BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8402
         (985 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T44259|T44259 lipoic acid synthase (EC 2.8.1.-) [imported] -...   298   e-100   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00224_1697001 Oryza sativa genomic DNA, chromosome 4, BAC...   289   8e-98   
gb:AB060812_1521944 Bruguiera gymnorhiza LAS mRNA for lipoic aci...   288   7e-97   
gb:AX155065_1462771 Sequence 111 from Patent WO0138484.               272   1e-88   
gb:BC056561_2551834 Danio rerio zgc:66080, mRNA (cDNA clone MGC:...   190   3e-60   
gb:AE014296_1137187 Drosophila melanogaster chromosome 3L, compl...   183   2e-59   
gb:BC083708_2108781 Rattus norvegicus lipoic acid synthetase (pr...   192   2e-59   
sp|Q99M04|LIAS_MOUSE|LIAS_MOUSE Lipoic acid synthetase, mitochondrial precu...   191   2e-59   Mus musculus [mouse]
sp|O43766|LIAS_HUMAN|LIAS_HUMAN Lipoic acid synthetase, mitochondrial precu...   187   2e-59   Homo sapiens [man]
gb:BC072900_2556824 Xenopus laevis MGC80349 protein, mRNA (cDNA ...   191   1e-58   
gb:TGO556158_1400187 Toxoplasma gondii mRNA for lipoic acid synt...   178   2e-58   
gb:AY085458_1570527 Arabidopsis thaliana clone 152427 mRNA, comp...   175   2e-58   
gb:AB073745_1523216 Arabidopsis thaliana LIP1p gene for lipoic a...   175   2e-58   
gb:AK031851_1162622 Mus musculus adult male medulla oblongata cD...   187   2e-58   
gb:AP003106_1824761 Oryza sativa (japonica cultivar-group) genom...   174   3e-58   
pir|T23655|T23655 hypothetical protein M01F1.3 - Caenorhabditis ...   182   4e-58   Caenorhabditis elegans [roundworm]
gb:PFMAL13_1191497 Plasmodium falciparum 3D7 chromosome 13, *** ...   180   2e-57   
gb:AC108873_1738584 Oryza sativa (japonica cultivar-group) chrom...   170   6e-57   
gb:AE016820_1750185 Ashbya gossypii (= Eremothecium gossypii) AT...   177   1e-56   
gb:CR382126_1658380 Kluyveromyces lactis strain NRRL Y-1140 chro...   177   2e-56   
gb:CR380955_1651985 Candida glabrata strain CBS138 chromosome I ...   178   5e-56   
gb:CR382131_1663895 Yarrowia lipolytica chromosome E of strain C...   179   6e-56   
sp|O13642|LIPA_SCHPO|LIPA_SCHPO Probable lipoic acid synthetase, mitochondr...   174   2e-54   Schizosaccharomyces pombe
gb:AB004537_1509128 Schizosaccharomyces pombe 37 kb genomic DNA,...   174   2e-54   
gb:AE017352_1759678 Cryptococcus neoformans var. neoformans JEC2...   172   2e-54   
gb:CR382139_1672856 Debaryomyces hansenii chromosome G of strain...   171   5e-54   
sp|P32875|LIP5_YEAST|LIP5_YEAST Lipoic acid synthetase, mitochondrial precu...   169   1e-53   Saccharomyces cerevisiae [brewer's yeast]
gb:AY596297_634156 Haloarcula marismortui ATCC 43049 chromosome ...   159   2e-51   
sp|Q9HN78|LIPA_HALN1|LIPA_HALN1 Probable lipoyl synthase (EC 2.8.1.-) (Lipo...   152   1e-49   Halobacterium sp.
gb:CR628337_113979 Legionella pneumophila str. Lens complete gen...   162   1e-48   
gb:ATF8L15_1551228 Arabidopsis thaliana DNA chromosome 5, BAC cl...   144   7e-48   
gb:CR628336_110922 Legionella pneumophila str. Paris complete ge...   159   9e-48   
gb:AE017307_437381 Thermus thermophilus HB27 section 7 of 7 of t...   154   2e-47   
gb:AY774691_2149404 Synthetic construct Francisella tularensis c...   153   4e-46   
gb:AJ749949_531110 Francisella tularensis subsp. tularensis comp...   153   4e-46   
sp|Q9RWA4|LIPA_DEIRA|LIPA_DEIRA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   152   9e-45   Deinococcus radiodurans
gb:AF153678_483839 Myxococcus xanthus lipoic acid synthetase pre...   153   3e-44   
gb:LMFL4738_1388077 Leishmania major Friedlin chromosome 19 cosm...   152   9e-44   
gb:AE017261_419567 Picrophilus torridus DSM 9790, complete genome.    142   2e-43   
gb:AF210624_1777355 Eremothecium gossypii Slk19 (SLK19) gene, pa...   177   2e-43   
sp|Q9Y9E3|LIPA_AERPE|LIPA_AERPE Probable lipoyl synthase (EC 2.8.1.-) (Lipo...   139   5e-43   Aeropyrum pernix
sp|Q8ZUR9|LIPA_PYRAE|LIPA_PYRAE Probable lipoyl synthase (EC 2.8.1.-) (Lipo...   151   1e-42   Pyrobaculum aerophilum
sp|Q97U63|LIPA_SULSO|LIPA_SULSO Probable lipoyl synthase (EC 2.8.1.-) (Lipo...   137   1e-41   Saccharolobus solfataricus
sp|Q8R9E1|LIPA_THETN|LIPA_THETN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   137   6e-40   
gb:CR543861_104160 Acinetobacter sp. ADP1 complete genome.            125   3e-37   
gb:AP006841_571503 Bacteroides fragilis YCH46 DNA, complete genome.   120   4e-36   
sp|Q57390|LIPA_PELCA|LIPA_PELCA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   130   6e-36   Pelobacter carbinolicus
sp|P44463|LIPA_HAEIN|LIPA_HAEIN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   113   1e-35   Haemophilus influenzae
gb:CP000030_83679 Anaplasma marginale str. St. Maries, complete ...   123   3e-35   
gb:AP006618_558081 Nocardia farcinica IFM 10152 DNA, complete ge...   128   4e-35   
gb:AE017340_456722 Idiomarina loihiensis L2TR, complete genome.       130   9e-35   
sp|P61199|LIPA_TREDE|LIPA_TREDE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   127   9e-35   Treponema denticola
sp|Q88DM5|LIPA_PSEPK|LIPA_PSEPK Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   117   1e-34   Pseudomonas putida
gb:AY659260_2148270 Synthetic construct Peudomonas aeruginosa cl...   119   2e-34   
sp|Q9HX25|LIPA_PSEAE|LIPA_PSEAE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   119   2e-34   Pseudomonas aeruginosa
sp|Q10380|LIPA_MYCTU|LIPA_MYCTU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   125   2e-34   Mycobacterium tuberculosis
gb:CR767821_116890 Ehrlichia ruminantium strain Welgevonden, com...   117   2e-34   
gb:AE017321_441936 Wolbachia endosymbiont strain TRS of Brugia m...   117   3e-34   
sp|P57978|LIPA_PASMU|LIPA_PASMU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   107   4e-34   Pasteurella multocida
sp|O67368|LIPA_AQUAE|LIPA_AQUAE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   119   4e-34   Aquifex aeolicus
gb:AE016827_343455 Mannheimia succiniciproducens MBEL55E, comple...   108   7e-34   
sp|P73572|LIP2_SYNY3|LIP2_SYNY3 Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   122   9e-34   Synechocystis sp.
sp|Q8PPL8|LIPA_XANAC|LIPA_XANAC Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   116   1e-33   Xanthomonas citri
sp|Q9A7I8|LIPA_CAUCR|LIPA_CAUCR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   112   1e-33   Caulobacter vibrioides
sp|O32962|LIPA_MYCLE|LIPA_MYCLE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   121   2e-33   Mycobacterium leprae
sp|Q8DFD1|LIPA_VIBVU|LIPA_VIBVU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   118   2e-33   Vibrio vulnificus
sp|Q8P590|LIPA_XANCP|LIPA_XANCP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   116   3e-33   Xanthomonas campestris pv. campestris
sp|Q98MY2|LIPA_RHILO|LIPA_RHILO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   114   3e-33   Mesorhizobium loti
sp|Q8YXD1|LIP2_ANASP|LIP2_ANASP Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   112   3e-33   Anabaena sp.
gb:CR543861_103002 Acinetobacter sp. ADP1 complete genome.            111   4e-33   
gb:AE013598_297653 Xanthomonas oryzae pv. oryzae KACC10331, comp...   115   4e-33   
sp|Q7VKB1|LIPA_HAEDU|LIPA_HAEDU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   109   4e-33   [Haemophilus] ducreyi
sp|Q8CPW4|LIPA_STAEP|LIPA_STAEP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   119   5e-33   Staphylococcus epidermidis
sp|P61200|LIPA_WOLPM|LIPA_WOLPM Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   118   5e-33   Wolbachia endosymbiont of Drosophila melanogaster
gb:AE017293_433850 Leptospira interrogans serovar Copenhageni st...   117   8e-33   
sp|Q8NNJ0|LIPA_CORGL|LIPA_CORGL Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   121   1e-32   Corynebacterium glutamicum
sp|Q8YHE2|LIPA_BRUME|LIPA_BRUME Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   112   1e-32   
sp|Q9PDW0|LIPA_XYLFA|LIPA_XYLFA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   115   3e-32   Xylella fastidiosa
sp|Q87VW7|LIPA_PSESM|LIPA_PSESM Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   113   3e-32   Pseudomonas syringae pv. tomato
sp|Q99VF2|LIPA_STAAM|LIPA_STAAM Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   119   3e-32   Staphylococcus aureus
sp|Q8DLC2|LIP1_SYNEL|LIP1_SYNEL Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   111   3e-32   Synechococcus elongatus
gb:AE004969_60536 Neisseria gonorrhoeae FA 1090, complete genome.     110   4e-32   
sp|Q9JZA5|LIPA_NEIMB|LIPA_NEIMB Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   110   4e-32   Neisseria meningitidis serogroup B
sp|Q9JUC8|LIPA_NEIMA|LIPA_NEIMA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   110   4e-32   
gb:BC087803_2565453 Xenopus tropicalis hypothetical LOC496674, m...   140   4e-32   
sp|Q8UFG1|LIPA_AGRT5|LIPA_AGRT5 Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   109   5e-32   Agrobacterium tumefaciens
gb:CR378672_96216 Photobacterium profundum SS9; segment 10/12.        112   5e-32   
sp|Q8F3V7|LIPA_LEPIN|LIPA_LEPIN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   117   5e-32   
gb:AE016851_348988 Tropheryma whipplei str. Twist, section 2 of ...   125   6e-32   
sp|Q83NN8|LIPA_TROW8|LIPA_TROW8 Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   125   6e-32   Tropheryma whipplei
gb:BA000039_726397 Thermosynechococcus elongatus BP-1 DNA, compl...   117   6e-32   
sp|Q8DL83|LIP2_SYNEL|LIP2_SYNEL Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   117   6e-32   Synechococcus elongatus
gb:BX248358_762912 Corynebacterium diphtheriae gravis NCTC13129,...   119   8e-32   
sp|P61194|LIPA_CORDI|LIPA_CORDI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   119   8e-32   Corynebacterium diphtheriae
sp|Q92Q94|LIPA_RHIME|LIPA_RHIME Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   110   8e-32   Sinorhizobium meliloti
sp|Q87DZ9|LIPA_XYLFT|LIPA_XYLFT Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   112   1e-31   Xylella fastidiosa
gb:AP008231_582187 Synechococcus elongatus PCC 6301 DNA, complet...   113   1e-31   
sp|Q89LR6|LIP1_BRAJA|LIP1_BRAJA Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   102   2e-31   Bradyrhizobium japonicum
gb:AE017197_402689 Rickettsia typhi str. Wilmington complete gen...   107   2e-31   
sp|Q8YWC1|LIP1_ANASP|LIP1_ANASP Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   111   2e-31   Anabaena sp.
gb:AE016822_340105 Leifsonia xyli subsp. xyli str. CTCB07, compl...   117   3e-31   
gb:BX950851_840044 Erwinia carotovora subsp. atroseptica SCRI104...   111   3e-31   
sp|Q82UJ5|LIPA_NITEU|LIPA_NITEU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   112   3e-31   Nitrosomonas europaea
gb:AE017312_439158 Desulfovibrio vulgaris subsp. vulgaris str. H...   110   4e-31   
gb:CP000010_864515 Burkholderia mallei ATCC 23344 chromosome 1, ...   105   7e-31   
