP2_HUMAN|RBP2_HUMAN Ran-binding protein 2 (RanBP2) (Nuclear por...   140   4e-32   
gb:BC071448_2556188 Danio rerio zgc:86780, mRNA (cDNA clone MGC:...   140   6e-32   
gb:AY170822_1937713 Homo sapiens transformation-related protein ...   140   6e-32   
gb:CNS07EGF_1373822 chromosome VIII of strain GB-M1 of Encephali...   140   6e-32   
sp|Q09637|CYP9_CAEEL|CYP9_CAEEL Peptidyl-prolyl cis-trans isomerase 9 (EC 5...   139   1e-31   
gb:AFU6689_1810976 Aspergillus fumigatus mRNA for rAsp f 11 alle...   139   1e-31   
gb:AY247029_1427948 Bos taurus peptidylprolyl isomerase A mRNA, ...   138   2e-31   
gb:AE017346_1757189 Cryptococcus neoformans var. neoformans JEC2...   138   2e-31   
sp|Q11004|CYP5_SCHPO|CYP5_SCHPO 40 kDa peptidyl-prolyl cis-trans isomerase ...   138   2e-31   
gb:AJ865374_1423285 Ovis aries partial mRNA for putative cycloph...   137   3e-31   
gb:AY217752_1590149 Triticum aestivum cyclophilin-like protein (...   137   4e-31   
sp|P15425|CYPR_DROME|CYPR_DROME Peptidyl-prolyl cis-trans isomerase, rhodop...   136   6e-31   
gb:AL133481_1918609 Human DNA sequence from clone RP11-342M3 on ...   132   4e-30   
gb:DIU70884_1377758 Dirofilaria immitis cyclophilin 1 mRNA, part...   133   5e-30   
gb:AY585960_1616367 Paxillus involutus strain ATCC 200175 putati...   132   1e-29   
gb:AY585961_1616368 Paxillus involutus strain Pi01SE putative cy...   130   3e-29   
gb:AJ609278_1812003 Cicer arietinum partial mRNA for cyclophilin...   130   6e-29   
gb:AY585963_1616370 Paxillus involutus strain Maj putative cyclo...   130   6e-29   
gb:AL139085_1920228 Human DNA sequence from clone RP11-431O22 on...   129   8e-29   
gb:AX461042_1469010 Sequence 32 from Patent WO0222823.                129   8e-29   
pir|A47328|A47328 natural killer cell tumor-recognition protein ...   129   8e-29   
gb:MUSCYCLORA_2125622 Mus musculus cyclophilin-related protein m...   129   1e-28   
gb:MMNKTR2_2116730 Mus musculus natural killer tumor recognition...   129   1e-28   
gb:AE017351_1759269 Cryptococcus neoformans var. neoformans JEC2...   129   1e-28   
gb:AK035582_1164158 Mus musculus adult male urinary bladder cDNA...   129   1e-28   
pir|B47328|B47328 natural killer cell tumor-recognition protein ...   129   1e-28   
sp|P30415|NKCR_MOUSE|NKCR_MOUSE NK-tumor recognition protein (Natural-kille...   129   1e-28   
sp|P30414|NKCR_HUMAN|NKCR_HUMAN NK-tumor recognition protein (Natural-kille...   129   1e-28   
gb:CR382127_1660164 Yarrowia lipolytica chromosome A of strain C...   128   2e-28   
gb:BC080913_2561827 Xenopus tropicalis MGC79544 protein, mRNA (c...   127   3e-28   
gb:AP003928_1835396 Oryza sativa (japonica cultivar-group) genom...   127   4e-28   
gb:AF384147_1794193 Triticum aestivum cyclophilin mRNA, partial ...   127   4e-28   
gb:AB110199_1526912 Oryza sativa (japonica cultivar-group) mRNA ...   127   4e-28   
gb:AF291180_1783697 Capsicum annuum cyclophilin CACYP1 mRNA, com...   127   5e-28   
gb:AY349022_1321769 Trypanosoma cruzi 40 kDa cyclophilin mRNA, c...   126   6e-28   
gb:AY062653_1565309 Arabidopsis thaliana putative protein (At3g4...   126   8e-28   
pir|T48940|T48940 hypothetical protein F14L2.150 - Arabidopsis t...   126   8e-28   
gb:CR382133_1666713 Debaryomyces hansenii chromosome A of strain...   125   1e-27   
gb:AF177281_1247763 Plasmodium falciparum isolate FCC1/HN cyclop...   124   2e-27   
pir|A53522|A53522 peptidylprolyl isomerase (EC 5.2.1.8) [similar...   124   2e-27   
gb:PFU10322_1395007 Plasmodium falciparum HB3 cyclophilin (cyppf...   124   3e-27   
gb:AY600587_1340199 Taenia solium isolate CD1 peptidylprolyl iso...   124   3e-27   
gb:PFMAL8P1_1192283 Plasmodium falciparum 3D7 chromosome 8, *** ...   124   3e-27   
gb:AE014296_1135573 Drosophila melanogaster chromosome 3L, compl...   124   3e-27   
gb:AF055990_1764647 Fucus distichus cyclophilin mRNA, partial cds.    124   4e-27   
gb:TGU04633_1400202 Toxoplasma gondii Rh 18 kDa cyclophilin mRNA...   124   4e-27   
gb:AK176511_1818499 Arabidopsis thaliana mRNA for cyclophilin (A...   121   2e-26   
gb:AY251270_1428027 Ovis aries peptidylprolyl isomerase A mRNA, ...   121   3e-26   
gb:CR382135_1668264 Debaryomyces hansenii chromosome C of strain...   120   4e-26   
gb:CR382129_1661599 Yarrowia lipolytica chromosome C of strain C...   120   4e-26   
gb:AE013599_1133338 Drosophila melanogaster chromosome 2R, compl...   120   5e-26   
gb:AE014188_967834 Plasmodium falciparum 3D7 chromosome 12, comp...   120   5e-26   
gb:BC087299_2565152 Xenopus laevis hypothetical LOC495937, mRNA ...   119   8e-26   
gb:AY775150_1350602 Farfantepenaeus paulensis cyclophilin mRNA, ...   119   1e-25   
gb:AY585941_1616348 Paxillus filamentosus strain Pf01DE putative...   119   1e-25   
gb:CR382136_1668808 Debaryomyces hansenii chromosome D of strain...   118   2e-25   
gb:AB098989_1410312 Bos taurus mRNA for similar to cyclophilin B...   118   2e-25   
gb:AF521140_1807878 Kandelia candel cyclophilin mRNA, partial cds.    117   3e-25   
gb:AY231875_1177168 Drosophila yakuba clone yak-em_CG2852 mRNA s...   116   7e-25   
gb:BX571790_2567682 Zebrafish DNA sequence from clone CH211-199M...   115   1e-24   
gb:AY456123_1607157 Triticum aestivum cyclophilin A (CYP18-1) ge...   115   1e-24   
gb:AY232181_1177474 Drosophila yakuba clone yak-ad_CG2852 mRNA s...   115   2e-24   
gb:BX842646_823213 Bdellovibrio bacteriovorus complete genome, s...   115   2e-24   
gb:AL162574_1922495 Human DNA sequence from clone RP11-282A11 on...   114   3e-24   
gb:BX842641_1644199 Neurospora crassa DNA linkage group I BAC co...   114   3e-24   
gb:AF286342_1258977 Trypanosoma cruzi cyclophilin mRNA, complete...   114   3e-24   
gb:CR382123_1655848 Kluyveromyces lactis strain NRRL Y-1140 chro...   113   6e-24   
gb:AE013599_1133805 Drosophila melanogaster chromosome 2R, compl...   111   2e-23   
gb:AE017342_1754836 Cryptococcus neoformans var. neoformans JEC2...   110   4e-23   
gb:AE014296_1134026 Drosophila melanogaster chromosome 3L, compl...   110   4e-23   
gb:CBR5807_1359339 Caenorhabditis briggsae pdi-1 gene and partia...   110   5e-23   
gb:AL359711_1925698 Human DNA sequence from clone RP11-425D10 on...   110   6e-23   
gb:AX884231_1479684 Sequence 94 from Patent EP1033401.                110   6e-23   
sp|P87051|PPI1_SCHPO|PPI1_SCHPO Peptidyl-prolyl cis-trans isomerase ppi1 (E...   109   1e-22   
gb:CR382129_1661945 Yarrowia lipolytica chromosome C of strain C...   107   3e-22   
gb:BX571661_778920 Wolinella succinogenes, complete genome; segm...   107   5e-22   
pir|T41399|T41399 probable cyclophilin-related peptidyl prolyl c...   106   7e-22   
pir|C84777|C84777 cyclophilin-like protein [imported] - Arabidop...   106   7e-22   
pir|T29283|T29283 peptidylprolyl isomerase (EC 5.2.1.8) C34D4.12...   106   9e-22   
gb:BX294145_769060 Pirellula sp. strain 1 complete genome; segme...   105   2e-21   
gb:AY596297_634459 Haloarcula marismortui ATCC 43049 chromosome ...   104   3e-21   
gb:AB067654_1522601 Oryza sativa (japonica cultivar-group) OsCyp...   104   3e-21   
gb:AY532061_1333581 Oikopleura dioica DLLregion-01, integrin alp...   104   3e-21   
sp|Q9Y3C6|PPL1_HUMAN|PPL1_HUMAN Peptidyl-prolyl cis-trans isomerase like 1 ...   103   6e-21   
gb:AY085003_1570085 Arabidopsis thaliana clone 124189 mRNA, comp...   103   8e-21   
gb:AY008846_1423475 Sus scrofa cyclophilin mRNA, partial cds.         102   1e-20   
pir|C86151|C86151 F22M8.7 protein - Arabidopsis thaliana>gb:AE00...   102   1e-20   
sp|Q9D0W5|PPL1_MOUSE|PPL1_MOUSE Peptidyl-prolyl cis-trans isomerase like 1 ...   102   1e-20   
gb:AF455393_1801133 Aspergillus niger cyclophilin-like peptidyl ...   102   1e-20   
gb:AP000559_1820309 Oryza sativa (japonica cultivar-group) genom...   102   2e-20   
gb:AB098936_1410259 Bos taurus mRNA for similar to cyclophilin B...   102   2e-20   
gb:AE017261_419654 Picrophilus torridus DSM 9790, complete genome.    102   2e-20   
gb:PFA929352_1393005 Plasmodium falciparum strain 3D7, chromosom...   101   2e-20   
gb:BX908798_830689 Parachlamydia-related symbiont UWE25, complet...   101   2e-20   
gb:AE017343_1755386 Cryptococcus neoformans var. neoformans JEC2...   101   3e-20   
gb:AK028532_1161039 Mus musculus 0 day neonate skin cDNA, RIKEN ...   101   3e-20   
sp|O66105|PPIB_TREPA|PPIB_TREPA Probable peptidyl-prolyl cis-trans isomeras...   101   3e-20   
gb:HUMORF006_2035278 Homo sapiens KIAA0073 mRNA, partial cds.         100   4e-20   
gb:BC015385_1975072 Homo sapiens KIAA0073 protein, mRNA (cDNA cl...   100   4e-20   
gb:CR926008_1185525 Pongo pygmaeus mRNA; cDNA DKFZp459P2020 (fro...   100   4e-20   
pir|S68767|S68767 peptidylprolyl isomerase (EC 5.2.1.8) - rat (f...   100   6e-20   
gb:BC044993_2548952 Xenopus laevis similar to peptidylprolyl iso...    99   1e-19   
gb:CEY87G2A_1371188 Caenorhabditis elegans YAC Y87G2A, complete ...    99   1e-19   
gb:AE017254_417428 Treponema denticola ATCC 35405, section 9 of ...    99   1e-19   
gb:TNCPTAG_1725337 T.niveum (ATCC34921) cptA gene for cyclophilin.     99   2e-19   
sp|Q9NI62|CYPE_DICDI|CYPE_DICDI Peptidyl-prolyl cis-trans isomerase cypE (E...    99   2e-19   
gb:BC078520_2561059 Xenopus laevis cDNA clone MGC:85340 IMAGE:68...    98   3e-19   
gb:BC051602_2550418 Xenopus laevis similar to peptidylprolyl iso...    98   3e-19   
gb:AE016818_1748087 Ashbya gossypii (= Eremothecium gossypii) AT...    98   3e-19   
gb:AY062516_1565172 Arabidopsis thaliana peptidylprolyl isomeras...    98   3e-19   
gb:AB013390_1512074 Arabidopsis thaliana genomic DNA, chromosome...    98   3e-19   
gb:AF121134_1242863 Schistosoma mansoni cyclophilin mRNA, comple...    98   3e-19   
gb:AK081792_1173384 Mus musculus 16 days embryo head cDNA, RIKEN...    97   5e-19   
gb:AK012472_1156977 Mus musculus 11 days embryo whole body cDNA,...    97   5e-19   
gb:AK009460_1155154 Mus musculus adult male tongue cDNA, RIKEN f...    97   5e-19   
pir|D84342|D84342 peptidyl-prolyl isomerase [imported] - Halobac...    97   5e-19   
pir|T43805|T43805 peptidylprolyl isomerase (EC 5.2.1.8) cyp [sim...    97   5e-19   
sp|Q9D787|PPL2_MOUSE|PPL2_MOUSE Peptidyl-prolyl cis-trans isomerase like 2 ...    97   5e-19   
gb:SCU48868_1710442 Saccharomyces cerevisiae cyclophilin (CPR7) ...    97   7e-19   
sp|P47103|CYP7_YEAST|CYP7_YEAST Peptidyl-prolyl cis-trans isomerase CYP7 (E...    97   7e-19   
gb:AE016956_366847 Enterococcus faecalis V583, section 10 of 11 ...    96   9e-19   
gb:AE013598_294673 Xanthomonas oryzae pv. oryzae KACC10331, comp...    96   9e-19   
gb:AE013599_1132189 Drosophila melanogaster chromosome 2R, compl...    96   2e-18   
gb:CR522870_100490 Desulfotalea psychrophila LSv54 chromosome.         96   2e-18   
gb:BC071410_2556150 Danio rerio zgc:56616, mRNA (cDNA clone MGC:...    95   2e-18   
gb:BC085890_2109449 Rattus norvegicus cDNA clone MGC:94681 IMAGE...    95   2e-18   
gb:CR382133_1666812 Debaryomyces hansenii chromosome A of strain...    95   2e-18   
gb:AE017203_404386 Lactobacillus johnsonii NCC 533, section 4 of...    95   2e-18   
gb:AE011730_275959 Xanthomonas axonopodis pv. citri str. 306, se...    95   2e-18   
pir|E75543|E75543 peptidylprolyl isomerase (EC 5.2.1.8) DR0237 [...    95   2e-18   
gb:AY568523_1615461 Arabidopsis thaliana single domain cyclophil...    95   3e-18   
gb:AE014186_938133 Plasmodium falciparum 3D7 chromosome 11 compl...    95   3e-18   
gb:CR628336_112062 Legionella pneumophila str. Paris complete ge...    95   3e-18   
gb:BC076653_2559402 Xenopus tropicalis MGC79515 protein, mRNA (c...    94   5e-18   
gb:BC075537_2558637 Xenopus tropicalis MGC89451 protein, mRNA (c...    94   5e-18   
gb:AJ720461_2502648 Gallus gallus mRNA for hypothetical protein,...    94   6e-18   
gb:HSU37221_2023857 Human cyclophilin-like protein mRNA, partial...    94   6e-18   
gb:HSU37220_2023856 Human cyclophilin-like protein mRNA, partial...    94   6e-18   
gb:BC028385_1979247 Homo sapiens peptidylprolyl isomerase (cyclo...    94   6e-18   
gb:BC000022_1966358 Homo sapiens peptidylprolyl isomerase (cyclo...    94   6e-18   
gb:CNS07EGG_1374163 chromosome X of strain GB-M1 of Encephalitoz...    94   6e-18   
sp|Q13356|PPL2_HUMAN|PPL2_HUMAN Peptidyl-prolyl cis-trans isomerase like 2 ...    94   6e-18   
gb:AE014188_967957 Plasmodium falciparum 3D7 chromosome 12, comp...    93   1e-17   
gb:AE012191_280193 Xanthomonas campestris pv. campestris str. AT...    93   1e-17   
gb:AJ719632_2501819 Gallus gallus mRNA for hypothetical protein,...    92   1e-17   
gb:AL935258_551920 Lactobacillus plantarum strain WCFS1 complete...    92   1e-17   
gb:CR628337_115140 Legionella pneumophila str. Lens complete gen...    92   1e-17   
gb:BX842594_1643610 Neurospora crassa DNA linkage group II BAC c...    92   2e-17   
gb:AE017354_460317 Legionella pneumophila subsp. pneumophila str...    92   2e-17   
gb:PFA929354_1393186 Plasmodium falciparum strain 3D7, chromosom...    92   2e-17   
gb:BC007693_1970916 Homo sapiens peptidylprolyl isomerase (cyclo...    91   3e-17   
gb:CP000033_89385 Lactobacillus acidophilus NCFM, complete genome.     91   3e-17   
gb:AF315802_2062627 Rattus norvegicus CYP10L (Cyp10l) mRNA, comp...    91   4e-17   
pir|T18577|T18577 peptidylprolyl isomerase (EC 5.2.1.8) cyp-10 [...    91   4e-17   
sp|P52017|CYPA_CAEEL|CYPA_CAEEL Peptidyl-prolyl cis-trans isomerase 10 (EC ...    91   4e-17   
gb:AF271652_1894089 Homo sapiens cyclophilin-like protein PPIL3b...    91   5e-17   
pir|H82708|H82708 peptidylprolyl isomerase (EC 5.2.1.8) [similar...    90   7e-17   
gb:AF146799_1886138 Homo sapiens cyclophilin mRNA, complete cds.       89   1e-16   


>gb:AC084818_1733850 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668H12, complete sequence.
          Length = 250

 Score =  283 bits (723), Expect = 5e-75
 Identities = 140/188 (74%), Positives = 154/188 (81%)
 Frame = -2

Query: 741 RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC 562
           R ++   A  +  + QSK+T++VYFDISIGNPVGK  GR+VIGLYGD+VPQTAENFRALC
Sbjct: 63  RFVSSATADPKEVDLQSKITNKVYFDISIGNPVGKNVGRVVIGLYGDDVPQTAENFRALC 122

Query: 561 TGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSM 382
           TGE         FHRVIKDFMIQ            KSIYGRTFKDENFKLVH GPGVVSM
Sbjct: 123 TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSM 182

Query: 381 ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS 202
           ANAGPNTNGSQFFICTVKTPWLD RHVVFGQVIEGMD+VK+IESQETDRGDRPKK+VVIS
Sbjct: 183 ANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVIEGMDIVKMIESQETDRGDRPKKKVVIS 242

Query: 201 DCGELPIV 178
           +CGELP+V
Sbjct: 243 ECGELPVV 250



>gb:AY088365_1573385 Arabidopsis thaliana clone 620 mRNA, complete
           sequence.
          Length = 259

 Score =  281 bits (718), Expect = 2e-74
 Identities = 149/264 (56%), Positives = 175/264 (66%), Gaps = 1/264 (0%)
 Frame = -2

Query: 969 MALPFAALANAGSLSVP-RNLAPVKVSSSMCSYSKLPRSNSAEDTTXXXXXXXXXXXXXX 793
           MA     L+N  SLS P R L+P+  S+   +  +L   +S +  +              
Sbjct: 1   MATLSMTLSNPKSLSAPPRRLSPINTSALTSTSFRLRTKSSFDSISFSSSTPFSASSLLL 60

Query: 792 XXXLQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG 613
                K +     V+S   +        V EPQSK+T +VYFDIS+GNPVGK AGRIVIG
Sbjct: 61  HTSYTKRNHRCFSVQSNAEV--------VTEPQSKITHKVYFDISVGNPVGKLAGRIVIG 112

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTF 433
           LYGD+VPQT ENFRALCTGE         FHRVI+DFMIQ            KS+YGRTF
Sbjct: 113 LYGDDVPQTVENFRALCTGEKGFGYKGSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTF 172

Query: 432 KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE 253
           KDENFKL H GPGV+SMANAGPNTNGSQFFICT+KT WLD RHVVFGQVIEGM+VVKLIE
Sbjct: 173 KDENFKLSHVGPGVLSMANAGPNTNGSQFFICTIKTSWLDGRHVVFGQVIEGMEVVKLIE 232

Query: 252 SQETDRGDRPKKRVVISDCGELPI 181
            QETDRGDRP+K+VVI+DCG+LP+
Sbjct: 233 EQETDRGDRPRKKVVIADCGQLPM 256



>sp|Q9ASS6|TL20_ARATH Peptidyl-prolyl cis-trans isomerase TLP20,
           chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Thylakoid lumen PPIase of 20 kDa).>gb:AY059152_1564515
           Arabidopsis thaliana AT5g13120/T19L5_80 mRNA, complete
           cds.>gb:AY568517_1615455 Arabidopsis thaliana thylakoid
           lumen single domain cyclophilin type peptidyl-prolyl
           cis-trans isomerase (CYP20-2) mRNA, complete
           cds.>gb:AF367307_1791759 Arabidopsis thaliana
           AT5g13120/T19L5_80 mRNA, complete cds.
          Length = 259

 Score =  281 bits (718), Expect = 2e-74
 Identities = 149/264 (56%), Positives = 175/264 (66%), Gaps = 1/264 (0%)
 Frame = -2

Query: 969 MALPFAALANAGSLSVP-RNLAPVKVSSSMCSYSKLPRSNSAEDTTXXXXXXXXXXXXXX 793
           MA     L+N  SLS P R L+P+  S+   +  +L   +S +  +              
Sbjct: 1   MATLSMTLSNPKSLSAPPRRLSPINTSAFTSTSFRLRTKSSFDSISFSSSTPFSASSLLL 60

Query: 792 XXXLQKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG 613
                K +     V+S   +        V EPQSK+T +VYFDIS+GNPVGK AGRIVIG
Sbjct: 61  HTSYTKRNHRCFSVQSNAEV--------VTEPQSKITHKVYFDISVGNPVGKLAGRIVIG 112

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTF 433
           LYGD+VPQT ENFRALCTGE         FHRVI+DFMIQ            KS+YGRTF
Sbjct: 113 LYGDDVPQTVENFRALCTGEKGFGYKGSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTF 172

Query: 432 KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE 253
           KDENFKL H GPGV+SMANAGPNTNGSQFFICT+KT WLD RHVVFGQVIEGM+VVKLIE
Sbjct: 173 KDENFKLSHVGPGVLSMANAGPNTNGSQFFICTIKTSWLDGRHVVFGQVIEGMEVVKLIE 232

Query: 252 SQETDRGDRPKKRVVISDCGELPI 181
            QETDRGDRP+K+VVI+DCG+LP+
Sbjct: 233 EQETDRGDRPRKKVVIADCGQLPM 256



>gb:AY217751_1590148 Triticum aestivum cyclophilin-like protein
           (CYP20-1) mRNA, complete cds.
          Length = 245

 Score =  274 bits (701), Expect = 2e-72
 Identities = 141/215 (65%), Positives = 160/215 (74%), Gaps = 15/215 (6%)
 Frame = -2

Query: 777 KFSSCSVQVKSGRPLAPVRATAQV----------AEP-----QSKVTSQVYFDISIGNPV 643
           K  S ++ ++ GR  +P  + +Q           AEP     QSKVT++VYFDISIGNPV
Sbjct: 31  KVPSSALSLRGGRVASPALSVSQQSRARFVASASAEPYAPELQSKVTNKVYFDISIGNPV 90

Query: 642 GKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXX 463
           GK  GRIVIGLYGD+VPQT ENFRALC GE         FHRVIKDFMIQ          
Sbjct: 91  GKNVGRIVIGLYGDDVPQTVENFRALCAGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGT 150

Query: 462 XXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVI 283
             KSIYGRTFKDENF+LVH GPGV+SMANAGPNTNGSQFFICT+KTPWLD RHVVFGQV+
Sbjct: 151 GGKSIYGRTFKDENFQLVHTGPGVLSMANAGPNTNGSQFFICTMKTPWLDGRHVVFGQVL 210

Query: 282 EGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV 178
           EGMD+V+ IES ETDRGDRPKK+VVIS+CGELP+V
Sbjct: 211 EGMDIVRTIESSETDRGDRPKKKVVISECGELPVV 245



>gb:AY217753_1590150 Triticum aestivum cyclophilin-like protein
           (CYP20-2) mRNA, complete cds.
          Length = 245

 Score =  273 bits (699), Expect = 3e-72
 Identities = 137/188 (72%), Positives = 150/188 (79%)
 Frame = -2

Query: 741 RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC 562
           R +A   A     E QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALC
Sbjct: 58  RFVASASAEPYAPELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVENFRALC 117

Query: 561 TGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSM 382
           TGE         FHRVIKDFMIQ            KSIYGRTFKDENF+LVH GPGV+SM
Sbjct: 118 TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGPGVLSM 177

Query: 381 ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS 202
           ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V++IES ETDRGDRPKK+VVIS
Sbjct: 178 ANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVRMIESSETDRGDRPKKKVVIS 237

Query: 201 DCGELPIV 178
           + GELP+V
Sbjct: 238 ESGELPVV 245



>gb:ATT19L5_1554843 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T19L5 (ESSA project).
          Length = 259

 Score =  273 bits (699), Expect = 3e-72
 Identities = 132/176 (75%), Positives = 146/176 (82%)
 Frame = -2

Query: 708 VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXX 529
           V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGE        
Sbjct: 81  VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS 140

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVI+DFMIQ            KS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct: 141 TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ 200

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           FFICT+KT WLD RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct: 201 FFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM 256



>gb:AY086899_1571939 Arabidopsis thaliana clone 29220 mRNA, complete
           sequence.
          Length = 260

 Score =  222 bits (566), Expect = 9e-57
 Identities = 111/177 (62%), Positives = 130/177 (73%)
 Frame = -2

Query: 711 QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX 532
           +V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+G+ VP+T ENFRALCTGE       
Sbjct: 85  EVTEPQAKVTNKVYFDVEIG---GEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKG 141

Query: 531 XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS 352
             FHR+IKDFMIQ             SIYG  F+DENF L H GPG++SMANAGPNTNGS
Sbjct: 142 SSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGS 201

Query: 351 QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           QFFICTVKT WLDN+HVVFGQVIEGM +V+ +ESQET   D PKK   I  CGELP+
Sbjct: 202 QFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPL 258



>sp|P34791|CYP4_ARATH Peptidyl-prolyl cis-trans isomerase,
           chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin) (Cyclosporin A-binding
           protein).>pir|B53422|B53422 peptidylprolyl isomerase (EC
           5.2.1.8) ROC4 - Arabidopsis thaliana>gb:ATF21F14_1549612
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           F21F14.>gb:ATHROC4ARA_1553358 Arabidopsis thaliana
           nuclear-encoded chloroplast stromal cyclophilin (ROC4)
           mRNA, complete cds.>gb:ATU42724_1556989 Arabidopsis
           thaliana cyclophilin (ROC4) gene, nuclear gene encoding
           chloroplast protein, complete cds.>gb:AY059843_1564687
           Arabidopsis thaliana peptidylprolyl isomerase ROC4
           (At3g62030; F21F14.200) mRNA, complete
           cds.>gb:AY093284_1575238 Arabidopsis thaliana
           peptidylprolyl isomerase ROC4 (At3g62030) mRNA, complete
           cds.
          Length = 260

 Score =  222 bits (565), Expect = 1e-56
 Identities = 111/177 (62%), Positives = 130/177 (73%)
 Frame = -2

Query: 711 QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX 532
           +V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+G+ VP+T ENFRALCTGE       
Sbjct: 85  EVIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKG 141

Query: 531 XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS 352
             FHR+IKDFMIQ             SIYG  F+DENF L H GPG++SMANAGPNTNGS
Sbjct: 142 SSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGS 201

Query: 351 QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           QFFICTVKT WLDN+HVVFGQVIEGM +V+ +ESQET   D PKK   I  CGELP+
Sbjct: 202 QFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPL 258



>gb:AF325026_1786480 Arabidopsis thaliana AT3g62030
           (AT3g62030/F21F14_200) mRNA, complete cds.
          Length = 260

 Score =  220 bits (561), Expect = 3e-56
 Identities = 110/177 (62%), Positives = 130/177 (73%)
 Frame = -2

Query: 711 QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX 532
           +V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+G+ VP+T ENFRALCTGE       
Sbjct: 85  EVIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKG 141

Query: 531 XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS 352
             FHR+IKDFMIQ             SIYG  F+DENF L H GPG++SMANAGPNTNGS
Sbjct: 142 SSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGS 201

Query: 351 QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           +FFICTVKT WLDN+HVVFGQVIEGM +V+ +ESQET   D PKK   I  CGELP+
Sbjct: 202 KFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQETRAFDVPKKGCRIYACGELPL 258



>gb:AP003018_1824194 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBa0004B13.>gb:AP003020_1824247 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0498A12.>gb:AP003631_1831794 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0581F09.
          Length = 231

 Score =  217 bits (552), Expect = 4e-55
 Identities = 108/174 (62%), Positives = 128/174 (73%)
 Frame = -2

Query: 702 EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXF 523
           E Q+KV S+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTG+         F
Sbjct: 59  ELQAKVNSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGDKGYGYKGCSF 115

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HR+IKDFMIQ            +SIYG  F DENF L H GPGV+SMANAGP+TNGSQFF
Sbjct: 116 HRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGPGVLSMANAGPDTNGSQFF 175

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           ICTVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+   I +CGELP+
Sbjct: 176 ICTVKTPWLDNRHVVFGHVLEGMDVVKNLESQETSRSDIPKQPCRIVNCGELPV 229



>sp|Q41651|CYPB_VICFA Peptidyl-prolyl cis-trans isomerase,
           chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin) (Cyclosporin A-binding protein) (CYP
           B).>pir|T12096|T12096 peptidylprolyl isomerase (EC
           5.2.1.8) - fava bean>gb:VFACYCLOPH_1727115 Vicia faba
           cyclophilin mRNA, complete cds.
          Length = 248

 Score =  209 bits (531), Expect = 1e-52
 Identities = 109/181 (60%), Positives = 129/181 (71%), Gaps = 1/181 (0%)
 Frame = -2

Query: 720 ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXX 541
           A  +VAE Q+KVTS+++FDI IG   G++AGRIVIGL+GD VP+T ENF+ L TG     
Sbjct: 69  AQGEVAELQAKVTSKIFFDIEIG---GESAGRIVIGLFGDAVPKTVENFKTLSTGAKGYG 125

Query: 540 XXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT 361
                FHR+I +FMIQ             SIYG  F+DE+F L H GPGV+SMANAGPNT
Sbjct: 126 YQGSFFHRIIPNFMIQGGDFTEGNGTGGVSIYGSKFEDESFDLKHVGPGVLSMANAGPNT 185

Query: 360 NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDR-PKKRVVISDCGELP 184
           NGSQFFICTV TPWLDNRHVVFG VIEG+DVVK +ESQET + D  PKK   I+  GELP
Sbjct: 186 NGSQFFICTVPTPWLDNRHVVFGHVIEGLDVVKQLESQETSKLDNSPKKPCKIAKSGELP 245

Query: 183 I 181
           +
Sbjct: 246 L 246



>sp|Q01490|CYPB_ORPSP Peptidyl-prolyl cis-trans isomerase B
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           B).>gb:OSU17900_1698409 Orpinomyces sp. PC-2 cyclophilin
           B precursor (cypB) mRNA, complete cds.
          Length = 203

 Score =  204 bits (518), Expect = 3e-51
 Identities = 109/180 (60%), Positives = 124/180 (68%)
 Frame = -2

Query: 720 ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXX 541
           AT   A    KVT++VYFDI  G+   K  GRIV+GLYG+ VP+T ENFRAL TGE    
Sbjct: 17  ATLVSASTNPKVTNKVYFDIKQGD---KDLGRIVLGLYGEVVPKTVENFRALATGEKGYG 73

Query: 540 XXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT 361
                FHRVIKDFMIQ            KSIYG  F DENFKL H GPG++SMANAG +T
Sbjct: 74  YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFADENFKLRHTGPGILSMANAGRDT 133

Query: 360 NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           NGSQFFI TV T WLD RHVVFG+VIEGMDVV  IE+ +T  GDRP   V+I+DCGELP+
Sbjct: 134 NGSQFFITTVTTSWLDGRHVVFGKVIEGMDVVTAIETTKTLPGDRPATPVIIADCGELPV 193



>gb:AY040611_1289020 Brugia malayi R2 (SM7) mRNA, complete cds.
          Length = 203

 Score =  194 bits (493), Expect = 3e-48
 Identities = 104/179 (58%), Positives = 123/179 (68%)
 Frame = -2

Query: 717 TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXX 538
           T+  A+  + VT +VYFDI+IG+   K  GRI IGL+G++VP+T ENFRAL TGE     
Sbjct: 16  TSNNAKEMATVTKKVYFDIAIGD---KKIGRIEIGLFGNDVPKTVENFRALATGEKGFGY 72

Query: 537 XXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN 358
               FHRVIKDFMIQ            KSIYG  F+DENFKL H G G +SMANAG +TN
Sbjct: 73  KGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFEDENFKLKHYGAGWLSMANAGKDTN 132

Query: 357 GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           GSQFFI TV+T WLD RHVVFG+V+ GMDVV+ IE   T  GDRPK+ V I DCGEL +
Sbjct: 133 GSQFFITTVQTTWLDGRHVVFGKVLSGMDVVRKIEQTSTHPGDRPKQSVEIVDCGELSL 191



>gb:AE017347_1757736 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 231

 Score =  193 bits (491), Expect = 4e-48
 Identities = 103/175 (58%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX------XX 526
           +T++VYFDI  G   GK  GRIV+GLYG  VP+TAENFRAL TG+               
Sbjct: 43  ITNKVYFDIEHG---GKPLGRIVMGLYGKTVPKTAENFRALATGKNSDGEDLGYGYEGSS 99