gb:BX571965_790190 Burkholderia pseudomallei strain K96243, chro...   105   7e-31   
gb:AE008692_240870 Zymomonas mobilis subsp. mobilis ZM4, complet...   111   9e-31   
sp|Q9RNY7|LIPA_ZYMMO|LIPA_ZYMMO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   111   9e-31   Zymomonas mobilis subsp. mobilis
sp|O05941|LIPA_RHIET|LIPA_RHIET Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   111   9e-31   Rhizobium etli
sp|O05959|LIPA_RICPR|LIPA_RICPR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   106   9e-31   Rickettsia prowazekii
gb:BX897699_827206 Bartonella henselae strain Houston-1, complet...   110   1e-30   
sp|Q8ZDH0|LIPA_YERPE|LIPA_YERPE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   107   1e-30   Yersinia pestis
gb:AE017131_386938 Yersinia pestis biovar Medievalis str. 91001 ...   107   1e-30   
sp|P61196|LIPA_GEOSL|LIPA_GEOSL Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   111   1e-30   Geobacter sulfurreducens
sp|Q83C63|LIPA_COXBU|LIPA_COXBU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   112   2e-30   Coxiella burnetii
pir|A97843|A97843 lipoic acid synthetase [imported] - Rickettsia...   105   2e-30   Rickettsia conorii
sp|Q92GH8|LIPA_RICCN|LIPA_RICCN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   105   2e-30   Rickettsia conorii
sp|Q7W222|LIPA_BORPA|LIPA_BORPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   103   2e-30   Bordetella parapertussis
gb:BX897700_828734 Bartonella quintana str. Toulouse, complete g...   109   2e-30   
sp|Q7WR00|LIPA_BORBR|LIPA_BORBR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   103   3e-30   Bordetella bronchiseptica
sp|Q8ZR04|LIPA_SALTY|LIPA_SALTY Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   106   4e-30   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q89NW6|LIP2_BRAJA|LIP2_BRAJA Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   100   4e-30   Bradyrhizobium japonicum
sp|P61198|LIPA_RHOPA|LIPA_RHOPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   107   4e-30   Rhodopseudomonas palustris
sp|Q7V507|LIP1_PROMM|LIP1_PROMM Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   114   4e-30   Prochlorococcus marinus
sp|Q8Z8I3|LIPA_SALTI|LIPA_SALTI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   105   6e-30   Salmonella enterica subsp. enterica serovar Typhi
gb:ECOLIPAB_129280 E.coli lipoic acid biosynthesis lipA, lipB, a...   107   7e-30   
sp|P60718|LIPA_ECO57|LIPA_ECO57 Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   107   7e-30   Escherichia coli O157:H7
sp|Q8D325|LIPA_WIGBR|LIPA_WIGBR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   110   7e-30   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
sp|Q7NTF9|LIPA_CHRVO|LIPA_CHRVO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   105   7e-30   Chromobacterium violaceum
gb:ECOLIP_129273 Escherichia coli lipoic acid synthetase (lip) g...   107   8e-30   
pir|F85562|F85562 lipoate synthesis, sulfur insertion [imported]...   107   1e-29   Escherichia coli [E. coli]
sp|Q9S2P2|LIPA_STRCO|LIPA_STRCO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   114   1e-29   
sp|Q82AP7|LIPA_STRAW|LIPA_STRAW Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   115   2e-29   Streptomyces avermitilis
sp|Q7U4D9|LIP1_SYNPX|LIP1_SYNPX Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   106   2e-29   Synechococcus sp.
gb:CP000009_864270 Gluconobacter oxydans 621H, complete genome.       103   3e-29   
sp|Q9Z774|LIPA_CHLPN|LIPA_CHLPN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   117   4e-29   Chlamydia pneumoniae
sp|P72980|LIP1_SYNY3|LIP1_SYNY3 Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   110   5e-29   Synechocystis sp.
sp|Q8ERL8|LIPA_OCEIH|LIPA_OCEIH Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   130   5e-29   Oceanobacillus iheyensis
sp|O84562|LIPA_CHLTR|LIPA_CHLTR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   115   6e-29   Chlamydia trachomatis
gb:AP006840_569342 Symbiobacterium thermophilum DNA, complete ge...   129   9e-29   
gb:CR555306_107126 Azoarcus sp. EbN1 complete genome.                 103   1e-28   
sp|Q7V9Z9|LIP1_PROMA|LIP1_PROMA Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   110   1e-28   Prochlorococcus marinus
sp|Q7V0Z8|LIP2_PROMP|LIP2_PROMP Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   101   2e-28   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
sp|Q8Y2L3|LIPA_RALSO|LIPA_RALSO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   100   2e-28   Ralstonia solanacearum
gb:AP008231_580674 Synechococcus elongatus PCC 6301 DNA, complet...   106   2e-28   
sp|Q8A029|LIPA_BACTN|LIPA_BACTN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   127   3e-28   Bacteroides thetaiotaomicron
sp|Q7UZY1|LIP1_PROMP|LIP1_PROMP Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   109   3e-28   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
sp|P61197|LIPA_MYCPA|LIPA_MYCPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   127   4e-28   Mycobacterium avium subsp. paratuberculosis
sp|Q9PJI2|LIPA_CHLMU|LIPA_CHLMU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   116   7e-28   Chlamydia muridarum [agent of mouse pneumonitis]
sp|Q821K6|LIPA_CHLCV|LIPA_CHLCV Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   119   9e-28   Chlamydia caviae
gb:CR522870_99141 Desulfotalea psychrophila LSv54 chromosome.         102   1e-27   
sp|Q9EYP3|LIPA_BURPS|LIPA_BURPS Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   100   1e-27   Burkholderia pseudomallei
sp|Q7NFJ9|LIP1_GLOVI|LIP1_GLOVI Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid...   125   1e-27   Gloeobacter violaceus
sp|Q7MWT4|LIPA_PORGI|LIPA_PORGI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   125   2e-27   Porphyromonas gingivalis
sp|Q89AL7|LIPA_BUCBP|LIPA_BUCBP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   104   2e-27   
sp|Q7UH37|LIPA_RHOBA|LIPA_RHOBA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   103   3e-27   Rhodopirellula baltica
sp|Q8K9Q2|LIPA_BUCAP|LIPA_BUCAP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   100   4e-27   
gb:HSAJ4162_2010364 Homo sapiens mRNA for putative lipoic acid s...   121   2e-26   
sp|Q8KDH2|LIPA_CHLTE|LIPA_CHLTE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   120   3e-26   Chlorobaculum tepidum
sp|Q9K7C9|LIPA_BACHD|LIPA_BACHD Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   120   3e-26   Bacillus halodurans
gb:AE017283_430478 Propionibacterium acnes KPA171202, complete g...   100   3e-26   
gb:AP006627_565268 Bacillus clausii KSM-K16 DNA, complete genome.     119   7e-26   
gb:CP000020_870918 Vibrio fischeri ES114 chromosome I, complete ...   119   1e-25   
sp|Q9KTF9|LIPA_VIBCH|LIPA_VIBCH Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   118   2e-25   
gb:CP000002_859003 Bacillus licheniformis ATCC 14580, complete g...   116   6e-25   
gb:AE017333_449212 Bacillus licheniformis DSM 13, complete genome.    116   6e-25   
sp|Q87RR1|LIPA_VIBPA|LIPA_VIBPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   116   6e-25   
sp|Q816A0|LIPA_BACCR|LIPA_BACCR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   116   6e-25   Bacillus cereus
sp|P57357|LIPA_BUCAI|LIPA_BUCAI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...    97   6e-25   
sp|Q8FNP4|LIPA_COREF|LIPA_COREF Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   116   8e-25   Corynebacterium efficiens
sp|Q81XM8|LIPA_BACAN|LIPA_BACAN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   116   8e-25   Bacillus anthracis [anthrax]
gb:AE017280_426309 Bacillus cereus ATCC 10987, section 17 of 18 ...   115   1e-24   
gb:AE017282_426946 Methylococcus capsulatus str. Bath, complete ...   115   1e-24   
gb:BA000043_739551 Geobacillus kaustophilus HTA426 DNA, complete...   112   1e-23   
sp|Q7V6S0|LIP2_PROMM|LIP2_PROMM Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   111   2e-23   Prochlorococcus marinus
sp|Q7NLU2|LIP2_GLOVI|LIP2_GLOVI Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...    91   3e-23   Gloeobacter violaceus
gb:YSCLIPOIC_1729812 Saccharomyces cerevisiae (clone pg189/ST3) ...    68   3e-23   
pir|D70023|D70023 lipoic acid synthetase (EC 2.8.1.-) yutB - Bac...   110   4e-23   Bacillus subtilis
sp|Q8EHQ6|LIPA_SHEON|LIPA_SHEON Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   110   4e-23   Shewanella oneidensis
sp|O32129|LIPA_BACSU|LIPA_BACSU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   110   4e-23   Bacillus subtilis
sp|Q7U7Q2|LIP2_SYNPX|LIP2_SYNPX Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   109   7e-23   Synechococcus sp.
sp|Q7N767|LIPA_PHOLL|LIPA_PHOLL Lipoyl synthase (EC 2.8.1.-) (Lipoic acid s...   108   2e-22   Photorhabdus laumondii subsp. laumondii
gb:CP000031_86130 Silicibacter pomeroyi DSS-3, complete genome.       107   3e-22   
sp|Q7VBJ3|LIP2_PROMA|LIP2_PROMA Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid...   104   2e-21   Prochlorococcus marinus
gb:BX908798_829708 Parachlamydia-related symbiont UWE25, complet...   102   9e-21   
gb:AB004538_1509129 Schizosaccharomyces pombe 39 kb genomic DNA,...    62   2e-19   
gb:AE014296_1137188 Drosophila melanogaster chromosome 3L, compl...    42   0.014   
pir|F72462|F72462 hypothetical protein APE2345 - Aeropyrum perni...    35   0.100   Aeropyrum pernix
gb:AC117072_1207653 Dictyostelium discoideum chromosome 2 map 38...    38   0.27    
pir|B69037|B69037 conserved hypothetical protein MTH1279 - Metha...    38   0.35    Methanothermobacter thermautotrophicus str. Delta H
pir|AD0673|AD0673 osmotically inducible protein C [imported] - S...    36   1.3     Salmonella enterica subsp. enterica serovar Typhi
gb:BX572599_801658 Rhodopseudomonas palustris CGA009 complete ge...    35   1.7     
pir|AI3047|AI3047 biotin synthetase [imported] - Agrobacterium t...    35   1.7     Agrobacterium fabrum str. C58
gb:AE017255_417773 Treponema denticola ATCC 35405, section 10 of...    35   2.3     
pir|C84465|C84465 hypothetical protein At2g05120 [imported] - Ar...    35   2.3     Arabidopsis thaliana [mouse-ear cress]
gb:CP000009_864011 Gluconobacter oxydans 621H, complete genome.        34   3.9     
gb:AE014292_310062 Brucella suis 1330 chromosome II, complete se...    34   3.9     
pir|AC1715|AC1715 hypothetical protein homolog lin2263 [imported...    34   3.9     Listeria innocua
pir|AH1344|AH1344 hypothetical protein lmo2160 [imported] - List...    34   3.9     Listeria monocytogenes
pir|AF3606|AF3606 biotin synthase (EC 2.8.1.6) [imported] - Bruc...    34   3.9     Brucella melitensis
sp|P36569|BIOB_SERMA|BIOB_SERMA Biotin synthase (EC 2.8.1.6) (Biotin synthe...    34   5.0     Serratia marcescens
gb:AE017231_411988 Mycobacterium avium subsp. paratuberculosis s...    33   6.6     
gb:AB031297_1194870 Sarcophaga peregrina mRNA for 120-kDa protei...    33   8.6     
gb:AE017329_444610 Listeria monocytogenes str. 4b F2365, section...    33   8.6     


>pir|T44259|T44259 lipoic acid synthase (EC 2.8.1.-) [imported] -
           Arabidopsis thaliana>gb:AB007987_1510332 Arabidopsis
           thaliana LIP1 mRNA for Lipoic acid synthase, complete
           cds.>gb:AC006234_1533808 Arabidopsis thaliana chromosome
           2 clone F5H14 map mi148, complete
           sequence.>gb:AY035143_1559912 Arabidopsis thaliana
           putative lipoic acid synthase LIP1 (At2g20860) mRNA,
           complete cds.>gb:AY059077_1564442 Arabidopsis thaliana
           putative lipoic acid synthase LIP1 (At2g20860) mRNA,
           complete cds.>gb:AF424583_1798922 Arabidopsis thaliana
           At2g20860/F5H14.17 mRNA, complete cds.
          Length = 374

 Score =  298 bits (762), Expect(2) = e-100
 Identities = 144/162 (88%), Positives = 156/162 (96%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           ALVPDFRGD  CVEKV+KSGLDV AHNIETVEELQS VRDHRANFKQS+DVL MAK+YAP
Sbjct: 208 ALVPDFRGDGGCVEKVSKSGLDVLAHNIETVEELQSFVRDHRANFKQSLDVLRMAKEYAP 267

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
           AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TP+AFE
Sbjct: 268 AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPDAFE 327

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 321
           +Y++LGMEMGFRYVASGPMVRSSYKAGE+YIKSMIE+DR AS
Sbjct: 328 RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIEADRVAS 369



 Score = 90.9 bits (224), Expect(2) = e-100
 Identities = 43/49 (87%), Positives = 46/49 (93%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +NVAEAIASWG+DYVVITSVDRDDLPDQGSGHF ETVQ+LK LKP MLI
Sbjct: 158 NNVAEAIASWGVDYVVITSVDRDDLPDQGSGHFAETVQRLKFLKPEMLI 206



>gb:OSJN00224_1697001 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0006M15, complete sequence.
          Length = 382

 Score =  289 bits (739), Expect(2) = 8e-98
 Identities = 140/163 (85%), Positives = 154/163 (94%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           ALVPDFRGDP+CVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQS+DVL +AK+YAP
Sbjct: 217 ALVPDFRGDPACVEKVATSGLHVFAHNIETVEELQRNVRDHRANFKQSIDVLKLAKEYAP 276

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
           AGTLTKTSIMLGCGETPDQV+ T EKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct: 277 AGTLTKTSIMLGCGETPDQVISTTEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE 336

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASS 318
           +Y+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE+DRA ++
Sbjct: 337 RYRSLGVDMGFRYVASGPMVRSSYKAGEFYIKAMIEADRAKAT 379



 Score = 92.0 bits (227), Expect(2) = 8e-98
 Identities = 43/49 (87%), Positives = 46/49 (93%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           SNVA+AIASWGL+Y+VITSVDRDDLPDQGSGHF ETVQKLK LKP MLI
Sbjct: 167 SNVAQAIASWGLEYIVITSVDRDDLPDQGSGHFAETVQKLKVLKPEMLI 215



>gb:AB060812_1521944 Bruguiera gymnorhiza LAS mRNA for lipoic acid
           synthase, complete cds.
          Length = 375

 Score =  288 bits (736), Expect(2) = 7e-97
 Identities = 141/163 (86%), Positives = 156/163 (95%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF+GD SCVEKVA +GLDVFAHNIETVEELQSVVRD+RANFKQS++VLM A++++P
Sbjct: 206 ALTPDFQGDKSCVEKVATAGLDVFAHNIETVEELQSVVRDNRANFKQSLEVLMAAREFSP 265

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
            GTLTKTSIMLGCGETPDQVVK+MEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAFE
Sbjct: 266 PGTLTKTSIMLGCGETPDQVVKSMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFE 325

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASS 318
           KY+VLG EMGFRYVASGPMVRSSYKAGEFYIK+MIE DRAA++
Sbjct: 326 KYKVLGDEMGFRYVASGPMVRSSYKAGEFYIKNMIERDRAAAA 368



 Score = 90.1 bits (222), Expect(2) = 7e-97
 Identities = 43/49 (87%), Positives = 46/49 (93%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +NVAEAIASWGLDYVV+TSVDRDDL DQGS HF ETVQ+LKALKPNMLI
Sbjct: 156 ANVAEAIASWGLDYVVLTSVDRDDLADQGSNHFRETVQRLKALKPNMLI 204



>gb:AX155065_1462771 Sequence 111 from Patent WO0138484.
          Length = 396

 Score =  272 bits (696), Expect(2) = 1e-88
 Identities = 132/159 (83%), Positives = 147/159 (92%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           ALVPDFRGDP+CVE+VA SGLDVFAHNIETVEELQS VRD RANFKQS+DVL MAK +AP
Sbjct: 229 ALVPDFRGDPACVERVATSGLDVFAHNIETVEELQSSVRDRRANFKQSLDVLRMAKKFAP 288

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
            GTLTKTSIMLGCGETP QVVK M+ VRAAGVDVMT GQYMRP+KRHMPVSE++TPEAFE
Sbjct: 289 PGTLTKTSIMLGCGETPAQVVKAMKSVRAAGVDVMTLGQYMRPTKRHMPVSEFVTPEAFE 348

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
           +Y+ LG+E+GFRYVASGPMVRSSYKAGE++IKSMI+ DR
Sbjct: 349 EYRKLGVELGFRYVASGPMVRSSYKAGEYFIKSMIDEDR 387



 Score = 78.2 bits (191), Expect(2) = 1e-88
 Identities = 35/47 (74%), Positives = 40/47 (85%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEAI +WGLDYVV+TSVDRDD+PDQGS HF ETV+ LK  KP ML+
Sbjct: 181 VAEAIVAWGLDYVVLTSVDRDDMPDQGSAHFAETVKNLKERKPTMLV 227



>gb:BC056561_2551834 Danio rerio zgc:66080, mRNA (cDNA clone
           MGC:66080 IMAGE:6797146), complete cds.
          Length = 399

 Score =  190 bits (483), Expect(2) = 3e-60
 Identities = 94/155 (60%), Positives = 119/155 (76%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK    +
Sbjct: 234 LTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDPRANFDQSLSVLRHAKK-VKS 292

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             LTKTSIMLG GET  Q+  T+ ++R +GVD +T GQYM+P+KRH+ V EY+TPE F  
Sbjct: 293 SVLTKTSIMLGLGETDAQIQATLTELRDSGVDCLTLGQYMQPTKRHLKVEEYVTPEKFAF 352

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIE 339
           ++ +G EMGF Y ASGP+VRSSYKAGEF++K+++E
Sbjct: 353 WEKVGQEMGFIYTASGPLVRSSYKAGEFFLKNLLE 387



 Score = 65.1 bits (157), Expect(2) = 3e-60
 Identities = 28/48 (58%), Positives = 37/48 (77%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AIA+WGLDYVV+TSVDRDD+PD G+ HF +TV  +K     +L+
Sbjct: 184 NTAKAIAAWGLDYVVLTSVDRDDIPDGGAEHFAKTVSNIKERNSKILV 231



>gb:AE014296_1137187 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003591_1216886 Drosophila melanogaster
           chromosome 3L, section 72 of 83 of the complete
           sequence.>gb:AY058557_1291711 Drosophila melanogaster
           LD24887 full length cDNA.>gb:BT003750_1357067 Drosophila
           melanogaster RH26374 full insert cDNA.
          Length = 380

 Score =  183 bits (465), Expect(2) = 2e-59
 Identities = 87/156 (55%), Positives = 121/156 (77%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           LVPDFRG+  CV+ +A SGLDV+AHNIETVE+L   VRD RA+++Q++ VL  AK + P 
Sbjct: 212 LVPDFRGNLECVKTIANSGLDVYAHNIETVEKLTPYVRDRRAHYRQTLQVLTEAKRFNP- 270