Query: 525 FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF 346
           FHR+IK+FMIQ            KSIYG  F DENFKL H GPGV+SMANAG +TNGSQF
Sbjct: 100 FHRIIKNFMIQGGDFTKGDGTGGKSIYGSKFPDENFKLKHTGPGVLSMANAGRDTNGSQF 159

Query: 345 FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           FICTVKT WLDNRHVVFG V+EGMDVV  +E+ +T RGD+P + + I+  GELPI
Sbjct: 160 FICTVKTAWLDNRHVVFGHVLEGMDVVYAMENVKTSRGDKPVEPITIAASGELPI 214



>sp|P24367|PPIB_CHICK Peptidyl-prolyl cis-trans isomerase B
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           B) (S-cyclophilin) (SCYLP).>pir|A40516|A40516
           peptidylprolyl isomerase (EC 5.2.1.8) (S-cyclophilin)
           precursor - chicken>gb:CHKSCYCLO_2569534 Chicken
           S-cyclophilin mRNA, complete cds.
          Length = 207

 Score =  192 bits (488), Expect = 1e-47
 Identities = 101/185 (54%), Positives = 124/185 (67%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT++V+FD+ +G    + AGR+VIGL+G  VP+T ENF AL TG
Sbjct: 17  LLPAASRADERKKGPKVTAKVFFDLRVGE---EDAGRVVIGLFGKTVPKTVENFVALATG 73

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 74  EKGFGFKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMAN 133

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +E+ +TD  D+P K V I+DC
Sbjct: 134 AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVTIADC 193

Query: 195 GELPI 181
           G + +
Sbjct: 194 GTIEV 198



>gb:BT020966_1436324 Bos taurus peptidylprolyl isomerase B
           (cyclophilin B) (PPIB), mRNA, complete cds.
          Length = 216

 Score =  191 bits (486), Expect = 2e-47
 Identities = 102/185 (55%), Positives = 124/185 (67%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct: 26  LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 83  EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V I+DC
Sbjct: 143 AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVESTKTDGRDKPLKDVTIADC 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIEV 207



>gb:BC084369_2563750 Xenopus laevis hypothetical LOC495270, mRNA
           (cDNA clone MGC:85280 IMAGE:6874278), complete cds.
          Length = 216

 Score =  190 bits (483), Expect = 4e-47
 Identities = 102/185 (55%), Positives = 124/185 (67%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYF+I IG+   +  GRIVIGL+G  VP+T ENF  L TG
Sbjct: 26  LFPGSSVADEKKKGPKVTEKVYFNIKIGD---EDVGRIVIGLFGKTVPKTVENFVTLATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GP  +SMAN
Sbjct: 83  EKGFGYQGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGEKFSDENFKLKHYGPYWLSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKTPWLD +HVVFG+++EGMDVV+ IES +TD  D+P K VVI++C
Sbjct: 143 AGKDTNGSQFFITTVKTPWLDGKHVVFGKILEGMDVVRKIESTKTDGRDKPIKDVVIAEC 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIEV 207



>gb:HUMCYCLO_2030406 Human cyclophilin mRNA, 3' end.
          Length = 207

 Score =  190 bits (482), Expect = 5e-47
 Identities = 99/185 (53%), Positives = 124/185 (67%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   +  GR++ GL+G  VP+T +NF AL TG
Sbjct: 17  LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDVGRVIFGLFGKTVPKTVDNFVALATG 73

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 74  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 133

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGM+VV+ +ES +TD  D+P K V+I+DC
Sbjct: 134 AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC 193

Query: 195 GELPI 181
           G++ +
Sbjct: 194 GKIEV 198



>gb:CR456829_1993036 Homo sapiens full open reading frame cDNA clone
           RZPDo834F0415D for gene PPIB, peptidylprolyl isomerase B
           (cyclophilin B); complete cds, incl. stopcodon.
          Length = 216

 Score =  190 bits (482), Expect = 5e-47
 Identities = 99/185 (53%), Positives = 124/185 (67%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   +  GR++ GL+G  VP+T +NF AL TG
Sbjct: 26  LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDVGRVIFGLFGKTVPKTVDNFVALATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 83  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGM+VV+ +ES +TD  D+P K V+I+DC
Sbjct: 143 AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIEV 207



>gb:BC001125_1967315 Homo sapiens peptidylprolyl isomerase B
           (cyclophilin B), mRNA (cDNA clone MGC:2224
           IMAGE:2966791), complete cds.>gb:BC008848_1971631 Homo
           sapiens peptidylprolyl isomerase B (cyclophilin B), mRNA
           (cDNA clone MGC:14109 IMAGE:3502055), complete
           cds.>gb:BC020800_1977215 Homo sapiens peptidylprolyl
           isomerase B (cyclophilin B), mRNA (cDNA clone MGC:23783
           IMAGE:4248828), complete cds.>gb:BC032138_1980346 Homo
           sapiens peptidylprolyl isomerase B (cyclophilin B), mRNA
           (cDNA clone MGC:29698 IMAGE:4896656), complete
           cds.>gb:HUMSCYLP_2036531 Human secreted cyclophilin-like
           protein (SCYLP) mRNA, complete cds.
          Length = 216

 Score =  190 bits (482), Expect = 5e-47
 Identities = 99/185 (53%), Positives = 124/185 (67%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   +  GR++ GL+G  VP+T +NF AL TG
Sbjct: 26  LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDVGRVIFGLFGKTVPKTVDNFVALATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 83  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGM+VV+ +ES +TD  D+P K V+I+DC
Sbjct: 143 AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIEV 207



>sp|P23284|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           B) (S-cyclophilin) (SCYLP) (CYP-S1).>pir|A39118|CSHUB
           peptidylprolyl isomerase (EC 5.2.1.8) B precursor
           [validated] - human>gb:HUMCYPBA_2030458 Human
           cyclophilin B (hCyPB) mRNA, complete cds.
          Length = 208

 Score =  190 bits (482), Expect = 5e-47
 Identities = 99/185 (53%), Positives = 124/185 (67%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   +  GR++ GL+G  VP+T +NF AL TG
Sbjct: 18  LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDVGRVIFGLFGKTVPKTVDNFVALATG 74

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 75  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 134

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGM+VV+ +ES +TD  D+P K V+I+DC
Sbjct: 135 AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC 194

Query: 195 GELPI 181
           G++ +
Sbjct: 195 GKIEV 199



>gb:BC059560_2552537 Danio rerio zgc:73214, mRNA (cDNA clone
           MGC:73214 IMAGE:4790964), complete
           cds.>gb:BC071458_2556198 Danio rerio zgc:73214, mRNA
           (cDNA clone MGC:86796 IMAGE:6900727), complete cds.
          Length = 216

 Score =  189 bits (479), Expect = 1e-46
 Identities = 102/185 (55%), Positives = 123/185 (66%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P    A   +   KVT++VYFDI IG+   + AGRIVIGL+G  VP+T ENF  L TG
Sbjct: 26  LFPSETEADEKKKGPKVTAKVYFDIKIGD---EDAGRIVIGLFGKTVPKTTENFLQLATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG +SMAN
Sbjct: 83  EKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWLSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TV+TPWLD +HVVFG+++EGMDVV+ IE+ +TD  D+P K V I D 
Sbjct: 143 AGKDTNGSQFFITTVQTPWLDGKHVVFGKILEGMDVVRKIEATKTDGRDKPLKDVSIHDS 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIDV 207



>sp|P80311|PPIB_BOVIN Peptidyl-prolyl cis-trans isomerase B
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           B) (S-cyclophilin) (SCYLP).>gb:BOVCYPB3_1435378 Bovine
           mRNA for cyclophilin B, complete cds.
          Length = 208

 Score =  189 bits (479), Expect = 1e-46
 Identities = 101/185 (54%), Positives = 123/185 (66%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct: 18  LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG 74

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 75  EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 134

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HV FG+V+EGMDVV+ +ES +TD  D+P K V I+DC
Sbjct: 135 AGKDTNGSQFFITTVKTAWLDGKHVGFGKVLEGMDVVRKVESTKTDGRDKPLKDVTIADC 194

Query: 195 GELPI 181
           G++ +
Sbjct: 195 GKIEV 199



>pir|A56861|A56861 peptidylprolyl isomerase (EC 5.2.1.8) CyP-S1
           precursor - mouse>gb:AK002357_1151144 Mus musculus adult
           male kidney cDNA, RIKEN full-length enriched library,
           clone:0610008P05 product:peptidylprolyl isomerase B,
           full insert sequence.>gb:BC013061_2091694 Mus musculus
           peptidylprolyl isomerase B, mRNA (cDNA clone MGC:6241
           IMAGE:3483267), complete cds.
          Length = 216

 Score =  188 bits (477), Expect = 2e-46
 Identities = 100/185 (54%), Positives = 123/185 (66%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   ++ GR+V GL+G  VP+T +NF AL TG
Sbjct: 26  LLPGPSVANDKKKGPKVTVKVYFDLQIGD---ESVGRVVFGLFGKTVPKTVDNFVALATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 83  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V+I D 
Sbjct: 143 AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIVDS 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIEV 207



>sp|P24369|PPIB_MOUSE Peptidyl-prolyl cis-trans isomerase B
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           B) (S-cyclophilin) (SCYLP) (CYP-S1).>gb:MMMCYPS1_2116429
           Mouse mCyP-S1 mRNA for cyclophilin
           CyP-S1.>gb:MUSCYCLOA_2125620 Mouse cyclophilin mRNA,
           complete cds.
          Length = 208

 Score =  188 bits (477), Expect = 2e-46
 Identities = 100/185 (54%), Positives = 123/185 (66%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   ++ GR+V GL+G  VP+T +NF AL TG
Sbjct: 18  LLPGPSVANDKKKGPKVTVKVYFDLQIGD---ESVGRVVFGLFGKTVPKTVDNFVALATG 74

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 75  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 134

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V+I D 
Sbjct: 135 AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIVDS 194

Query: 195 GELPI 181
           G++ +
Sbjct: 195 GKIEV 199



>gb:BC061971_2104749 Rattus norvegicus peptidylprolyl isomerase B,
           mRNA (cDNA clone MGC:72443 IMAGE:5623342), complete cds.
          Length = 216

 Score =  187 bits (476), Expect = 2e-46
 Identities = 99/185 (53%), Positives = 121/185 (65%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD  IG+   +  GR+  GL+G  VP+T +NF AL TG
Sbjct: 26  LLPGPSVANDKKKGPKVTVKVYFDFQIGD---EPVGRVTFGLFGKTVPKTVDNFVALATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 83  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +E+ +TD  D+P K V+I DC
Sbjct: 143 AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDC 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIEV 207



>pir|T02489|T02489 peptidylprolyl isomerase (EC 5.2.1.8) F23F1.12 -
           Arabidopsis thaliana>gb:AC004680_1532014 Arabidopsis
           thaliana chromosome 2 clone F23F1 map m283, complete
           sequence.>gb:AY054593_1563247 Arabidopsis thaliana
           cyclophilin (At2g29960; F23F1.12) mRNA, complete
           cds.>gb:BT000068_1634346 Arabidopsis thaliana
           cyclophilin (At2g29960) mRNA, complete cds.
          Length = 201

 Score =  187 bits (476), Expect = 2e-46
 Identities = 102/187 (54%), Positives = 124/187 (66%), Gaps = 7/187 (3%)
 Frame = -2

Query: 720 ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXX 541
           A+ Q  E   +VT +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGE    
Sbjct: 19  ASIQAKEDLKEVTHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG 75

Query: 540 XXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSM 382
                       FHR+I  FMIQ            +SIYG+ F DENFKL H GPGV+SM
Sbjct: 76  KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSM 135

Query: 381 ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS 202
           AN+G +TNGSQFFI TV T WLD RHVVFG+V++GMDVV  IE++    G  PK +VVI+
Sbjct: 136 ANSGEDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSG-TPKSKVVIA 194

Query: 201 DCGELPI 181
           D GELP+
Sbjct: 195 DSGELPL 201



>sp|P24368|PPIB_RAT Peptidyl-prolyl cis-trans isomerase B precursor
           (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin B)
           (S-cyclophilin) (SCYLP) (CYP-S1).>gb:AF071225_2053328
           Rattus norvegicus cyclophilin B mRNA, complete cds.
          Length = 208

 Score =  187 bits (476), Expect = 2e-46
 Identities = 99/185 (53%), Positives = 121/185 (65%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD  IG+   +  GR+  GL+G  VP+T +NF AL TG
Sbjct: 18  LLPGPSVANDKKKGPKVTVKVYFDFQIGD---EPVGRVTFGLFGKTVPKTVDNFVALATG 74

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIKDFMIQ            KSIYG  F DENFKL H GPG VSMAN
Sbjct: 75  EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN 134

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +E+ +TD  D+P K V+I DC
Sbjct: 135 AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDC 194

Query: 195 GELPI 181
           G++ +
Sbjct: 195 GKIEV 199



>pir|T50837|T50837 peptidylprolyl isomerase (EC 5.2.1.8) CYP5
           [similarity] - Arabidopsis thaliana>gb:AF020433_1761638
           Arabidopsis thaliana cyclophilin (CYP5) gene, complete
           cds.
          Length = 201

 Score =  187 bits (475), Expect = 3e-46
 Identities = 101/187 (54%), Positives = 124/187 (66%), Gaps = 7/187 (3%)
 Frame = -2

Query: 720 ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXX 541
           A+ Q  E   ++T +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGE    
Sbjct: 19  ASIQAKEDLKEITHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG 75

Query: 540 XXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSM 382
                       FHR+I  FMIQ            +SIYG+ F DENFKL H GPGV+SM
Sbjct: 76  KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSM 135

Query: 381 ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS 202
           AN+G +TNGSQFFI TV T WLD RHVVFG+V++GMDVV  IE++    G  PK +VVI+
Sbjct: 136 ANSGEDTNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSG-TPKSKVVIA 194

Query: 201 DCGELPI 181
           D GELP+
Sbjct: 195 DSGELPL 201



>gb:BC054168_2550823 Xenopus laevis peptidylprolyl isomerase B, mRNA
           (cDNA clone MGC:64287 IMAGE:6874180), complete cds.
          Length = 216

 Score =  187 bits (474), Expect = 4e-46
 Identities = 100/185 (54%), Positives = 123/185 (66%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L P  + A   +   KVT +VYFD+ IG+   +  GRIVIGL+G  VP+T ENF  L TG
Sbjct: 26  LFPGSSVADDKKKGPKVTDKVYFDLKIGD---EEVGRIVIGLFGKTVPKTVENFVTLATG 82

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E         FHRVIK+FMIQ            KSIYG  F DENFKL H GP  +SMAN
Sbjct: 83  EKGYGYKGSKFHRVIKEFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPFWLSMAN 142

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI TVKTPWLD +HVVFG+V+EG ++V+ IES +TD  D+P K VVI+DC
Sbjct: 143 AGKDTNGSQFFITTVKTPWLDGKHVVFGKVLEGTEIVRKIESTKTDGRDKPLKDVVIADC 202

Query: 195 GELPI 181
           G++ +
Sbjct: 203 GKIEV 207



>gb:AF017993_1232987 Entamoeba histolytica cyclophilin (CYP1) mRNA,
           complete cds.>gb:AF498649_1277185 Entamoeba histolytica
           small heat shock protein (HSP16) and cyclophilin (CYP1)
           genes, complete cds; and serine/threonine protein
           kinase-like protein (STPK1) gene, partial cds.
          Length = 167

 Score =  186 bits (473), Expect = 5e-46
 Identities = 99/166 (59%), Positives = 116/166 (69%), Gaps = 2/166 (1%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX--FHRVIKD 505
           +V+FDI+IG   G+ AGRIV+ L+ D VP+TAENFR LCTGE           FHRVIKD
Sbjct: 5   KVFFDITIG---GEKAGRIVMELFNDIVPKTAENFRCLCTGEKGNGLTYKGCGFHRVIKD 61

Query: 504 FMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKT 325
           FMIQ            KSIYG  F DE F + H  PG++SMANAGPNTNGSQFFI TV  
Sbjct: 62  FMIQGGDFTRHNGTGGKSIYGTKFADEAFTVKHTKPGMLSMANAGPNTNGSQFFITTVPC 121

Query: 324 PWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           PWLD +HVVFGQV+EG DVVK+IE+  T   D+PKK VVI+DCG+L
Sbjct: 122 PWLDGKHVVFGQVVEGYDVVKMIENNPTGAQDKPKKAVVIADCGQL 167



>pir|S71547|S71547 peptidylprolyl isomerase (EC 5.2.1.8) B, 20.3K -
           rat
          Length = 183

 Score =  186 bits (473), Expect = 5e-46
 Identities = 96/170 (56%), Positives = 116/170 (68%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVI 511
           KVT +VYFD  IG+   +  GR+  GL+G  VP+T +NF AL TGE         FHRVI
Sbjct: 8   KVTVKVYFDFQIGD---EPVGRVTFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVI 64

Query: 510 KDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV 331
           KDFMIQ            KSIYG  F DENFKL H GPG VSMANAG +TNGSQFFI TV
Sbjct: 65  KDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTV 124

Query: 330 KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           KT WLD +HVVFG+V+EGMDVV+ +E+ +TD  D+P K V+I DCG++ +
Sbjct: 125 KTSWLDGKHVVFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIEV 174



>gb:AY085875_1570939 Arabidopsis thaliana clone 19211 mRNA, complete
           sequence.
          Length = 201

 Score =  186 bits (471), Expect = 9e-46
 Identities = 101/187 (54%), Positives = 123/187 (65%), Gaps = 7/187 (3%)
 Frame = -2

Query: 720 ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXX 541
           A+ Q  E   +VT +VYFD+ I    GK+AGR+VIGL+G  VP+TAENFRALCTGE    
Sbjct: 19  ASIQAKEDLKEVTHKVYFDVEID---GKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVG 75

Query: 540 XXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSM 382
                       FHR+I  FMIQ            +SIYG+ F DENFKL H GPGV+SM
Sbjct: 76  KSGKPLHYKGSKFHRIIPSFMIQGGDFTHGNGMGGESIYGQKFADENFKLKHTGPGVLSM 135

Query: 381 ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS 202
           AN+G + NGSQFFI TV T WLD RHVVFG+V++GMDVV  IE++    G  PK +VVI+
Sbjct: 136 ANSGEDXNGSQFFITTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSG-TPKSKVVIA 194

Query: 201 DCGELPI 181
           D GELP+
Sbjct: 195 DSGELPL 201



>sp|P52011|CYP3_CAEEL Peptidyl-prolyl cis-trans isomerase 3 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-3).>pir|T27373|T27373 peptidylprolyl
           isomerase (EC 5.2.1.8) Y75B12B.5 [similarity] -
           Caenorhabditis elegans>gb:CEU31077_1368487
           Caenorhabditis elegans cyclophilin isoform 3 (cyp-3)
           mRNA, complete cds.>gb:CEY75B12B_1371079 Caenorhabditis
           elegans YAC Y75B12B, complete sequence.
          Length = 173

 Score =  185 bits (470), Expect = 1e-45
 Identities = 98/172 (56%), Positives = 119/172 (69%), Gaps = 7/172 (4%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXF 523
           S+V+FDI+IG   GKA+GRIV+ LY D VP+TA NFRALCTGE                F
Sbjct: 4   SKVFFDITIG---GKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKF 60

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HR+I +FMIQ            +SIYG  F DENFK  H GPGV+SMANAGPNTNGSQFF
Sbjct: 61  HRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFF 120

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           +CTVKT WLD +HVVFG+V+EG+DVVK +ES  +  G +P K  +I+DCG+L
Sbjct: 121 LCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSG-KPVKDCMIADCGQL 171



>gb:CR382131_1664413 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 228

 Score =  184 bits (467), Expect = 3e-45
 Identities = 94/175 (53%), Positives = 117/175 (66%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           AEP +++T +VYFDI  G    ++ G+IV+GLYGD VP+T ENFRALCTGE         
Sbjct: 24  AEPDAEITHKVYFDIKQGE---ESLGKIVMGLYGDVVPKTVENFRALCTGETGKGYKGSK 80

Query: 525 FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF 346
           FHRVIK+FMIQ            +SIYGR F DENF+L H  P  +SMANAG +TNGSQF
Sbjct: 81  FHRVIKNFMIQGGDFTRGDGTGGESIYGRKFPDENFQLKHTKPYKLSMANAGRDTNGSQF 140

Query: 345 FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           FI TV T WLD +HVVFG+V+EG D+V  IE+  T     PK  + I+D GE+P+
Sbjct: 141 FITTVVTSWLDGKHVVFGEVLEGQDIVDAIENAPTGARSNPKVDITIADAGEIPV 195



>gb:AF107254_1768413 Emericella nidulans cyclophilin B (cypB) gene,
           complete cds.
          Length = 214

 Score =  181 bits (459), Expect = 2e-44
 Identities = 99/179 (55%), Positives = 118/179 (65%), Gaps = 1/179 (0%)
 Frame = -2

Query: 720 ATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXX 544
           A    +EP+  K+T++VYFDI  G+   ++ GRIV+GLYG  VP+TAENFRAL TGE   
Sbjct: 20  ALVNASEPRGPKITNKVYFDIQHGD---ESLGRIVLGLYGKTVPETAENFRALATGEKGF 76

Query: 543 XXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPN 364
                 FHRVIKDFMIQ            KSIYG  FKDENFKL H   G++SMANAG +
Sbjct: 77  GYEGSNFHRVIKDFMIQGGDFTRGDGTGGKSIYGAKFKDENFKLRHTKTGLLSMANAGKD 136

Query: 363 TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           TNGSQFFI T  TPWLD +HVVFG+V+EG D+V  I++    R DRP K V I   GEL
Sbjct: 137 TNGSQFFITTAVTPWLDGKHVVFGEVLEGYDIVDKIQNVPKGRNDRPLKDVKIVKSGEL 195



>gb:AX024013_1456798 Sequence 2 from Patent
           WO0018934.>gb:AY005867_1557855 Aspergillus niger
           cyclophilin-like peptidyl prolyl cis-trans isomerase
           (cypB) gene, complete cds.
          Length = 212

 Score =  181 bits (458), Expect = 3e-44
 Identities = 99/177 (55%), Positives = 118/177 (66%), Gaps = 1/177 (0%)
 Frame = -2

Query: 714 AQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXX 538
           A+ A+P+  K+TS+V+FDI  G+   K  GR+V+GLYG  VP+TAENFRAL TGE     
Sbjct: 23  AEDAQPRGPKITSKVFFDIEHGD---KPLGRVVLGLYGKTVPKTAENFRALATGEKGFGY 79

Query: 537 XXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN 358
               FHRVIKDFMIQ            KSIYG  F DENFKL H   G++SMANAG +TN
Sbjct: 80  EGSTFHRVIKDFMIQGGDFTRGDGTGGKSIYGEKFADENFKLRHTRKGLLSMANAGKDTN 139

Query: 357 GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           GSQFFI TV TPWLD RHVVFG+V+EG ++V  IE+    R DRP + V I   GEL
Sbjct: 140 GSQFFITTVPTPWLDGRHVVFGEVLEGYEIVAQIENVPKGRSDRPVETVKIVKSGEL 196



>gb:AY543004_1334460 Bigelowiella natans cyclophilin mRNA, complete
           cds.
          Length = 201

 Score =  181 bits (458), Expect = 3e-44
 Identities = 102/190 (53%), Positives = 119/190 (62%), Gaps = 7/190 (3%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L  +      A+   KVTS+V+FD+ IG   G+ AGRIV+GLYG  VP+TAENFRALCTG
Sbjct: 10  LLAINQPGVAAKKLPKVTSKVFFDVEIG---GEKAGRIVMGLYGKTVPKTAENFRALCTG 66

Query: 555 EXXXXXXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGP 397
           E                FHR+I  FMIQ            +SIYG  F+DENFKL H  P
Sbjct: 67  EKGTGKSGKPLHYKGSSFHRIIPQFMIQGGDFTQGNGRGGESIYGEKFEDENFKLRHTSP 126

Query: 396 GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK 217
             +SMANAGPNTNGSQFFI TVKT WLD RHVVFG+V+EG DVV  IE+  +  G  P K
Sbjct: 127 YQLSMANAGPNTNGSQFFITTVKTSWLDGRHVVFGRVLEGTDVVDKIEAAGSPSG-TPSK 185

Query: 216 RVVISDCGEL 187
           +V I D GEL
Sbjct: 186 KVTIVDSGEL 195



>sp|P24525|CYPH_BRANA Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).
          Length = 171

 Score =  181 bits (458), Expect = 3e-44
 Identities = 98/174 (56%), Positives = 114/174 (65%), Gaps = 7/174 (4%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------X 529
           V  +VYFD+++G+   KAAGRIV+ LY D VP+TAENFRALCTGE               
Sbjct: 2   VNPKVYFDMTVGD---KAAGRIVMELYADTVPETAENFRALCTGERGIGKSGKPLHYKGS 58

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVI  FM Q            +SIYG  FKDENF   H GPG++SM NAG NTNGSQ
Sbjct: 59  AFHRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQ 118

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFICT KT WLD +HVVFGQV+EGMDVV+ IE   +D G R  K+VV  DCG+L
Sbjct: 119 FFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSG-RTSKKVVTCDCGQL 171



>gb:AF053068_1236807 Dictyostelium discoideum cyclophilin B (CypB)
           gene, complete cds.>gb:AF123597_1242910 Dictyostelium
           discoideum cyclophilin B (cypB) mRNA, complete cds.
          Length = 197

 Score =  180 bits (457), Expect = 4e-44
 Identities = 101/190 (53%), Positives = 120/190 (63%), Gaps = 7/190 (3%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           L  + A    A    K+T++V+FDI I N   K AGRIV GLYG  VP+T ENFRALCTG
Sbjct: 12  LVTLWAMPSEAGKDPKITNKVFFDIEIDN---KPAGRIVFGLYGKTVPKTVENFRALCTG 68

Query: 555 EXXXXXXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGP 397
           E                FHR+I +FMIQ            +SIYG+ F DENFK+ H+ P
Sbjct: 69  EKGLGTSGKPLHYKDSKFHRIIPNFMIQGGDFTRGDGTGGESIYGKKFNDENFKIKHSKP 128

Query: 396 GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK 217
           G++SMANAGPNTNGSQFFI TV T WLD RH VFG+VIEGMD+VKL+ES  +  G  P K
Sbjct: 129 GLLSMANAGPNTNGSQFFITTVVTSWLDGRHTVFGEVIEGMDIVKLLESIGSQSG-TPSK 187

Query: 216 RVVISDCGEL 187
              IS+ GEL
Sbjct: 188 IAKISNSGEL 197



>sp|P30405|PPIF_HUMAN Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin F).>pir|A41581|A41581 peptidylprolyl
           isomerase (EC 5.2.1.8) 3 precursor -
           human>gb:AX134756_1461838 Sequence 39 from Patent
           WO0132876.>gb:AL133481_1918610 Human DNA sequence from
           clone RP11-342M3 on chromosome 10 Contains the 3' end of
           the PPIF gene for peptidylprolyl isomerase F
           (cyclophilin F), gene FLJ90798, the EIF5AP1 pseudogene
           for eukaryotic translation initiation factor 5A
           pseudogene 1, a novel gene, a novel pseudogene and a CpG
           island, complete sequence.>gb:AL391665_1926991 Human DNA
           sequence from clone RP11-519K18 on chromosome 10
           Contains the 3' end of the RAI17 gene for retinoic acid
           induced 17, the 5' end of the PPIF gene for
           peptidylprolyl isomerase F (cyclophilin F) and two CpG
           islands, complete sequence.>gb:BC005020_1969529 Homo
           sapiens peptidylprolyl isomerase F (cyclophilin F), mRNA
           (cDNA clone MGC:11022 IMAGE:3659599), complete
           cds.>gb:HUMCYP_2030428 H.sapiens cyclophilin isoform
           (hCyP3) mRNA, complete cds.
          Length = 207

 Score =  180 bits (457), Expect = 4e-44
 Identities = 96/163 (58%), Positives = 108/163 (66%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           VY D+      GK  GR+V+ L  D VP+TAENFRALCTGE         FHRVI  FM 
Sbjct: 48  VYLDVDAN---GKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMC 104

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            KSIYG  F DENF L H GPGV+SMANAGPNTNGSQFFICT+KT WL
Sbjct: 105 QAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWL 164

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           D +HVVFG V EGMDVVK IES  +  G R  K++VI+DCG+L
Sbjct: 165 DGKHVVFGHVKEGMDVVKKIESFGSKSG-RTSKKIVITDCGQL 206



>gb:BNACYP_1633431 Brassica napus cyclophilin (CyP) mRNA, 3' end.
          Length = 168

 Score =  179 bits (455), Expect = 6e-44
 Identities = 97/171 (56%), Positives = 113/171 (66%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +VYFD+++G+   KAAGRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 2   KVYFDMTVGD---KAAGRIVMELYADTVPETAENFRALCTGERGIGKSGKPLHYKGSAFH 58

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  FKDENF   H GPG++SM NAG NTNGSQFFI
Sbjct: 59  RVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQFFI 118

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EGMDVV+ IE   +D G R  K+VV  DCG+L
Sbjct: 119 CTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSG-RTSKKVVTCDCGQL 168



>gb:AY362759_1322644 Chlamys farreri cyclophilin A mRNA, complete
           cds.
          Length = 164

 Score =  179 bits (455), Expect = 6e-44
 Identities = 91/164 (55%), Positives = 112/164 (68%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++     GK  GRI++ L GD VP+TAENFRALCTGE         FHRVI  FM
Sbjct: 5   RVFFDVTAN---GKPVGRIMMELRGDVVPKTAENFRALCTGEKGFGYKGSPFHRVIPSFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H GPGV+SMANAGPNTNGSQFF+CT +T W
Sbjct: 62  CQGGDFTRQNGTGGKSIYGEKFADENFTLKHTGPGVLSMANAGPNTNGSQFFLCTARTEW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG V+EGMDVVK IES  +  G +  ++++++DCG+L
Sbjct: 122 LDGKHVVFGSVVEGMDVVKKIESYGSQSG-KTSEKIIVADCGQL 164



>sp|P52010|CYP2_CAEEL Peptidyl-prolyl cis-trans isomerase 2 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-2).>pir|T27882|T27882 peptidylprolyl
           isomerase (EC 5.2.1.8) ZK520.5 [similarity] -
           Caenorhabditis elegans>gb:CEZK520_1371640 Caenorhabditis
           elegans cosmid ZK520, complete sequence.
          Length = 172

 Score =  179 bits (455), Expect = 6e-44
 Identities = 97/171 (56%), Positives = 115/171 (67%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI+IG   GK  GRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 5   KVFFDITIG---GKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I +FMIQ            +SI+G  F DENFK  H GPGV+SMAN G NTNGSQFF+
Sbjct: 62  RIIPEFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFL 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFG+VIEGMDVVK IES+ ++ G  P    VI+DCGE+
Sbjct: 122 CTVKTTWLDGKHVVFGKVIEGMDVVKAIESKGSEDG-APSAPCVIADCGEM 171



>gb:AY290733_1595602 Triticum aestivum cyclophilin mRNA, partial
           sequence.>gb:AF542973_1810235 Triticum aestivum
           cyclophilin mRNA, partial cds.
          Length = 233

 Score =  179 bits (454), Expect = 8e-44
 Identities = 103/196 (52%), Positives = 125/196 (63%), Gaps = 11/196 (5%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQ----SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA 568
           LA V AT  +A+ +    S+VT +VYFDI I    GK AGR+V+GL+G  VP+TAENFRA
Sbjct: 41  LALVAATLVLAQGKKSNLSEVTHKVYFDIEID---GKPAGRVVMGLFGKAVPKTAENFRA 97

Query: 567 LCTGEXXXXXXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLV 409
           LCTGE                FHR+I  FMIQ            +SIYG  F DENFKL 
Sbjct: 98  LCTGEKGMGNSGKPLHYKGSSFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFGDENFKLK 157

Query: 408 HAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGD 229
           H GPG +SMANAG +TNGSQFFI TV T WLD +HVVFG+V+ GMDVV  +E+     G 
Sbjct: 158 HTGPGYLSMANAGRDTNGSQFFITTVTTSWLDGKHVVFGKVLSGMDVVYKVEAXGKQNG- 216

Query: 228 RPKKRVVISDCGELPI 181
            PK +VVI+D GE+P+
Sbjct: 217 TPKSKVVIADSGEVPL 232



>pir|B39252|CSRP peptidylprolyl isomerase (EC 5.2.1.8) - rape
          Length = 171

 Score =  179 bits (454), Expect = 8e-44
 Identities = 97/174 (55%), Positives = 114/174 (65%), Gaps = 7/174 (4%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------X 529
           V  +V+FD+++G+   KAAGRIV+ LY D VP+TAENFRALCTGE               
Sbjct: 2   VNPKVFFDMTVGD---KAAGRIVMELYADTVPETAENFRALCTGERGIGKSGKPLHYKGS 58

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVI  FM Q            +SIYG  FKDENF   H GPG++SM NAG NTNGSQ
Sbjct: 59  AFHRVIPKFMCQGGDFTAGNGTGGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQ 118

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFICT KT WLD +HVVFGQV+EGMDVV+ IE   +D G R  K+VV  DCG+L
Sbjct: 119 FFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSG-RTSKKVVTCDCGQL 171



>sp|Q39613|CYPH_CATRO Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|T10056|T10056 peptidylprolyl
           isomerase (EC 5.2.1.8) (cyclophilin 1), cytosolic -
           Madagascar periwinkle>gb:CRPCKR1_1673512 C.roseus PCKR1
           mRNA for cyclophilin.
          Length = 172