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             +TK+SIMLG GET +++  T++ +R AGVD +T GQYM+P+ +H+ V EY+TPE F+ 
Sbjct: 271 NLITKSSIMLGLGETDEEIENTLKDLREAGVDCVTLGQYMQPTNKHLKVIEYVTPEKFKH 330

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIES 336
           ++  G E+GF Y ASGP+VRSSYKAGEF+I S++E+
Sbjct: 331 WEERGNELGFLYTASGPLVRSSYKAGEFFITSILEN 366



 Score = 69.7 bits (169), Expect(2) = 2e-59
 Identities = 31/48 (64%), Positives = 38/48 (79%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A AIASWGLDY+V+TSVDRDDLPD GS H  ETV+++KA   N+ +
Sbjct: 162 NTATAIASWGLDYIVLTSVDRDDLPDGGSEHIAETVREIKARNSNIFV 209



>gb:BC083708_2108781 Rattus norvegicus lipoic acid synthetase
           (predicted), mRNA (cDNA clone MGC:94598 IMAGE:7190554),
           complete cds.
          Length = 373

 Score =  192 bits (488), Expect(2) = 2e-59
 Identities = 95/154 (61%), Positives = 120/154 (77%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P 
Sbjct: 211 LTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVQP- 269

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             ++KTSIMLG GET +QV  TM+ +RAA VD +T GQYM+P+KRH+ V EY+TPE F+ 
Sbjct: 270 DVVSKTSIMLGLGETDEQVYATMKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKY 329

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMI 342
           ++ +G E+GF Y ASGP+VRSSYKAGEF++K+++
Sbjct: 330 WEEVGNELGFHYTASGPLVRSSYKAGEFFLKNLV 363



 Score = 60.8 bits (146), Expect(2) = 2e-59
 Identities = 28/48 (58%), Positives = 34/48 (70%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A AIA WGLDYVV+TSVDRDD+ D G+ H  +TV  LK   P +L+
Sbjct: 161 NTARAIAEWGLDYVVLTSVDRDDVVDGGAEHIAKTVSCLKERNPKILV 208



>sp|Q99M04|LIAS_MOUSE Lipoic acid synthetase, mitochondrial
           precursor (Lip-syn) (Lipoate synthase)
           (mLIP1).>gb:AK048744_1168491 Mus musculus 0 day neonate
           cerebellum cDNA, RIKEN full-length enriched library,
           clone:C230036L07 product:lipoic acid synthetase, full
           insert sequence.>gb:AK049548_1168852 Mus musculus 7 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:C430024E13 product:lipoic acid
           synthetase, full insert sequence.>gb:AK077192_1171722
           Mus musculus adult male testis cDNA, RIKEN full-length
           enriched library, clone:4933425M12 product:lipoic acid
           synthetase, full insert sequence.>gb:AB057731_2046512
           Mus musculus mLIP1 mRNA for lipoic acid synthase,
           complete cds.>gb:BC002141_2088902 Mus musculus lipoic
           acid synthetase, mRNA (cDNA clone MGC:7254
           IMAGE:3484559), complete cds.
          Length = 373

 Score =  191 bits (485), Expect(2) = 2e-59
 Identities = 95/162 (58%), Positives = 123/162 (75%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P 
Sbjct: 211 LTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQP- 269

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             ++KTSIMLG GET +QV  T++ +RAA VD +T GQYM+P+KRH+ V EY+TPE F+ 
Sbjct: 270 DVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKY 329

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASS 318
           ++ +G E+GF Y ASGP+VRSSYKAGEF++K+++   +  +S
Sbjct: 330 WEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLVARRKTKAS 371



 Score = 61.6 bits (148), Expect(2) = 2e-59
 Identities = 28/48 (58%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AIA WGLDYVV+TSVDRDD+ D G+ H  +TV  LK   P +L+
Sbjct: 161 NTAKAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILV 208



>sp|O43766|LIAS_HUMAN Lipoic acid synthetase, mitochondrial
           precursor (Lip-syn) (Lipoate synthase)
           (HUSSY-01).>gb:BC023635_1978163 Homo sapiens lipoic acid
           synthetase, transcript variant 1, mRNA (cDNA clone
           MGC:23245 IMAGE:4841470), complete cds.
          Length = 372

 Score =  187 bits (475), Expect(2) = 2e-59
 Identities = 92/154 (59%), Positives = 117/154 (75%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFRGD   +EKVA SGLDV+AHN+ETV ELQS VRD R NF QS+ VL  AK   P 
Sbjct: 212 LTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDPRVNFDQSLRVLKHAKKVQP- 270

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P++RH+ V EYITPE F+ 
Sbjct: 271 DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKVEEYITPEKFKY 330

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMI 342
           ++ +G E+GF Y ASGP+VRSSYKAGEF++K+++
Sbjct: 331 WEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV 364



 Score = 65.5 bits (158), Expect(2) = 2e-59
 Identities = 29/48 (60%), Positives = 36/48 (75%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AIA WGLDYVV+TSVDRDD+PD G+ H  +TV  LK   P +L+
Sbjct: 162 NTAKAIAEWGLDYVVLTSVDRDDMPDGGAEHIAKTVSYLKERNPKILV 209



>gb:BC072900_2556824 Xenopus laevis MGC80349 protein, mRNA (cDNA
           clone MGC:80349 IMAGE:5074358), complete cds.
          Length = 372

 Score =  191 bits (485), Expect(2) = 1e-58
 Identities = 95/155 (61%), Positives = 120/155 (77%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFRG+   VE VAKSGLDV+AHN+ETV  LQ  VRD RANF QS++VL  AK+  P 
Sbjct: 212 LTPDFRGNMKAVETVAKSGLDVYAHNVETVPALQRHVRDPRANFDQSLNVLKHAKNVRP- 270

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             ++KTSIMLG GET +Q+  TM+ +R AGVD +T GQYM+P+KRH+ V EYITPE F+ 
Sbjct: 271 DLVSKTSIMLGLGETDEQIYSTMKALREAGVDCLTLGQYMQPTKRHLKVEEYITPEKFKY 330

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIE 339
           ++  G E+GF Y ASGP+VRSSYKAGEF++K++IE
Sbjct: 331 WEKAGNELGFLYTASGPLVRSSYKAGEFFLKNLIE 365



 Score = 59.3 bits (142), Expect(2) = 1e-58
 Identities = 27/48 (56%), Positives = 34/48 (70%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N ++AIA WGLDYVV+TSVDRDD+ D G+ H  +TV  LK     +LI
Sbjct: 162 NTSKAIAEWGLDYVVLTSVDRDDISDGGAEHIAQTVSMLKERNKTILI 209



>gb:TGO556158_1400187 Toxoplasma gondii mRNA for lipoic acid
           synthase precursor (lipA gene).
          Length = 543

 Score =  178 bits (452), Expect(2) = 2e-58
 Identities = 89/158 (56%), Positives = 118/158 (74%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           LV DF+G    V  +A+SGLDV+AHNIETV  L   VRD RA + QS+ VL +AK + P+
Sbjct: 353 LVSDFQGMEESVRTLAQSGLDVYAHNIETVRRLTPYVRDKRAKYDQSLRVLHLAKQFNPS 412

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+SIMLG GET ++VV+T+  +R   VDV+T GQY+RP+K+ + V EY+TPE F+K
Sbjct: 413 -LFTKSSIMLGLGETSEEVVRTLRDLRDHDVDVVTLGQYLRPTKQQLGVVEYVTPETFKK 471

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
           YQ +  EMGF+YVASGP+VRSSYKAGE+Y+K +I+  R
Sbjct: 472 YQDIAEEMGFKYVASGPLVRSSYKAGEYYMKHLIDDAR 509



 Score = 71.2 bits (173), Expect(2) = 2e-58
 Identities = 31/47 (65%), Positives = 39/47 (82%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+A+A W +DYVV+TSVDRDD+PD G+GHF  TVQ +K  KP+MLI
Sbjct: 304 VADAVAKWDIDYVVMTSVDRDDMPDGGAGHFARTVQLVKKAKPSMLI 350



>gb:AY085458_1570527 Arabidopsis thaliana clone 152427 mRNA,
           complete sequence.
          Length = 393

 Score =  175 bits (443), Expect(2) = 2e-58
 Identities = 85/161 (52%), Positives = 117/161 (72%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DFRGD   V+ +  SGLDVFAHN+ETV+ LQ +VRD RA ++QSM VL  AK   P 
Sbjct: 232 LTSDFRGDLEAVDTLVHSGLDVFAHNVETVKRLQRLVRDPRAGYEQSMSVLKHAKISKP- 290

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TKTSIMLG GET +++ + M  +RA  VD++T GQY++P+  H+ V EY+TPE F+ 
Sbjct: 291 GMITKTSIMLGLGETDEELKEAMADLRAIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDF 350

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 321
           ++  G  +GFRYVASGP+VRSSY+AGE ++K+M++   + S
Sbjct: 351 WKTYGESIGFRYVASGPLVRSSYRAGELFVKTMVKESYSKS 391



 Score = 74.7 bits (182), Expect(2) = 2e-58
 Identities = 32/48 (66%), Positives = 42/48 (87%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AIASWG+DY+VITSVDRDD+PD GSGHF +TV+ +K  KP+++I
Sbjct: 182 NTAKAIASWGVDYIVITSVDRDDIPDGGSGHFAQTVKAMKRHKPDIMI 229



>gb:AB073745_1523216 Arabidopsis thaliana LIP1p gene for lipoic acid
           synthase, complete cds.
          Length = 394

 Score =  175 bits (443), Expect(2) = 2e-58
 Identities = 85/161 (52%), Positives = 117/161 (72%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DFRGD   V+ +  SGLDVFAHN+ETV+ LQ +VRD RA ++QSM VL  AK   P 
Sbjct: 233 LTSDFRGDLEAVDTLVHSGLDVFAHNVETVKRLQRLVRDPRAGYEQSMSVLKHAKISKP- 291

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TKTSIMLG GET +++ + M  +RA  VD++T GQY++P+  H+ V EY+TPE F+ 
Sbjct: 292 GMITKTSIMLGLGETDEELKEAMADLRAIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDF 351

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 321
           ++  G  +GFRYVASGP+VRSSY+AGE ++K+M++   + S
Sbjct: 352 WKTYGESIGFRYVASGPLVRSSYRAGELFVKTMVKESYSKS 392



 Score = 74.7 bits (182), Expect(2) = 2e-58
 Identities = 32/48 (66%), Positives = 42/48 (87%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AIASWG+DY+VITSVDRDD+PD GSGHF +TV+ +K  KP+++I
Sbjct: 183 NTAKAIASWGVDYIVITSVDRDDIPDGGSGHFAQTVKAMKRHKPDIMI 230



>gb:AK031851_1162622 Mus musculus adult male medulla oblongata cDNA,
           RIKEN full-length enriched library, clone:6330419A18
           product:lipoic acid synthetase, full insert sequence.
          Length = 373

 Score =  187 bits (476), Expect(2) = 2e-58
 Identities = 94/162 (58%), Positives = 122/162 (75%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VR  RANF QS+ VL  AK+  P 
Sbjct: 211 LTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRVPRANFDQSLRVLRHAKEVQP- 269

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             ++KTSIMLG GET +QV  T++ +RAA VD +T GQYM+P+KRH+ V EY+TPE F+ 
Sbjct: 270 DVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKY 329

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASS 318
           ++ +G E+GF Y ASGP+VRSSYKAGEF++K+++   +  +S
Sbjct: 330 WEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLVARRKTKAS 371



 Score = 61.6 bits (148), Expect(2) = 2e-58
 Identities = 28/48 (58%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AIA WGLDYVV+TSVDRDD+ D G+ H  +TV  LK   P +L+
Sbjct: 161 NTAKAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILV 208



>gb:AP003106_1824761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0665A11.>gb:AP003371_1828644 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1143G03.
          Length = 370

 Score =  174 bits (442), Expect(2) = 3e-58
 Identities = 84/158 (53%), Positives = 117/158 (74%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DFRGD   V  +A SGLDVFAHNIETV  LQ +VRD RA + QS+ VL  AK     
Sbjct: 207 LTSDFRGDLEAVSALANSGLDVFAHNIETVRSLQRIVRDPRAGYDQSLAVLKHAKS-CKE 265

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK+SIMLG GET ++V + M  +RA GVD++T GQY++P++RH+ V EY+TPE F+ 
Sbjct: 266 GMITKSSIMLGLGETDEEVKQAMIDLRAIGVDILTLGQYLQPTERHLTVREYVTPEKFQF 325

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
           ++  G  +GFRYVASGP+VRSSY+AGE ++++++ +++
Sbjct: 326 WKEYGESVGFRYVASGPLVRSSYRAGELFVQNLVRNNK 363



 Score = 74.3 bits (181), Expect(2) = 3e-58
 Identities = 33/48 (68%), Positives = 40/48 (83%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A A+ASWG+DYVV+TSVDRDDLPD GS HF +TV+ LK LKP +L+
Sbjct: 157 NTALAVASWGVDYVVLTSVDRDDLPDGGSSHFAQTVRALKELKPGILV 204



>pir|T23655|T23655 hypothetical protein M01F1.3 - Caenorhabditis
           elegans>gb:CEM01F1_1366126 Caenorhabditis elegans cosmid
           M01F1, complete sequence.
          Length = 354

 Score =  182 bits (462), Expect(2) = 4e-58
 Identities = 88/156 (56%), Positives = 120/156 (76%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF GD   VEK+A SGLDV+AHNIETVE L   VRD RA ++QS+D L  AK+ +P 
Sbjct: 197 LLPDFAGDKISVEKMATSGLDVYAHNIETVERLTPWVRDPRAKYRQSLDALRYAKEVSPK 256

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             +TKTSIMLG GE  D++ + +  +RA+ VDV+TFGQYM+P+KRH+ V E++TPE F++
Sbjct: 257 -LITKTSIMLGLGEAEDEIKQCLADLRASNVDVVTFGQYMQPTKRHLLVKEWVTPEKFDQ 315

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIES 336
           +     ++GF YVASGP+VRSSYKAGEFY+K+++ +
Sbjct: 316 WAEYSKKLGFLYVASGPLVRSSYKAGEFYLKNVLRN 351



 Score = 66.2 bits (160), Expect(2) = 4e-58
 Identities = 28/48 (58%), Positives = 38/48 (79%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N + A+ASWG++Y+V+TSVDRDDLPD G+ H  +TVQ +K  KP +LI
Sbjct: 147 NTSTAVASWGVEYIVLTSVDRDDLPDGGADHLRKTVQLMKLKKPELLI 194



>gb:PFMAL13_1191497 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 415

 Score =  180 bits (457), Expect(2) = 2e-57
 Identities = 87/154 (56%), Positives = 119/154 (77%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           LV DF+G+   V K+A SGLDV+AHNIETV+ LQ  VRD RAN+ QS+ VL  AK+  P 
Sbjct: 254 LVSDFQGNIDSVRKLAFSGLDVYAHNIETVKRLQKYVRDKRANYDQSLFVLKTAKEINPQ 313

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TKTSIMLG GET ++V++TM   R   +DV+TFGQY+RP+K H+ + +YI+P+ FE 
Sbjct: 314 -LYTKTSIMLGLGETKEEVIQTMYDARKNNIDVITFGQYLRPTKNHLSIVQYISPQMFEY 372

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMI 342
           Y+  G++MGF+Y+ASGP+VRSSYKAGE++IK+++
Sbjct: 373 YKEEGLKMGFKYIASGPLVRSSYKAGEYFIKNLV 406



 Score = 65.5 bits (158), Expect(2) = 2e-57
 Identities = 28/48 (58%), Positives = 38/48 (79%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AI  W +DYVV+TSVDRDDLPD G+ HF +TV+ +K  +P++LI
Sbjct: 204 NTAKAICEWNIDYVVLTSVDRDDLPDGGASHFAKTVELVKFSRPDILI 251



>gb:AC108873_1738584 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1005_B11, complete
           sequence.>gb:AC130604_1740804 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone B1155G07, complete
           sequence.
          Length = 384

 Score =  170 bits (430), Expect(2) = 6e-57
 Identities = 84/159 (52%), Positives = 116/159 (72%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DFRGD   V  +A SGLDVFAHNIETV  LQ +VRD RA + QS+ VL  AK+    
Sbjct: 220 LTSDFRGDLEAVSSLASSGLDVFAHNIETVRSLQRIVRDPRAAYDQSLAVLKHAKN-CKD 278

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK+SIMLG GET ++V +TM  +RA  VD++T GQY++P++RH+ V EY+TPE F+ 
Sbjct: 279 GMVTKSSIMLGLGETDEEVKQTMCDLRAIDVDILTLGQYLQPTERHLRVREYVTPEKFDF 338

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA 327
           ++  G  +GF YVASGP+VRSSY+AGE ++++++   +A
Sbjct: 339 WKEYGESLGFLYVASGPLVRSSYRAGELFVQNLVRRKKA 377



 Score = 74.7 bits (182), Expect(2) = 6e-57
 Identities = 33/46 (71%), Positives = 40/46 (86%)
 Frame = -2

Query: 948 AEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           A A+ASWG+DYVV+TSVDRDDLPD GSGHF +TV+ LK LKP +L+
Sbjct: 172 AVAVASWGVDYVVLTSVDRDDLPDGGSGHFAQTVKALKELKPGILV 217



>gb:AE016820_1750185 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 369

 Score =  177 bits (450), Expect(2) = 1e-56
 Identities = 89/160 (55%), Positives = 119/160 (74%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DFRG+   V+ +A+SGLDV+AHN+ETVE L   VRD RA ++QS+ VL  AK   P 
Sbjct: 211 LAGDFRGNLEMVDVMARSGLDVYAHNVETVEALTPHVRDRRATYQQSLSVLKRAKQTVPT 270

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             +TKTSIMLG GET +QV++TM+ +RA   DV+TFGQYMRP++RHM V EY+ PE F+ 
Sbjct: 271 -LVTKTSIMLGMGETDEQVLQTMKDLRAVDCDVVTFGQYMRPTRRHMKVVEYVKPEKFDY 329

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA 324
           ++   +E+GF Y ASGP+VRSSYKAGE YI++++ + R A
Sbjct: 330 WKEKALELGFLYCASGPLVRSSYKAGEAYIENVLRNRRQA 369



 Score = 65.9 bits (159), Expect(2) = 1e-56
 Identities = 29/48 (60%), Positives = 37/48 (77%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI+ WGL YVV+T VDRDDLPD G+ H  ETVQ++K   P++L+
Sbjct: 161 NTAEAISRWGLGYVVLTMVDRDDLPDGGAHHLAETVQRIKQKAPHILV 208



>gb:CR382126_1658380 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 370

 Score =  177 bits (448), Expect(2) = 2e-56
 Identities = 88/151 (58%), Positives = 116/151 (76%)
 Frame = -3

Query: 794 DFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTL 615
           DFRGD   V+ +A SGLDV+AHN+ETVE L   VRD RA ++QS+ VL  AK   P   +
Sbjct: 213 DFRGDLEMVKVMALSGLDVYAHNMETVEALTPHVRDRRATYRQSLSVLECAKKTVPT-LV 271

Query: 614 TKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQV 435
           TKTS+MLG GET +QV++TM+ +RA G DV+TFGQYMRP+KRHM V EY+TPE F+ ++ 
Sbjct: 272 TKTSVMLGLGETDEQVLQTMKDLRAIGCDVITFGQYMRPTKRHMKVVEYVTPEKFDYWKQ 331

Query: 434 LGMEMGFRYVASGPMVRSSYKAGEFYIKSMI 342
             +E+GF Y ASGP+VRSSYKAGE +I++++
Sbjct: 332 KALELGFLYCASGPLVRSSYKAGESFIENVL 362



 Score = 65.9 bits (159), Expect(2) = 2e-56
 Identities = 30/48 (62%), Positives = 37/48 (77%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI+ WGL YVV+T+VDRDDL D G+ H  ETVQK+K   PN+L+
Sbjct: 160 NTAEAISRWGLGYVVLTTVDRDDLVDGGAYHLAETVQKIKQKAPNILV 207



>gb:CR380955_1651985 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 388

 Score =  178 bits (451), Expect(2) = 5e-56
 Identities = 88/155 (56%), Positives = 118/155 (76%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL  DF G+   V+ +AKSGLDV+AHN+ETVE L   VRD RA ++QS++VL  AK+  P
Sbjct: 225 ALTGDFLGNLEMVDVMAKSGLDVYAHNLETVEALTPHVRDRRAGYRQSLNVLKRAKETVP 284

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
           +  +TKTS+MLG GET DQ+++TM+ +RA   DV+TFGQYMRP+KRHM V EY+ PE F+
Sbjct: 285 S-LITKTSVMLGLGETDDQIIQTMQDLRAINCDVITFGQYMRPTKRHMKVVEYVRPEKFD 343

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMI 342
            ++    EMGF Y ASGP+VRSSYKAGE +I++++
Sbjct: 344 YWKDKAKEMGFLYCASGPLVRSSYKAGEAFIENVL 378