 Score =  179 bits (454), Expect = 8e-44
 Identities = 95/171 (55%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+S+G   G+ AGRIV+ L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   RVFFDMSVG---GQPAGRIVMELFADTTPRTAENFRALCTGEKGTGRSGKPLHYKDSSFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGPNTNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EGMDVVK IE   +  G R  K+VV+ DCG+L
Sbjct: 122 CTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSG-RTAKKVVVEDCGQL 171



>sp|P34790|CYP1_ARATH Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|T06073|T06073 peptidylprolyl
           isomerase (EC 5.2.1.8) ROC1 - Arabidopsis
           thaliana>gb:ATCHRIV89_1547826 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           89.>gb:ATHROC1ARA_1553357 Arabidopsis thaliana cytosolic
           cyclophilin (ROC1) mRNA, complete
           cds.>gb:ATT9A14_1556551 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T9A14 (ESSA
           project).>gb:AY088103_1573127 Arabidopsis thaliana clone
           41363 mRNA, complete sequence.>gb:AY093227_1575181
           Arabidopsis thaliana peptidylprolyl isomerase ROC1
           (At4g38740) mRNA, complete cds.>gb:BT003397_1636820
           Arabidopsis thaliana peptidylprolyl isomerase ROC1
           (At4g38740) mRNA, complete cds.
          Length = 172

 Score =  179 bits (454), Expect = 8e-44
 Identities = 95/171 (55%), Positives = 116/171 (67%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +VYFD++I    G+ AGRIV+ LY D+ P+TAENFRALCTGE                FH
Sbjct: 5   KVYFDMTID---GQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F+DENF+  H GPG++SMANAG NTNGSQFFI
Sbjct: 62  RVIPNFMCQGGDFTAGNGTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFGQV+EG+DVVK IE   +  G +P K VV++DCG+L
Sbjct: 122 CTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSG-KPTKPVVVADCGQL 171



>gb:AP003621_1831598 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003634_1831850 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0655A07.
          Length = 220

 Score =  179 bits (453), Expect = 1e-43
 Identities = 96/178 (53%), Positives = 118/178 (66%), Gaps = 7/178 (3%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX------ 532
           ++VT +VYFD+ I    GK AGR+V+GL+G  VP+TAENFRALCTGE             
Sbjct: 47  TEVTHKVYFDVEID---GKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFK 103

Query: 531 -XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNG 355
              FHR+I  FMIQ            +SIYG  F DENFK+ H GPG++SMANAG +TNG
Sbjct: 104 GSAFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNG 163

Query: 354 SQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           SQFFI TV T WLD +HVVFG+V+ GMDVV  IE++    G  PK +VVI+D GELP+
Sbjct: 164 SQFFITTVTTSWLDGKHVVFGKVLSGMDVVYKIEAEGQQSGS-PKSKVVIADSGELPM 220



>gb:AP003621_1831597 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003634_1831849 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0655A07.
          Length = 225

 Score =  179 bits (453), Expect = 1e-43
 Identities = 96/178 (53%), Positives = 118/178 (66%), Gaps = 7/178 (3%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX------ 532
           ++VT +VYFD+ I    GK AGR+V+GL+G  VP+TAENFRALCTGE             
Sbjct: 52  TEVTHKVYFDVEID---GKPAGRVVMGLFGKTVPKTAENFRALCTGEKGTGKSGKALHFK 108

Query: 531 -XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNG 355
              FHR+I  FMIQ            +SIYG  F DENFK+ H GPG++SMANAG +TNG
Sbjct: 109 GSAFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADENFKIKHTGPGLLSMANAGRDTNG 168

Query: 354 SQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           SQFFI TV T WLD +HVVFG+V+ GMDVV  IE++    G  PK +VVI+D GELP+
Sbjct: 169 SQFFITTVTTSWLDGKHVVFGKVLSGMDVVYKIEAEGQQSGS-PKSKVVIADSGELPM 225



>pir|T50838|T50838 peptidylprolyl isomerase (EC 5.2.1.8) ROC7
           [similarity] - Arabidopsis thaliana>gb:AB020755_1514716
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MZN1.>gb:AY048227_1561689 Arabidopsis thaliana
           AT5g58710/mzn1_160 mRNA, complete
           cds.>gb:AY086471_1571519 Arabidopsis thaliana clone
           25325 mRNA, complete sequence.>gb:AY094017_1575523
           Arabidopsis thaliana AT5g58710/mzn1_160 mRNA, complete
           cds.>gb:AF192490_1775518 Arabidopsis thaliana
           cyclophilin (ROC7) mRNA, complete cds.
          Length = 204

 Score =  179 bits (453), Expect = 1e-43
 Identities = 97/181 (53%), Positives = 116/181 (64%), Gaps = 7/181 (3%)
 Frame = -2

Query: 702 EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEX-------XX 544
           E   ++T +VYFD+ I    GKAAGRIV+GL+G  VP+T ENFRALCTGE          
Sbjct: 28  ENLKEITHKVYFDVEID---GKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKAL 84

Query: 543 XXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPN 364
                 FHR+I  FM+Q            +SIYG  F DENFKL H GPG +SMANAG +
Sbjct: 85  HYKGSSFHRIIPSFMLQGGDFTHGNGMGGESIYGEKFADENFKLKHTGPGFLSMANAGQD 144

Query: 363 TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
           TNGSQFFI TV T WLD RHVVFG+V+ GMDVV  +E++    G  PK +VVI D GELP
Sbjct: 145 TNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYKVEAEGNQSG-TPKSKVVIVDSGELP 203

Query: 183 I 181
           +
Sbjct: 204 L 204



>pir|E84597|E84597 cyclophilin (CYP2) [imported] - Arabidopsis
           thaliana>gb:AC006264_1533909 Arabidopsis thaliana
           chromosome 2 clone F26H11 map mi148, complete
           sequence.>gb:AY087454_1572485 Arabidopsis thaliana clone
           35643 mRNA, complete sequence.
          Length = 174

 Score =  179 bits (453), Expect = 1e-43
 Identities = 95/171 (55%), Positives = 116/171 (67%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G  AG+IV+ LY D+ P+TAENFRALCTGE                FH
Sbjct: 6   KVFFDMTIG---GAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFH 62

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F+DENF+  H GPG++SMANAG NTNGSQFFI
Sbjct: 63  RVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFI 122

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFGQV+EG+DVVK IE   +  G +P K VVI+DCGE+
Sbjct: 123 CTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSG-KPTKPVVIADCGEI 172



>sp|P52009|CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-1).>pir|T27034|T27034 peptidylprolyl
           isomerase (EC 5.2.1.8) Y49A3A.5 [similarity] -
           Caenorhabditis elegans>gb:CEU30943_1368486
           Caenorhabditis elegans cyclophilin-1 (cyp-1) mRNA,
           complete cds.>gb:CEY49A3A_1370318 Caenorhabditis elegans
           YAC Y49A3A, complete sequence.
          Length = 192

 Score =  179 bits (453), Expect = 1e-43
 Identities = 96/171 (56%), Positives = 111/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEX-------XXXXXXXXFH 520
           +V+FD+SIG    + AGR+ + L+ D VP+TAENFRALCTGE                FH
Sbjct: 23  KVFFDVSIGE---EPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFH 79

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I +FMIQ            +SIYG  FKDENF L H GPG +SMANAGPNTNGSQFFI
Sbjct: 80  RIIPEFMIQGGDFTRHNGTGGESIYGNKFKDENFDLKHTGPGCLSMANAGPNTNGSQFFI 139

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTV TPWLD  HVVFGQV +GM VVK IE   + R   P K V I+DCGEL
Sbjct: 140 CTVDTPWLDGGHVVFGQVTDGMSVVKKIEKMGS-RSGAPAKTVTIADCGEL 189



>pir|T50772|T50772 peptidylprolyl isomerase (EC 5.2.1.8) CYP2
           [similarity] - Arabidopsis thaliana>gb:AF020434_1761639
           Arabidopsis thaliana cyclophilin (CYP2) gene, complete
           cds.
          Length = 174

 Score =  178 bits (452), Expect = 1e-43
 Identities = 94/171 (54%), Positives = 116/171 (67%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G  AG+IV+ LY D+ P+TAENFRALCTGE                FH
Sbjct: 6   KVFFDMTIG---GAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSSFH 62

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F+DENF+  H GPG++SMANAG NTNGSQFFI
Sbjct: 63  RVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFI 122

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFGQV+EG+DVVK IE   +  G +P K VV++DCGE+
Sbjct: 123 CTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSG-KPTKPVVVADCGEI 172



>sp|P52015|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 (EC
           5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-7).>pir|T27371|T27371 peptidylprolyl
           isomerase (EC 5.2.1.8) Y75B12B.2 [similarity] -
           Caenorhabditis elegans>gb:CEY75B12B_1371077
           Caenorhabditis elegans YAC Y75B12B, complete sequence.
          Length = 171

 Score =  178 bits (452), Expect = 1e-43
 Identities = 93/171 (54%), Positives = 113/171 (66%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI+I    GK  GRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 5   RVFFDITIA---GKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I +FMIQ            +SIYG  F DENFK  H GPGV+SMANAGPNTNGSQFF+
Sbjct: 62  RIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFL 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFG+V+EG+D+V  +E   +  G  PK   +I+DCG+L
Sbjct: 122 CTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSG-TPKSECLIADCGQL 171



>gb:BT016150_1358595 Drosophila melanogaster AT16671 full insert
           cDNA.
          Length = 194

 Score =  177 bits (449), Expect = 3e-43
 Identities = 93/164 (56%), Positives = 112/164 (68%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +VYFDI+ G   G+  GRIV+ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 35  RVYFDIAAG---GEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFM 91

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            +SIYG  F DENF+L H G GV+SMANAG NTNGSQFFICT KT W
Sbjct: 92  CQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTW 151

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LDN+HVVFG+V+EGMD+V+ +ES  +  G +  K+V+I DCG L
Sbjct: 152 LDNKHVVFGKVVEGMDIVQKVESYGSQDG-KTSKKVIIEDCGAL 194



>gb:AE014296_1136235 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1136236 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003535_1214456
           Drosophila melanogaster chromosome 3L, section 50 of 83
           of the complete sequence.>gb:AE003535_1214457 Drosophila
           melanogaster chromosome 3L, section 50 of 83 of the
           complete sequence.>gb:AY060923_1292727 Drosophila
           melanogaster GM06533 full length cDNA.
          Length = 164

 Score =  177 bits (449), Expect = 3e-43
 Identities = 93/164 (56%), Positives = 112/164 (68%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +VYFDI+ G   G+  GRIV+ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 5   RVYFDIAAG---GEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            +SIYG  F DENF+L H G GV+SMANAG NTNGSQFFICT KT W
Sbjct: 62  CQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LDN+HVVFG+V+EGMD+V+ +ES  +  G +  K+V+I DCG L
Sbjct: 122 LDNKHVVFGKVVEGMDIVQKVESYGSQDG-KTSKKVIIEDCGAL 164



>pir|S71219|S71219 peptidylprolyl isomerase (EC 5.2.1.8) ROC3 -
           Arabidopsis thaliana>gb:AC005825_1533061 Arabidopsis
           thaliana chromosome 2 clone T24I21 map mi398, complete
           sequence.>gb:ATU40399_1556975 Arabidopsis thaliana
           cytosolic cyclophilin (ROC3) mRNA, complete
           cds.>gb:AY048215_1561677 Arabidopsis thaliana
           At2g16600/T24I21.1 mRNA, complete
           cds.>gb:AY086330_1571380 Arabidopsis thaliana clone
           23995 mRNA, complete sequence.>gb:AY091694_1574705
           Arabidopsis thaliana At2g16600/T24I21.1 mRNA, complete
           cds.
          Length = 173

 Score =  177 bits (449), Expect = 3e-43
 Identities = 95/171 (55%), Positives = 114/171 (66%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +VYFD+++G   GK+AGRIV+ LY D  P+TAENFRALCTGE                FH
Sbjct: 6   KVYFDMTVG---GKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFH 62

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  FKDENF   H GPG++SMANAG NTNGSQFFI
Sbjct: 63  RVIPKFMCQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQFFI 122

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EG++VV+ IE   +D G R  K VVI+DCG++
Sbjct: 123 CTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSG-RTSKPVVIADCGQI 172



>gb:AY392408_1604713 Thellungiella halophila cyclophilin mRNA,
           complete cds.
          Length = 173

 Score =  177 bits (448), Expect = 4e-43
 Identities = 94/171 (54%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+++G   G  AGRIV+ LY D  P+TAENFRALCTGE                FH
Sbjct: 6   KVFFDMTVG---GSPAGRIVMELYADTTPETAENFRALCTGEKGMGKSGKPLHYKGSAFH 62

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  FKDENF   H GPG++SMANAG NTNGSQFFI
Sbjct: 63  RVIPKFMCQGGDFTKGNGTGGESIYGMKFKDENFTKKHTGPGILSMANAGANTNGSQFFI 122

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQVIEGMDVV+ IE   +D G +  K VV++DCG++
Sbjct: 123 CTEKTSWLDGKHVVFGQVIEGMDVVRAIEKVGSDSG-KTSKPVVVADCGQI 172



>gb:CEU27559_1368480 Caenorhabditis elegans cyclophilin (cyp-7)
           mRNA, complete cds.
          Length = 171

 Score =  176 bits (447), Expect = 5e-43
 Identities = 92/171 (53%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI+     GK  GRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 5   RVFFDITTA---GKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I +FMIQ            +SIYG  F DENFK  H GPGV+SMANAGPNTNGSQFF+
Sbjct: 62  RIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFL 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFG+V+EG+D+V  +E   +  G  PK   +I+DCG+L
Sbjct: 122 CTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSG-TPKSECLIADCGQL 171



>sp|P29117|PPIF_RAT Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin F).>gb:BC086977_2109885 Rattus norvegicus
           peptidylprolyl isomerase F (cyclophilin F), mRNA (cDNA
           clone MGC:93084 IMAGE:7193156), complete
           cds.>gb:RNU68544_2137642 Rattus norvegicus cyclophilin D
           mRNA, nuclear gene encoding mitochondrial protein,
           complete cds.
          Length = 206

 Score =  176 bits (447), Expect = 5e-43
 Identities = 94/163 (57%), Positives = 108/163 (66%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           VY D+      G+  GR+V+ L  D VP+TAENFRALCTGE         FHRVI  FM 
Sbjct: 47  VYLDVGAD---GQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMC 103

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            KSIYG  F DENF L H GPGV+SMANAGPNTNGSQFFICT+KT WL
Sbjct: 104 QAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWL 163

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           D +HVVFG V EGMDVVK IES  +  G +  K++VI+DCG+L
Sbjct: 164 DGKHVVFGHVKEGMDVVKKIESFGSKSG-KTSKKIVITDCGQL 205



>sp|Q99KR7|PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase,
           mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin F).>gb:BC004041_2089555 Mus musculus
           peptidylprolyl isomerase F (cyclophilin F), mRNA (cDNA
           clone MGC:7667 IMAGE:3496285), complete cds.
          Length = 206

 Score =  176 bits (447), Expect = 5e-43
 Identities = 93/163 (57%), Positives = 108/163 (66%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           VY D+      G+  GR+V+ L  D VP+TAENFRALCTGE         FHRVI  FM 
Sbjct: 47  VYLDVGAD---GQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMC 103

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            +SIYG  F DENF L H GPGV+SMANAGPNTNGSQFFICT+KT WL
Sbjct: 104 QAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWL 163

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           D +HVVFG V EGMDVVK IES  +  G +  K++VI+DCG+L
Sbjct: 164 DGKHVVFGHVKEGMDVVKKIESFGSKSG-KTSKKIVITDCGQL 205



>sp|Q26551|PPIB_SCHMA Peptidyl-prolyl cis-trans isomerase B
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           B) (S-cyclophilin).>gb:SMU30874_1397853 Schistosoma
           mansoni cyclophilin B mRNA, complete cds.
          Length = 213

 Score =  176 bits (447), Expect = 5e-43
 Identities = 92/175 (52%), Positives = 112/175 (64%), Gaps = 5/175 (2%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEX-----XXXXXXXX 526
           KVT +V+FDI +    GK   RI+IGL+G  VP+T ENF+ L  G               
Sbjct: 29  KVTDKVFFDIEVD---GKPLARIIIGLFGKTVPKTVENFKQLSIGTQLKDGRTASYKGST 85

Query: 525 FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF 346
           FHRVIK FMIQ             SIYG  F DENFKL H G G +SMANAGP+TNGSQF
Sbjct: 86  FHRVIKSFMIQGGDFTNHDGTGGFSIYGDRFPDENFKLRHVGAGWLSMANAGPDTNGSQF 145

Query: 345 FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           FI TVKT WLD +HVVFG+V+EGM++V+ IES+ TD  DRP K + I+ CG +P+
Sbjct: 146 FITTVKTSWLDGKHVVFGKVVEGMNIVRQIESETTDSRDRPVKSIKIASCGHIPV 200



>sp|P52013|CYP5_CAEEL Peptidyl-prolyl cis-trans isomerase 5
           precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-5).>pir|T21587|T21587 peptidylprolyl
           isomerase (EC 5.2.1.8) F31C3.1 [similarity] -
           Caenorhabditis elegans>gb:CEF31C3_1363210 Caenorhabditis
           elegans cosmid F31C3, complete sequence.
          Length = 204

 Score =  176 bits (447), Expect = 5e-43
 Identities = 101/195 (51%), Positives = 121/195 (62%), Gaps = 4/195 (2%)
 Frame = -2

Query: 753 VKSGRPLAPVRATAQVAEPQS----KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQT 586
           +KS   +A V A   +A+       KVT +VYFD+ IG   GK  GRIVIGL+G  VP+T
Sbjct: 1   MKSLLVVAAVLAVGALAQGDDAKGPKVTDKVYFDMEIG---GKPIGRIVIGLFGKTVPKT 57

Query: 585 AENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVH 406
           A NF  L             FHRVI DFMIQ            +SIYG  F DENFKL H
Sbjct: 58  ATNFIELAKKPKGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKH 117

Query: 405 AGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDR 226
            G G +SMANAG +TNGSQFFI TVKTPWLD RHVVFG+++EGMDVV+ IE  E   GDR
Sbjct: 118 YGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDR 177

Query: 225 PKKRVVISDCGELPI 181
           PK+ V+I+  G + +
Sbjct: 178 PKQDVIIAASGHIAV 192



>gb:AF411956_2492676 Takifugu rubripes lck gene locus, partial
           sequence.
          Length = 300

 Score =  176 bits (446), Expect = 7e-43
 Identities = 99/200 (49%), Positives = 122/200 (61%), Gaps = 3/200 (1%)
 Frame = -2

Query: 780 QKFSSCSVQVKSGRPLAPVRATAQVAEPQSK---VTSQVYFDISIGNPVGKAAGRIVIGL 610
           ++FS  +++          + TAQ  EP +K   V  QVY DI IGN   K AGR+   L
Sbjct: 103 KRFSGKTLEEAEAEAGETTKTTAQEGEPPAKKGRVNPQVYMDIKIGN---KPAGRLRFLL 159

Query: 609 YGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFK 430
             D VP TAENFR LCT E         FHR+I  FM Q            KSIYGR F 
Sbjct: 160 RADIVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFD 219

Query: 429 DENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIES 250
           DENF L H  PG +SMAN+GPNTNGSQFFI T KT WLD +HVVFG+++EGMDV++ +E+
Sbjct: 220 DENFVLKHTAPGQLSMANSGPNTNGSQFFITTDKTDWLDGKHVVFGELMEGMDVLRQMEA 279

Query: 249 QETDRGDRPKKRVVISDCGE 190
           Q    G + K++V+ISDCGE
Sbjct: 280 QGAKDG-KTKQKVIISDCGE 298



>gb:AY678298_1622003 Lycopersicon esculentum clone 56B23 chromosome
           6, genomic sequence.
          Length = 225

 Score =  176 bits (446), Expect = 7e-43
 Identities = 95/188 (50%), Positives = 119/188 (63%), Gaps = 7/188 (3%)
 Frame = -2

Query: 726 VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXX 547
           ++  A+ +E   +VT +VYFD+ I    GK  GRIV+GL+G  VP+TAENFRALCTGE  
Sbjct: 41  IKIEAKTSEDLERVTHKVYFDVEIN---GKPTGRIVMGLFGKTVPKTAENFRALCTGEKG 97

Query: 546 XXXXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVV 388
                         FHR+I  FMIQ            +SIYG +F DENF L H  PG++
Sbjct: 98  TGKAGKPLHYKGSSFHRIIPSFMIQGGDFTRGDGRGGESIYGESFPDENFDLKHTEPGIL 157

Query: 387 SMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVV 208
           SMANAGP+TNGSQFFI TV T WLD  HVVFG+V+ GMDVV  IE++    G  PK +V 
Sbjct: 158 SMANAGPDTNGSQFFITTVTTSWLDKHHVVFGKVLSGMDVVHKIEAEGRQSG-TPKSKVR 216

Query: 207 ISDCGELP 184
           I++ G+LP
Sbjct: 217 ITNSGDLP 224



>gb:DIU47813_1377748 Dirofilaria immitis cyclophilin Dicyp-2 mRNA,
           complete cds.
          Length = 171

 Score =  176 bits (446), Expect = 7e-43
 Identities = 96/171 (56%), Positives = 114/171 (66%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +VYFDI+I    G  AGRIV+ L+ D VP+TAENFR LCTGE                FH
Sbjct: 5   KVYFDITID---GSNAGRIVMELFADIVPKTAENFRCLCTGERGVGRSGKKLHYKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM+Q            +SIYG  F DENF+  H GPGV+SMANAGPNTNGSQFFI
Sbjct: 62  RVIPNFMLQGGDFTRGNGTGGESIYGEKFPDENFQEKHTGPGVLSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V+EGM+VVK IES+ +  G R    VVI+DCG+L
Sbjct: 122 CTAKTEWLDGKHVVFGRVVEGMNVVKAIESKGSQSG-RTSADVVITDCGQL 171



>gb:CEU31948_1368492 Caenorhabditis elegans cyclophilin isoform 5
           (cyp-5) mRNA, complete cds.
          Length = 204

 Score =  176 bits (446), Expect = 7e-43
 Identities = 95/170 (55%), Positives = 111/170 (65%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVI 511
           KVT +VYFD+ IG   GK  GRIVIGL+G  VP+TA NF  L             FHRVI
Sbjct: 26  KVTDKVYFDMEIG---GKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEGYPGSKFHRVI 82

Query: 510 KDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV 331
            DFMIQ            +SIYG  F DENFKL H G G +SMANAG +TNGSQFFI TV
Sbjct: 83  ADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTV 142

Query: 330 KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           KTPWLD RHVVFG+++EGMDVV+ IE  E   GDRPK+ V+I+  G + +
Sbjct: 143 KTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAASGHIAV 192



>sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E (EC
           5.2.1.8) (PPIase E) (Rotamase E) (Cyclophilin E)
           (Cyclophilin 33).>gb:AK008177_1154428 Mus musculus adult
           male small intestine cDNA, RIKEN full-length enriched
           library, clone:2010010D16 product:peptidylprolyl
           isomerase E (cyclophilin E), full insert
           sequence.>gb:BC045154_2099087 Mus musculus
           peptidylprolyl isomerase E (cyclophilin E), mRNA (cDNA
           clone MGC:54434 IMAGE:6468589), complete cds.
          Length = 301

 Score =  176 bits (446), Expect = 7e-43
 Identities = 97/183 (53%), Positives = 118/183 (64%), Gaps = 3/183 (1%)
 Frame = -2

Query: 729 PVRATAQVAEPQSKVTS---QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT 559
           P +A AQ  EP +K      QVY DI IGN   K AGRI + L  D VP TAENFR LCT
Sbjct: 121 PPKAEAQEGEPTAKKARSNPQVYMDIKIGN---KPAGRIQMLLRSDVVPMTAENFRCLCT 177

Query: 558 GEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMA 379
            E         FHR+I  FM Q            KSIYG+ F DENF L H GPG++SMA
Sbjct: 178 HEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMA 237

Query: 378 NAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISD 199
           N+GPNTNGSQFF+   KT WLD +HVVFG+V EG+DV++ IE+Q +  G +PK++V+I+D
Sbjct: 238 NSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDG-KPKQKVMIAD 296

Query: 198 CGE 190
           CGE
Sbjct: 297 CGE 299



>gb:AF424658_1798993 Phytophthora infestans clone MY-08-C-01
           peptidylprolyl isomerase mRNA, complete cds.
          Length = 171

 Score =  176 bits (445), Expect = 9e-43
 Identities = 94/171 (54%), Positives = 115/171 (67%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           QV+FD+++G   G  AGRI   L+ D+VP+TAENFRALCTGE                FH
Sbjct: 5   QVFFDMTVG---GAPAGRITFELFADKVPKTAENFRALCTGEKGVGRSGKPLHFKGSSFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F DENF L H G G++SMANAGPNTNGSQFFI
Sbjct: 62  RVIPNFMCQGGDFTRGNGTGGESIYGEKFPDENFLLKHKGEGILSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTV+T WLD +HVVFG+V++GMDVVK IES  +  G + KK VV+++CGEL
Sbjct: 122 CTVETSWLDGKHVVFGRVVDGMDVVKNIESVGSQSG-QTKKPVVVANCGEL 171



>gb:AJ719394_2501581 Gallus gallus mRNA for hypothetical protein,
           clone 1o7.
          Length = 204

 Score =  175 bits (444), Expect = 1e-42
 Identities = 94/163 (57%), Positives = 107/163 (65%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           VY D+   N   +  GR+V+ L  D VP+TAENFRALCTGE         FHRVI  FM 
Sbjct: 45  VYLDVGADN---QPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMC 101

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            KSIYG  F DENF L H GPGV+SMANAGPNTNGSQFFICT KT WL
Sbjct: 102 QGGDFTNHNGTGGKSIYGSRFPDENFLLKHEGPGVLSMANAGPNTNGSQFFICTAKTDWL 161

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           D +HVVFG V EGMDVVK IES  +  G +  K++VI+DCG+L
Sbjct: 162 DGKHVVFGHVKEGMDVVKKIESFGSKNG-KTSKKIVITDCGQL 203



>gb:AY551095_1334919 Crassostrea gigas cyclophilin mRNA, complete
           cds.
          Length = 164

 Score =  175 bits (444), Expect = 1e-42
 Identities = 94/164 (57%), Positives = 111/164 (67%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           QV+FDISIG   G+ AGRIV+ L  D VP+TAENFRALCTGE         FHRVI  FM
Sbjct: 5   QVFFDISIG---GQPAGRIVMELEADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L   GPG +SMANAGPNTNGSQFFICT KT W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGNKFPDENFQLKPLGPGTLSMANAGPNTNGSQFFICTEKTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG+V +GM+VVK +E+  +  G +P K + I +CG+L
Sbjct: 122 LDGKHVVFGRVTDGMNVVKAMEATGSQSG-KPSKPIKIENCGQL 164



>pir|T40819|T40819 peptidylprolyl isomerase (EC 5.2.1.8) SPBP8B7.25
           [similarity] - fission yeast (Schizosaccharomyces
           pombe)>gb:SPBP8B7_1720675 S.pombe chromosome II p1 p8B7.
          Length = 201

 Score =  175 bits (444), Expect = 1e-42
 Identities = 93/168 (55%), Positives = 110/168 (65%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVI 511
           KVT  VYFD+  G+   +  GR+ IGL+G  VP+TAENFRAL TGE         FHRVI
Sbjct: 24  KVTDTVYFDLQQGD---EFLGRVTIGLFGKTVPKTAENFRALATGEKGFGYEGSIFHRVI 80

Query: 510 KDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV 331
            +FMIQ            KSIYG  F DENFKL H  PG++SMANAGP++NGSQFFI TV
Sbjct: 81  PNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAGPDSNGSQFFITTV 140

Query: 330 KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           KTPWLD  HVVFG+V+ G D+VK I   ETD  D+P + V I   G+L
Sbjct: 141 KTPWLDGHHVVFGEVLSGYDIVKKISKAETDNRDKPLEDVKIIKSGQL 188



>sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E (EC
           5.2.1.8) (PPIase E) (Rotamase E) (Cyclophilin E)
           (Cyclophilin 33).>pir|S66681|S66681 peptidylprolyl
           isomerase (EC 5.2.1.8) A - human>gb:AF104012_1883887
           Homo sapiens peptidyl-prolyl cis-trans isomerase E
           (PPIE) mRNA, alternatively spliced, complete
           cds.>gb:BC004898_1969424 Homo sapiens peptidylprolyl
           isomerase E (cyclophilin E), transcript variant 1, mRNA
           (cDNA clone MGC:3736 IMAGE:3545997), complete
           cds.>gb:BC008451_1971390 Homo sapiens peptidylprolyl
           isomerase E (cyclophilin E), transcript variant 1, mRNA
           (cDNA clone MGC:14691 IMAGE:4134572), complete
           cds.>gb:HS144F13_1997150 Human DNA sequence from clone
           RP1-144F13 on chromosome 1p33-34.3 Contains the HEYL
           gene for hairy/enhancer-of-split related protein with
           YRPW-like motif, a novel gene, the NT5C1A gene for
           cytosolic IA 5'-nucleotidase, the HPCAL4 gene for
           hippocalcin like 4, a novel pseudogene, the 5' end of
           the PPIE gene for peptidylprolyl isomerase E
           (cyclophilin E) and six CpG islands, complete
           sequence.>gb:HSJ117L23_2015737 Human DNA sequence from
           clone RP1-117L23 on chromosome 1p33-34.2 Contains part
           of the PPIE gene for peptidylprolyl isomerase E
           (cyclophilin E) and the 3' end of the BMP8B gene for
           bone morphogenetic protein 8b (osteogenic protein 2),
           complete sequence.
          Length = 301

 Score =  175 bits (444), Expect = 1e-42
 Identities = 99/201 (49%), Positives = 126/201 (62%), Gaps = 4/201 (1%)
 Frame = -2

Query: 780 QKFSSCSVQV-KSGRPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGRIVIG 613
           +KFS  +++  K      P +A  Q  EP   +++   QVY DI IGN   K AGRI + 
Sbjct: 103 KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGN---KPAGRIQML 159

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTF 433
           L  D VP TAENFR LCT E         FHR+I  FM Q            KSIYG+ F
Sbjct: 160 LRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKF 219

Query: 432 KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE 253
            DENF L H GPG++SMAN+GPNTNGSQFF+   KT WLD +HVVFG+V EG+DV++ IE
Sbjct: 220 DDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIE 279

Query: 252 SQETDRGDRPKKRVVISDCGE 190
           +Q +  G +PK++V+I+DCGE
Sbjct: 280 AQGSKDG-KPKQKVIIADCGE 299



>sp|Q27774|PPIB_SCHJA Peptidyl-prolyl cis-trans isomerase B
           precursor (EC 5.2.1.8) (PPIase B) (Rotamase B)
           (Cyclophilin B) (S-cyclophilin).>gb:SJU50389_1397651
           Schistosoma japonicum cyclophilin B mRNA, complete cds.
          Length = 213

 Score =  175 bits (444), Expect = 1e-42
 Identities = 90/175 (51%), Positives = 111/175 (63%), Gaps = 5/175 (2%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEX-----XXXXXXXX 526
           KVT +V+FDI +     +  GRI+IGL+G  VP+T ENF+ L  G               
Sbjct: 29  KVTEKVFFDIEVDE---QPLGRIIIGLFGKTVPKTVENFKQLSIGTTLKDGRTAAYKGST 85

Query: 525 FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF 346
           FHRVIK FMIQ             SIYG  F DENFKL H G G +SMANAGPNTNG+QF
Sbjct: 86  FHRVIKSFMIQGGDFTNHDGTGGFSIYGERFPDENFKLKHVGAGWLSMANAGPNTNGAQF 145

Query: 345 FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           FI T + PWLD +HVVFG+V+EGM VV+ IE+ +TD  DRP K V I++CG +P+
Sbjct: 146 FITTTQNPWLDGKHVVFGKVVEGMSVVRQIENMQTDSRDRPVKSVKIANCGHIPV 200



>gb:AF042385_1878496 Homo sapiens cyclophilin-33A (CYP-33) mRNA,
           complete cds.
          Length = 301

 Score =  175 bits (443), Expect = 2e-42
 Identities = 99/201 (49%), Positives = 126/201 (62%), Gaps = 4/201 (1%)
 Frame = -2

Query: 780 QKFSSCSVQV-KSGRPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGRIVIG 613
           +KFS  +++  K      P +A  Q  EP   +++   QVY DI IGN   K AGRI + 
Sbjct: 103 KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGN---KPAGRIQML 159

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTF 433
           L  D VP TAENFR LCT E         FHR+I  FM Q            KSIYG+ F
Sbjct: 160 LRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKF 219

Query: 432 KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE 253
            DENF L H GPG++SMAN+GPNTNGSQFF+   KT WLD +HVVFG+V EG+DV++ IE
Sbjct: 220 DDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIE 279

Query: 252 SQETDRGDRPKKRVVISDCGE 190
           +Q +  G+ PK++V+I+DCGE
Sbjct: 280 AQGSKDGN-PKQKVIIADCGE 299



>gb:CR382129_1661726 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 176

 Score =  175 bits (443), Expect = 2e-42
 Identities = 93/167 (55%), Positives = 113/167 (67%), Gaps = 1/167 (0%)
 Frame = -2

Query: 687 VTSQVYFDISI-GNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVI 511
           V + VYF++S  GNP+GK    I   LY D+VP+TAENFRALCTGE         FHRVI
Sbjct: 14  VRNNVYFNVSANGNPLGK----ISFKLYKDQVPKTAENFRALCTGEKGFGYAGSSFHRVI 69

Query: 510 KDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV 331
            +FM+Q            KSIYG+ F DENF + H  PG++SMANAGPNTNGSQFFI TV
Sbjct: 70  PNFMLQGGDFTNHNGTGGKSIYGQKFPDENFNVKHTRPGLLSMANAGPNTNGSQFFITTV 129

Query: 330 KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
            TPWLD  HVVFG+V +GMDVVK IE   ++ G R  +++VI DCG+
Sbjct: 130 DTPWLDGAHVVFGEVTDGMDVVKAIEKLGSNSG-RTSQKIVIDDCGQ 175



>gb:AE013599_1133337 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003458_1210636 Drosophila melanogaster
           chromosome 2R, section 66 of 74 of the complete
           sequence.
          Length = 205

 Score =  175 bits (443), Expect = 2e-42
 Identities = 92/170 (54%), Positives = 114/170 (67%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVI 511
           KVT +V+FDI+IG   G+ AGRI IGL+G  VP+T ENF+ L             FHR+I
Sbjct: 26  KVTEKVFFDITIG---GEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRII 82

Query: 510 KDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV 331
           KDFMIQ            +SIYG  F+DENFKL H G G +SMANAG +TNGSQFFI T 
Sbjct: 83  KDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTK 142

Query: 330 KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           +T WLD RHVVFG+++ GM+VV+ IE+  TD  DRP K VVI++ G LP+
Sbjct: 143 QTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTLPV 192



>sp|Q9P3X9|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-41)
           (CYP-41).>gb:NCR292563_1690629 Neurospora crassa mRNA
           for cyclophilin41.
          Length = 375

 Score =  175 bits (443), Expect = 2e-42
 Identities = 97/172 (56%), Positives = 116/172 (67%), Gaps = 7/172 (4%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXF 523
           S+V+FDI+IG   GKAAGRIV  LY D VP+TAENFRALCTGE                F
Sbjct: 12  SRVFFDITIG---GKAAGRIVFELYNDIVPKTAENFRALCTGEKGVGKLGKPLHYKGSTF 68

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVIK FMIQ            +SIYG  F+DENF+L H  P ++SMANAGP TNGSQFF
Sbjct: 69  HRVIKQFMIQGGDFTAGNGTGGESIYGAKFEDENFQLKHDRPFLLSMANAGPGTNGSQFF 128

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           + TV TP LD +HVVFG+V+ G  VV+ IE+ +T +GD+P K  VI+DCGEL
Sbjct: 129 VTTVPTPHLDGKHVVFGEVLSGKSVVRQIENLKT-QGDKPTKDAVIADCGEL 179



>sp|P54985|CYPH_BLAGE Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|S63995|S63995 peptidylprolyl
           isomerase (EC 5.2.1.8) - German
           cockroach>gb:BGPEPPROI_1355291 B.germanica mRNA for
           peptidyl-propyl cis-trans-isomerase.
          Length = 164

 Score =  174 bits (442), Expect = 2e-42
 Identities = 91/164 (55%), Positives = 111/164 (67%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD+S     G+  GRIV+ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 5   RVFFDMSAD---GQPVGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSRFHRVIPNFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F+DENF+L H GPG++ MANAGPNTNGSQFFI T KT W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGTKFEDENFQLKHTGPGILWMANAGPNTNGSQFFITTAKTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LDNRHVVFG V+EGMDVVK +ES  +  G +  K++ + DCG++
Sbjct: 122 LDNRHVVFGSVVEGMDVVKKLESLGSQSG-KTNKKIAVVDCGQI 164



>gb:AB019518_1514317 Trichophyton mentagrophytes mRNA for
           cyclophilin, complete cds.
          Length = 226

 Score =  174 bits (441), Expect = 3e-42
 Identities = 96/168 (57%), Positives = 109/168 (64%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVI 511
           K+TS+VYFDI      G+  GRIV+GLYG  VP+TAENFRAL TGE         FHRVI
Sbjct: 32  KITSKVYFDIEHD---GQPLGRIVMGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRVI 88

Query: 510 KDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV 331
           KDFMIQ            KSIYG  F+DENFKL H   GV+SMANAG +TNGSQFFI T 
Sbjct: 89  KDFMIQGGDFTNGDGTGGKSIYGNKFEDENFKLRHTKKGVLSMANAGKDTNGSQFFITTA 148

Query: 330 KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
            T WLD +HVVFG+V+EG D+V  I+       DRP K V I  CGEL
Sbjct: 149 ITAWLDGKHVVFGEVLEGYDIVDKIQVVPKGFQDRPTKDVKIVKCGEL 196



>gb:LMFL2581_1387885 Leishmania major Friedlin chromosome 23 cosmid
           L2581, complete cds.
          Length = 295

 Score =  174 bits (441), Expect = 3e-42
 Identities = 96/174 (55%), Positives = 116/174 (66%), Gaps = 10/174 (5%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXX-------XXXFH 520
           +V+FDISI N   KAAGRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 25  KVFFDISIDN---KAAGRIVMELYADTVPKTAENFRALCTGEKGKGRSGKPLHYKSSVFH 81

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLV---HAGPGVVSMANAGPNTNGSQ 349
           RVI +FMIQ            +SIYG TF+DE+F      H G G +SMANAGPNTNGSQ
Sbjct: 82  RVIPNFMIQGGDFTRGNGTGGESIYGTTFRDESFSGKAGRHTGLGCLSMANAGPNTNGSQ 141

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFICT  TPWLD +HVVFG+VI+G+DVVK +E   +  G + + R+V+SDCGE+
Sbjct: 142 FFICTAATPWLDGKHVVFGRVIDGLDVVKKVERLGSSSG-KTRSRIVVSDCGEV 194



>gb:CR860299_1184382 Pongo pygmaeus mRNA; cDNA DKFZp459B225 (from
           clone DKFZp459B225).
          Length = 301

 Score =  174 bits (441), Expect = 3e-42
 Identities = 99/201 (49%), Positives = 125/201 (62%), Gaps = 4/201 (1%)
 Frame = -2

Query: 780 QKFSSCSVQV-KSGRPLAPVRATAQVAEPQSKVTS---QVYFDISIGNPVGKAAGRIVIG 613
           +KFS  +++  K      P +A  Q  EP +K      QVY DI IGN   K AGRI + 
Sbjct: 103 KKFSGKTLEENKEEEGSEPPKAETQEGEPAAKKARSNPQVYMDIKIGN---KPAGRIQML 159

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTF 433
           L  D VP TAENFR LCT E         FHR+I  FM Q            KSIYG+ F
Sbjct: 160 LRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKF 219

Query: 432 KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE 253
            DENF L H GPG++SMAN+GPNTNGSQFF+   KT WLD +HVVFG+V EG+DV++ IE
Sbjct: 220 DDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIE 279

Query: 252 SQETDRGDRPKKRVVISDCGE 190
           ++ +  G +PK++V+I+DCGE
Sbjct: 280 ARGSKDG-KPKQKVIIADCGE 299



>gb:OVU47812_1391506 Onchocerca volvulus cyclophilin Ovcyp-2 mRNA,
           complete cds.
          Length = 171

 Score =  174 bits (440), Expect = 4e-42
 Identities = 92/171 (53%), Positives = 118/171 (69%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI+IG   G+ +GRIV+ L+ D VP+TAENFRALCTGE                FH
Sbjct: 5   RVFFDITIG---GQQSGRIVMELFNDIVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F+DENFK  H GPGV+SMANAGP+TNGSQFF+
Sbjct: 62  RVIPNFMCQGGDFTRGNGTGGESIYGEKFEDENFKEKHTGPGVLSMANAGPDTNGSQFFL 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFG+V++GMDVV+ IE+  +  G +  K VV+++CG+L
Sbjct: 122 CTVKTDWLDGKHVVFGRVVDGMDVVQKIEAVGSQSG-KTSKDVVVANCGQL 171



>gb:NC18F11_1688433 Neurospora crassa DNA linkage group V Cosmid
           contig 18F11.
          Length = 207

 Score =  173 bits (439), Expect = 5e-42
 Identities = 98/180 (54%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = -2

Query: 714 AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXX 541
           AQ AE     K+T +VYFDI  G+   K  GRIV+GLYG  VP+TAENFRAL TGE    
Sbjct: 22  AQSAEAAKGPKITHKVYFDIEQGD---KPLGRIVMGLYGKTVPKTAENFRALATGEKGFG 78

Query: 540 XXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT 361
                FHRVIK FMIQ            KSIYG  F DENFKL H+  G++SMANAG +T
Sbjct: 79  YEGSTFHRVIKQFMIQGGDFTKGDGTGGKSIYGDKFPDENFKLKHSKKGLLSMANAGKDT 138

Query: 360 NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           NGSQFFI TV T WLD +HVVFG+V+EG DVV+ IE+ +T   D P + + I+  GEL +
Sbjct: 139 NGSQFFITTVITSWLDGKHVVFGEVLEGYDVVEKIENTKTGPRDAPAEPIKIAKSGELEV 198



>gb:AF182825_2058112 Mus musculus cyclophilin-33 (Cyp33) mRNA,
           partial cds.
          Length = 298

 Score =  173 bits (438), Expect = 6e-42
 Identities = 96/183 (52%), Positives = 117/183 (63%), Gaps = 3/183 (1%)
 Frame = -2

Query: 729 PVRATAQVAEPQSKVTS---QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT 559
           P +A AQ  EP +K      QVY DI IGN   K AGRI + L  D VP TAENFR LCT
Sbjct: 118 PPKAEAQEGEPTAKKARSNPQVYMDIKIGN---KPAGRIQMLLRSDVVPMTAENFRCLCT 174

Query: 558 GEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMA 379
            E         FHR+I  FM Q            KSIYG+ F DENF L H GPG++SMA
Sbjct: 175 HEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMA 234

Query: 378 NAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISD 199
           N+G NTNGSQFF+   KT WLD +HVVFG+V EG+DV++ IE+Q +  G +PK++V+I+D
Sbjct: 235 NSGSNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDG-KPKQKVMIAD 293

Query: 198 CGE 190
           CGE
Sbjct: 294 CGE 296



>gb:PAB271126_1698633 Picea abies mRNA for putative cyclosporin
           A-binding protein, (pPA0005 gene).
          Length = 172

 Score =  173 bits (438), Expect = 6e-42
 Identities = 93/171 (54%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXX-------XXXFH 520
           +V+FD+ +G   G  AGRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 5   KVFFDMQVG---GAPAGRIVMELYADVVPKTAENFRALCTGERGTGRSGKPLHFKSSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGPNTNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTRGNGTGGESIYGEKFADENFARKHTGPGILSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT +T WLD +HVVFGQV+EG+DVV+ IE   +  G R  K V I+DCG+L
Sbjct: 122 CTAQTSWLDGKHVVFGQVVEGLDVVREIEKVGSGSG-RTSKPVSIADCGQL 171



>gb:ATU40400_1556976 Arabidopsis thaliana cytosolic cyclophilin
           (ROC2) gene, complete cds.
          Length = 176

 Score =  173 bits (438), Expect = 6e-42
 Identities = 91/171 (53%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI IG      AGR+V+ L+ D  P+TA NFRALCTGE                FH
Sbjct: 5   KVFFDILIGK---MKAGRVVMELFADVTPRTANNFRALCTGENGIGKAGKALHYKGSAFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I  FM Q            +SIYG  F+DENFKL H GPG++SMAN+GPNTNGSQFFI
Sbjct: 62  RIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENFKLKHTGPGILSMANSGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V++G +VVK +E   +D G+ P +RVVI DCGEL
Sbjct: 122 CTEKTSWLDGKHVVFGKVVDGYNVVKAMEDVGSDMGN-PSERVVIEDCGEL 171



>pir|T47724|T47724 peptidylprolyl isomerase (EC 5.2.1.8) ROC2 -
           Arabidopsis thaliana>gb:ATF18O21_1549197 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           F18O21.>gb:AY072128_1567022 Arabidopsis thaliana
           putative peptidylprolyl isomerase (At3g56070) mRNA,
           complete cds.>gb:AY096697_1576233 Arabidopsis thaliana
           putative peptidylprolyl isomerase (At3g56070) mRNA,
           complete cds.
          Length = 176

 Score =  173 bits (438), Expect = 6e-42
 Identities = 91/171 (53%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI IG      AGR+V+ L+ D  P+TA NFRALCTGE                FH
Sbjct: 5   KVFFDILIGK---MKAGRVVMELFADVTPRTANNFRALCTGENGIGKAGKALHYKGSAFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I  FM Q            +SIYG  F+DENFKL H GPG++SMAN+GPNTNGSQFFI
Sbjct: 62  RIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENFKLKHTGPGILSMANSGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V++G +VVK +E   +D G+ P +RVVI DCGEL
Sbjct: 122 CTEKTSWLDGKHVVFGKVVDGYNVVKAMEDVGSDMGN-PSERVVIEDCGEL 171



>pir|T50769|T50769 peptidylprolyl isomerase (EC 5.2.1.8) CYP18
           [similarity] - Digitalis lanata>gb:DLCYP18_1675945
           D.lanata CYP18 gene.
          Length = 172

 Score =  173 bits (438), Expect = 6e-42
 Identities = 93/171 (54%), Positives = 111/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+SIG   G+  GRIV+ LY D VP+TA+NFRALCTGE                FH
Sbjct: 5   KVFFDMSIG---GQPCGRIVMELYADVVPKTADNFRALCTGEKGVGKSGKPLHYKGSAFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EGMDVV+ IE   +  G +  K VV++DCG+L
Sbjct: 122 CTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSG-KTAKPVVVADCGQL 171



>gb:BVE311666_1643105 Betula verrucosa mRNA for peptidylprolyl
           isomerase (cyclophilin), ppiase gene (CyP).
          Length = 173

 Score =  172 bits (437), Expect = 8e-42
 Identities = 91/171 (53%), Positives = 109/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+ +G   G+  GRIV+ LY D  P+TAENFRALCTGE                FH
Sbjct: 6   KVFFDMEVG---GQPVGRIVMELYADTTPRTAENFRALCTGEKGNGRSGKPLHYKKSSFH 62

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 63  RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFI 122

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EG+D+VK IE   +  G R  K VV++DCG+L
Sbjct: 123 CTAKTEWLDGKHVVFGQVVEGLDIVKAIEKVGSSSG-RTSKPVVVADCGQL 172



>gb:AY150052_1584922 Kandelia candel cyclophilin (Cyp1) mRNA,
           complete cds.
          Length = 172

 Score =  172 bits (437), Expect = 8e-42
 Identities = 94/171 (54%), Positives = 109/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +VYFD+S+G   G  AGRIV+ L+ D VP+T ENFRALCTGE                FH
Sbjct: 5   RVYFDMSVG---GSPAGRIVMELFADVVPRTTENFRALCTGEKGKGRSGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
            VI +FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  LVIPNFMCQGGDFTAGNETGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+ GMDVVK IE   +  G R  K VVI+DCG+L
Sbjct: 122 CTAKTEWLDGKHVVFGQVVYGMDVVKAIEKVGSGNG-RTSKPVVIADCGQL 171



>gb:BX294148_769820 Pirellula sp. strain 1 complete genome; segment
           16/24.
          Length = 207

 Score =  172 bits (437), Expect = 8e-42
 Identities = 95/193 (49%), Positives = 122/193 (63%), Gaps = 7/193 (3%)
 Frame = -2

Query: 744 GRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRAL 565
           G    P  +T+     + +VT +VYFD+SIG+   + AGRIV+GL+G +VP+TAENFRAL
Sbjct: 17  GLTAGPASSTSAADPAKGEVTHKVYFDVSIGS---EPAGRIVLGLFGKDVPKTAENFRAL 73

Query: 564 CTGEXXXXXXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVH 406
            TGE                FHRVI  FM+Q            +SIYG  F DENFK  H
Sbjct: 74  STGEKGEGKLGVPLDFEGSAFHRVIPGFMLQGGDFTAGNGTGGESIYGMKFADENFKFQH 133

Query: 405 AGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDR 226
             PG++SMAN+G NTNGSQFFI    TPWLD +HVVFG+VIEGMDVVK IE+Q +  G +
Sbjct: 134 TTPGLLSMANSGRNTNGSQFFITVAPTPWLDGKHVVFGRVIEGMDVVKKIEAQGSGSG-Q 192

Query: 225 PKKRVVISDCGEL 187
            +K + I++ GE+
Sbjct: 193 TRKLIKITEAGEV 205



>pir|T50768|T50768 peptidylprolyl isomerase (EC 5.2.1.8)
           [similarity] - Digitalis lanata>gb:DLCYCLO_1675943
           D.lanata mRNA for cyclophilin.
          Length = 172

 Score =  172 bits (437), Expect = 8e-42
 Identities = 93/171 (54%), Positives = 111/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G+  GRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 5   KVFFDMTIG---GQPCGRIVMELYADVVPKTAENFRALCTGEKGVGKTGKPLHYKGSAFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EGMDVV+ IE   +  G +  K VVI+DCG++
Sbjct: 122 CTEKTSWLDGKHVVFGQVVEGMDVVRAIEKVGSQSG-KTAKPVVIADCGQI 171



>sp|P45877|PPIC_HUMAN Peptidyl-prolyl cis-trans isomerase C (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           C).>pir|A54204|A54204 peptidylprolyl isomerase (EC
           5.2.1.8) C precursor - human>gb:BC002678_1968313 Homo
           sapiens peptidylprolyl isomerase C (cyclophilin C), mRNA
           (cDNA clone MGC:3673 IMAGE:3610178), complete
           cds.>gb:S71018_2041153 cyclophilin C [human, kidney,
           mRNA, 883 nt].
          Length = 212

 Score =  172 bits (436), Expect = 1e-41
 Identities = 94/169 (55%), Positives = 109/169 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           VT++V+FD+ IG+   K  GRIVIGL+G  VP+T ENF AL TGE         FHRVIK
Sbjct: 36  VTAKVFFDVRIGD---KDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIK 92

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
           DFMIQ             SIYG TF DENFKL H G G VSMANAGP+TNGSQFFI   K
Sbjct: 93  DFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTK 152

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
             WLD +HVVFG+VI+GM VV  IE Q TD  DRP     I + G++ +
Sbjct: 153 PTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDV 201



>sp|P21569|CYPH_MAIZE Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|C39252|CSZM peptidylprolyl
           isomerase (EC 5.2.1.8) - maize>gb:MZECYP_1687897 Zea
           mays cyclophilin (CyP) mRNA, complete
           cds.>gb:ZMCYCL_1731815 Z.mays gene for cyclophilin.
          Length = 172

 Score =  172 bits (436), Expect = 1e-41
 Identities = 94/171 (54%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+++G   G  AGRIV+ LY +EVP+TAENFRALCTGE                FH
Sbjct: 5   RVFFDMTVG---GAPAGRIVMELYANEVPKTAENFRALCTGEKGVGKSGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F DE F      PGV+SMANAGPNTNGSQFFI
Sbjct: 62  RVIPEFMCQGGDFTRGNGTGGESIYGEKFPDEKFVRKQPAPGVLSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTV TPWLD +HVVFGQV+EGMDVVK IE   T  G    K V ++DCG+L
Sbjct: 122 CTVATPWLDGKHVVFGQVVEGMDVVKAIEKVGTRNGS-TSKVVKVADCGQL 171



>sp|P30412|PPIC_MOUSE Peptidyl-prolyl cis-trans isomerase C (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           C).>pir|A40047|A40047 peptidylprolyl isomerase (EC
           5.2.1.8) (cyclophilin C) - mouse>gb:BC025861_2095186 Mus
           musculus peptidylprolyl isomerase C, mRNA (cDNA clone
           MGC:31015 IMAGE:5026674), complete
           cds.>gb:MUSCYPC_2125636 Mouse cyclophilin C (cyp C)
           mRNA, complete cds.
          Length = 212

 Score =  172 bits (435), Expect = 1e-41
 Identities = 93/169 (55%), Positives = 109/169 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           VT +V+FD+ IG+   K  GRIVIGL+G+ VP+T ENF AL TGE         FHRVIK
Sbjct: 36  VTDKVFFDVRIGD---KDVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIK 92

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
           DFMIQ             SIYG TF DENFKL H G G VSMANAGP+TNGSQFFI   K
Sbjct: 93  DFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTK 152

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
             WLD +HVVFG+V++GM VV  IE Q TD  DRP     I + G++ +
Sbjct: 153 PTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKIDV 201



>gb:CEU34354_1368504 Caenorhabditis elegans cyclophilin isoform 2
           cyp-2 mRNA, complete cds.
          Length = 171

 Score =  171 bits (434), Expect = 2e-41
 Identities = 95/171 (55%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+ DI+IG   GK  GRIV+ LY D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFIDITIG---GKKGGRIVMELYNDIAPKTAENFRALCTGEKGKGKSGKKLHFKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I +FMIQ             SI+G  F DENFK  H GPGV+SMAN G NTNGSQFF+
Sbjct: 62  RIIPEFMIQGGDFTEGNGTGE-SIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFL 120

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTVKT WLD +HVVFG+VIEGMDVVK IES+ ++ G  P    VI+DCGE+
Sbjct: 121 CTVKTTWLDGKHVVFGKVIEGMDVVKAIESKGSEDG-APSAPCVIADCGEM 170



>pir|S48017|S48017 peptidylprolyl isomerase (EC 5.2.1.8) Cyp2 -
           rice>gb:RICCYP2G_1703597 Oryza sativa cyclophilin 2
           (Cyp2) gene, complete cds.>gb:AP004078_1837353 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           2, BAC clone:OJ1020_C02.>gb:AP005851_1859098 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           2, BAC clone:OSJNBb0088N06.
          Length = 172

 Score =  171 bits (434), Expect = 2e-41
 Identities = 93/172 (54%), Positives = 112/172 (65%), Gaps = 7/172 (4%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXF 523
           ++V+FD+++G   G  AGRIV+ LY  +VP+TAENFRALCTGE                F
Sbjct: 4   TRVFFDMTVG---GAPAGRIVMELYAKDVPRTAENFRALCTGEKGVGKSGKPLHYKGSTF 60

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVI +FM Q            +SIYG  F DE FK  H  PG++SMANAGPNTNGSQFF
Sbjct: 61  HRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSPGILSMANAGPNTNGSQFF 120

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           ICTV   WLD +HVVFG+V+EGMDVVK IE +   RG    K VVI+DCG+L
Sbjct: 121 ICTVPCSWLDGKHVVFGRVVEGMDVVKAIE-KVGSRGGSTAKPVVIADCGQL 171



>pir|A39252|CSTO peptidylprolyl isomerase (EC 5.2.1.8) - tomato
          Length = 171

 Score =  171 bits (434), Expect = 2e-41
 Identities = 92/171 (53%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G  AGR+V+ LY D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFFDLTIG---GAPAGRVVMELYADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WL+ +HVVFGQV+EGMDV+K  E+  +  G R  K VVI+DCG+L
Sbjct: 122 CTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSG-RCSKPVVIADCGQL 171



>gb:BC059741_2552686 Xenopus tropicalis hypothetical protein
           MGC75715, mRNA (cDNA clone MGC:75715 IMAGE:5380778),
           complete cds.
          Length = 164

 Score =  171 bits (432), Expect = 3e-41
 Identities = 88/164 (53%), Positives = 111/164 (67%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FDI++    G   GRI++ L  D VP+TAENFRALCT E         FHR+I +FM
Sbjct: 5   RVFFDIAVD---GCPMGRIIMELRSDVVPKTAENFRALCTNEKGFGYKNSGFHRIIPEFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L H GPG++SMANAG NTNGSQFFICT KT W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGNKFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG VI+GMDVV+ +E   +  G +P K++VI++CG+L
Sbjct: 122 LDGKHVVFGTVIDGMDVVRNMEKLGSQSG-KPAKKIVIANCGQL 164



>gb:BC059470_2552447 Danio rerio peptidylprolyl isomerase A, like,
           mRNA (cDNA clone MGC:73102 IMAGE:4786094), complete
           cds.>gb:BC071370_2556112 Danio rerio peptidylprolyl
           isomerase A, like, mRNA (cDNA clone MGC:86688
           IMAGE:6895545), complete cds.
          Length = 164

 Score =  171 bits (432), Expect = 3e-41
 Identities = 91/164 (55%), Positives = 110/164 (67%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FDI+I    GK AGRIV+ L  D VP+TAENFRALCTGE         FHRVI  FM
Sbjct: 5   KVFFDITID---GKEAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F+DENF L H G G +SMANAGPNTNGSQFFICT  T W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGNKFEDENFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG+V++G+DVV  IE + +  G +   +VVI++CG+L
Sbjct: 122 LDGKHVVFGKVVDGLDVVDAIEKKGSSSG-KCSAKVVIANCGQL 164



>gb:AY088764_1573777 Arabidopsis thaliana clone 94608 mRNA, complete
           sequence.>gb:AY568519_1615457 Arabidopsis thaliana
           single domain cyclophilin type peptidyl-prolyl cis-trans
           isomerase (CYP21-2) mRNA, complete cds.
          Length = 228

 Score =  171 bits (432), Expect = 3e-41
 Identities = 96/184 (52%), Positives = 116/184 (63%), Gaps = 7/184 (3%)
 Frame = -2

Query: 711 QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX 532
           QV E    VT +VYFDI I    G  AGRI+IGL+G+ VP+TAENFR+LCTGE       
Sbjct: 49  QVGEDLEGVTHKVYFDIQIN---GSPAGRILIGLFGNIVPKTAENFRSLCTGEKGVGNMG 105

Query: 531 -------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANA 373
                    FHR+I  FMIQ            +SIYG  F DENFKL H GPG +SMAN+
Sbjct: 106 KPLYFKGSSFHRIIPGFMIQGGDFTRGDGRGGESIYGDKFADENFKLKHTGPGFLSMANS 165

Query: 372 GPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           GP++NGSQFFI TV T WLD  HVVFG+V+ GM+VV+ IE+Q  D G  PK  V+I   G
Sbjct: 166 GPDSNGSQFFITTVTTSWLDGHHVVFGKVLSGMEVVRKIEAQGQDSG-VPKANVIIFASG 224

Query: 192 ELPI 181
           E+ +
Sbjct: 225 EVSL 228



>pir|B38388|B38388 peptidylprolyl isomerase (EC 5.2.1.8)
           (cyclophilin) cyp-1 - fruit fly (Drosophila
           melanogaster)>gb:BT009946_1357312 Drosophila
           melanogaster SD01793 full insert
           cDNA.>gb:DROCYP1_1381847 Drosophila melanogaster CYP-1
           protein mRNA, complete cds.
          Length = 165

 Score =  171 bits (432), Expect = 3e-41
 Identities = 89/164 (54%), Positives = 112/164 (68%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++  N   +  GRIV+ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 6   RVFFDMTADN---EPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 62

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L H G G++SMANAG NTNGSQFFICTVKT W
Sbjct: 63  CQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAW 122

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LDN+HVVFG+V+EG+DVVK IES  +  G +  K++++++ G L
Sbjct: 123 LDNKHVVFGEVVEGLDVVKKIESYGSQSG-KTSKKIIVANSGSL 165



>pir|S25443|CSBY peptidylprolyl isomerase (EC 5.2.1.8), cytosolic -
           yeast  (Saccharomyces cerevisiae)>gb:AY557665_1613892
           Saccharomyces cerevisiae clone FLH001736.01X YDR155C
           gene, complete cds.>gb:SC8358_1705631 S.cerevisiae
           chromosome IV cosmid 8358.>gb:SCCYCL_1707465 Yeast mRNA
           for cyclophilin.>gb:YSCCPHA_1728632 S.cerevisiae
           cyclophilin (CPH) gene, complete cds.
          Length = 162

 Score =  171 bits (432), Expect = 3e-41
 Identities = 91/165 (55%), Positives = 108/165 (65%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           SQVYFD+      G+  GR+V  LY D VP+TAENFRALCTGE         FHRVI DF
Sbjct: 2   SQVYFDVEAD---GQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENFK  H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 59  MLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V++G D+VK +ES  +  G   K R+V++  GEL
Sbjct: 119 WLDGKHVVFGEVVDGYDIVKKVESLGSPSG-ATKARIVVAKSGEL 162



>sp|P14832|CYPH_YEAST Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein) (CPH) (PPI-II).
          Length = 161

 Score =  171 bits (432), Expect = 3e-41
 Identities = 91/165 (55%), Positives = 108/165 (65%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           SQVYFD+      G+  GR+V  LY D VP+TAENFRALCTGE         FHRVI DF
Sbjct: 1   SQVYFDVEAD---GQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDF 57

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENFK  H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 58  MLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCP 117

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V++G D+VK +ES  +  G   K R+V++  GEL
Sbjct: 118 WLDGKHVVFGEVVDGYDIVKKVESLGSPSG-ATKARIVVAKSGEL 161



>sp|P25007|CYPH_DROME Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:AE014298_1125953 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003501_1212962 Drosophila melanogaster
           chromosome X, section 53 of 74 of the complete sequence.
          Length = 227

 Score =  171 bits (432), Expect = 3e-41
 Identities = 89/164 (54%), Positives = 112/164 (68%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++  N   +  GRIV+ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 68  RVFFDMTADN---EPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 124

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L H G G++SMANAG NTNGSQFFICTVKT W
Sbjct: 125 CQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAW 184

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LDN+HVVFG+V+EG+DVVK IES  +  G +  K++++++ G L
Sbjct: 185 LDNKHVVFGEVVEGLDVVKKIESYGSQSG-KTSKKIIVANSGSL 227



>sp|P52014|CYP6_CAEEL Peptidyl-prolyl cis-trans isomerase 6
           precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin-6).>pir|T18573|T18573 peptidylprolyl
           isomerase (EC 5.2.1.8) precursor - Caenorhabditis
           elegans>gb:CEU27354_1368479 Caenorhabditis elegans
           cyclophilin (cyp-6) mRNA, complete
           cds.>gb:U00051_1401531 Caenorhabditis elegans cosmid
           F42G9, complete sequence.
          Length = 201

 Score =  171 bits (432), Expect = 3e-41
 Identities = 91/185 (49%), Positives = 121/185 (65%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           LA +  +A+   P  +VT +V+FD+ IG   G+  G+IVIGL+G+ VP+T +NF  L   
Sbjct: 10  LAILALSAEARGP--RVTDKVFFDMEIG---GRPVGKIVIGLFGEVVPKTVKNFVELAQR 64

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
                     FHRVI++FMIQ            +SIYG  F+DENFKL H GPG +SMAN
Sbjct: 65  AEGEGYVGSKFHRVIENFMIQGGDFTRGDGTGGRSIYGERFEDENFKLQHYGPGWLSMAN 124

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
           AG +TNGSQFFI T KT WLD +HVVFG+++EGMDVV+ IE+     GDRP + VVI++ 
Sbjct: 125 AGEDTNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREIEATPKGAGDRPIEDVVIANA 184

Query: 195 GELPI 181
           G +P+
Sbjct: 185 GHIPV 189



>gb:RCO245940_1703385 Ricinus communis mRNA for cyclophilin (cyp1
           gene).
          Length = 173

 Score =  170 bits (430), Expect = 5e-41
 Identities = 91/171 (53%), Positives = 109/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+++G   G  AGRIV+ L+ D  P+TAENFRALCTGE                FH
Sbjct: 6   KVFFDMTVG---GAPAGRIVMELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFH 62

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 63  RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFI 122

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V+EGMD+VK IE   +  G R  K V I+DCG+L
Sbjct: 123 CTAKTEWLDGKHVVFGRVVEGMDIVKAIEKVGSSSG-RTSKPVQIADCGQL 172



>pir|S54833|S54833 peptidylprolyl isomerase (EC 5.2.1.8) Cyp -
           kidney bean>gb:PVCYCGNA_1702927 P.vulgaris gene for
           cyclophilin.
          Length = 172

 Score =  170 bits (430), Expect = 5e-41
 Identities = 92/171 (53%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G+ AGRIV  LY D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFFDMTIG---GQPAGRIVFELYADVTPRTAENFRALCTGEKGVGRSGKPVHFKGSIFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EG+DVVK IE   +  G +  + V I+DCG+L
Sbjct: 122 CTTKTEWLDGKHVVFGQVVEGLDVVKDIEKVGSGSG-KTARPVAIADCGQL 171



>sp|P21568|CYPH_LYCES Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:TOMCYP_1725644 Lycopersicon
           esculentum cyclophilin (CyP) mRNA, complete cds.
          Length = 171

 Score =  170 bits (430), Expect = 5e-41
 Identities = 91/171 (53%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G  AGR+V+ L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFFDLTIG---GAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WL+ +HVVFGQV+EGMDV+K  E+  +  G R  K VVI+DCG+L
Sbjct: 122 CTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSG-RCSKPVVIADCGQL 171



>gb:BC081399_2562278 Danio rerio peptidylprolyl isomerase F
           (cyclophilin F), mRNA (cDNA clone MGC:101753
           IMAGE:7229434), complete cds.
          Length = 189

 Score =  169 bits (429), Expect = 7e-41
 Identities = 90/163 (55%), Positives = 106/163 (65%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           V+ DI+     G+  GRI+I L+ D VP+T  NFRALCTGE         FHR+I +FM 
Sbjct: 30  VFMDIAAD---GEFIGRIIIELFADVVPKTVANFRALCTGEHGFGYKGSVFHRIIPEFMC 86

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            KSIYG+ F DENFKL H G G++SMAN+GPNTNGSQFFICT KT WL
Sbjct: 87  QGGDFTNHNGTGGKSIYGKKFNDENFKLKHTGAGILSMANSGPNTNGSQFFICTAKTEWL 146

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           D +HVVFGQV EGM+ V L+ES     G   KK V I+DCGEL
Sbjct: 147 DGKHVVFGQVKEGMETVSLMESYGLHDGGTVKK-VAITDCGEL 188



>gb:BC078949_2107095 Rattus norvegicus peptidylprolyl isomerase C,
           mRNA (cDNA clone MGC:93799 IMAGE:7109986), complete cds.
          Length = 212

 Score =  169 bits (429), Expect = 7e-41
 Identities = 92/169 (54%), Positives = 107/169 (63%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           VT +V+FD+ IG+   K  GRIVIGL+G  VP+T ENF  L TGE         FHRVIK
Sbjct: 36  VTDKVFFDVRIGD---KDVGRIVIGLFGKVVPRTVENFVTLATGEKGYGYKGSIFHRVIK 92