 Score = 63.5 bits (153), Expect(2) = 5e-56
 Identities = 29/48 (60%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI+ WGL YVV+T+VDRDDLPD G+ H  ETV K+K   P  L+
Sbjct: 176 NTAEAISRWGLGYVVLTTVDRDDLPDGGAHHLAETVIKIKQKAPKTLV 223



>gb:CR382131_1663895 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 351

 Score =  179 bits (454), Expect(2) = 6e-56
 Identities = 91/160 (56%), Positives = 119/160 (74%)
 Frame = -3

Query: 794 DFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTL 615
           DFRG+   V  +A+SGLDVFAHN+ETVE L   VRD RA F+QS+ VL  AK   P   +
Sbjct: 193 DFRGNLDHVTTLAESGLDVFAHNMETVEALTPFVRDRRATFQQSLSVLRQAKVAVP-DLI 251

Query: 614 TKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQV 435
           TKTSIMLG GET +QV  T+ ++R  GVD++TFGQYMRP+ RH+ V+EY+TPE F+ +Q 
Sbjct: 252 TKTSIMLGFGETDEQVEDTLMQLRGVGVDIVTFGQYMRPTIRHLKVAEYVTPEKFDYWQK 311

Query: 434 LGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 315
             M+MGF Y ASGP+VRSSYKAGE +I+++++   AA +V
Sbjct: 312 RAMDMGFLYCASGPLVRSSYKAGEVFIENVLKKRNAAKAV 351



 Score = 62.0 bits (149), Expect(2) = 6e-56
 Identities = 27/48 (56%), Positives = 37/48 (77%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A AI+ WGL YVV+T+VDRDDL D GS HF +TV+++K   P++L+
Sbjct: 140 NTAVAISKWGLGYVVLTTVDRDDLSDGGSWHFADTVKRIKEKAPHILV 187



>sp|O13642|LIPA_SCHPO Probable lipoic acid synthetase, mitochondrial
           precursor (Lip-syn) (Lipoate
           synthetase).>pir|T40760|T40760 lipoic acid synthetase -
           fission yeast (Schizosaccharomyces
           pombe)>gb:SPBC8D2_1720511 S.pombe chromosome II cosmid
           c8D2.
          Length = 370

 Score =  174 bits (442), Expect(2) = 2e-54
 Identities = 87/156 (55%), Positives = 116/156 (74%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF G    VE VAKSGLDVFAHN+ETVEEL   VRD RA ++QS+ VL   K   P
Sbjct: 205 ALTPDFSGRMDLVEIVAKSGLDVFAHNVETVEELTPFVRDRRATYRQSLSVLKHVKKTCP 264

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              +TKTSIMLG GET  +++ T++ +    VDV+TFGQYMRP+KRH+ V EY+ P+ FE
Sbjct: 265 H-LITKTSIMLGLGETDAEILTTLKDLLEHNVDVVTFGQYMRPTKRHLKVQEYVHPKKFE 323

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIE 339
            ++ +  ++GF YVASGP+VRSSYKAGE++++++I+
Sbjct: 324 YWKEVAEKLGFLYVASGPLVRSSYKAGEYFMENLIK 359



 Score = 61.6 bits (148), Expect(2) = 2e-54
 Identities = 26/48 (54%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI  W L Y+V+TSVDRDDL D G+ H  +T+QK+K   P++L+
Sbjct: 156 NTAEAIKQWNLGYIVLTSVDRDDLTDLGANHIAKTIQKIKEKAPHILV 203



>gb:AB004537_1509128 Schizosaccharomyces pombe 37 kb genomic DNA,
           clone c213.
          Length = 277

 Score =  174 bits (442), Expect(2) = 2e-54
 Identities = 87/156 (55%), Positives = 116/156 (74%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF G    VE VAKSGLDVFAHN+ETVEEL   VRD RA ++QS+ VL   K   P
Sbjct: 112 ALTPDFSGRMDLVEIVAKSGLDVFAHNVETVEELTPFVRDRRATYRQSLSVLKHVKKTCP 171

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              +TKTSIMLG GET  +++ T++ +    VDV+TFGQYMRP+KRH+ V EY+ P+ FE
Sbjct: 172 H-LITKTSIMLGLGETDAEILTTLKDLLEHNVDVVTFGQYMRPTKRHLKVQEYVHPKKFE 230

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIE 339
            ++ +  ++GF YVASGP+VRSSYKAGE++++++I+
Sbjct: 231 YWKEVAEKLGFLYVASGPLVRSSYKAGEYFMENLIK 266



 Score = 61.6 bits (148), Expect(2) = 2e-54
 Identities = 26/48 (54%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI  W L Y+V+TSVDRDDL D G+ H  +T+QK+K   P++L+
Sbjct: 63  NTAEAIKQWNLGYIVLTSVDRDDLTDLGANHIAKTIQKIKEKAPHILV 110



>gb:AE017352_1759678 Cryptococcus neoformans var. neoformans JEC21
           chromosome 12, complete sequence.
          Length = 395

 Score =  172 bits (436), Expect(2) = 2e-54
 Identities = 91/167 (54%), Positives = 119/167 (71%), Gaps = 4/167 (2%)
 Frame = -3

Query: 806 ALVPDFRGDP-SCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYA 630
           AL PDF     + +  VA SGLDVFAHN+ETVE     VRD RA F QS+ VL  AK  A
Sbjct: 211 ALTPDFATKGVNVIHTVASSGLDVFAHNVETVERCTPFVRDRRAGFSQSLKVLEEAKKGA 270

Query: 629 PAG---TLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP 459
            A     LTK+SIMLG GE  +++ +T+ ++RA+ VDV+TFGQYMRP+KRHM V  Y+ P
Sbjct: 271 KAAGREILTKSSIMLGVGEMEEEIHETLRRLRASDVDVVTFGQYMRPTKRHMKVDRYVEP 330

Query: 458 EAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASS 318
           E F K++ +   MGF YVASGP+VRSSYKAGEF+I+++++  RAA++
Sbjct: 331 EEFAKWKNVAEGMGFLYVASGPLVRSSYKAGEFFIENVLKKRRAAAA 377



 Score = 63.5 bits (153), Expect(2) = 2e-54
 Identities = 27/48 (56%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI+ WGL Y+V+TSVDRDDL D G+ H   T+ K+K   PN+L+
Sbjct: 162 NTAEAISRWGLGYIVLTSVDRDDLVDGGAAHIASTISKIKQKAPNILV 209



>gb:CR382139_1672856 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 401

 Score =  171 bits (434), Expect(2) = 5e-54
 Identities = 84/155 (54%), Positives = 116/155 (74%)
 Frame = -3

Query: 794 DFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTL 615
           DFRGD      +A+SGLDV+AHNIETVE L   VRD RA ++QS+ +L  AK+  P+  +
Sbjct: 220 DFRGDLDMAAILARSGLDVYAHNIETVEALTPYVRDRRATYRQSLSILNKAKETKPS-LV 278

Query: 614 TKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQV 435
           TKTS+MLG GET +Q+++T++ +R    DV+TFGQYMRP+KRHM V +Y+ PE F+ ++ 
Sbjct: 279 TKTSLMLGFGETDEQIMQTLKDLREIKCDVVTFGQYMRPTKRHMKVVDYVKPEKFDYWRD 338

Query: 434 LGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
             ++MGF YVASGP+VRSSYKAGE +I+++I   R
Sbjct: 339 TALQMGFLYVASGPLVRSSYKAGEAFIENVIRKRR 373



 Score = 63.2 bits (152), Expect(2) = 5e-54
 Identities = 28/48 (58%), Positives = 36/48 (75%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI+ WGL YVV+T+VDRDDL D G+ H  ETV+K+K   P +L+
Sbjct: 167 NTAEAISRWGLGYVVLTTVDRDDLVDGGANHLAETVRKIKEKAPQILV 214



>sp|P32875|LIP5_YEAST Lipoic acid synthetase, mitochondrial
           precursor (Lip-syn) (Lipoate
           synthase).>pir|S42159|S42159 lipoic acid synthase (EC
           2.8.1.-) precursor [validated] - yeast (Saccharomyces
           cerevisiae)>gb:AY558046_1614273 Saccharomyces cerevisiae
           clone FLH006492.01X YOR196C gene, complete
           cds.>gb:SCYOR196C_1714433 S.cerevisiae chromosome XV
           reading frame ORF YOR196c.
          Length = 414

 Score =  169 bits (429), Expect(2) = 1e-53
 Identities = 84/152 (55%), Positives = 114/152 (75%)
 Frame = -3

Query: 794 DFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTL 615
           DFRGD   V+ +A+ GLDV+AHN+ETVE L   VRD RA ++QS+ VL  AK   P+  +
Sbjct: 259 DFRGDLKMVDIMAQCGLDVYAHNLETVESLTPHVRDRRATYRQSLSVLERAKATVPS-LI 317

Query: 614 TKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQV 435
           TKTSIMLG GET +Q+ +T++ +R    DV+TFGQYMRP+KRHM V EY+ PE F+ ++ 
Sbjct: 318 TKTSIMLGLGETDEQITQTLKDLRNIQCDVVTFGQYMRPTKRHMKVVEYVKPEKFDYWKE 377

Query: 434 LGMEMGFRYVASGPMVRSSYKAGEFYIKSMIE 339
             +EMGF Y ASGP+VRSSYKAGE +I+++++
Sbjct: 378 RALEMGFLYCASGPLVRSSYKAGEAFIENVLK 409



 Score = 63.9 bits (154), Expect(2) = 1e-53
 Identities = 29/48 (60%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI  WGL YVV+T+VDRDDL D G+ H  ETV+K+K   PN L+
Sbjct: 206 NTAEAIKRWGLGYVVLTTVDRDDLVDGGANHLAETVRKIKQKAPNTLV 253



>gb:AY596297_634156 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 309

 Score =  159 bits (402), Expect(2) = 2e-51
 Identities = 80/161 (49%), Positives = 112/161 (69%), Gaps = 1/161 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF+G+P  V K+  +  DV AHNIETV+ LQ  VRD RA ++QS+ VL        +
Sbjct: 140 LIPDFQGEPDLVRKIIDADPDVIAHNIETVDRLQWPVRDRRAGYEQSLSVLRQVN--RES 197

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              +KTS+MLG GE   +V +T+  +R AGVDV+TFGQY++PS+ H+ VSEY+ P+AF+ 
Sbjct: 198 DCYSKTSLMLGVGEYAHEVYQTLSDLRQAGVDVVTFGQYLQPSRSHLEVSEYVHPDAFDT 257

Query: 443 Y-QVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA 324
           + QV   E  F Y ASGPMVRSSY+AGE +++S++   R+A
Sbjct: 258 WQQVAEAEFDFLYCASGPMVRSSYRAGELFVESVLREGRSA 298