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
           DFMIQ             SIYG TF DENFKL H G G VSMANAGP+TNGSQFFI   K
Sbjct: 93  DFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTK 152

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
             WLD +HVVFG+V++GM VV  IE Q TD  DRP     I + G++ +
Sbjct: 153 PAWLDGKHVVFGKVLDGMTVVHSIELQATDDHDRPLTDCTIVNSGKIDV 201



>gb:AP006067_1860854 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0569E11.>gb:AP006174_1861365 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0229B10.
          Length = 215

 Score =  169 bits (429), Expect = 7e-41
 Identities = 90/175 (51%), Positives = 112/175 (64%), Gaps = 7/175 (4%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEX-------XXXXXXX 529
           VT++VY D+ I    G+  GRIVIGLYGD VP+T  NFRALCTGE               
Sbjct: 36  VTNRVYLDVEID---GQHIGRIVIGLYGDVVPKTVANFRALCTGEEGIGHKGKSLHYKGS 92

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHR+I  FMIQ            +SIYG TF DENF + H  PGV++MAN+GP++NGSQ
Sbjct: 93  RFHRIIPGFMIQGGDIVRGDGKGSESIYGGTFPDENFIVKHTHPGVIAMANSGPDSNGSQ 152

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
           F+I T+KT WLD  HVVFG+VI+GMD V  IE        +P+K+VVI+D GE+P
Sbjct: 153 FYITTIKTSWLDGEHVVFGRVIQGMDYVYAIEGGAGTYNGKPRKKVVITDSGEIP 207



>gb:AF456323_1801173 Glycine max cyclophilin (Cyp) mRNA, complete
           cds.
          Length = 172

 Score =  169 bits (429), Expect = 7e-41
 Identities = 93/170 (54%), Positives = 111/170 (65%), Gaps = 7/170 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G++AGRIV+ LY D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFFDMTIG---GQSAGRIVMELYADVTPRTAENFRALCTGEKGVGRSGKPLHYKGSSFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPSFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
           CT KT WLD +HVVFGQVIEG++VVK IE   +  G R  K VVI++CG+
Sbjct: 122 CTEKTEWLDGKHVVFGQVIEGLNVVKDIEKVGSGSG-RTSKPVVIANCGQ 170



>gb:AF078071_1766252 Griffithsia japonica cyclophilin (cypA) mRNA,
           complete cds.
          Length = 162

 Score =  169 bits (429), Expect = 7e-41
 Identities = 90/161 (55%), Positives = 108/161 (67%)
 Frame = -2

Query: 672 YFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQ 493
           +FD+SI    GK +GRIV+ L  D VP+TAENFRALCTGE         FHRVI  FM+Q
Sbjct: 5   FFDVSIA---GKPSGRIVMELRPDVVPKTAENFRALCTGEKGFGFKGSVFHRVIPGFMLQ 61

Query: 492 XXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLD 313
                       KSIYG  F+DENF L H GPG +SMANAGPNTNGSQFFICT  T WLD
Sbjct: 62  GGDFTRGDGTGGKSIYGEKFEDENFTLKHTGPGTLSMANAGPNTNGSQFFICTETTSWLD 121

Query: 312 NRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
            +HVVFG+V+EGM+VV+ +E+  T  G   +K V ++D GE
Sbjct: 122 GKHVVFGKVVEGMNVVRAVEAVGTRSGSTSQK-VSVTDAGE 161



>gb:SMU30265_1397849 Schistosoma mansoni cyclophylin-like protein
           trans-spliced mRNA, complete cds.
          Length = 273

 Score =  169 bits (429), Expect = 7e-41
 Identities = 95/170 (55%), Positives = 113/170 (66%)
 Frame = -2

Query: 696 QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHR 517
           Q +   +V+FDI IGN     AGRIV+ L  D VP+TAENFRALCTGE         FHR
Sbjct: 107 QKRNLPRVFFDIRIGNG---DAGRIVMELRSDIVPRTAENFRALCTGERGFGYHNCCFHR 163

Query: 516 VIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC 337
           VI  FM Q            KSIYGR F DENF+L H G GV+SMAN+GPNTNGSQFFIC
Sbjct: 164 VIPQFMCQGGDFVKGDGTGGKSIYGRKFDDENFQLRHEGFGVLSMANSGPNTNGSQFFIC 223

Query: 336 TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T K  WLD +HVVFG+V++G +VVK +ES  +  G + K+ V+IS CGEL
Sbjct: 224 TTKCDWLDGKHVVFGRVVDGQNVVKKMESVGSKSG-KVKEPVIISRCGEL 272



>pir|T50767|T50767 peptidylprolyl isomerase (EC 5.2.1.8) ATCYP4
           [similarity] - Arabidopsis thaliana>gb:ATU31370_1556898
           Arabidopsis thaliana cyclophilin (ATCYP4) gene, complete
           cds.
          Length = 176

 Score =  169 bits (429), Expect = 7e-41
 Identities = 90/171 (52%), Positives = 111/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI IG      AGR+V+ L+ D  P+TA NFRALCTGE                FH
Sbjct: 5   KVFFDILIGK---MKAGRVVMELFADVTPRTANNFRALCTGENGIGKAGKALHYKGSAFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I  FM Q            +SIYG  F+DENFKL H GPG++SMAN+GPNTNGSQFFI
Sbjct: 62  RIIPGFMCQGGDFTRGNGTGGESIYGSKFEDENFKLKHTGPGILSMANSGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V++G +VVK +E   +  G+ P +RVVI DCGEL
Sbjct: 122 CTEKTSWLDGKHVVFGKVVDGYNVVKAMEDVGSYMGN-PSERVVIEDCGEL 171



>gb:RICCYP2R_1703598 Oryza sativa cyclophilin 2 (Cyp2) mRNA,
           complete cds.
          Length = 172

 Score =  169 bits (428), Expect = 9e-41
 Identities = 92/172 (53%), Positives = 111/172 (64%), Gaps = 7/172 (4%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXF 523
           ++V+FD+++G   G  AGRIV+ LY  +VP+TAENFRALCTGE                F
Sbjct: 4   TRVFFDMTVG---GAPAGRIVMELYAKDVPRTAENFRALCTGEKGVGKSGKPLHYKGSTF 60

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVI +FM Q            +SIYG  F DE FK  H  PG++S ANAGPNTNGSQFF
Sbjct: 61  HRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSPGILSTANAGPNTNGSQFF 120

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           ICTV   WLD +HVVFG+V+EGMDVVK IE +   RG    K VVI+DCG+L
Sbjct: 121 ICTVPCSWLDGKHVVFGRVVEGMDVVKAIE-KVGSRGGSTAKPVVIADCGQL 171



>gb:AY705800_1179907 Pinus halepensis clone 17r cyclophilin mRNA,
           complete cds.
          Length = 172

 Score =  169 bits (428), Expect = 9e-41
 Identities = 92/171 (53%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+ +G   G  AGRIV+ LY D VP+TAENFRALCTGE                FH
Sbjct: 5   KVFFDMQVG---GAPAGRIVMELYADVVPKTAENFRALCTGEKGTGRSGKPLHFKGSSFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMANAGPNTNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTRGNGTGGESIYGEKFADENFVKKHTGPGILSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT +T WLD +HVVFGQV+EG++VV+ IE   +  G R  K VVI+D G+L
Sbjct: 122 CTAQTSWLDGKHVVFGQVVEGLEVVREIEKVGSGSG-RTSKPVVIADSGQL 171



>pir|T50771|T50771 peptidylprolyl isomerase (EC 5.2.1.8)
           [similarity] - potato>gb:AF126551_1770416 Solanum
           tuberosum subsp. tuberosum cyclophilin mRNA, complete
           cds.
          Length = 171

 Score =  169 bits (428), Expect = 9e-41
 Identities = 90/171 (52%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G  AGR+V+ L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   RVFFDLTIG---GAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  FKDENF   H G G++SMANAGP TNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGGESIYGAKFKDENFVKKHTGTGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EG+DV+K  E+  +  G R  K VV++DCG+L
Sbjct: 122 CTAKTEWLDGKHVVFGQVVEGLDVIKKAEAVGSSSG-RCSKPVVVADCGQL 171



>gb:AY391451_2531587 Danio rerio peptidylprolyl isomerase A (PPIA-1)
           mRNA, complete cds.
          Length = 164

 Score =  169 bits (427), Expect = 1e-40
 Identities = 90/164 (54%), Positives = 110/164 (67%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FDI+I    GK AGRIV+ L  D VP+TAENFRALCTGE         FHRVI  FM
Sbjct: 5   KVFFDITID---GKEAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F+DENF L H G G +SMANAGPNTNGSQFFICT  T W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGNKFEDENFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG+V++G++VV  IE + +  G +   +VVI++CG+L
Sbjct: 122 LDGKHVVFGKVVDGLNVVDAIEKKGSSSG-KCSAKVVIANCGQL 164



>gb:CR382129_1661993 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 367

 Score =  169 bits (427), Expect = 1e-40
 Identities = 89/172 (51%), Positives = 110/172 (63%), Gaps = 7/172 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+F+++IG   GK  G+I   L+ D+VP+TAENFRALCTGE                FH
Sbjct: 5   RVFFEVAIG---GKTIGKIYFELFADKVPKTAENFRALCTGEKGNTQAGIPLHFKGSSFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVIKDFM+Q            +SIYG  F DE F   H  P ++SMANAGPNTNGSQFFI
Sbjct: 62  RVIKDFMVQGGDFTAGNGTGGESIYGEKFPDEAFPYPHDQPFLLSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
            T +TP LDN+HVVFG+++ G  +V+ IE  ET   DRPK+ V I DCGELP
Sbjct: 122 TTTETPHLDNKHVVFGKLLSGKGIVRQIERTETGEQDRPKQPVTIVDCGELP 173



>gb:AY229877_1591321 Populus tremuloides cyclophilin mRNA, complete
           cds.
          Length = 172

 Score =  169 bits (427), Expect = 1e-40
 Identities = 91/171 (53%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +VYFD++IG   G  AGRIV+ L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   KVYFDMTIG---GAPAGRIVMELFADTTPRTAENFRALCTGEKGKVRSGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMAN+GP TNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTEGNGTGGESIYGAKFADENFVKKHTGPGILSMANSGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V+EGM+VVK IE   +  G R  + VV++DCG+L
Sbjct: 122 CTDKTEWLDGKHVVFGRVVEGMNVVKAIEKVGSS-GGRTSRPVVVADCGQL 171



>gb:TVU68269_1401293 Trypanosoma vivax cyclophilin A (cypA) mRNA,
           complete cds.
          Length = 177

 Score =  169 bits (427), Expect = 1e-40
 Identities = 92/167 (55%), Positives = 108/167 (64%), Gaps = 3/167 (1%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +VYFDISIG   G+ AGRI   L+ D VP+TAENFRALCTGE         FHR+I +FM
Sbjct: 15  KVYFDISIG---GQGAGRITFELFADAVPKTAENFRALCTGEKGFGFANSGFHRIIPNFM 71

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLV---HAGPGVVSMANAGPNTNGSQFFICTVK 328
            Q            KSIYG  F+DE+F      H GPG +SMANAGPNTNGSQFFICT +
Sbjct: 72  CQGGDFTNHNGTGGKSIYGAKFEDESFAGKAGKHFGPGTLSMANAGPNTNGSQFFICTAR 131

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFGQV+EGM+VVK +E   +  G    K V I  CG+L
Sbjct: 132 TQWLDGKHVVFGQVLEGMNVVKAVEGVGSQSGS-TTKAVKIDSCGQL 177



>gb:BMU47811_1355691 Brugia malayi cyclophilin Bmcyp-2 mRNA,
           complete cds.
          Length = 171

 Score =  169 bits (427), Expect = 1e-40
 Identities = 92/171 (53%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI+I    G  AGRIV+ L+ D VP+TAENFR LCTGE                FH
Sbjct: 5   KVFFDITID---GSNAGRIVMELFADIVPKTAENFRCLCTGERGMGRSGKKLHYKGSKFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM+Q            +SIYG  F DENF+  H G GV+SMANAGPNTNGSQFFI
Sbjct: 62  RVIPNFMLQGGDFTRGNGTGGQSIYGEKFPDENFQEKHTGLGVLSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVF +V+EGM+VVK +ES+ +  G R    +VISDCG+L
Sbjct: 122 CTAKTEWLDGKHVVFNRVVEGMNVVKAVESKGSQSG-RTSADIVISDCGQL 171



>gb:AY442290_2532577 Bitis gabonica venom gland cyclophilin mRNA,
           partial cds.
          Length = 160

 Score =  168 bits (426), Expect = 1e-40
 Identities = 86/152 (56%), Positives = 102/152 (67%)
 Frame = -2

Query: 642 GKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXX 463
           G+A GRI + L+ D VP+TAENFR L TGE         FHRVI  FM Q          
Sbjct: 9   GQALGRITLELFADTVPKTAENFRVLSTGEKGFGYKGSCFHRVIPGFMCQGGDFTRHNGT 68

Query: 462 XXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVI 283
             KS YG  F DENF L H GPG++SMANAGPNTNGSQFFICT KT WLD +HVVFGQV 
Sbjct: 69  GGKSTYGEKFADENFILKHTGPGILSMANAGPNTNGSQFFICTEKTEWLDGKHVVFGQVR 128

Query: 282 EGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
            GMD+V+ IES  +  G +P K+++ISDCG++
Sbjct: 129 GGMDIVRKIESFGSKNG-KPSKKIIISDCGDM 159



>gb:CR382137_1670320 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 162

 Score =  168 bits (426), Expect = 1e-40
 Identities = 90/165 (54%), Positives = 104/165 (63%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           SQVYFDIS     G   GR+   LY D VP+TAENFRALCTGE         FHRVI  F
Sbjct: 2   SQVYFDISAD---GNKLGRVTFKLYDDVVPKTAENFRALCTGEKGFGYASSTFHRVIPQF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F+DENF   H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 59  MLQGGDFTRGNGTGGKSIYGEKFRDENFVKKHEKPGLLSMANAGPNTNGSQFFITTVTCP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V++G D+VK +ES  +  G   K R+ I   GEL
Sbjct: 119 WLDGKHVVFGEVVDGFDIVKKVESYGSGSG-ATKSRITIDASGEL 162



>gb:AY594335_1431715 Bos taurus cyclophilin F mRNA, complete cds.
          Length = 209

 Score =  168 bits (426), Expect = 1e-40
 Identities = 90/153 (58%), Positives = 99/153 (64%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           VY D+      G+  GR+V+ L  D VP+TAENFRALCTGE         FHRVI  FM 
Sbjct: 49  VYLDVGAD---GQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMC 105

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            KSIYG  F DENFKL H GPGV+SMANAGPNTNGSQFFICT+KT WL
Sbjct: 106 QAGDFTNHNGTGGKSIYGSRFPDENFKLKHEGPGVLSMANAGPNTNGSQFFICTIKTDWL 165

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK 217
           D +HVVFG V EGMDVVK IES  +  G   KK
Sbjct: 166 DGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKK 198



>pir|S07597|CSHYAC peptidylprolyl isomerase (EC 5.2.1.8) A - Chinese
           hamster>gb:CLCYC_2111778 Chinese hamster mRNA for
           cyclophilin.
          Length = 164

 Score =  168 bits (426), Expect = 1e-40
 Identities = 87/167 (52%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDIS     G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDISAD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            +SIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ ISDCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITISDCGQL 164



>sp|P14851|PPIA_CRILO Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein).
          Length = 163

 Score =  168 bits (426), Expect = 1e-40
 Identities = 87/167 (52%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDIS     G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 1   VNPTVFFDISAD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIP 57

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            +SIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 58  GFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 117

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ ISDCG+L
Sbjct: 118 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITISDCGQL 163



>gb:BC059458_2552435 Danio rerio peptidylprolyl isomerase A
           (cyclophilin A), mRNA (cDNA clone IMAGE:4199657),
           partial cds.
          Length = 183

 Score =  168 bits (425), Expect = 2e-40
 Identities = 86/172 (50%), Positives = 109/172 (63%)
 Frame = -2

Query: 702 EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXF 523
           E ++    +V+FD++ G   G   GR+V+ L  D VP+TAENFR LCTG+         F
Sbjct: 16  ESKAMARPKVFFDLTAG---GNPVGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSF 72

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVI  FM Q            KSIYG  F DENF L H G G +SMANAGPNTNGSQFF
Sbjct: 73  HRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFF 132

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           ICT  T WLD +HVVFGQV+EG+DV+K +E   +  G +   +++I+DCG+L
Sbjct: 133 ICTALTSWLDGKHVVFGQVVEGLDVIKKVEGFGSSSG-KTSAKIIIADCGQL 183



>gb:BC049009_2550082 Danio rerio peptidylprolyl isomerase A
           (cyclophilin A), mRNA (cDNA clone IMAGE:5604178),
           partial cds.
          Length = 190

 Score =  168 bits (425), Expect = 2e-40
 Identities = 86/172 (50%), Positives = 109/172 (63%)
 Frame = -2

Query: 702 EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXF 523
           E ++    +V+FD++ G   G   GR+V+ L  D VP+TAENFR LCTG+         F
Sbjct: 23  ESKAMARPKVFFDLTAG---GNPVGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSF 79

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVI  FM Q            KSIYG  F DENF L H G G +SMANAGPNTNGSQFF
Sbjct: 80  HRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFF 139

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           ICT  T WLD +HVVFGQV+EG+DV+K +E   +  G +   +++I+DCG+L
Sbjct: 140 ICTALTSWLDGKHVVFGQVVEGLDVIKKVEGFGSSSG-KTSAKIIIADCGQL 190



>gb:AK003402_1151842 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110004B08
           product:40 KDA PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (EC
           5.2.1.8) (PPIASE) (ROTAMASE) (CYCLOPHILIN-40) (CYP-40)
           (CYCLOPHILIN-RELATED PROTEIN) homolog [Homo sapiens],
           full insert sequence.>gb:AK013919_1157695 Mus musculus
           13 days embryo head cDNA, RIKEN full-length enriched
           library, clone:3100002J09 product:40 KDA PEPTIDYL-PROLYL
           CIS-TRANS ISOMERASE (EC 5.2.1.8) (PPIASE) (ROTAMASE)
           (CYCLOPHILIN-40) (CYP-40) (CYCLOPHILIN-RELATED PROTEIN)
           homolog [Homo sapiens], full insert
           sequence.>gb:AK051597_1169734 Mus musculus 12 days
           embryo spinal ganglion cDNA, RIKEN full-length enriched
           library, clone:D130059D15 product:40 KDA PEPTIDYL-PROLYL
           CIS-TRANS ISOMERASE (EC 5.2.1.8) (PPIASE) (ROTAMASE)
           (CYCLOPHILIN-40) (CYP-40) (CYCLOPHILIN-RELATED PROTEIN)
           homolog [Homo sapiens], full insert
           sequence.>gb:BC011499_2091461 Mus musculus
           peptidylprolyl isomerase D (cyclophilin D), mRNA (cDNA
           clone MGC:6702 IMAGE:3584183), complete
           cds.>gb:BC019778_2093104 Mus musculus peptidylprolyl
           isomerase D (cyclophilin D), mRNA (cDNA clone MGC:25799
           IMAGE:4035785), complete cds.
          Length = 370

 Score =  168 bits (425), Expect = 2e-40
 Identities = 91/181 (50%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE         
Sbjct: 8   AKPSNSKNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGK 64

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 65  PLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAG 124

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
           PNTNGSQFFI TV TP LD +HVVFGQVI+G+ V + +E+ E + G++P K  VI++CGE
Sbjct: 125 PNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARTLENVEVN-GEKPAKLCVIAECGE 183

Query: 189 L 187
           L
Sbjct: 184 L 184



>sp|Q9CR16|PPID_MOUSE 40 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40).
          Length = 369

 Score =  168 bits (425), Expect = 2e-40
 Identities = 91/181 (50%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE         
Sbjct: 7   AKPSNSKNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGK 63

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 64  PLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAG 123

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
           PNTNGSQFFI TV TP LD +HVVFGQVI+G+ V + +E+ E + G++P K  VI++CGE
Sbjct: 124 PNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARTLENVEVN-GEKPAKLCVIAECGE 182

Query: 189 L 187
           L
Sbjct: 183 L 183



>gb:BC068613_2555121 Xenopus laevis hypothetical protein LOC398630,
           mRNA (cDNA clone IMAGE:3400465), partial cds.
          Length = 192

 Score =  167 bits (424), Expect = 3e-40
 Identities = 89/164 (54%), Positives = 109/164 (66%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++     G   GRIV+ L  D VP+TAENFRALCT +         FHR+I +FM
Sbjct: 33  RVFFDVAAD---GCPLGRIVMELRSDVVPKTAENFRALCTHDKGFGFRNSGFHRIIPEFM 89

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H GPG++SMANAG NTNGSQFFICT KT W
Sbjct: 90  CQGGDFTNHNGTGGKSIYGNKFADENFTLKHTGPGILSMANAGANTNGSQFFICTAKTSW 149

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFGQVIEGMDVVK ++   +  G +P K+VVI++ G+L
Sbjct: 150 LDGKHVVFGQVIEGMDVVKTMDRLGSQSG-KPSKKVVITNSGQL 192



>gb:BC054186_2550840 Xenopus laevis hypothetical protein LOC398630,
           mRNA (cDNA clone IMAGE:6876259), partial cds.
          Length = 193

 Score =  167 bits (424), Expect = 3e-40
 Identities = 89/164 (54%), Positives = 109/164 (66%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++     G   GRIV+ L  D VP+TAENFRALCT +         FHR+I +FM
Sbjct: 34  RVFFDVAAD---GCPLGRIVMELRSDVVPKTAENFRALCTHDKGFGFRNSGFHRIIPEFM 90

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H GPG++SMANAG NTNGSQFFICT KT W
Sbjct: 91  CQGGDFTNHNGTGGKSIYGNKFADENFTLKHTGPGILSMANAGANTNGSQFFICTAKTSW 150

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFGQVIEGMDVVK ++   +  G +P K+VVI++ G+L
Sbjct: 151 LDGKHVVFGQVIEGMDVVKTMDRLGSQSG-KPSKKVVITNSGQL 193



>gb:AY646834_2541524 Xenopus laevis cyclophilin A (CypA) mRNA,
           complete cds.
          Length = 164

 Score =  167 bits (424), Expect = 3e-40
 Identities = 89/164 (54%), Positives = 109/164 (66%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++     G   GRIV+ L  D VP+TAENFRALCT +         FHR+I +FM
Sbjct: 5   RVFFDVAAD---GCPLGRIVMELRSDVVPKTAENFRALCTHDKGFGFRNSGFHRIIPEFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H GPG++SMANAG NTNGSQFFICT KT W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGNKFADENFTLKHTGPGILSMANAGANTNGSQFFICTAKTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFGQVIEGMDVVK ++   +  G +P K+VVI++ G+L
Sbjct: 122 LDGKHVVFGQVIEGMDVVKTMDRLGSQSG-KPSKKVVITNSGQL 164



>gb:BC005982_1969983 Homo sapiens peptidylprolyl isomerase A
           (cyclophilin A), transcript variant 1, mRNA (cDNA clone
           MGC:14681 IMAGE:4109260), complete cds.
          Length = 165

 Score =  167 bits (424), Expect = 3e-40
 Identities = 86/167 (51%), Positives = 110/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 164



>gb:AY646200_1958003 Aotus trivirgatus cyclophilin A mRNA, complete
           cds.
          Length = 164

 Score =  167 bits (424), Expect = 3e-40
 Identities = 87/167 (52%), Positives = 110/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICTVK
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTVK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 164



>gb:AY346337_1321667 Branchiostoma belcheri tsingtaunese cyclophilin
           A mRNA, complete cds.
          Length = 164

 Score =  167 bits (424), Expect = 3e-40
 Identities = 87/164 (53%), Positives = 108/164 (65%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FDI+ G   G+  GR+V+ L  D  P+TAENFRALCTGE         FHRVI  FM
Sbjct: 5   RVFFDITAG---GQPLGRVVMELRADVAPKTAENFRALCTGEKSMGYKGSTFHRVIPGFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L H G G++SMANAGPNTNGSQFF+CT KT W
Sbjct: 62  CQGGDFIRGDGTGGKSIYGNKFADENFQLKHTGKGILSMANAGPNTNGSQFFLCTAKTDW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG V+EGMDVV  +ES  +  G +   ++VI++ G+L
Sbjct: 122 LDGKHVVFGSVVEGMDVVTKVESYGSGNG-KTSAKIVIANSGQL 164



>gb:BC062863_2553452 Danio rerio peptidylprolyl isomerase A
           (cyclophilin A), mRNA (cDNA clone IMAGE:7002384),
           partial cds.
          Length = 184

 Score =  167 bits (423), Expect = 3e-40
 Identities = 86/172 (50%), Positives = 109/172 (63%)
 Frame = -2

Query: 702 EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXF 523
           E ++    +V+FD++ G   G   GR+V+ L  D VP+TAENFR LCTG+         F
Sbjct: 17  ESKAMARPKVFFDLTAG---GSPVGRVVMELRTDVVPRTAENFRQLCTGQPGYGYKGSSF 73

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVI  FM Q            KSIYG  F DENF L H G G +SMANAGPNTNGSQFF
Sbjct: 74  HRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFF 133

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           ICT  T WLD +HVVFGQV+EG+DV+K +E   +  G +   +++I+DCG+L
Sbjct: 134 ICTALTSWLDGKHVVFGQVVEGLDVIKKVEGFGSSSG-KTSAKIIIADCGQL 184



>gb:AY652862_1620183 Populus balsamifera subsp. trichocarpa
           peptidyl-prolyl cis-trans isomerase (CYC063) gene,
           complete cds.
          Length = 172

 Score =  167 bits (423), Expect = 3e-40
 Identities = 91/171 (53%), Positives = 109/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +VY D++IG   G  AGRIVI L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   KVYLDMTIG---GVPAGRIVIELFADTTPRTAENFRALCTGEKGKGRSGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  F DENF   H GPG++SMAN+GP TNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANSGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V+EGM+VVK IE   +  G R  + VV++DCG+L
Sbjct: 122 CTDKTEWLDGKHVVFGRVVEGMNVVKAIEKVGSS-GGRTSRPVVVADCGQL 171



>gb:SMU50388_1397865 Schistosoma mansoni cyclophilin A mRNA,
           complete cds.
          Length = 172

 Score =  167 bits (423), Expect = 3e-40
 Identities = 94/170 (55%), Positives = 112/170 (65%)
 Frame = -2

Query: 696 QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHR 517
           Q +   +V+FDI IGN     AGRIV+ L  D VP+TAENFRALCTGE         FHR
Sbjct: 6   QKRNLPRVFFDIRIGNG---DAGRIVMELRSDIVPRTAENFRALCTGERGFGYHNCCFHR 62

Query: 516 VIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC 337
           VI  FM Q            KSIYGR F DEN +L H G GV+SMAN+GPNTNGSQFFIC
Sbjct: 63  VIPQFMCQGGDFVKGDGTGGKSIYGRKFDDENIQLRHEGFGVLSMANSGPNTNGSQFFIC 122

Query: 336 TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T K  WLD +HVVFG+V++G +VVK +ES  +  G + K+ V+IS CGEL
Sbjct: 123 TTKCDWLDGKHVVFGRVVDGQNVVKKMESVGSKSG-KVKEPVIISRCGEL 171



>pir|A46579|A46579 estrogen receptor-binding cyclophilin -
           bovine>gb:BOVCLPL_1435326 Bovine mRNA for cyclophilin,
           complete cds.
          Length = 370

 Score =  167 bits (423), Expect = 3e-40
 Identities = 92/181 (50%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE         
Sbjct: 8   AKPSNPSNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGK 64

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 65  PLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAG 124

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
            NTNGSQFFI TV TP LD +HVVFGQVI+GM V K++E+ E  +G++P K  VI++CGE
Sbjct: 125 SNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV-KGEKPAKLCVIAECGE 183

Query: 189 L 187
           L
Sbjct: 184 L 184



>pir|A29819|CSRTA peptidylprolyl isomerase (EC 5.2.1.8) A -
           rat>gb:BC059141_2103658 Rattus norvegicus peptidylprolyl
           isomerase A, mRNA (cDNA clone MGC:72881 IMAGE:6919594),
           complete cds.>gb:RATCYCA_2131946 Rat cyclophilin mRNA,
           complete cds.>gb:RATP31_2133275 Rat housekeeping protein
           P31 mRNA, complete cds.
          Length = 164

 Score =  167 bits (423), Expect = 3e-40
 Identities = 87/167 (52%), Positives = 108/167 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI+     G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDITAD---GEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM +V+ +E +   R  +  K++ ISDCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMSIVEAME-RFGSRNGKTSKKITISDCGQL 164



>sp|P26882|PPID_BOVIN 40 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40)
           (Cyclophilin-related protein) (Estrogen receptor binding
           cyclophilin).
          Length = 369

 Score =  167 bits (423), Expect = 3e-40
 Identities = 92/181 (50%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE         
Sbjct: 7   AKPSNPSNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGK 63

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 64  PLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAG 123

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
            NTNGSQFFI TV TP LD +HVVFGQVI+GM V K++E+ E  +G++P K  VI++CGE
Sbjct: 124 SNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV-KGEKPAKLCVIAECGE 182

Query: 189 L 187
           L
Sbjct: 183 L 183



>sp|P10111|PPIA_RAT Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein) (P31).
          Length = 163

 Score =  167 bits (423), Expect = 3e-40
 Identities = 87/167 (52%), Positives = 108/167 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI+     G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 1   VNPTVFFDITAD---GEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIP 57

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 58  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 117

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM +V+ +E +   R  +  K++ ISDCG+L
Sbjct: 118 TEWLDGKHVVFGKVKEGMSIVEAME-RFGSRNGKTSKKITISDCGQL 163



>sp|P91791|CYPH_HEMPU Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:S82440_1396994 cyclophilin
           [Hemicentrotus pulcherrimus, early pluteus larva, mRNA,
           1755 nt].
          Length = 164

 Score =  167 bits (423), Expect = 3e-40
 Identities = 87/164 (53%), Positives = 106/164 (64%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           QV+FD+      G+  GRIV+ L  D VP+TAENFRALCTGE         FHRVI  FM
Sbjct: 5   QVFFDLQAN---GENLGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPGFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H  PG++SMANAG NTNGSQFFICT  T W
Sbjct: 62  CQGGDFTRHNGTGGKSIYGEKFADENFTLKHTQPGILSMANAGVNTNGSQFFICTAVTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG V +G+D++K +ES  +D G +  K++ I+DCG+L
Sbjct: 122 LDGKHVVFGAVTQGLDIIKKVESYGSDSG-KTSKKITIADCGQL 164



>gb:AY391452_2531588 Danio rerio 2-peptidylprolyl isomerase A
           (PPIA-2) mRNA, complete cds.
          Length = 164

 Score =  167 bits (422), Expect = 4e-40
 Identities = 85/164 (51%), Positives = 106/164 (64%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++ G   G   GR+V+ L  D VP+TAENFR LCTG+         FHRVI  FM
Sbjct: 5   KVFFDLTAG---GNPVGRVVMELRADVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H G G +SMANAGPNTNGSQFFICT  T W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFGQV+EG+DV+K +E   +  G +   +++I+DCG+L
Sbjct: 122 LDGKHVVFGQVVEGLDVIKKVEGFGSSSG-KTSAKIIIADCGQL 164



>gb:BC076386_2106753 Rattus norvegicus peptidylprolyl isomerase D,
           mRNA (cDNA clone MGC:93768 IMAGE:7108860), complete cds.
          Length = 370

 Score =  167 bits (422), Expect = 4e-40
 Identities = 90/180 (50%), Positives = 116/180 (64%), Gaps = 8/180 (4%)
 Frame = -2

Query: 702 EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX- 526
           +P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE          
Sbjct: 9   KPSNSKNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKP 65

Query: 525 -------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGP 367
                  FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAGP
Sbjct: 66  LHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGP 125

Query: 366 NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           NTNGSQFFI TV TP LD +HVVFGQVI+G+ V +++E+ E + G++P K  VI++CGEL
Sbjct: 126 NTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARMLENVEVN-GEKPAKLCVIAECGEL 184



>gb:CR456707_1992914 Homo sapiens full open reading frame cDNA clone
           RZPDo834F113D for gene PPIA, peptidylprolyl isomerase A
           (cyclophilin A); complete cds, incl. stopcodon.
          Length = 165

 Score =  167 bits (422), Expect = 4e-40
 Identities = 86/167 (51%), Positives = 110/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 164



>gb:AP004741_1844182 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0024N18.
          Length = 396

 Score =  167 bits (422), Expect = 4e-40
 Identities = 94/187 (50%), Positives = 113/187 (60%), Gaps = 8/187 (4%)
 Frame = -2

Query: 720 ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXX 541
           A+A  AE + K   + + D+SIG   G+  GRIVI LY   VP+TAENFRALCTGE    
Sbjct: 14  ASAAAAEVEVK-NPRCFMDVSIG---GEIEGRIVIELYASVVPRTAENFRALCTGEKGVG 69

Query: 540 XXXXXF--------HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVS 385
                         HRVIK FM+Q            +SIYG  F+DENF L H   G++S
Sbjct: 70  AVTGKHLHYKGSCFHRVIKGFMVQGGDITAGDGTGGESIYGLKFEDENFVLKHERKGMLS 129

Query: 384 MANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVI 205
           MAN+GPNTNGSQFFI T +TP LD +HVVFG+VI+GM VV+ +E       DRP   V I
Sbjct: 130 MANSGPNTNGSQFFITTTRTPHLDGKHVVFGRVIKGMGVVRSVEHAPVGEADRPTSDVEI 189

Query: 204 SDCGELP 184
            DCGELP
Sbjct: 190 VDCGELP 196



>gb:AF542516_1810034 Beauveria bassiana cyclophilin A mRNA, complete
           cds.
          Length = 164

 Score =  167 bits (422), Expect = 4e-40
 Identities = 87/163 (53%), Positives = 108/163 (66%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+F++S     G+  G+IV+ L  D VP+TAENFRALCTGE         FHRVI  FM
Sbjct: 5   KVFFEVSAN---GEPLGKIVMELRKDVVPKTAENFRALCTGEKGYGFKGSSFHRVIPGFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L H GPG++SMANAGPNTNGSQFF+CT  T W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGEKFADENFQLKHTGPGILSMANAGPNTNGSQFFLCTATTGW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
           LD +HVVFG+V+EG+DVVK +E   +D G +  K++VI   GE
Sbjct: 122 LDGKHVVFGKVVEGLDVVKKVEKFGSDSG-KTSKKIVIDASGE 163



>gb:AF262982_1781650 Triticum aestivum cyclophilin A-1 (CyP1) mRNA,
           complete cds.>gb:AF262984_1781652 Triticum aestivum
           cyclophilin A-3 (CyP3) mRNA, complete cds.
          Length = 171

 Score =  167 bits (422), Expect = 4e-40
 Identities = 92/171 (53%), Positives = 109/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+++G   G  AGRIV+ LY D VP+T ENFRALCTGE                FH
Sbjct: 5   RVFFDMTVG---GAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSAFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI DFM Q            +SIYG  F DE F   H  PG++SMANAGPNTNGSQFFI
Sbjct: 62  RVIPDFMCQGGDFTRGNGTGGESIYGEKFADEKFVHKHTKPGILSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTV   WLD +HVVFG+V+EGMDVVK IE +   R     K+VVI+DCG+L
Sbjct: 122 CTVPCNWLDGKHVVFGEVVEGMDVVKNIE-KVGSRSGTCSKQVVIADCGQL 171



>gb:AF242312_1780142 Euphorbia esula cyclophilin mRNA, partial cds.
          Length = 160

 Score =  167 bits (422), Expect = 4e-40
 Identities = 89/159 (55%), Positives = 100/159 (62%), Gaps = 7/159 (4%)
 Frame = -2

Query: 642 GKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFHRVIKDFMIQXXX 484
           G   GRIV+ LY D  P+TAENFRALCTGE                FHRVI  FM Q   
Sbjct: 2   GAPVGRIVMELYADTTPRTAENFRALCTGEKGVGRSRKPLHFKGSSFHRVIPGFMCQGGD 61

Query: 483 XXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRH 304
                    +SIYG  F DENF   H GPG++SMANAGP TNGSQFFICT KT WLD +H
Sbjct: 62  FTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLDGKH 121

Query: 303 VVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           VVFG+V+EGMDVVK IE   +  G R  K VV+SDCG+L
Sbjct: 122 VVFGKVVEGMDVVKAIEKVGSSSG-RTSKPVVVSDCGQL 159



>gb:AE016818_1748302 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 188

 Score =  167 bits (422), Expect = 4e-40
 Identities = 93/165 (56%), Positives = 106/165 (64%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           ++V+FD SI    G  AGRI   LY D VP+TAENFRALCTGE         FHR+I DF
Sbjct: 26  TKVFFDTSIN---GAKAGRIEFELYDDVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDF 82

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF   H   G++SMANAG NTNGSQFFI TV  P
Sbjct: 83  MLQGGDTDLTNGFGGKSIYGARFPDENFTKKHTRAGLLSMANAGRNTNGSQFFITTVPCP 142

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V +GMDVVK IES  T  G +P  +VVI D GEL
Sbjct: 143 WLDGKHVVFGEVTKGMDVVKAIESYGTGNG-QPSAKVVIEDAGEL 186



>gb:CR380954_1651241 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 183

 Score =  167 bits (422), Expect = 4e-40
 Identities = 89/169 (52%), Positives = 109/169 (64%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRV 514
           +K+  +VYF+ S+    G   GRI   LY D VP+TAENFRALCTGE         FHR+
Sbjct: 17  AKLGKKVYFEPSVN---GSRIGRIEFELYDDVVPKTAENFRALCTGEKGWGYKGVPFHRI 73

Query: 513 IKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT 334
           I  FMIQ            KSIYG  F DENF   H  PG++SMANAGPNTNGSQFFI T
Sbjct: 74  IPQFMIQGGDTDLTNGFGGKSIYGNKFADENFTKTHDKPGLLSMANAGPNTNGSQFFITT 133

Query: 333 VKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           V  PWLD +HVVFG+V +GMD+VK IES  T  G +P+ ++V+ + GE+
Sbjct: 134 VPCPWLDGKHVVFGEVTKGMDIVKTIESYGTMSG-QPRAKIVVEESGEI 181



>gb:AY456122_1607156 Triticum aestivum cyclophilin A (CYP18-2) gene,
           complete cds.>gb:AF262983_1781651 Triticum aestivum
           cyclophilin A-2 (CyP2) mRNA, complete cds.
          Length = 171

 Score =  167 bits (422), Expect = 4e-40
 Identities = 92/171 (53%), Positives = 109/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+++G   G  AGRIV+ LY D VP+T ENFRALCTGE                FH
Sbjct: 5   RVFFDMTVG---GAPAGRIVMELYKDAVPRTVENFRALCTGEKGVGKSGKPLHYKGSSFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI DFM Q            +SIYG  F DE F   H  PG++SMANAGPNTNGSQFFI
Sbjct: 62  RVIPDFMCQGGDFTKGNGTGGESIYGEKFADEKFVHKHTKPGILSMANAGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CTV   WLD +HVVFG+V+EGMDVVK IE +   R     K+VVI+DCG+L
Sbjct: 122 CTVPCNWLDGKHVVFGEVVEGMDVVKNIE-KVGSRSGTCSKQVVIADCGQL 171



>gb:AB020612_1514551 Vigna radiata mRNA for CYP1, complete cds.
          Length = 172

 Score =  167 bits (422), Expect = 4e-40
 Identities = 89/171 (52%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G+ AG+IV  L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFFDMTIG---GQPAGKIVFELFADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSIFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV+EG++VVK IE   +  G +  + V I+DCG+L
Sbjct: 122 CTTKTEWLDGKHVVFGQVVEGLNVVKEIEKVGSSSG-KTSRPVAIADCGQL 171



>gb:AF222790_1252586 Theileria parva cyclophilin 1 mRNA, complete
           cds.
          Length = 227

 Score =  167 bits (422), Expect = 4e-40
 Identities = 90/176 (51%), Positives = 111/176 (63%), Gaps = 5/176 (2%)
 Frame = -2

Query: 699 PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXX-----XXX 535
           P+     +VYFD+++G   G  AGR+V  L+ D VP+TAENFRALCTGE           
Sbjct: 56  PEMSKRPRVYFDLTVG---GAKAGRVVFELFSDVVPKTAENFRALCTGEKSTPGNPLHYK 112

Query: 534 XXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNG 355
              FHRVI  F  Q            KSIYG  F+DENF L H  P ++SMANAGPNTNG
Sbjct: 113 GSTFHRVIPHFTCQGGDFTNHNGTGGKSIYGAKFEDENFTLKHDRPFLLSMANAGPNTNG 172

Query: 354 SQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           SQFF+ TV T WLD +HVVFG+V+EG DVV+ +E+  T  G +P K VV+ DCG+L
Sbjct: 173 SQFFVTTVVTQWLDGKHVVFGEVVEGKDVVRAVEAVGTQSG-KPTKPVVVEDCGQL 227



>gb:AF158368_1246025 Leishmania donovani cyclophilin (CYP) gene,
           complete cds.
          Length = 187

 Score =  167 bits (422), Expect = 4e-40
 Identities = 94/173 (54%), Positives = 111/173 (64%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           AEP+  VT++VYFD+ I +   +  GRI IGL+G + P T ENFR LCTGE         
Sbjct: 21  AEPE--VTAKVYFDVMIDS---EPLGRITIGLFGKDAPLTTENFRQLCTGEHGFGYKDSI 75

Query: 525 FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF 346
           FHRVI++FMIQ            KSIYG  F DEN  + H   G +SMANAGPNTNGSQF
Sbjct: 76  FHRVIQNFMIQGGDFTNFDGTGGKSIYGEKFADENLNVKHF-VGALSMANAGPNTNGSQF 134

Query: 345 FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FI T  TPWLD RHVVFG+V++GMDVV  IE  +T+  DRP K V I   GEL
Sbjct: 135 FITTAPTPWLDGRHVVFGKVLDGMDVVLRIEKTKTNSHDRPVKPVKIVASGEL 187



>gb:AF121347_1242874 Dictyostelium discoideum cyclophilin D (cypD)
           mRNA, nuclear gene encoding mitochondrial protein,
           complete cds.
          Length = 174

 Score =  167 bits (422), Expect = 4e-40
 Identities = 91/174 (52%), Positives = 110/174 (63%), Gaps = 7/174 (4%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------X 529
           + ++V+F I  GN      GR+V  LY D VP+TAENFRALCTGE               
Sbjct: 5   IRNKVFFQIKQGNT---PLGRVVFELYNDIVPKTAENFRALCTGEKGIGKSGKPLHYKGS 61

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVIK+FM+Q            +SIYGRTF DENF + H   G +SMANAG NTNGSQ
Sbjct: 62  SFHRVIKNFMVQGGDFTHGTGIGGESIYGRTFNDENFLVKHK-IGCLSMANAGKNTNGSQ 120

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFI T +TP L+  H VFG+V+EG D+VK +E+ ETDR DRPK   VI DCG+L
Sbjct: 121 FFITTAETPHLNGGHTVFGEVVEGFDIVKKVENAETDRSDRPKAACVIEDCGQL 174



>pir|A94496|CSHUA peptidylprolyl isomerase (EC 5.2.1.8) A -
           human>gb:AX134743_1461837 Sequence 26 from Patent
           WO0132876.>gb:AF023859_1877161 Papio hamadryas
           cyclophilin A mRNA, complete cds.>gb:AF023860_1877162
           Cercopithecus aethiops cyclophilin A mRNA, complete
           cds.>gb:AF023861_1877163 Macaca mulatta cyclophilin A
           mRNA, complete cds.>gb:AY739283_1961585 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A) (PPIA) gene,
           complete cds.>gb:BC000689_1966945 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:2351 IMAGE:3349335),
           complete cds.>gb:BC003026_1968622 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:4203 IMAGE:2823490),
           complete cds.>gb:BC005320_1969769 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:12404 IMAGE:3935025),
           complete cds.>gb:BC013915_1974257 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:22814 IMAGE:3684721),
           complete cds.>gb:BC073992_1989209 Homo sapiens
           peptidylprolyl isomerase A (cyclophilin A), transcript
           variant 1, mRNA (cDNA clone MGC:87929 IMAGE:6161389),
           complete cds.>gb:HSCPH70_2011629 Human cyclophilin gene
           for cyclophilin (EC 5.2.1.8).>gb:HSCYCR_2011754 Human
           mRNA for T-cell cyclophilin.
          Length = 165

 Score =  167 bits (422), Expect = 4e-40
 Identities = 86/167 (51%), Positives = 110/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 164



>sp|P05092|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein).
          Length = 164

 Score =  167 bits (422), Expect = 4e-40
 Identities = 86/167 (51%), Positives = 110/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 1   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 57

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 58  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 117

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 118 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 163



>gb:AB002814_1192815 Tachypleus tridentatus mRNA for cyclophilin G,
           complete cds.
          Length = 220

 Score =  166 bits (421), Expect = 6e-40
 Identities = 94/188 (50%), Positives = 114/188 (60%), Gaps = 8/188 (4%)
 Frame = -2

Query: 720 ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT------ 559
           AT +      KVT  VYFDI+IG   GK AGRI IGL+G  VP+T +NF    T      
Sbjct: 23  ATTEKKPKGPKVTDIVYFDITIG---GKPAGRIEIGLFGKTVPKTVKNFVETATKHLTEK 79

Query: 558 --GEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVS 385
              +         FHR+I DFMIQ            +SIYG  F DENFKL H G G +S
Sbjct: 80  SEDDKLVGYKGSIFHRIINDFMIQGGDFTKGDGTGGRSIYGERFPDENFKLKHYGAGWLS 139

Query: 384 MANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVI 205
           MANAG +TNGSQFFI   KT WLD +HVVFG+V++GM VV+ IES +TD  D+P K VVI
Sbjct: 140 MANAGKDTNGSQFFITCKKTSWLDGKHVVFGKVVKGMSVVRKIESTKTDSRDKPVKDVVI 199

Query: 204 SDCGELPI 181
           +D G +P+
Sbjct: 200 ADSGTIPV 207



>gb:AF139893_1414924 Oryctolagus cuniculus cyclophilin 18 mRNA,
           complete cds.
          Length = 164

 Score =  166 bits (420), Expect = 7e-40
 Identities = 85/167 (50%), Positives = 110/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFLLKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM +V+ +E   ++ G +  K++ I++CG+L
Sbjct: 119 TEWLDGKHVVFGRVKEGMSIVEAMEHFGSENG-KTSKKITIANCGQL 164



>sp|P35627|CYP2_ARATH Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>pir|S22496|S22496 peptidylprolyl
           isomerase (EC 5.2.1.8) - Arabidopsis
           thaliana>gb:ATCYCP_1548038 A.thaliana mRNA for
           cyclophilin-like protein.
          Length = 169

 Score =  166 bits (420), Expect = 7e-40
 Identities = 91/169 (53%), Positives = 112/169 (66%), Gaps = 7/169 (4%)
 Frame = -2

Query: 672 YFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXX-------XXXXXXFHRV 514
           +FD++IG   G+ AGRI++ L+ D VP+TAENFRALCTGE                FHRV
Sbjct: 5   FFDMTIG---GQPAGRIIMELFPD-VPKTAENFRALCTGEKGIGPSGKKMTYEGSVFHRV 60

Query: 513 IKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT 334
           I  FM+Q            +SIYG  F DENF   H  PG++SMANAGP TNGSQFFI T
Sbjct: 61  IPKFMLQGGDFTLGNGRGGESIYGAKFADENFIHKHTTPGLLSMANAGPGTNGSQFFITT 120

Query: 333 VKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           V TP LD +HVVFG+V+EGMDVV+ IE+ +TDRGD+P   V I+ CG+L
Sbjct: 121 VATPHLDGKHVVFGKVVEGMDVVRKIEATQTDRGDKPLSEVKIAKCGQL 169



>gb:BC071388_2556129 Danio rerio zgc:86711, mRNA (cDNA clone
           MGC:86711 IMAGE:6896868), complete cds.
          Length = 371

 Score =  166 bits (419), Expect = 1e-39
 Identities = 91/180 (50%), Positives = 114/180 (63%), Gaps = 8/180 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG    +  GR+V  L+ D VP+TAENFRALCTGE         
Sbjct: 8   AKPGNAENPRVFFDVEIG---AERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGK 64

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 65  PLHFKGCPFHRIIKSFMIQGGDFSNQNGTGGESIYGDKFEDENFHYKHDREGLLSMANAG 124

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
           PNTNGSQFFI TV TP LD +HVVFGQV++GM VVK++E+ ET + D P K  VI++CGE
Sbjct: 125 PNTNGSQFFITTVPTPHLDGKHVVFGQVLKGMGVVKMLEAMET-KEDNPVKPCVIAECGE 183



>gb:BC041536_2547984 Xenopus laevis CYcloPhilin (18.4 kD) (cyp-7),
           mRNA (cDNA clone MGC:53254 IMAGE:5543670), complete cds.
          Length = 164

 Score =  166 bits (419), Expect = 1e-39
 Identities = 86/164 (52%), Positives = 108/164 (65%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FDI+         GRI++ L  D VP+TAENFRALCT E         FHR+I  FM
Sbjct: 5   RVFFDIAANEC---PMGRIIMELRSDVVPRTAENFRALCTHEKGYGYKNSGFHRIIPSFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H GPG++SMANAG NTNGSQFFICT KT W
Sbjct: 62  CQGGDFTNHNGTGGKSIYGEKFADENFTLKHTGPGILSMANAGSNTNGSQFFICTAKTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG+V+EGMD+V+ ++   +  G +P K+VVI++CG+L
Sbjct: 122 LDGKHVVFGRVVEGMDIVENLDRLGSQSG-KPSKKVVITNCGQL 164



>gb:SCMCLCLPHN_1397186 Schistosoma japonicum (blood fluke)
           cyclophilin mRNA, 3' end.
          Length = 179

 Score =  166 bits (419), Expect = 1e-39
 Identities = 93/170 (54%), Positives = 111/170 (65%)
 Frame = -2

Query: 696 QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHR 517
           Q +   +V+FDI IGN      GRIV+ L  D VP+TAENFRALCTG+         FHR
Sbjct: 13  QKRNLPRVFFDIRIGNA---DRGRIVMELRSDIVPRTAENFRALCTGDRGFGYHNCCFHR 69

Query: 516 VIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC 337
           VI  FM Q            KSIYGR F DENF+L H G GV+SMAN+GPNTNGSQFFIC
Sbjct: 70  VIPQFMCQGGDFVKGDGTGGKSIYGRKFDDENFQLRHEGFGVLSMANSGPNTNGSQFFIC 129

Query: 336 TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T K  WLD +HVVFG+V++G +VVK +ES  +  G + K+ V IS CGEL
Sbjct: 130 TTKCDWLDGKHVVFGRVVDGQNVVKKMESVGSKSG-KVKEPVTISRCGEL 178



>gb:LRU238310_1389050 Lumbricus rubellus mRNA for cyclophilin A.
          Length = 164

 Score =  166 bits (419), Expect = 1e-39
 Identities = 89/164 (54%), Positives = 112/164 (68%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FDI+IG   G A GRI++ L  D VP+TAENFRAL TGE         FHRVI  FM
Sbjct: 5   KVFFDITIG---GNATGRIIMELRSDVVPKTAENFRALSTGEKGFGFKGSKFHRVIPKFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F+DENF L H G G +SMANAGPNTNGSQFFICT +T W
Sbjct: 62  CQGGDFTKGDGTGGKSIYGEKFQDENFTLKHQGEGTLSMANAGPNTNGSQFFICTGQTSW 121

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           LD +HVVFG+V+EG+DVVK +E+  ++ G + K+ V+I++ G+L
Sbjct: 122 LDGKHVVFGRVVEGLDVVKKMEAVGSESG-KTKQPVLIANSGQL 164



>gb:AF025804_1234141 Drosophila subobscura cyclophilin 1 (Cyp1)
           mRNA, partial cds.
          Length = 157

 Score =  166 bits (419), Expect = 1e-39
 Identities = 86/154 (55%), Positives = 104/154 (67%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++     G+  GRI++ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 6   RVFFDMTAD---GEPLGRIIMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 62

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L H G G++SMANAG NTNGSQFFICTVKT W
Sbjct: 63  CQGGDFTNHNGTGGKSIYGNKFADENFQLKHTGTGILSMANAGANTNGSQFFICTVKTAW 122

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK 217
           LDN+HVVFG+V+EG+D+VK IES  +  G   KK
Sbjct: 123 LDNKHVVFGEVVEGLDIVKKIESFGSQSGKTSKK 156



>sp|P18253|CYPH_SCHPO Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein) (CPH).>pir|S11212|CSZPA
           peptidylprolyl isomerase (EC 5.2.1.8) A - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPBC28F2_1719706 S.pombe
           chromosome II cosmid c28F2.>gb:SPPPCTI_1721997
           Schizosaccharomyces pombe gene for cyclophilin
           (peptidyl-prolyl cis-trans
           isomerase).>gb:YSP972HA_1731014 Fission yeast DNA for
           ISP4, peptidyl-prolyl cis-trans isomerase, atf1,
           chromosome II cosmid 1228 sequence.
          Length = 162

 Score =  166 bits (419), Expect = 1e-39
 Identities = 91/163 (55%), Positives = 106/163 (65%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           S  +FD+ I N  G+  GRIV  L+ D VP+TA NFRALCTGE         FHRVI  F
Sbjct: 2   SNCFFDV-IAN--GQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIPQF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF L H  PG++SMANAGPNTNGSQFFI TV TP
Sbjct: 59  MLQGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           WLD +HVVFG+V EGMDVVK +ES  ++ G   + R+VI  CG
Sbjct: 119 WLDGKHVVFGEVTEGMDVVKKVESLGSNSG-ATRARIVIDKCG 160



>gb:AP003621_1831596 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003634_1831848 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0655A07.
          Length = 208

 Score =  165 bits (418), Expect = 1e-39
 Identities = 99/196 (50%), Positives = 125/196 (63%), Gaps = 13/196 (6%)
 Frame = -2

Query: 735 LAPVRAT---AQVAEPQS---KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF 574
           LA V AT   AQ  E ++   KVT++V+FDI+I    GK AGRIV+GL+G+ VP+TAENF
Sbjct: 16  LALVAATLSLAQAVESEAELTKVTTKVFFDITIN---GKPAGRIVMGLFGNTVPKTAENF 72

Query: 573 RALCTGEXXXXXXX-------XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFK 415
           RA+CTGE                FHR+I  FMIQ             SIYG  F DENFK
Sbjct: 73  RAICTGEKGLGKSGKPLSYKGTPFHRIIPGFMIQGGDTVSGNGTGCDSIYGGMFPDENFK 132

Query: 414 LVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDR 235
           + H+ PG++SMAN   +TNGSQFFI TVK   LD +HVVFG+V+ GMDVV  IE++ +  
Sbjct: 133 INHSAPGLLSMANYAKDTNGSQFFITTVKLTRLDGKHVVFGKVLSGMDVVYKIEAEGSQS 192

Query: 234 GDRPKKRVVISDCGEL 187
           G  P+ +V+ISD GEL
Sbjct: 193 G-TPRSKVLISDSGEL 207



>gb:AE016820_1749778 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 162

 Score =  165 bits (418), Expect = 1e-39
 Identities = 91/165 (55%), Positives = 106/165 (64%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           S+V+FD+      G+  GRIV  LY D  P+TAENFRALCTGE         FHRVI DF
Sbjct: 2   SKVFFDVEAD---GQPLGRIVFQLYNDVTPKTAENFRALCTGEKGFGYAGCPFHRVIPDF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF   H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 59  MLQGGDFTHGTGVGGKSIYGGKFPDENFVKKHEKPGLLSMANAGPNTNGSQFFITTVPCP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WL+ +HVVFG+V EGMDVVK +ES  +  G   + R+VIS  GEL
Sbjct: 119 WLNGKHVVFGEVSEGMDVVKKVESMGSSSG-ATRARIVISKSGEL 162



>gb:CR382122_1654998 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 192

 Score =  165 bits (418), Expect = 1e-39
 Identities = 89/165 (53%), Positives = 107/165 (64%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           ++V+FD SI    G    RI   LY D VP+TAENFRALCTGE         FHR+I +F
Sbjct: 30  TKVFFDTSIN---GNKMDRIEFELYDDIVPKTAENFRALCTGEKGFGYKGVPFHRIIPNF 86

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF+  H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 87  MLQGGDTDLTNGYGGKSIYGNKFADENFQEKHTKPGLLSMANAGPNTNGSQFFITTVPCP 146

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V +G+  VK IES  T  G RP+ ++VI +CGEL
Sbjct: 147 WLDGKHVVFGEVTDGLSTVKTIESFGTVSG-RPRAKIVIEECGEL 190



>gb:CR380954_1651124 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 205

 Score =  165 bits (418), Expect = 1e-39
 Identities = 95/174 (54%), Positives = 112/174 (64%), Gaps = 1/174 (0%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC-TGEXXXXXXXX 529
           A  + +VT +VYFDI      G + GRIVIGLYG  VP+T ENF  L  + +        
Sbjct: 18  AAVKPEVTHKVYFDIEHD---GVSKGRIVIGLYGKIVPKTVENFYELSISDDSNMGYLGS 74

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVI  FMIQ            KSIYG TF DENF L H  PG++SMAN G +TNGSQ
Sbjct: 75  IFHRVIPQFMIQGGDFTHGTGIGGKSIYGSTFPDENFDLKHDRPGLLSMANRGKDTNGSQ 134

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFI TV TPWLD RHVVFG+V+EGMDVV  IE+ +T+  +RP K VVI+D GEL
Sbjct: 135 FFITTVATPWLDGRHVVFGEVLEGMDVVTYIENVKTNAQNRPLKDVVIADSGEL 188



>gb:CR380951_1649984 Candida glabrata strain CBS138 chromosome E
           complete sequence.
          Length = 162

 Score =  165 bits (418), Expect = 1e-39
 Identities = 90/165 (54%), Positives = 105/165 (63%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           S+VYFDI      G+  GR+V  LY D VP+TA NFRALCTGE         FHRVI DF
Sbjct: 2   SKVYFDIEAD---GQPLGRVVFQLYDDVVPKTAANFRALCTGEKGFGYAGSPFHRVIPDF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF   H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 59  MLQGGDFTAGNGTGGKSIYGGKFPDENFVKRHERPGLLSMANAGPNTNGSQFFITTVPCP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V EG DVVK +ES  +  G   + R+++S  GEL
Sbjct: 119 WLDGKHVVFGEVSEGYDVVKKVESMGSSSG-ATRARIIVSKSGEL 162



>gb:AY266299_1428139 Sus scrofa peptidyl-prolyl cis-trans isomerase
           A mRNA, complete cds.
          Length = 164

 Score =  165 bits (418), Expect = 1e-39
 Identities = 85/167 (50%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG++
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQI 164



>gb:AK010649_1155910 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2410041G18
           product:peptidylprolyl isomerase A, full insert
           sequence.
          Length = 164

 Score =  165 bits (418), Expect = 1e-39
 Identities = 85/167 (50%), Positives = 108/167 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI+      +  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDITANE---EPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            +SIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ ISDCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITISDCGQL 164



>pir|S10327|CSMSA peptidylprolyl isomerase (EC 5.2.1.8) A -
           mouse>gb:AK002236_1151065 Mus musculus adult male kidney
           cDNA, RIKEN full-length enriched library,
           clone:0610006E04 product:peptidylprolyl isomerase A,
           full insert sequence.>gb:AK007981_1154312 Mus musculus
           10 day old male pancreas cDNA, RIKEN full-length
           enriched library, clone:1810074A10
           product:peptidylprolyl isomerase A, full insert
           sequence.>gb:AK012531_1157011 Mus musculus 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700078G16 product:peptidylprolyl
           isomerase A, full insert sequence.>gb:AK012663_1157089
           Mus musculus 10, 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2810003N04
           product:peptidylprolyl isomerase A, full insert
           sequence.>gb:AK028210_1160860 Mus musculus 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700098C05 product:peptidylprolyl
           isomerase A, full insert sequence.>gb:AF022115_1877060
           Homo sapiens cyclophilin mRNA, complete
           cds.>gb:AL607152_2071522 Mouse DNA sequence from clone
           RP23-198N14 on chromosome 11, complete
           sequence.>gb:BC083076_2108492 Mus musculus
           peptidylprolyl isomerase A, mRNA (cDNA clone MGC:103198
           IMAGE:6442005), complete cds.>gb:BC087928_2110257 Mus
           musculus peptidylprolyl isomerase A, mRNA (cDNA clone
           MGC:107289 IMAGE:6533710), complete
           cds.>gb:MMCYCM_2114673 Mouse mRNA for cyclophilin (EC
           5.2.1.8).>gb:BC082162_2562518 Xenopus laevis
           hypothetical LOC494607, mRNA (cDNA clone MGC:98498
           IMAGE:7198636), complete cds.
          Length = 164

 Score =  165 bits (418), Expect = 1e-39
 Identities = 85/167 (50%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI+  +   +  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDITADD---EPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            +SIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ ISDCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITISDCGQL 164



>sp|P17742|PPIA_MOUSE Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein) (SP18).
          Length = 163

 Score =  165 bits (418), Expect = 1e-39
 Identities = 85/167 (50%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI+  +   +  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 1   VNPTVFFDITADD---EPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIP 57

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            +SIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 58  GFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 117

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ ISDCG+L
Sbjct: 118 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITISDCGQL 163



>sp|P04374|PPIA_BOVIN Peptidyl-prolyl cis-trans isomerase A (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin A)
           (Cyclosporin A-binding protein).>pir|A01852|CSBOAB
           peptidylprolyl isomerase (EC 5.2.1.8) A -
           bovine>pir|S02172|CSPGA peptidylprolyl isomerase (EC
           5.2.1.8) A - pig
          Length = 163

 Score =  165 bits (418), Expect = 1e-39
 Identities = 85/167 (50%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 1   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 57

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 58  GFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 117

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG++
Sbjct: 118 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQI 163



>gb:AP006618_560249 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 197

 Score =  165 bits (417), Expect = 2e-39
 Identities = 94/183 (51%), Positives = 111/183 (60%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           LAP   TA  A   +    +VY D++IG   G  AGR+VI L  D VP+TAENFRAL TG
Sbjct: 21  LAPGPLTAPQAHADA--LPRVYLDLTIG---GAPAGRVVIELRSDVVPRTAENFRALATG 75

Query: 555 EXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMAN 376
           E          HRVI  FM Q             SIYG  F DENF+L HAGPGVVSMAN
Sbjct: 76  EQGFGYRGSTLHRVIPGFMAQGGDFTHGDGTGGHSIYGPVFADENFQLPHAGPGVVSMAN 135

Query: 375 AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC 196
            GP TNGSQFFI    TPWLD +HVVFG V+EGMDVV+ + +  +D G    + VV++D 
Sbjct: 136 RGPGTNGSQFFITLDATPWLDGKHVVFGTVVEGMDVVQAVAATGSDTG-ATTQPVVVADS 194

Query: 195 GEL 187
           G+L
Sbjct: 195 GQL 197



>gb:CR542081_1994307 Homo sapiens full open reading frame cDNA clone
           RZPDo834G1236D for gene PPID, peptidylprolyl isomerase D
           (cyclophilin D); complete cds, incl. stopcodon.
          Length = 370

 Score =  164 bits (416), Expect = 2e-39
 Identities = 90/181 (49%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE         
Sbjct: 8   AKPSNPSNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGK 64

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 65  PLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAG 124

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
            NTNGSQFFI TV TP LD +HVVFGQVI+G+ V +++E+ E  +G++P K  VI++CGE
Sbjct: 125 RNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEV-KGEKPAKLCVIAECGE 183

Query: 189 L 187
           L
Sbjct: 184 L 184



>gb:AY684994_1958784 Aotus trivirgatus TRIM5/cyclophilin A V4 fusion
           protein mRNA, complete cds.
          Length = 474

 Score =  164 bits (416), Expect = 2e-39
 Identities = 87/167 (52%), Positives = 108/167 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 312 VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 368

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 369 GFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 428

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM+VV+ +E      G +  K++ I+DCG+L
Sbjct: 429 TEWLDGKHVVFGKVKEGMNVVEAMERFGCRYG-KTSKKITIADCGQL 474



>gb:AY646199_1958002 Aotus trivirgatus TRIM5/cyclophilin A fusion
           protein gene, partial cds.
          Length = 200

 Score =  164 bits (416), Expect = 2e-39
 Identities = 87/167 (52%), Positives = 108/167 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 38  VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 94

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 95  GFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 154

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM+VV+ +E      G +  K++ I+DCG+L
Sbjct: 155 TEWLDGKHVVFGKVKEGMNVVEAMERFGCRYG-KTSKKITIADCGQL 200



>gb:AY646198_1958001 Aotus trivirgatus TRIM5/cyclophilin A fusion
           protein mRNA, complete cds.
          Length = 474

 Score =  164 bits (416), Expect = 2e-39
 Identities = 87/167 (52%), Positives = 108/167 (64%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 312 VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 368

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 369 GFMCQGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 428

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM+VV+ +E      G +  K++ I+DCG+L
Sbjct: 429 TEWLDGKHVVFGKVKEGMNVVEAMERFGCRYG-KTSKKITIADCGQL 474



>gb:AF252388_1893057 Macaca mulatta cyclophilin mRNA, partial cds.
          Length = 158

 Score =  164 bits (416), Expect = 2e-39
 Identities = 87/149 (58%), Positives = 97/149 (65%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           VY D+      G+  GR+V+ L  D VP+TAENFRALCTGE         FHRVI  FM 
Sbjct: 11  VYLDVGAD---GQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMC 67

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            KSIYG  F DENF L H GPGV+SMANAGPNTNGSQFFICT+KT WL
Sbjct: 68  QAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWL 127

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGD 229
           D +HVVFG V EGMDVVK IES  +  G+
Sbjct: 128 DGKHVVFGHVKEGMDVVKKIESFGSKSGE 156



>gb:CR382133_1666890 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 370

 Score =  164 bits (416), Expect = 2e-39
 Identities = 88/173 (50%), Positives = 109/173 (63%), Gaps = 8/173 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX--------XXF 523
           +V+FDIS     GK  GR+V  LY D VP+TAENFRALCTGE                 F
Sbjct: 9   KVFFDISAD---GKPKGRVVFELYNDVVPKTAENFRALCTGEKGASESSGKQLHYKGSIF 65

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HR+IKDFM Q            +SIYG  F+DENF+L H  P ++SMANAG NTNGSQFF
Sbjct: 66  HRIIKDFMCQGGDFTHGSGIGGESIYGEKFEDENFQLTHDKPFLLSMANAGANTNGSQFF 125

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
           I TV TP L+ +HVVFG+VI+G  +V+ +E  +    D+P +  +ISDCGELP
Sbjct: 126 ITTVPTPHLNGKHVVFGEVIQGKSIVRQLERCDKGENDKPVEDWIISDCGELP 178



>gb:AY029366_1424135 Felis catus cyclophilin A (cypA) mRNA, complete
           cds.
          Length = 164

 Score =  164 bits (416), Expect = 2e-39
 Identities = 84/163 (51%), Positives = 107/163 (65%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMI 496
           V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I  FM 
Sbjct: 6   VFFDIAVD---GEPLGRVSFDLFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMC 62