 Score = 67.0 bits (162), Expect(2) = 2e-51
 Identities = 29/47 (61%), Positives = 39/47 (82%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+A+A  GLDYVV+TSVDRDDLPDQG+ HF ET++ +K   P++L+
Sbjct: 91  VADAVAEIGLDYVVLTSVDRDDLPDQGASHFAETIRAIKERDPSILV 137



>sp|Q9HN78|LIPA_HALN1 Probable lipoyl synthase (EC 2.8.1.-) (Lipoic
           acid synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|C84372|C84372 lipoic acid synthase
           [imported] - Halobacterium sp. NRC-1>gb:AE005108_63503
           Halobacterium sp. NRC-1 section 139 of 170 of the
           complete genome.>gb:AE004437_888422 Halobacterium sp.
           NRC-1 complete genome.
          Length = 311

 Score =  152 bits (384), Expect(2) = 1e-49
 Identities = 78/160 (48%), Positives = 109/160 (68%), Gaps = 1/160 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF+G+ S V+K+  +G DV AHNIETV   Q  VRD RA ++QS+ VL        +
Sbjct: 140 LIPDFQGEKSLVQKIIDAGPDVIAHNIETVARRQVPVRDRRAGYEQSLSVLEYVT--RES 197

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TKTSIMLG GE   +V +T+  +R AGVDV+T GQY++PS+ H+ V++Y+ P+ FE 
Sbjct: 198 DIYTKTSIMLGVGEYDHEVYQTLGDLREAGVDVVTLGQYLQPSRSHLDVADYVHPQKFET 257

Query: 443 YQ-VLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA 327
           +Q V   E GF Y ASGPMVRSSYKAGE ++ +++   ++
Sbjct: 258 WQRVAESEFGFLYCASGPMVRSSYKAGELFVDAVLREGKS 297



 Score = 67.8 bits (164), Expect(2) = 1e-49
 Identities = 29/49 (59%), Positives = 41/49 (83%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +NVAE++A  GLDYVV+TSVDRDDL DQG+GHF  T++++K   P++L+
Sbjct: 89  ANVAESVAEIGLDYVVLTSVDRDDLDDQGAGHFARTIREIKERDPSILV 137



>gb:CR628337_113979 Legionella pneumophila str. Lens complete
           genome.
          Length = 329

 Score =  162 bits (410), Expect(2) = 1e-48
 Identities = 77/158 (48%), Positives = 113/158 (71%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF+G    V  +  SGLDVFA N+ETVE L   VRD+RA ++Q+++VL  AK Y P
Sbjct: 172 ALTPDFQGSERDVAVLLDSGLDVFAQNVETVERLTHPVRDNRAGYQQTLNVLAFAKKYRP 231

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              LTKTS+MLG GET +++++TM+ +RA  VD++T GQY++P+K H+P++ Y+TPE F 
Sbjct: 232 -DVLTKTSLMLGLGETDEEIIRTMDDLRAHHVDILTLGQYLQPTKNHLPIARYVTPETFS 290

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESD 333
           + + +G++ GF  VASGP+VRSSY+A   + +  +  D
Sbjct: 291 ELRQIGLKKGFFEVASGPLVRSSYRADRVFKRDNLGLD 328



 Score = 54.7 bits (130), Expect(2) = 1e-48
 Identities = 23/44 (52%), Positives = 32/44 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           N AE +A   LDYVV+TSV+RDDLPD G+ H+ +T++ +K   P
Sbjct: 123 NTAETVALMNLDYVVLTSVNRDDLPDGGANHYAKTIRAIKKRSP 166



>gb:ATF8L15_1551228 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F8L15 (ESSA project).
          Length = 477

 Score =  144 bits (362), Expect(2) = 7e-48
 Identities = 70/132 (53%), Positives = 97/132 (73%)
 Frame = -3

Query: 770 VEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLG 591
           V+ +  SGLDVFAHN+ETV+ LQ +VRD RA ++QSM VL  AK   P G +TKTSIMLG
Sbjct: 168 VDTLVHSGLDVFAHNVETVKRLQRLVRDPRAGYEQSMSVLKHAKISKP-GMITKTSIMLG 226

Query: 590 CGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFR 411
            GET +++ + M  +RA  VD++T GQY++P+  H+ V EY+TPE F+ ++  G  +GFR
Sbjct: 227 LGETDEELKEAMADLRAIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKTYGESIGFR 286

Query: 410 YVASGPMVRSSY 375
           YVASGP++ +SY
Sbjct: 287 YVASGPLMTNSY 298



 Score = 70.5 bits (171), Expect(2) = 7e-48
 Identities = 30/42 (71%), Positives = 38/42 (90%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKAL 829
           N A+AIASWG+DY+VITSVDRDD+PD GSGHF +TV+ +KA+
Sbjct: 127 NTAKAIASWGVDYIVITSVDRDDIPDGGSGHFAQTVKAMKAV 168



>gb:CR628336_110922 Legionella pneumophila str. Paris complete
           genome.>gb:AE017354_459120 Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1, complete genome.
          Length = 329

 Score =  159 bits (402), Expect(2) = 9e-48
 Identities = 75/158 (47%), Positives = 112/158 (70%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF+G    V  +  SG+DVFA N+ETVE L   VRD+RA ++Q+++VL  AK Y P
Sbjct: 172 ALTPDFQGSERDVAVLLDSGVDVFAQNVETVERLTHPVRDNRAGYQQTLNVLAFAKKYRP 231

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              LTKTS+MLG GET +++++TM+ +R   VD++T GQY++P+K H+P++ Y+TPE F 
Sbjct: 232 -DVLTKTSLMLGLGETDEEIIQTMDDLRTHHVDILTLGQYLQPTKNHLPIARYVTPETFS 290

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESD 333
           + + +G++ GF  VASGP+VRSSY+A   + +  +  D
Sbjct: 291 ELRQIGLKKGFFEVASGPLVRSSYRADRVFKRDNLGLD 328



 Score = 54.7 bits (130), Expect(2) = 9e-48
 Identities = 23/44 (52%), Positives = 32/44 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           N AE +A   LDYVV+TSV+RDDLPD G+ H+ +T++ +K   P
Sbjct: 123 NTAETVALMNLDYVVLTSVNRDDLPDGGANHYAKTIRAIKKRSP 166



>gb:AE017307_437381 Thermus thermophilus HB27 section 7 of 7 of the
           complete genome.>gb:AP008226_577696 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1079359
           Thermus thermophilus HB27 complete genome.
          Length = 323

 Score =  154 bits (388), Expect(2) = 2e-47
 Identities = 73/153 (47%), Positives = 108/153 (70%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF+GD   VE V  +  +V+A N+ETV  L   VRD RA ++Q++ VL  AK   P
Sbjct: 169 ALTPDFQGDLKAVETVLAANPEVYAQNLETVRRLTPKVRDPRAGYEQTLKVLAHAKKVRP 228

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              LTK+S+MLG GET +++++ M  +RAAGVD++T GQY+RP+  H+PV+ Y+ PE F+
Sbjct: 229 -DILTKSSLMLGLGETEEEILEAMRDLRAAGVDILTLGQYLRPTPAHLPVARYVPPEDFK 287

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKS 348
           +Y+  G E+GFR V +GP+VRSSY+A   ++++
Sbjct: 288 RYEAWGYELGFREVFAGPLVRSSYRADRVFLEA 320



 Score = 59.3 bits (142), Expect(2) = 2e-47
 Identities = 27/47 (57%), Positives = 35/47 (74%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEAIA  G+ YVV+TSVDRDDLPD G+ HF  T++ +K   P +L+
Sbjct: 121 VAEAIARMGVRYVVLTSVDRDDLPDGGASHFAATIRAIKERAPGVLV 167



>gb:AY774691_2149404 Synthetic construct Francisella tularensis
           clone FLH153390.01X NT02FT1048 gene, complete cds.
          Length = 327

 Score =  153 bits (387), Expect(2) = 4e-46
 Identities = 74/156 (47%), Positives = 108/156 (69%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF G    ++K+  + +DV A NIETVE L   VRD RA + Q+++ L   K  +P
Sbjct: 172 ALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSP 231

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              LTKTSIM+G GET +++ KTM+  R+ GVD++T GQYM+P+K H+ V  ++TP+ FE
Sbjct: 232 -NVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFE 290

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIE 339
           +Y+ +G+E GF  VASGPMVRSSY+A   + ++ ++
Sbjct: 291 EYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLD 326



 Score = 55.1 bits (131), Expect(2) = 4e-46
 Identities = 24/48 (50%), Positives = 34/48 (70%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AE++   GL+YVV+TSVDRDDL D G+GH+  T+  +K L  N+ +
Sbjct: 123 NAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKV 170



>gb:AJ749949_531110 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 327

 Score =  153 bits (387), Expect(2) = 4e-46
 Identities = 74/156 (47%), Positives = 108/156 (69%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF G    ++K+  + +DV A NIETVE L   VRD RA + Q+++ L   K  +P
Sbjct: 172 ALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSP 231

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              LTKTSIM+G GET +++ KTM+  R+ GVD++T GQYM+P+K H+ V  ++TP+ FE
Sbjct: 232 -NVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFE 290

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIE 339
           +Y+ +G+E GF  VASGPMVRSSY+A   + ++ ++
Sbjct: 291 EYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLD 326



 Score = 55.1 bits (131), Expect(2) = 4e-46
 Identities = 24/48 (50%), Positives = 34/48 (70%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AE++   GL+YVV+TSVDRDDL D G+GH+  T+  +K L  N+ +
Sbjct: 123 NAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKV 170



>sp|Q9RWA4|LIPA_DEIRA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|A75480|A75480 lipoic acid synthase -
           Deinococcus radiodurans (strain R1)>gb:AE001931_41041
           Deinococcus radiodurans R1 section 68 of 229 of the
           complete chromosome 1.>gb:AE000513_881936 Deinococcus
           radiodurans R1 complete chromosome 1.
          Length = 331

 Score =  152 bits (383), Expect(2) = 9e-45
 Identities = 75/146 (51%), Positives = 103/146 (70%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL PDF G+ +CV+ V  SG+D +A N+ETV  L   VRD RA++ +++ VL  AK   P
Sbjct: 160 ALTPDFGGNTACVDLVLDSGVDTYAQNLETVRRLTHPVRDIRASYDRTLSVLAHAKQARP 219

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              +TKTS+MLG GET +++ + M   RAAGVDV+TFGQY+RP+  H+PV  YI+P  F+
Sbjct: 220 -DVITKTSLMLGLGETREEIREAMADCRAAGVDVLTFGQYLRPTMHHLPVERYISPAEFD 278