Query: 495 QXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL 316
           Q            KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICT KT WL
Sbjct: 63  QGGDFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWL 122

Query: 315 DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           D +HVVFG V EGM++V+ +E +   R  +  K++ I+DCG++
Sbjct: 123 DGKHVVFGMVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQI 164



>gb:AF025803_1234140 Drosophila pseudoobscura cyclophilin 1 (Cyp1)
           mRNA, partial cds.
          Length = 157

 Score =  164 bits (416), Expect = 2e-39
 Identities = 86/154 (55%), Positives = 103/154 (66%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++     G+  GRI++ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 6   RVFFDMTAD---GEPLGRIIMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 62

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF L H G G++SMANAG NTNGSQFFICTVKT W
Sbjct: 63  CQGGDFTNHNGTGGKSIYGNKFPDENFLLKHTGTGILSMANAGANTNGSQFFICTVKTAW 122

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK 217
           LDN+HVVFG+V+EG+D+VK IES  +  G   KK
Sbjct: 123 LDNKHVVFGEVVEGLDIVKKIESFGSQSGKTSKK 156



>gb:CR859672_1183778 Pongo pygmaeus mRNA; cDNA DKFZp459I0834 (from
           clone DKFZp459I0834).
          Length = 165

 Score =  164 bits (416), Expect = 2e-39
 Identities = 85/167 (50%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+ DI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFLDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 164



>pir|A45981|A45981 peptidylprolyl isomerase (EC 5.2.1.8) CyP-40 -
           human>gb:AY714221_1960067 Homo sapiens peptidylprolyl
           isomerase D (cyclophilin D) (PPID) gene, complete
           cds.>gb:BC030707_1979929 Homo sapiens peptidylprolyl
           isomerase D (cyclophilin D), mRNA (cDNA clone MGC:33096
           IMAGE:4819748), complete cds.>gb:D63861_1994837 Homo
           sapiens DNA for cyclophilin 40, complete
           cds.>gb:HUMCYC40A_2030399 Human cyclophilin-40 mRNA,
           complete cds.
          Length = 370

 Score =  164 bits (416), Expect = 2e-39
 Identities = 90/181 (49%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE         
Sbjct: 8   AKPSNPSNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGK 64

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 65  PLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAG 124

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
            NTNGSQFFI TV TP LD +HVVFGQVI+G+ V +++E+ E  +G++P K  VI++CGE
Sbjct: 125 RNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEV-KGEKPAKLCVIAECGE 183

Query: 189 L 187
           L
Sbjct: 184 L 184



>sp|Q08752|PPID_HUMAN 40 kDa peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40)
           (Cyclophilin-related protein).
          Length = 369

 Score =  164 bits (416), Expect = 2e-39
 Identities = 90/181 (49%), Positives = 116/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query: 705 AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX 526
           A+P +    +V+FD+ IG   G+  GRIV+ L+ D VP+TAENFRALCTGE         
Sbjct: 7   AKPSNPSNPRVFFDVDIG---GERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGK 63

Query: 525 --------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAG 370
                   FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANAG
Sbjct: 64  PLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAG 123

Query: 369 PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE 190
            NTNGSQFFI TV TP LD +HVVFGQVI+G+ V +++E+ E  +G++P K  VI++CGE
Sbjct: 124 RNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEV-KGEKPAKLCVIAECGE 182

Query: 189 L 187
           L
Sbjct: 183 L 183



>gb:AX887972_1483425 Sequence 3835 from Patent EP1033401.
          Length = 165

 Score =  164 bits (415), Expect = 3e-39
 Identities = 85/167 (50%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GP ++SMANAGPNTNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPXILSMANAGPNTNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 164



>gb:AY232025_1177318 Drosophila yakuba clone yak-ad_Cyp1 mRNA
           sequence.
          Length = 152

 Score =  164 bits (415), Expect = 3e-39
 Identities = 85/149 (57%), Positives = 102/149 (68%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD++  N   +  GRI++ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 6   RVFFDMTADN---EPLGRIIMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFM 62

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            KSIYG  F DENF+L H G G++SMANAG NTNGSQFFICTVKT W
Sbjct: 63  CQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAW 122

Query: 318 LDNRHVVFGQVIEGMDVVKLIESQETDRG 232
           LDN+HVVFG+V+EG+DVVK IES  +  G
Sbjct: 123 LDNKHVVFGEVVEGLDVVKKIESYGSQSG 151



>pir|T50770|T50770 peptidylprolyl isomerase (EC 5.2.1.8) vcCyP
           [similarity] - fava bean>gb:AB012947_1511974 Vicia faba
           vcCyP mRNA, complete cds.
          Length = 171

 Score =  164 bits (415), Expect = 3e-39
 Identities = 87/171 (50%), Positives = 111/171 (64%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+++G   G+ AGRI+  L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFFDMTVG---GQNAGRIIFELFADVTPRTAENFRALCTGEKGVGRSGKPLHFKGSSFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI +FM Q            +SIYG  F DENF   H GPG++SMANAGP TNGSQFFI
Sbjct: 62  RVIPNFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV++G++VV+ IE   +  G +  K VVI++CG+L
Sbjct: 122 CTAKTDWLDGKHVVFGQVVDGLNVVRDIEKVGSGSG-KTSKPVVIANCGQL 171



>pir|S48018|S48018 peptidylprolyl isomerase (EC 5.2.1.8) Cyp1 -
           rice>gb:RICCYP1R_1703596 Oryza sativa cyclophilin 1
           (Cyp1) mRNA, complete cds.>gb:AP006162_1861130 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           9, BAC clone:B1331F11.
          Length = 179

 Score =  164 bits (415), Expect = 3e-39
 Identities = 88/171 (51%), Positives = 109/171 (63%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI IG      AGR+V+ L+ D VP+TAENFR LCTGE                FH
Sbjct: 7   KVFFDILIGKA---RAGRVVMELFADTVPKTAENFRCLCTGEKGLGASGKPLHYKGSAFH 63

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I +FM Q            +SIYG  F DENFKL H GPGV+SMANAGPNTNGSQFFI
Sbjct: 64  RIIPNFMCQGGDFTRGNGTGGESIYGDRFADENFKLRHTGPGVLSMANAGPNTNGSQFFI 123

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT +T WLD +HVVFG+V++G  VV+ +E   +  G    +RV+I DCG+L
Sbjct: 124 CTTRTTWLDGKHVVFGKVVDGYTVVEKMEQVGSGSGG-TAERVLIEDCGQL 173



>gb:XLA496795_2582598 Xenopus laevis partial mRNA for peptidylprolyl
           cis-trans isomerase (cyp gene).
          Length = 157

 Score =  164 bits (414), Expect = 4e-39
 Identities = 82/148 (55%), Positives = 101/148 (68%)
 Frame = -2

Query: 630 GRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKS 451
           GRI++ L  D VP+TAENFRALCT E         FHR+I  FM Q            KS
Sbjct: 11  GRIIMELRSDVVPRTAENFRALCTHEKGYGYKNSGFHRIIPSFMCQGGDFTNHNGTGGKS 70

Query: 450 IYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMD 271
           IYG  F DENF L H GPG++SMANAG NTNGSQFFICT KT WLD +HVVFG+V+EGMD
Sbjct: 71  IYGEKFADENFTLKHTGPGILSMANAGSNTNGSQFFICTAKTSWLDGKHVVFGRVVEGMD 130

Query: 270 VVKLIESQETDRGDRPKKRVVISDCGEL 187
           +V+ ++   +  G +P K+VVI++CG+L
Sbjct: 131 IVENLDRLGSQSG-KPSKKVVITNCGQL 157



>gb:MFU011956_1686054 Malassezia sympodialis mRNA for allergen Mal s
           6, strain ATCC no. 42132.
          Length = 162

 Score =  164 bits (414), Expect = 4e-39
 Identities = 88/163 (53%), Positives = 107/163 (65%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           S V+FDI+     G   G I   L+ D VP+TA NFRALCTGE         FHRVI DF
Sbjct: 2   SNVFFDITKN---GAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF+L H  PG++SMANAGPNTNGSQFFI TV T 
Sbjct: 59  MLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTS 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           WLD +HVVFG+VI+GM+VVK IE++ +  G +P+ R+ I+ CG
Sbjct: 119 WLDGKHVVFGEVIDGMNVVKAIEAEGSGSG-KPRSRIEIAKCG 160



>gb:AY773481_1628186 Amanita muscaria 40 kDa cyclophilin (Cyp40)
           mRNA, complete cds.
          Length = 371

 Score =  164 bits (414), Expect = 4e-39
 Identities = 89/170 (52%), Positives = 108/170 (63%), Gaps = 7/170 (4%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFHR 517
           V+FDI+IG   G+ AGR+   LY D VP+TAENFRALCTGE                FHR
Sbjct: 7   VFFDIAIG---GQLAGRVAFRLYSDLVPKTAENFRALCTGEKGLGQSGKPLWYKGSAFHR 63

Query: 516 VIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC 337
           VIK FM Q            +SIYG  F+DE F + H+ P ++SMANAGPNTNGSQFFI 
Sbjct: 64  VIKGFMCQGGDFTAGNGTGGESIYGEKFEDEGFPVHHSRPFLLSMANAGPNTNGSQFFIT 123

Query: 336 TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
              TP LD +HVVFG+VI+G  VV+ IE+     GD PK+ VVI+DCG+L
Sbjct: 124 VSATPHLDGKHVVFGEVIKGRSVVRTIENNPATNGDVPKEPVVIADCGQL 173



>gb:TBU68270_1399479 Trypanosoma brucei brucei cyclophilin A (cypA)
           mRNA, complete cds.
          Length = 177

 Score =  164 bits (414), Expect = 4e-39
 Identities = 91/167 (54%), Positives = 106/167 (63%), Gaps = 3/167 (1%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +VYFD+SI    G+AAGRI   L+ D VP+TAENFRALCTGE         FHR+I  FM
Sbjct: 15  KVYFDVSIA---GQAAGRITFELFADAVPKTAENFRALCTGEKGFGYAGSGFHRIIPQFM 71

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLV---HAGPGVVSMANAGPNTNGSQFFICTVK 328
            Q            KSIYG  F DE+F      H G G +SMANAGPNTNGSQFFICT  
Sbjct: 72  CQGGDFTRHNGTCGKSIYGEKFPDESFAGKAGKHFGAGTLSMANAGPNTNGSQFFICTAP 131

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFGQV+EGMDVVK +E+  + +G    K V I  CG+L
Sbjct: 132 TQWLDGKHVVFGQVLEGMDVVKAMEAVGS-QGGSTSKPVKIDSCGQL 177



>gb:BC007104_1970526 Homo sapiens peptidylprolyl isomerase A
           (cyclophilin A), transcript variant 1, mRNA (cDNA clone
           MGC:14747 IMAGE:4281376), complete cds.
          Length = 165

 Score =  163 bits (413), Expect = 5e-39
 Identities = 85/167 (50%), Positives = 109/167 (65%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           V   V+FDI++    G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I 
Sbjct: 2   VNPTVFFDIAVD---GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIP 58

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM Q            KSIYG  F+DENF L H GPG++SMANAGP TNGSQFFICT K
Sbjct: 59  GFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPITNGSQFFICTAK 118

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFG+V EGM++V+ +E +   R  +  K++ I+DCG+L
Sbjct: 119 TEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITIADCGQL 164



>sp|P73789|PPI2_SYNY3 Peptidyl-prolyl cis-trans isomerase slr1251
           (EC 5.2.1.8) (PPIase) (Rotamase).>pir|S74880|S74880
           peptidylprolyl isomerase (EC 5.2.1.8) - Synechocystis
           sp.  (strain PCC 6803)>gb:BA000022_688620 Synechocystis
           sp. PCC 6803 DNA, complete genome.
          Length = 171

 Score =  163 bits (413), Expect = 5e-39
 Identities = 86/172 (50%), Positives = 114/172 (66%), Gaps = 7/172 (4%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXF 523
           S+V+FDI+IG+     AGRIV+ L+ +  P+TAENFRALCTGE                F
Sbjct: 3   SKVFFDITIGSDT---AGRIVMELFDEVTPKTAENFRALCTGEKGVGKAGKPLHFKGSHF 59

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVI DFM Q            +SIYG  F DENF+L H  PG++SMANAGPNTNGSQFF
Sbjct: 60  HRVITDFMAQGGDFTRGNGTGGESIYGEKFADENFQLKHDRPGLLSMANAGPNTNGSQFF 119

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           +  V  PWLD +HVVFG+V+EG+++++ +E+  +  G + K+ +VISDCGE+
Sbjct: 120 LTFVPCPWLDGKHVVFGEVVEGLEILEQLEANGSQSG-QTKQAIVISDCGEI 170



>gb:AP004159_1838390 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1175_B01.>gb:AP005002_1847068 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0486G03.
          Length = 403

 Score =  163 bits (412), Expect = 6e-39
 Identities = 91/195 (46%), Positives = 113/195 (57%), Gaps = 12/195 (6%)
 Frame = -2

Query: 732 APVRATAQVAEPQSKVT----SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRAL 565
           A   A A   E +++V      + Y D+SIG   G   GRIV+ LY    P+TAENFRAL
Sbjct: 12  AAAAAVAAGKEEEAEVVVVRNPRCYLDVSIG---GDMEGRIVVELYASVAPRTAENFRAL 68

Query: 564 CTGEXXXXXXXXX--------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLV 409
           CTGE                  HR++K FM+Q            +SIYG  F+DENF L 
Sbjct: 69  CTGEKGVSAATGVPLHYKGSCIHRIVKGFMVQGGDITAGDGTGGESIYGLNFEDENFVLK 128

Query: 408 HAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGD 229
           H   G++SMANAGP+TNGSQFFI T +TP LD +HVVFG+VI+GM VV+ +E       D
Sbjct: 129 HERKGMLSMANAGPDTNGSQFFITTTRTPHLDGKHVVFGRVIKGMGVVRSMEHVSVGESD 188

Query: 228 RPKKRVVISDCGELP 184
           RP   +VI DCGELP
Sbjct: 189 RPITDIVIVDCGELP 203



>gb:TCR010066_1399749 Trypanosoma cruzi cyp gene.
          Length = 258

 Score =  163 bits (412), Expect = 6e-39
 Identities = 90/176 (51%), Positives = 113/176 (64%), Gaps = 10/176 (5%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXX-------XFH 520
           +V+FDISI N   K +GRI + LY D VP+TAENFRALCTGE                FH
Sbjct: 25  KVFFDISIDN---KPSGRIKMELYADTVPKTAENFRALCTGEKGRGKSGKPLHYKGCVFH 81

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLV---HAGPGVVSMANAGPNTNGSQ 349
           RVI  FMIQ            +SIYG  F+DE+F      H G G +SMANAGPNTNGSQ
Sbjct: 82  RVIPGFMIQGGDITRGNGTGGESIYGMNFRDESFSGKAGKHTGVGCLSMANAGPNTNGSQ 141

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           FFICT  TPWLD +HVVFG+V EG+DVV+ +E   ++ G + + R++I+DCGE+ +
Sbjct: 142 FFICTANTPWLDGKHVVFGRVTEGIDVVRRVERLGSESG-KTRGRIIIADCGEVVV 196



>pir|S50141|S50141 peptidylprolyl isomerase (EC 5.2.1.8) -
           Arabidopsis thaliana>gb:ATCHRIV82_1547448 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           82.>gb:ATF11I11_1548281 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F11I11 (ESSA
           project).>gb:ATU07276_1556712 Arabidopsis thaliana
           peptidyl-prolyl cis-trans isomerase mRNA, complete
           cds.>gb:ATU32186_1556907 Arabidopsis thaliana
           cyclophilin (ATCYP1) gene, complete
           cds.>gb:AY054468_1563123 Arabidopsis thaliana
           peptidylprolyl isomerase (cyclophilin) (At4g34870;
           T11I11.110) mRNA, complete cds.>gb:AY087606_1572636
           Arabidopsis thaliana clone 37 mRNA, complete
           sequence.>gb:BT006560_1639447 Arabidopsis thaliana
           At4g34870 gene, complete cds.
          Length = 172

 Score =  163 bits (412), Expect = 6e-39
 Identities = 89/171 (52%), Positives = 107/171 (62%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD+S+    G   GRI + L+ D  P TAENFRALCTGE                FH
Sbjct: 5   RVFFDMSLS---GTPIGRIEMELFADTTPNTAENFRALCTGEKGMGKLGKPLHFKGSIFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           RVI  FM Q            +SIYG  FKDENF   H G G++SMAN+GPNTNGSQFFI
Sbjct: 62  RVIPGFMCQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFGQV++G+DVVK IE   +D G +  K V I+DCG+L
Sbjct: 122 CTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSG-KTSKVVTITDCGQL 171



>pir|T07950|T07950 peptidylprolyl isomerase (EC 5.2.1.8) 1 -
           Chlamydomonas reinhardtii>gb:AF052206_1764330
           Chlamydomonas reinhardtii cyclophilin 1 (cyp1) mRNA,
           complete cds.
          Length = 172

 Score =  163 bits (412), Expect = 6e-39
 Identities = 88/170 (51%), Positives = 107/170 (62%), Gaps = 7/170 (4%)
 Frame = -2

Query: 675 VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFHR 517
           V+FDI+     G   GRI + LY D+VP+TAENFRALCTGE                FHR
Sbjct: 6   VFFDITAD---GAPVGRIEMELYADDVPKTAENFRALCTGEKGVGRSGKPLHFKGSTFHR 62

Query: 516 VIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC 337
           VI +FM Q            +SIYG  F DENFK  H GPGV+SMANAGPNTNGSQFF+C
Sbjct: 63  VIPNFMCQGGDFTRGNGTGGESIYGEKFPDENFKHRHTGPGVLSMANAGPNTNGSQFFLC 122

Query: 336 TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           TV+T WLD +HVVFG+V +GMDVVK +E   +  G + +    I+DC +L
Sbjct: 123 TVETAWLDGKHVVFGKVCKGMDVVKKVEGYGSSSG-KTRATFAIADCAQL 171



>sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E (EC
           5.2.1.8) (PPIase E) (Rotamase E) (Cyclophilin E)
           (Cyclophilin 33).>gb:AE013599_1132442 Drosophila
           melanogaster chromosome 2R, complete
           sequence.>gb:AE003803_1225312 Drosophila melanogaster
           chromosome 2R, section 47 of 74 of the complete
           sequence.>gb:AF182826_1248508 Drosophila melanogaster
           cyclophilin-33 (cyp33) mRNA, complete
           cds.>gb:AY061421_1293224 Drosophila melanogaster LD35248
           full length cDNA.
          Length = 300

 Score =  163 bits (412), Expect = 6e-39
 Identities = 92/174 (52%), Positives = 107/174 (61%)
 Frame = -2

Query: 708 VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXX 529
           V E   K   QV+FDI IG   G  AGRIV+ L  D VP+TAENFR LCT E        
Sbjct: 130 VIEKAEKRNPQVFFDIRIG---GNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGC 186

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVI +FM Q            KSIYG+ F DENF L H   G +SMAN+G NTNGSQ
Sbjct: 187 SFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQ 246

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFICT KT WLDN+HVVFG VI G +VV+ +E   +  G  P +++VI  CGEL
Sbjct: 247 FFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSG-TPSQKIVIYSCGEL 299



>gb:CR382129_1661735 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 163

 Score =  162 bits (411), Expect = 8e-39
 Identities = 88/167 (52%), Positives = 106/167 (63%)
 Frame = -2

Query: 687 VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIK 508
           +++QVYFD+S     G+  GRI   LY D VP+TAENFRALCTGE         FHRVI 
Sbjct: 1   MSNQVYFDVSAD---GQPLGRIEFKLYNDIVPKTAENFRALCTGEQGFGYANSIFHRVIP 57

Query: 507 DFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK 328
            FM+Q            KSIYG  F DENF+  H  PG++SMAN+GPNTNGSQFF+ TV 
Sbjct: 58  QFMLQGGDFTRHNGTGGKSIYGAKFPDENFEAKHTRPGLLSMANSGPNTNGSQFFVTTVP 117

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
            PWLD +HVVFG+V  GMDVVK IES  +  G   + ++ I   GEL
Sbjct: 118 CPWLDGKHVVFGEVTNGMDVVKKIESFGSSSG-ATRAKISIDKSGEL 163



>gb:AK012491_1156989 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700065P13
           product:peptidylprolyl isomerase A, full insert
           sequence.
          Length = 167

 Score =  162 bits (411), Expect = 8e-39
 Identities = 85/168 (50%), Positives = 111/168 (66%), Gaps = 1/168 (0%)
 Frame = -2

Query: 687 VTSQVYFDISIGN-PVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVI 511
           V   V+FDI+  + P+G+ +  +   L+ D+VP+TAENFRAL TGE         FHR+I
Sbjct: 2   VNPTVFFDITADDEPLGRVSFEVG-WLFADKVPKTAENFRALSTGEKGFGYKGSSFHRII 60

Query: 510 KDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV 331
             FM Q            +SIYG  F+DENF L H GPG++SMANAGPNTNGSQFFICT 
Sbjct: 61  PGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTA 120

Query: 330 KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           KT WLD +HVVFG+V EGM++V+ +E +   R  +  K++ ISDCG+L
Sbjct: 121 KTEWLDGKHVVFGKVKEGMNIVEAME-RFGSRNGKTSKKITISDCGQL 167



>sp|P25719|CYPC_YEAST Peptidyl-prolyl cis-trans isomerase C,
           mitochondrial precursor (EC 5.2.1.8) (PPIase) (Rotamase)
           (Cyclophilin C) (PPI-III).>pir|S30507|S30507
           peptidylprolyl isomerase (EC 5.2.1.8) 3 precursor -
           yeast  (Saccharomyces cerevisiae)>gb:AY557761_1613988
           Saccharomyces cerevisiae clone FLH111081.01X YML078W
           gene, complete cds.>gb:SC8248_1705524 S.cerevisiae
           chromosome XIII cosmid 8248.>gb:SCCPR3_1707381 S.
           cerevisiae CPR 3 gene for cyclophilin-3
           (cyclosporin-sensitive proline
           rotamase-3).>gb:YSCCYP3A_1728661 Saccharomyces
           cerevisiae cyclophilin (CYP3) gene, complete cds.
          Length = 182

 Score =  162 bits (411), Expect = 8e-39
 Identities = 89/169 (52%), Positives = 108/169 (63%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRV 514
           S++  +V+FD ++    G   GRI   LY + VP+TAENFRALCTGE         FHR+
Sbjct: 18  SRLGKKVFFDPAVN---GTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRI 74

Query: 513 IKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT 334
           I DFMIQ            KSIYG  F DENF   H   G++SMANAGPNTNGSQFFI T
Sbjct: 75  IPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITT 134

Query: 333 VKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           V  PWLD +HVVFG+V +GMD+VK IES  T  G +P+  +VI + GEL
Sbjct: 135 VPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASG-KPRAEIVIEEAGEL 182



>gb:TCU68268_1399925 Trypanosoma congolense cyclophilin A (cypA)
           mRNA, complete cds.
          Length = 177

 Score =  162 bits (410), Expect = 1e-38
 Identities = 90/174 (51%), Positives = 110/174 (63%), Gaps = 3/174 (1%)
 Frame = -2

Query: 699 PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFH 520
           P      +VYFDI+IG   G  AGRI   L+ D VP+TAENFRALCTGE         FH
Sbjct: 8   PTVPTNPKVYFDITIG---GTPAGRITFELFADAVPKTAENFRALCTGEKGFGYSGSGFH 64

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLV---HAGPGVVSMANAGPNTNGSQ 349
           R+I +FM Q            KSIYG  F DE+F      H GPG +SMANAGPNTNGSQ
Sbjct: 65  RIIPNFMCQGGDFTRHNGTGGKSIYGEKFPDESFAGKAGKHFGPGTLSMANAGPNTNGSQ 124

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFICT +T WLD +HVVFGQV++GM+VV+ +E+  +  G   K  V+IS+ G+L
Sbjct: 125 FFICTARTAWLDGKHVVFGQVLDGMNVVEGMEAVGSQTGSTDKP-VMISESGQL 177



>gb:AY775573_1628283 Codonopsis lanceolata cyclophilin 1 (CyP1)
           mRNA, complete cds.
          Length = 174

 Score =  162 bits (409), Expect = 1e-38
 Identities = 87/171 (50%), Positives = 107/171 (62%), Gaps = 7/171 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FDI IG      AGRIV+ L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   KVFFDIVIGK---MKAGRIVMELFADSTPKTAENFRALCTGEKGIGLSGKPLHYKGSIFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I +FM Q            +SIYG  F DENFK  H GPG++SMAN+GPNTNGSQFFI
Sbjct: 62  RIIPNFMCQGGDFTRFNGTGGESIYGAKFADENFKNKHTGPGILSMANSGPNTNGSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           CT KT WLD +HVVFG+V++G  VVK +E   +D G   K  V I +CG++
Sbjct: 122 CTEKTSWLDGKHVVFGKVVDGYSVVKEMEKVGSD-GGNSKSTVEIEECGQI 171



>gb:HMU36797_1386253 Hirudo medicinalis cyclophilin-A mRNA
           (hcyp),complete cds.
          Length = 143

 Score =  162 bits (409), Expect = 1e-38
 Identities = 83/142 (58%), Positives = 96/142 (67%)
 Frame = -2

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTF 433
           L  D VP+TAENFRALCTGE         FHRVI +FM Q            KSIYG  F
Sbjct: 3   LDADVVPKTAENFRALCTGEKGFGYKGSSFHRVIPNFMCQGGDFTRGDGTGGKSIYGNKF 62

Query: 432 KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE 253
           +DENFKL H GPG++SMANAG NTNGSQFFICT KT WLD +HVVFG+V+EG+DVVK +E
Sbjct: 63  EDENFKLKHTGPGILSMANAGKNTNGSQFFICTTKTEWLDGKHVVFGRVVEGLDVVKEVE 122

Query: 252 SQETDRGDRPKKRVVISDCGEL 187
           +  T     P  R  I+DCG+L
Sbjct: 123 TFGTQSAS-PSSRSSIADCGQL 143



>pir|T05766|T05766 peptidylprolyl isomerase (EC 5.2.1.8) M4E13.20 -
           Arabidopsis thaliana>gb:ATCHRIV82_1547457 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           82.>gb:ATM4E13_1553636 Arabidopsis thaliana DNA
           chromosome 4, BAC clone M4E13 (ESSAII
           project).>gb:AY568518_1615456 Arabidopsis thaliana
           single domain cyclophilin type peptidyl-prolyl cis-trans
           isomerase (CYP21-1) mRNA, complete
           cds.>gb:BT004972_1637918 Arabidopsis thaliana clone
           U50493 putative cyclophilin (At4g34960) mRNA, complete
           cds.>gb:AK117671_1815693 Arabidopsis thaliana At4g34960
           mRNA for cyclophilin like protein (ROC14), putative,
           complete cds, clone: RAFL17-33-L10.
          Length = 224

 Score =  162 bits (409), Expect = 1e-38
 Identities = 86/176 (48%), Positives = 110/176 (62%), Gaps = 7/176 (3%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX------- 532
           ++T++V+ D+ I    G+  GRIVIGLYG  VP+T ENFRALCTGE              
Sbjct: 44  EITNRVFLDVDID---GQRLGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPLHYKG 100

Query: 531 XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS 352
             FHR+I  F+IQ             SIYG TF DENFK+ H+  G+V+MAN GP++NGS
Sbjct: 101 TPFHRIISGFVIQGGDIIHGDGKSSDSIYGGTFPDENFKIQHSHAGMVAMANTGPDSNGS 160

Query: 351 QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
           QFFI TVK  WL+  HVV G+VI+GMD V  IE        +P+K+VVI+D GE+P
Sbjct: 161 QFFITTVKASWLEGEHVVLGKVIQGMDNVFAIEGGAGTYSGKPRKKVVIADSGEIP 216



>sp|O49886|CYPH_LUPLU Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:LLCYCLOPH_1685072 Lupinus luteus
           mRNA for cyclophilin.>gb:AF178458_1774712 Lupinus luteus
           cytosolic cyclophilin gene, complete cds.
          Length = 172

 Score =  162 bits (409), Expect = 1e-38
 Identities = 91/172 (52%), Positives = 110/172 (63%), Gaps = 8/172 (4%)
 Frame = -2

Query: 678 QVYFDISI-GNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXF 523
           +V+FD++I GNP    AGRIV+ LY D  P+TAENFRALCTGE                F
Sbjct: 5   KVFFDMAIAGNP----AGRIVMELYADTTPRTAENFRALCTGEKGVGRSGKPLHYKGSTF 60

Query: 522 HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           HRVI +FM Q            +SIYG  F DENF   H GPG++SMANAG  TNGSQFF
Sbjct: 61  HRVIPNFMCQGGDFTAGNGTGAESIYGAKFADENFIKRHTGPGILSMANAGAGTNGSQFF 120

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           ICT KT WLD +HVVFG+VIEGM+VV+ IE   +  G +  + V I+DCG+L
Sbjct: 121 ICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSG-KTSRPVTIADCGQL 171



>sp|P22011|CYPH_CANAL Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein) (CPH).>pir|JQ0888|CSCK peptidylprolyl
           isomerase (EC 5.2.1.8) - yeast (Candida
           albicans)>gb:YSACYP1_1728102 C.albicans peptidyl-propyl
           cis-trans isomerase (CYP1) gene, complete cds.
          Length = 162

 Score =  162 bits (409), Expect = 1e-38
 Identities = 89/165 (53%), Positives = 105/165 (63%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           S VYFD+S     G+  G+I   LY D VP+TAENFRALCTGE         FHRVI  F
Sbjct: 2   STVYFDVSAD---GQKLGKITFKLYDDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPQF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF   H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 59  MLQGGDFTNFNGTGGKSIYGTKFADENFVKRHDRPGLLSMANAGPNTNGSQFFITTVPCP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V +G+D+VK IES  +  G   KK +VI + G+L
Sbjct: 119 WLDGKHVVFGEVTDGLDIVKKIESFGSGSGATSKK-IVIEESGQL 162



>gb:CR382124_1657059 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 162

 Score =  161 bits (408), Expect = 2e-38
 Identities = 89/165 (53%), Positives = 104/165 (63%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           S+V+FD+      G+  GRIV  LY D VP+T ENFRAL TGE         FHRVI DF
Sbjct: 2   SKVFFDVEAD---GQPLGRIVFQLYNDVVPKTTENFRALATGEKGFGYAGSVFHRVIPDF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF   H  PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 59  MLQGGDFTHGTGVGGKSIYGAKFPDENFVKKHEKPGLLSMANAGPNTNGSQFFITTVPCP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           WLD +HVVFG+V +G DVVK +ES  +  G   K R+VI+  GEL
Sbjct: 119 WLDGKHVVFGEVADGFDVVKKVESLGSGSG-ATKARIVIAKSGEL 162



>gb:LMCYCL_1387675 Leishmania major mRNA for cyclophilin.
          Length = 177

 Score =  161 bits (408), Expect = 2e-38
 Identities = 91/174 (52%), Positives = 108/174 (62%), Gaps = 3/174 (1%)
 Frame = -2

Query: 699 PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFH 520
           P  +   +V+ DI IG   GK AGR+ + L+ D VPQTAENFRALCTGE         FH
Sbjct: 8   PVVESNPKVWMDIDIG---GKPAGRVTMELFKDAVPQTAENFRALCTGEKGFGYANSPFH 64

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENF---KLVHAGPGVVSMANAGPNTNGSQ 349
           RVI DFM Q            KSIYG  F DE+F      H GPG +SMANAGPNTNGSQ
Sbjct: 65  RVIPDFMCQGGDFTNGNGTGGKSIYGSKFADESFLGKAGKHFGPGTLSMANAGPNTNGSQ 124

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FF+CT  T WLD +HVVFGQV+EG +VVK +E+  + R     K V +S CG+L
Sbjct: 125 FFLCTAPTSWLDGKHVVFGQVLEGYEVVKAMEAVGS-RSGTTSKPVRVSACGQL 177



>gb:AY429574_1605886 Populus alba x Populus tremula clone INRA
           7171-B4 putative cyclophilin mRNA, partial
           cds.>gb:AY429575_1605887 Populus alba x Populus tremula
           putative cyclophilin mRNA, partial cds.
          Length = 151

 Score =  161 bits (407), Expect = 2e-38
 Identities = 85/147 (57%), Positives = 98/147 (66%), Gaps = 7/147 (4%)
 Frame = -2

Query: 672 YFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFHRV 514
           +FD+++G   G+  GRIV+ L+ D VP+TAENFRALCTGE                FHRV
Sbjct: 4   FFDMTVG---GQPVGRIVMELFADVVPRTAENFRALCTGEKGVGRLGKPLHFKGSSFHRV 60

Query: 513 IKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT 334
           I +FM Q            +SIYG  F DENF   H GPGV+SMANAGP TNGSQFFICT
Sbjct: 61  IPNFMCQGGDFTAGNGTGGESIYGAKFADENFVRKHTGPGVLSMANAGPGTNGSQFFICT 120

Query: 333 VKTPWLDNRHVVFGQVIEGMDVVKLIE 253
           VKT WLD +HVVFGQV+EGMDVVK IE
Sbjct: 121 VKTEWLDGKHVVFGQVVEGMDVVKAIE 147



>gb:PFMAL3P7_1394593 Plasmodium falciparum MAL3P7, complete
           sequence.>gb:PFU33869_1395067 Plasmodium falciparum
           cyclophilin mRNA, complete cds.
          Length = 171

 Score =  161 bits (407), Expect = 2e-38
 Identities = 89/171 (52%), Positives = 108/171 (63%), Gaps = 6/171 (3%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX------XXFH 520
           S+V+FDISI N     AGRI+  L+ D  P+T ENFRALCTGE               FH
Sbjct: 5   SKVFFDISIDN---SNAGRIIFELFSDITPRTCENFRALCTGEKIGSRGKNLHYKNSIFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI 340
           R+I  FM Q            +SIYGR+F DENF + H  PG++SMANAGPNTN SQFFI
Sbjct: 62  RIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFI 121

Query: 339 CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
             V  PWLD +HVVFG+VIEGM+VV+ +E +    G   K+ VVI+DCGEL
Sbjct: 122 TLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAKSG-YVKRSVVITDCGEL 171



>gb:SCU92087_1710610 Solanum commersonii stress responsive
           cyclophilin (SCCYP1) mRNA, complete cds.
          Length = 172

 Score =  160 bits (406), Expect = 3e-38
 Identities = 88/172 (51%), Positives = 109/172 (63%), Gaps = 8/172 (4%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX-------XXFH 520
           +V+FD++IG   G  AGR+V+ L+ D  P+TAENFRALCTGE                FH
Sbjct: 5   RVFFDLTIG---GAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTFH 61

Query: 519 RVIKDFMIQXXXXXXXXXXXXK-SIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF 343
           RVI  FM Q            + SIYG  FKDENF   H G G++SMANAGP TNGSQF 
Sbjct: 62  RVIPGFMCQGGDFTAGNGTGEEKSIYGAKFKDENFVKKHTGAGILSMANAGPGTNGSQFL 121

Query: 342 ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           IC+ KT WLD +HVVFGQV+EG+DV+K  E+  +  G R  K VV++DCG+L
Sbjct: 122 ICSAKTEWLDGKHVVFGQVVEGLDVIKKAEAVGSSSG-RCSKPVVVADCGQL 172



>gb:BC082380_2562617 Xenopus laevis MGC81732 protein, mRNA (cDNA
           clone MGC:81732 IMAGE:6865456), complete cds.
          Length = 370

 Score =  160 bits (405), Expect = 4e-38
 Identities = 87/182 (47%), Positives = 114/182 (62%), Gaps = 8/182 (4%)
 Frame = -2

Query: 708 VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXX 529
           +A+P +    +V+ D  IG   G+  GRIV+ L+ D VP+TAENFRALCTGE        
Sbjct: 7   MAKPSNPSNPKVFLDAEIG---GERVGRIVLELFADVVPKTAENFRALCTGEKGIGQSTG 63

Query: 528 X--------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANA 373
                    FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANA
Sbjct: 64  KPLHFKGCPFHRIIKKFMIQCGDFSNQDGTGGESIYGEKFEDENFHYKHDKEGLLSMANA 123

Query: 372 GPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           GPNTNGSQFFI TV TP LD +HVVFGQV++G  +VK++E+ E  + ++P K   I++CG
Sbjct: 124 GPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGYGIVKILENVEV-KDEKPAKMCTIAECG 182

Query: 192 EL 187
           E+
Sbjct: 183 EV 184



>gb:BT019342_2151301 Synthetic construct Homo sapiens peptidyl
           prolyl isomerase H (cyclophilin H) mRNA, partial cds.
          Length = 178

 Score =  160 bits (405), Expect = 4e-38
 Identities = 87/174 (50%), Positives = 109/174 (62%), Gaps = 5/174 (2%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXX-----XX 529
           S V   V+FD+SIG   G+  GR+ I L+ D VP+TAENFR  CTGE             
Sbjct: 7   SPVNPVVFFDVSIG---GQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGS 63

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVIKDFMIQ             SIY   F DENFKL H+ PG++SMAN+GP+TNG Q
Sbjct: 64  TFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQ 123

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFI   K  WLD +HVVFG++I+G+ V++ IE+  T   ++PK  VVIS CGE+
Sbjct: 124 FFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177



>gb:AY231990_1177283 Drosophila yakuba clone yak-ad_CG7768 mRNA
           sequence.
          Length = 139

 Score =  160 bits (405), Expect = 4e-38
 Identities = 83/138 (60%), Positives = 96/138 (69%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +VYFDI+ G   G+  GRIV+ L  D VP+TAENFRALCTGE         FHRVI +FM
Sbjct: 5   RVYFDIAAG---GEKIGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFM 61

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPW 319
            Q            +SIYG  F DENF+L H G GV+SMANAG NTNGSQFFICT KT W
Sbjct: 62  CQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTW 121

Query: 318 LDNRHVVFGQVIEGMDVV 265
           LDN+HVVFG+V+EGMD+V
Sbjct: 122 LDNKHVVFGKVVEGMDIV 139



>sp|O43447|PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H (EC
           5.2.1.8) (PPIase H) (Rotamase H) (U-snRNP-associated
           cyclophilin SnuCyp-20) (USA-CYP) (Small nuclear
           ribonucleoprotein particle-specific cyclophilin H)
           (CypH).>gb:AK003179_1151702 Mus musculus 18-day embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:1100001J08 product:U-SNRNP-ASSOCIATED CYCLOPHILIN
           (EC 5.2.1.8) homolog [Homo sapiens], full insert
           sequence.>gb:AK005202_1152884 Mus musculus adult male
           cerebellum cDNA, RIKEN full-length enriched library,
           clone:1500011D08 product:U-SNRNP-ASSOCIATED CYCLOPHILIN
           (EC 5.2.1.8) homolog [Homo sapiens], full insert
           sequence.>gb:AK014665_1158082 Mus musculus 0 day neonate
           head cDNA, RIKEN full-length enriched library,
           clone:4833408F11 product:U-SNRNP-ASSOCIATED CYCLOPHILIN
           (EC 5.2.1.8) homolog [Homo sapiens], full insert
           sequence.>gb:AF016371_1876690 Homo sapiens
           U-snRNP-associated cyclophilin (USA-CyP) mRNA, complete
           cds.>gb:AF036331_1878026 Homo sapiens cyclophilin
           (CYP-20) mRNA, complete cds.>gb:BC003412_1968822 Homo
           sapiens peptidyl prolyl isomerase H (cyclophilin H),
           mRNA (cDNA clone MGC:5016 IMAGE:3451034), complete
           cds.>gb:BT019343_1991029 Homo sapiens peptidyl prolyl
           isomerase H (cyclophilin H) mRNA, complete
           cds.>gb:CR541920_1994147 Homo sapiens full open reading
           frame cDNA clone RZPDo834G0833D for gene PPIH, peptidyl
           prolyl isomerase H (cyclophilin H); complete cds,
           without stopcodon.>gb:BC050116_2100360 Mus musculus
           peptidyl prolyl isomerase H, mRNA (cDNA clone MGC:60913
           IMAGE:6432881), complete cds.
          Length = 177

 Score =  160 bits (405), Expect = 4e-38
 Identities = 87/174 (50%), Positives = 109/174 (62%), Gaps = 5/174 (2%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXX-----XX 529
           S V   V+FD+SIG   G+  GR+ I L+ D VP+TAENFR  CTGE             
Sbjct: 7   SPVNPVVFFDVSIG---GQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGS 63

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVIKDFMIQ             SIY   F DENFKL H+ PG++SMAN+GP+TNG Q
Sbjct: 64  TFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQ 123

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFI   K  WLD +HVVFG++I+G+ V++ IE+  T   ++PK  VVIS CGE+
Sbjct: 124 FFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177



>gb:AF180337_1774807 Filobasidiella neoformans var. neoformans
           cyclophilin A (CPA2) gene, complete cds.
          Length = 162

 Score =  160 bits (404), Expect = 5e-38
 Identities = 89/163 (54%), Positives = 103/163 (63%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           SQVYFDI+I N     AGRI   L+ D VP+TA NFR LCTG+         FHRVI  F
Sbjct: 2   SQVYFDIAINNA---PAGRITFKLFDDVVPKTARNFRELCTGQNGFGYAGSGFHRVIPQF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DE FKL H  P ++SMANAGPNTNGSQFFI TV T 
Sbjct: 59  MLQGGDFTNHNGTGGKSIYGNKFADEEFKLRHDRPFLLSMANAGPNTNGSQFFITTVVTS 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           WLD +HVVFG+V  G D+VK IES  +D G +PK +V I+  G
Sbjct: 119 WLDGKHVVFGEVSSGQDLVKNIESYGSDSG-KPKAKVTITGSG 160



>gb:AB125939_1528236 Malassezia pachydermatis CYP mRNA for
           cyclophilin, complete cds.
          Length = 162

 Score =  160 bits (404), Expect = 5e-38
 Identities = 86/163 (52%), Positives = 105/163 (64%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           S V+FDI+     G     I   L+ D VP+T  NFRALCTGE         FHRVI +F
Sbjct: 2   SNVFFDITKN---GSPLDPIKFKLFDDVVPKTTANFRALCTGEKGFGYAGSHFHRVIPNF 58

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENF+L H+ PG++SMANAGPNTNGSQFFI TV  P
Sbjct: 59  MLQGGDFTAGNGTGGKSIYGAKFADENFQLKHSKPGLLSMANAGPNTNGSQFFITTVVAP 118

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           WLD +HVVFG+VIEGMDVVK IE++ ++ G +   R+ I+ CG
Sbjct: 119 WLDGKHVVFGEVIEGMDVVKAIEAEGSNSG-KTSSRIEIAKCG 160



>gb:AF243140_1416671 Canis familiaris cyclophilin A mRNA, partial
           cds.
          Length = 156

 Score =  160 bits (404), Expect = 5e-38
 Identities = 80/152 (52%), Positives = 101/152 (66%)
 Frame = -2

Query: 642 GKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXX 463
           G+  GR+   L+ D+VP+TAENFRAL TGE         FHR+I  FM Q          
Sbjct: 6   GEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGT 65

Query: 462 XXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVI 283
             KSIYG  F DENF L H GPG++SMANAGPNTNGSQFFICT KT WLD +HVVFG+V 
Sbjct: 66  GGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVK 125

Query: 282 EGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           EGM++V+ +E +   R  +  K++ I+DCG++
Sbjct: 126 EGMNIVEAME-RFGSRNGKTSKKITIADCGQI 156



>pir|JT0686|JT0686 peptidylprolyl isomerase (EC 5.2.1.8) a,
           cytosolic - fungus  (Fusarium sporotrichioides)
          Length = 179

 Score =  160 bits (404), Expect = 5e-38
 Identities = 90/178 (50%), Positives = 113/178 (63%), Gaps = 13/178 (7%)
 Frame = -2

Query: 681 SQVYFDISIGNPV---GKA-------AGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX 532
           ++V+FDI+   PV   GK        +GRI   L+ ++VP+TAENF+ALCTGE       
Sbjct: 2   NKVFFDITWEGPVFQNGKPTSTVKEQSGRINFNLFNEQVPKTAENFKALCTGEKGFGYKG 61

Query: 531 XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS 352
             FHR+I DFM+Q            KSIYG  F DENFKL H+ PG++SMANAGPNTNGS
Sbjct: 62  SSFHRIIPDFMLQGGDFTRGNGTGGKSIYGEKFADENFKLEHSKPGLLSMANAGPNTNGS 121

Query: 351 QFFICTVKTPWLDNRHVVFGQVI--EGMDVVKLIESQETDRGD-RPKKRVVISDCGEL 187
           QFF+ TV T WLD RHVVFG+V   E M+VVK +E+  +  G  +  K+  I DCGEL
Sbjct: 122 QFFVTTVVTSWLDGRHVVFGEVADEESMNVVKALEATGSGSGAIKYNKKATIVDCGEL 179



>gb:AF042386_1878497 Homo sapiens cyclophilin-33B (CYP-33) mRNA,
           complete cds.>gb:AF104013_1883888 Homo sapiens
           peptidyl-prolyl cis-trans isomerase E (PPIE) mRNA,
           alternatively spliced, complete cds.>gb:HS118J21_1996989
           Human DNA sequence from clone RP1-118J21 on chromosome
           1p34.1-35.3 Contains the 5' end of the BMP8B gene for
           bone morphogenetic protein 8b (osteogenic protein 2),
           the 3' end of the PPIE gene for peptidylprolyl isomerase
           E (cyclophilin E), the OXCT2 gene for 3-oxoacid CoA
           transferase 2, the gene for tRNA isopentenyltransferase
           1 (IPT), the MYCL1 gene for v-myc myelocytomatosis viral
           oncogene homolog 1 lung carcinoma derived (avian), a
           novel gene and seven CpG islands, complete
           sequence.>gb:HS144F13_1997148 Human DNA sequence from
           clone RP1-144F13 on chromosome 1p33-34.3 Contains the
           HEYL gene for hairy/enhancer-of-split related protein
           with YRPW-like motif, a novel gene, the NT5C1A gene for
           cytosolic IA 5'-nucleotidase, the HPCAL4 gene for
           hippocalcin like 4, a novel pseudogene, the 5' end of
           the PPIE gene for peptidylprolyl isomerase E
           (cyclophilin E) and six CpG islands, complete
           sequence.>gb:HSJ117L23_2015739 Human DNA sequence from
           clone RP1-117L23 on chromosome 1p33-34.2 Contains part
           of the PPIE gene for peptidylprolyl isomerase E
           (cyclophilin E) and the 3' end of the BMP8B gene for
           bone morphogenetic protein 8b (osteogenic protein 2),
           complete sequence.
          Length = 296

 Score =  159 bits (403), Expect = 7e-38
 Identities = 91/183 (49%), Positives = 111/183 (60%), Gaps = 4/183 (2%)
 Frame = -2

Query: 780 QKFSSCSVQV-KSGRPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGRIVIG 613
           +KFS  +++  K      P +A  Q  EP   +++   QVY DI IGN   K AGRI + 
Sbjct: 103 KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGN---KPAGRIQML 159

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTF 433
           L  D VP TAENFR LCT E         FHR+I  FM Q            KSIYG+ F
Sbjct: 160 LRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKF 219

Query: 432 KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE 253
            DENF L H GPG++SMAN+GPNTNGSQFF+   KT WLD +HVVFG+V EG+DV++ IE
Sbjct: 220 DDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIE 279

Query: 252 SQE 244
            QE
Sbjct: 280 KQE 282



>gb:CR382134_1667277 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 186

 Score =  159 bits (403), Expect = 7e-38
 Identities = 89/185 (48%), Positives = 111/185 (60%)
 Frame = -2

Query: 741 RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC 562
           +P+   R T   +       ++V+   SIG   G     I   LY + VP+T ENFRALC
Sbjct: 3   KPVNFTRQTRLFSSSARNWGTKVFITPSIG---GVKQSPIKFELYDEVVPKTTENFRALC 59

Query: 561 TGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSM 382
           TGE         FHRVI +FM+Q            +SIYG+ F DENF+  H   G++SM
Sbjct: 60  TGEKGFGYANSIFHRVIPNFMLQGGDFETGKGYGGRSIYGQKFSDENFQKKHEKAGLLSM 119

Query: 381 ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS 202
           ANAGPNTNGSQFFI TV  PWLD  HVVFG+VIEGMD+VK IE+Q +  G  P+  +VI 
Sbjct: 120 ANAGPNTNGSQFFITTVPCPWLDGAHVVFGEVIEGMDIVKKIEAQGSGSG-APQSSIVIE 178

Query: 201 DCGEL 187
           +CGEL
Sbjct: 179 ECGEL 183



>gb:CR541899_1994126 Homo sapiens full open reading frame cDNA clone
           RZPDo834B1133D for gene PPIH, peptidyl prolyl isomerase
           H (cyclophilin H); complete cds, incl. stopcodon.
          Length = 177

 Score =  159 bits (402), Expect = 9e-38
 Identities = 87/174 (50%), Positives = 108/174 (62%), Gaps = 5/174 (2%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXX-----XX 529
           S V   V+FD+SIG   G+  GR+ I L+ D VP+TAENFR  CTGE             
Sbjct: 7   SPVNPVVFFDVSIG---GQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGS 63

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHRVIKDFMIQ             SIY   F DENFKL H+ PG++SMAN+GP+TNG Q
Sbjct: 64  TFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQ 123

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           FFI   K  WLD +HVVFG++I+G+ V++ IE   T   ++PK  VVIS CGE+
Sbjct: 124 FFITCSKCDWLDGKHVVFGKIIDGLLVMRKIEYVPTGPNNKPKLPVVISQCGEM 177



>gb:CR382126_1658575 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 372

 Score =  159 bits (402), Expect = 9e-38
 Identities = 90/179 (50%), Positives = 105/179 (58%), Gaps = 9/179 (5%)
 Frame = -2

Query: 693 SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXX------ 532
           S+   + +FDISIG   GK AGRIV  LY D VP+TAENF  LC G              
Sbjct: 2   SETRPKTFFDISIG---GKPAGRIVFELYSDVVPKTAENFLKLCEGNSGFAKSKPDIPLS 58

Query: 531 ---XXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT 361
                FHRVIK FM Q            +SIYG  F+DENF L H  P ++SMANAG NT
Sbjct: 59  YKGSIFHRVIKSFMCQFGDFTNFNGTGGESIYGEKFEDENFTLKHDKPFLLSMANAGANT 118

Query: 360 NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
           NGSQ FI  V TP LD +HVVFG+VI+G  +V+ IE+  TD  D+P K V I DCG LP
Sbjct: 119 NGSQCFITCVPTPHLDGKHVVFGEVIQGKRLVRTIENNATDEADKPAKEVKIEDCGVLP 177



>sp|P35176|CYPD_YEAST Peptidyl-prolyl cis-trans isomerase D
           precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Cyclophilin
           D).>pir|S38324|S38324 peptidylprolyl isomerase (EC
           5.2.1.8) D precursor - yeast  (Saccharomyces
           cerevisiae)>gb:AY557734_1613961 Saccharomyces cerevisiae
           clone FLH002170.01X YDR304C gene, complete
           cds.>gb:SCCYPD_1707468 S.cerevisiae CYPD
           mRNA.>gb:YSCD9740_1728728 Saccharomyces cerevisiae
           chromosome IV cosmid 9740.
          Length = 225

 Score =  159 bits (402), Expect = 9e-38
 Identities = 89/172 (51%), Positives = 109/172 (63%), Gaps = 1/172 (0%)
 Frame = -2

Query: 690 KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG-EXXXXXXXXXFHRV 514
           ++T +VYFDI+ G+   K  GRIV+GLYG   PQT ENF  L    +         FHRV
Sbjct: 31  EITHKVYFDINHGD---KQIGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNSIFHRV 87

Query: 513 IKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT 334
           I +FMIQ            KSI+G TFKDENF + H  PG +SMAN G NTNGSQFFI T
Sbjct: 88  IPNFMIQGGDFTHRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITT 147

Query: 333 VKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV 178
           V  PWLD +HVVFG+V++GMDVV  IE+ +TD  + P K V+I + GEL  V
Sbjct: 148 VPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVIIVESGELETV 199



>gb:BC061335_2553111 Xenopus tropicalis hypothetical protein
           MGC75854, mRNA (cDNA clone MGC:75854 IMAGE:5382751),
           complete cds.
          Length = 370

 Score =  159 bits (401), Expect = 1e-37
 Identities = 88/182 (48%), Positives = 114/182 (62%), Gaps = 8/182 (4%)
 Frame = -2

Query: 708 VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXX 529
           VA+P +    +V+ D+ IG   G+  GRIV+ L+ D VP+TAENFRAL TGE        
Sbjct: 7   VAKPSNPSNPKVFLDVEIG---GERVGRIVLELFADVVPKTAENFRALSTGEKGIGQSTG 63

Query: 528 X--------FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANA 373
                    FHR+IK FMIQ            +SIYG  F+DENF   H   G++SMANA
Sbjct: 64  KPLHFKGCPFHRIIKKFMIQCGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANA 123

Query: 372 GPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           GPNTNGSQFFI TV T  LD +HVVFGQV++G  +VK++E+ E  + ++P K  VI++CG
Sbjct: 124 GPNTNGSQFFITTVPTAHLDGKHVVFGQVLKGYGIVKMLENVEV-KDEKPAKMCVIAECG 182

Query: 192 EL 187
           EL
Sbjct: 183 EL 184



>gb:AE017342_1754779 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 179

 Score =  159 bits (401), Expect = 1e-37
 Identities = 87/163 (53%), Positives = 103/163 (63%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDF 502
           SQVYFDI+I N     AGRI   L+ D VP+TA NFR LCTG+         FHRVI  F
Sbjct: 19  SQVYFDIAINNA---PAGRITFKLFDDVVPKTARNFRELCTGQNGFGYAGSGFHRVIPQF 75

Query: 501 MIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTP 322
           M+Q            KSIYG  F DENFKL H  P ++SMANAGPNTNGSQFFI TV T 
Sbjct: 76  MLQGGDFTNHNGTGGKSIYGNKFADENFKLRHDRPFLLSMANAGPNTNGSQFFITTVVTS 135

Query: 321 WLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG 193
           WLD +H VFG+V  G D+V+ IES  +D G +PK ++ I+  G
Sbjct: 136 WLDGKHCVFGEVSSGQDLVRKIESYGSDSG-KPKAKITITASG 177



>gb:CR382123_1655917 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 201

 Score =  159 bits (401), Expect = 1e-37
 Identities = 91/187 (48%), Positives = 114/187 (60%), Gaps = 1/187 (0%)
 Frame = -2

Query: 735 LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG 556
           +A + A A        +T +VYFDI  G+   ++ GRIVIGL+G+  P+T +NF  L   
Sbjct: 8   IAVLSALAAFVLADPTITHKVYFDIEHGD---ESVGRIVIGLFGEVAPRTVQNFFELSIS 64

Query: 555 EX-XXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMA 379
           E          FHRVI  FMIQ            KSIYG TF DE+F++ H  PG +SMA
Sbjct: 65  EDPKMGYVKSIFHRVIPQFMIQGGDFTNGNGTGGKSIYGDTFDDESFEVKHDKPGRLSMA 124

Query: 378 NAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISD 199
           N G NTNGSQFFI TV TPWLD +HVVFG+V+EGMDVV  IE+   +R DRPK+ V I+ 
Sbjct: 125 NRGRNTNGSQFFITTVPTPWLDGKHVVFGEVLEGMDVVSYIENVPRNRSDRPKQDVRIAG 184

Query: 198 CGELPIV 178
            GE+  V
Sbjct: 185 SGEVETV 191



>gb:AC006438_1534276 Arabidopsis thaliana chromosome 2 clone F19G14
           map mi398, complete sequence.>gb:AY026065_1559016
           Arabidopsis thaliana cyclophilin-40 mRNA, complete cds.
          Length = 361

 Score =  159 bits (401), Expect = 1e-37
 Identities = 90/174 (51%), Positives = 107/174 (61%), Gaps = 8/174 (4%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX-------- 526
           S+ + DISIG   G+  GRIVI LY D VP+TAENFR LCTGE                 
Sbjct: 4   SKCFMDISIG---GELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNR 60

Query: 525 FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF 346
           FHRVIK FMIQ            +SIYG  F DENF+L H   G++SMAN+GPNTNGSQF
Sbjct: 61  FHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQF 120

Query: 345 FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
           FI T +T  LD +HVVFG+V +GM VV+ IE    +    P + VVI DCGE+P
Sbjct: 121 FITTTRTSHLDGKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEIP 174



>pir|D84533|D84533 hypothetical protein At2g15790 [imported] -
           Arabidopsis thaliana
          Length = 404

 Score =  159 bits (401), Expect = 1e-37
 Identities = 90/174 (51%), Positives = 107/174 (61%), Gaps = 8/174 (4%)
 Frame = -2

Query: 681 SQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXX-------- 526
           S+ + DISIG   G+  GRIVI LY D VP+TAENFR LCTGE                 
Sbjct: 4   SKCFMDISIG---GELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNR 60

Query: 525 FHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF 346
           FHRVIK FMIQ            +SIYG  F DENF+L H   G++SMAN+GPNTNGSQF
Sbjct: 61  FHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQF 120

Query: 345 FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP 184
           FI T +T  LD +HVVFG+V +GM VV+ IE    +    P + VVI DCGE+P
Sbjct: 121 FITTTRTSHLDGKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEIP 174



>pir|S68357|S52760 peptidylprolyl isomerase (EC 5.2.1.8) precursor -
           malaria parasite (Plasmodium
           falciparum)>gb:AE014186_938127 Plasmodium falciparum 3D7
           chromosome 11 complete sequence.>gb:AE014838_1228861
           Plasmodium falciparum 3D7 chromosome 11 section 3 of 8
           of the complete sequence.>gb:PFRNACYC_1394963
           P.falciparum mRNA for cyclophilin.
          Length = 195

 Score =  159 bits (401), Expect = 1e-37
 Identities = 84/176 (47%), Positives = 112/176 (63%), Gaps = 4/176 (2%)
 Frame = -2

Query: 696 QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXX----XXX 529
           + ++T + YFDI+I +   K  GRIV GLYG   P+T ENF ++C G             
Sbjct: 24  EHEITHKTYFDITIDD---KPLGRIVFGLYGKVAPKTVENFVSICKGTVVDGKMLHYTNS 80

Query: 528 XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ 349
            FHR+I +FM Q             SIYG+ F+DENFK+ H+  G++SMANAG NTNGSQ
Sbjct: 81  IFHRIIPNFMAQGGDITNFNGTGGLSIYGKKFEDENFKVNHSKRGLLSMANAGKNTNGSQ 140

Query: 348 FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI 181
           FFI  + TPWLD RHVVFG+V+EG+D +  IE+  TD G+ P KRV++ + GELP+
Sbjct: 141 FFILFIPTPWLDGRHVVFGEVVEGLDKLVHIEAVGTDSGE-PLKRVLVKESGELPL 195



>gb:PME132763_1700771 Pseudotsuga menziesii mRNA for cyclophilin.
          Length = 189

 Score =  158 bits (400), Expect = 2e-37
 Identities = 90/193 (46%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -2

Query: 747 SGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA 568
           SG     V    ++  P++ V   V+FD++IG      AGRI + L+ D VP+TAENFR 
Sbjct: 3   SGAAAGVVEWHQKLPNPKNPV---VFFDVTIGTI---PAGRIKMELFADIVPRTAENFRQ 56

Query: 567 LCTGEXXXXXXXXXF-----HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHA 403
            CTGE         +     HRVIKDFMIQ             SIYG  F+DENF   H 
Sbjct: 57  FCTGEYRKAGIPIGYKGCHFHRVIKDFMIQAGDFVKGDGSGCISIYGSKFEDENFIAKHT 116

Query: 402 GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVI-EGMDVVKLIESQETDRGDR 226
           GPG++SMAN+GPNTNGSQFF+   K  WLDN+HVVFG+V+ EG+ V++ IE+ +T   +R
Sbjct: 117 GPGLLSMANSGPNTNGSQFFLTCAKCDWLDNKHVVFGRVLGEGLLVLRKIENVQTGPNNR 176

Query: 225 PKKRVVISDCGEL 187
           PK   VI++CGE+
Sbjct: 177 PKLPCVIAECGEM 189



>gb:AB098778_1410147 Bos taurus mRNA for similar to peptidylprolyl
           isomerase A (cyclophilin A), partial cds, clone:
           ORCS12086.
          Length = 150

 Score =  158 bits (400), Expect = 2e-37
 Identities = 79/148 (53%), Positives = 99/148 (66%)
 Frame = -2

Query: 630 GRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFMIQXXXXXXXXXXXXKS 451
           GR+   L+ D+VP+TAENFRAL TGE         FHR+I  FM Q            KS
Sbjct: 4   GRVSFELFADQVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKS 63

Query: 450 IYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMD 271
           IYG  F DENF L H GPG++SMANAGPNTNGSQFFICT KT WLD +HVVFG+V EGM+
Sbjct: 64  IYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMN 123

Query: 270 VVKLIESQETDRGDRPKKRVVISDCGEL 187
           +V+ +E +   R  +  K++ I+DCG++
Sbjct: 124 IVEAME-RFGSRNGKTSKKITIADCGQI 150



>sp|P34887|CYPH_ALLCE Peptidyl-prolyl cis-trans isomerase (EC
           5.2.1.8) (PPIase) (Rotamase) (Cyclophilin) (Cyclosporin
           A-binding protein).>gb:ALCCYCLOPH_1818940 Allium cepa
           cyclophilin mRNA, complete cds.
          Length = 150

 Score =  158 bits (400), Expect = 2e-37
 Identities = 86/148 (58%), Positives = 96/148 (64%), Gaps = 6/148 (4%)
 Frame = -2

Query: 612 LYGDEVPQTAENFRALCTGEXXXXXXX------XXFHRVIKDFMIQXXXXXXXXXXXXKS 451
           L+ D VPQTAENFRALCTGE               FHRVI  FM Q            +S
Sbjct: 3   LFQDVVPQTAENFRALCTGEKGMGDRKPLHYKGSSFHRVIPGFMCQGGDFTAGNGTGGES 62

Query: 450 IYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMD 271
           IYG  FKDENF   H GPGV+SMANAGP TNGSQFFICT KT WLD +HVVFGQV+EGMD
Sbjct: 63  IYGAKFKDENFIKKHTGPGVLSMANAGPGTNGSQFFICTEKTAWLDGKHVVFGQVVEGMD 122

Query: 270 VVKLIESQETDRGDRPKKRVVISDCGEL 187
           VV+ IE   +  G + KK V I+DCG+L
Sbjct: 123 VVRAIEKVGSQSG-QTKKPVKIADCGQL 149



>gb:AY394969_2531712 Danio rerio clone RK058A3D03 peptidyl prolyl
           isomerase H mRNA, complete cds.
          Length = 177

 Score =  158 bits (399), Expect = 2e-37
 Identities = 83/177 (46%), Positives = 110/177 (62%), Gaps = 5/177 (2%)
 Frame = -2

Query: 702 EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXX-- 529
           +P +     V+FD+SIG   G+  GR+ I L+ D VP+TAENFR  CTGE          
Sbjct: 4   QPSNPNNPIVFFDVSIG---GQEVGRMKIELFADIVPKTAENFRQFCTGEFKKDGVPVGY 60

Query: 528 ---XFHRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN 358
               FHRVIKDFMIQ             SIY   F DENF++ H+GPG++SMAN+GP TN
Sbjct: 61  KGCTFHRVIKDFMIQGGDFVNGDGTGICSIYRGPFADENFRMKHSGPGLLSMANSGPGTN 120

Query: 357 GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           G QFFI   K  WLD +HVVFG+V++G+ V++ IE+  T   ++PK  +V+S CGE+
Sbjct: 121 GCQFFITCTKCDWLDGKHVVFGKVVDGLLVMRKIENVPTGPNNKPKLPIVVSQCGEM 177



>gb:AF191832_1249603 Trypanosoma cruzi cyclophilin A (CYP A) mRNA,
           complete cds.
          Length = 177

 Score =  157 bits (397), Expect = 3e-37
 Identities = 86/167 (51%), Positives = 107/167 (64%), Gaps = 3/167 (1%)
 Frame = -2

Query: 678 QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXFHRVIKDFM 499
           +V+FD+SIG   G++AGR+V  L+ D VP+TAENFRALCTGE         FHR+I  FM
Sbjct: 15  KVFFDVSIG---GQSAGRVVFELFADAVPKTAENFRALCTGEKNFGYAGSGFHRIIPQFM 71

Query: 498 IQXXXXXXXXXXXXKSIYGRTFKDENFKLV---HAGPGVVSMANAGPNTNGSQFFICTVK 328
            Q            +SIYG  F DE+F      H G G +SMANAGPNTNGSQFFICT  
Sbjct: 72  CQGGDFTNHNGTGGRSIYGEKFADESFAGKAGKHFGLGTLSMANAGPNTNGSQFFICTAP 131

Query: 327 TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
           T WLD +HVVFGQV+EG++VVK +E+  +  G +  K V I   G+L
Sbjct: 132 TQWLDGKHVVFGQVLEGIEVVKAMEAVGSQTG-KTSKPVKIEASGQL 177



>pir|F84808|F84808 probable peptidyl-prolyl cis-trans isomerase
           [imported] - Arabidopsis thaliana>gb:AC005499_1532763
           Arabidopsis thaliana chromosome 2 clone T6A23 map ve018,
           complete sequence.>gb:AY568522_1615460 Arabidopsis
           thaliana single domain cyclophilin type peptidyl-prolyl
           cis-trans isomerase (CYP22-1) mRNA, complete
           cds.>gb:BT002031_1635634 Arabidopsis thaliana putative
           peptidyl-prolyl cis-trans isomerase (At2g38730) mRNA,
           complete cds.>gb:BT006565_1639452 Arabidopsis thaliana
           At2g38730 gene, complete cds.
          Length = 199

 Score =  157 bits (397), Expect = 3e-37
 Identities = 85/177 (48%), Positives = 109/177 (61%), Gaps = 6/177 (3%)
 Frame = -2

Query: 699 PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEXXXXXXXXXF- 523
           P +     V+FD+SIG   G  AGRI + L+ D  P+TAENFR  CTGE         + 
Sbjct: 26  PPNPKNPVVFFDVSIG---GIPAGRIKMELFADIAPKTAENFRQFCTGELRKAGKPLGYK 82

Query: 522 ----HRVIKDFMIQXXXXXXXXXXXXKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNG 355
               HRVIKDFM+Q             SIYG  F+DENF   H GPG++SMAN+GPNTNG
Sbjct: 83  ECQFHRVIKDFMVQSGDFLKNDGSGCMSIYGHKFEDENFTAKHTGPGLLSMANSGPNTNG 142

Query: 354 SQFFICTVKTPWLDNRHVVFGQVI-EGMDVVKLIESQETDRGDRPKKRVVISDCGEL 187
            QFFI   K  WLDN+HVVFG+V+ +G+ V++ IE+      +RPK  VVI++CGE+
Sbjct: 143 CQFFITCAKCDWLDNKHVVFGRVLGDGLLVMRKIENVAIGPNNRPKLAVVITECGEM 199


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,060,533,628
Number of Sequences: 1806583
Number of extensions: 21371952
Number of successful extensions: 54747
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 51757
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53926
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 81486358910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)