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +  GM++GF  V SGP+VRSSYKA
Sbjct: 279 EIREEGMQLGFLEVVSGPLVRSSYKA 304



 Score = 52.0 bits (123), Expect(2) = 9e-45
 Identities = 23/44 (52%), Positives = 33/44 (75%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           +VA+++    L YVV+TSVDRDDLPD G+ HF +TV+ +K + P
Sbjct: 111 SVADSVRLMDLKYVVLTSVDRDDLPDGGAYHFAKTVKAIKEVNP 154



>gb:AF153678_483839 Myxococcus xanthus lipoic acid synthetase
           precursor, lipoamide acyltransferase, and
           lipoate-protein ligase B genes, complete cds; and
           unknown genes.
          Length = 216

 Score =  153 bits (387), Expect(2) = 3e-44
 Identities = 76/158 (48%), Positives = 107/158 (67%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF+G    +  VA++   V AHN+ETVE L   VRD RA + QS+ VL   K+  P 
Sbjct: 55  LIPDFKGVEKDLTTVAEAKPHVVAHNVETVERLTPTVRDRRAKYHQSLRVLEYLKN-RPE 113

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G  TKTS+M+G GET  ++ +T + +R  GVDV+T GQY++PS+ H+ V  ++TP  FE 
Sbjct: 114 GLYTKTSVMVGLGETDAELEQTFKDLRDVGVDVLTLGQYLQPSQYHLRVERFVTPAQFEA 173

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
           Y+ L    GF YVASGP+VRSSY+A EF++K ++E +R
Sbjct: 174 YKTLAESYGFLYVASGPLVRSSYRAAEFFMKGLMERER 211



 Score = 48.5 bits (114), Expect(2) = 3e-44
 Identities = 18/48 (37%), Positives = 33/48 (68%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++A+A+    L+Y+V+TSV+RDD PD G+ HF   +++L+   P  ++
Sbjct: 5   HLAQAVKEMDLEYIVVTSVNRDDRPDGGASHFASAIRELRRESPRTIV 52



>gb:LMFL4738_1388077 Leishmania major Friedlin chromosome 19 cosmid
           L4738.
          Length = 418

 Score =  152 bits (385), Expect(2) = 9e-44
 Identities = 77/161 (47%), Positives = 108/161 (67%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           ALV DF GD   VE++A + L V+AHNIE VE +   VRD RA+++QS+  L     +  
Sbjct: 239 ALVGDFHGDLKLVEQLAVTPLSVYAHNIECVERITPRVRDRRASYRQSLQTLEHVTKWTN 298

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              LTK+SIMLG GE   +V +T+  +R AGV  +T GQY++PS   + VS Y  P+ FE
Sbjct: 299 GNMLTKSSIMLGLGEEEAEVRQTLRDLRTAGVSAVTLGQYLQPSHTRLKVSRYAHPKEFE 358

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA 324
            ++   M+MGF Y ASGPMVRSSY+AGE+YIK++++  ++A
Sbjct: 359 MWEKEAMDMGFLYCASGPMVRSSYRAGEYYIKNILKQRQSA 399



 Score = 47.8 bits (112), Expect(2) = 9e-44
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA A+   G+DY+V+T VDRDDLPD G+ H    +  +K   P +++
Sbjct: 191 VAAAVHEMGVDYIVMTMVDRDDLPDGGASHVCCCIHTIKKKNPELML 237



>gb:AE017261_419567 Picrophilus torridus DSM 9790, complete genome.
          Length = 286

 Score =  142 bits (359), Expect(2) = 2e-43
 Identities = 70/157 (44%), Positives = 103/157 (65%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G    ++K+     DV AHNIETV  L   VRD RA + QS++VL   K  + +
Sbjct: 132 LIPDFSGVHKFIDKIIDERPDVIAHNIETVRRLTKTVRDPRAGYDQSLNVLRYVK--SRS 189

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             +TK+SIMLG GET D+V++T+  +  AGVD++T GQY+RP+K+ + V EY   E F+ 
Sbjct: 190 NIITKSSIMLGLGETDDEVIETLHDLHDAGVDIVTIGQYLRPTKKQLEVKEYSPMERFKN 249

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESD 333
            +     +GF +VASGP+VR+SY+A E ++K   ++D
Sbjct: 250 LEESAYSIGFSFVASGPLVRTSYRAAEAFVKGGFKND 286



 Score = 57.0 bits (136), Expect(2) = 2e-43
 Identities = 26/42 (61%), Positives = 32/42 (76%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALK 826
           V E++    LDYVVITSVDRDDLPD+GS HF   +++LK LK
Sbjct: 85  VYESVKMMNLDYVVITSVDRDDLPDKGSSHFAAVIRRLKDLK 126



>gb:AF210624_1777355 Eremothecium gossypii Slk19 (SLK19) gene,
           partial cds; Bem3 (BEM3) gene, complete cds; and Lip5
           (LIP5) gene, partial cds.
          Length = 176

 Score =  177 bits (450), Expect = 2e-43
 Identities = 89/160 (55%), Positives = 119/160 (74%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DFRG+   V+ +A+SGLDV+AHN+ETVE L   VRD RA ++QS+ VL  AK   P 
Sbjct: 18  LAGDFRGNLEMVDVMARSGLDVYAHNVETVEALTPHVRDRRATYQQSLSVLKRAKQTVPT 77

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             +TKTSIMLG GET +QV++TM+ +RA   DV+TFGQYMRP++RHM V EY+ PE F+ 
Sbjct: 78  -LVTKTSIMLGMGETDEQVLQTMKDLRAVDCDVVTFGQYMRPTRRHMKVVEYVKPEKFDY 136

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA 324
           ++   +E+GF Y ASGP+VRSSYKAGE YI++++ + R A
Sbjct: 137 WKEKALELGFLYCASGPLVRSSYKAGEAYIENVLRNRRQA 176



>sp|Q9Y9E3|LIPA_AERPE Probable lipoyl synthase (EC 2.8.1.-) (Lipoic
           acid synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|E72462|E72462 probable lipoic acid
           synthetase APE2344 - Aeropyrum pernix  (strain
           K1)>gb:BA000002_653101 Aeropyrum pernix K1 DNA, complete
           genome.
          Length = 295

 Score =  139 bits (349), Expect(2) = 5e-43
 Identities = 69/154 (44%), Positives = 103/154 (66%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           AL+PDF+G    V  VA SGL+V AHNIETVE L  +VRD RA ++QS+ VL +AK+   
Sbjct: 133 ALIPDFQGVEEHVRLVAASGLEVLAHNIETVERLTPLVRDRRAGYRQSLRVLEIAKE--- 189

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
            G +TK+SI+LG GE   +V++ M  +R+ GVD++   QY RPS++ +PV++  +   F 
Sbjct: 190 EGVVTKSSILLGLGEDKSEVIEAMRDLRSVGVDILVLSQYYRPSRKQLPVAKRYSLSEFR 249

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           +    G+ MGF YV + P+ R+S+KA E Y+ ++
Sbjct: 250 ELAEKGLRMGFAYVVAHPLARTSFKAKEAYLAAV 283



 Score = 59.3 bits (142), Expect(2) = 5e-43
 Identities = 26/47 (55%), Positives = 36/47 (76%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA A+ + GLDYV +TSVDRDDLPD G+ HF  TV+ +K L+P+ ++
Sbjct: 85  VALAVDALGLDYVTLTSVDRDDLPDGGASHFAATVRAIKRLRPDTIV 131



>sp|Q8ZUR9|LIPA_PYRAE Probable lipoyl synthase (EC 2.8.1.-) (Lipoic
           acid synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE009887_256962 Pyrobaculum aerophilum
           strain IM2 section 142 of 201 of the complete
           genome.>gb:AE009441_899588 Pyrobaculum aerophilum strain
           IM2 complete genome.
          Length = 290

 Score =  151 bits (382), Expect(2) = 1e-42
 Identities = 78/160 (48%), Positives = 109/160 (68%), Gaps = 2/160 (1%)
 Frame = -3

Query: 818 CS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAK 639
           C    LVPDF G P+ V+ V  SG DVFAHN+ETV  L  +VRD RA +++S+ VL  AK
Sbjct: 126 CVVEVLVPDFGGSPASVKTVVSSGPDVFAHNVETVRRLTPLVRDRRAGYERSLSVLKYAK 185

Query: 638 DYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRP--SKRHMPVSEYI 465
           ++     LTK+ +MLG GET ++VV+T+E +R A VD++T GQY++P  S RH+    Y 
Sbjct: 186 EF--GAPLTKSGLMLGLGETFEEVVETLEDLRRADVDIVTIGQYIKPSGSPRHLNPVRYA 243

Query: 464 TPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           TPE F K + + + +GF+ VASGP+VRSSYKA   Y +++
Sbjct: 244 TPEEFAKIKEVAVSLGFKAVASGPLVRSSYKAYSLYREAL 283



 Score = 45.1 bits (105), Expect(2) = 1e-42
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLK 835
           + EA+   GL YVV+TSV RDDLPD G+  F   V+KL+
Sbjct: 84  LVEAVRELGLKYVVVTSVARDDLPDGGASVFAAVVKKLR 122



>sp|Q97U63|LIPA_SULSO Probable lipoyl synthase (EC 2.8.1.-) (Lipoic
           acid synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|D90500|D90500 hypothetical protein lipA
           [imported] - Sulfolobus solfataricus>gb:AE006905_223874
           Sulfolobus solfataricus P2 section 264 of 272 of the
           complete genome.>gb:AE006641_1109722 Sulfolobus
           solfataricus P2, complete genome.
          Length = 285

 Score =  137 bits (346), Expect(2) = 1e-41
 Identities = 68/153 (44%), Positives = 104/153 (67%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFRG+   V+KV  +G+DVFAHN+ETV  L  +VRD RA+++QS++VL  A++    
Sbjct: 131 LTPDFRGNIDAVKKVIDAGVDVFAHNVETVRRLTPIVRDPRASYEQSLNVLKYAEN---- 186

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             + K+SI+LG GET D++V+TM  +R+ GV ++   QYMRPS++ + V +  T E F++
Sbjct: 187 -VIKKSSILLGLGETWDEIVETMRDLRSVGVSILVLSQYMRPSRKQLEVKKRYTLEEFKE 245

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
            + +   MGF  V S P+ R+SYKA E Y +++
Sbjct: 246 LEEIAYSMGFSAVISLPLARTSYKAKEAYFRAI 278



 Score = 55.8 bits (133), Expect(2) = 1e-41
 Identities = 26/47 (55%), Positives = 33/47 (70%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEA+    LDYVVITSVDRDDL D G+ HF   V+ +K L P +++
Sbjct: 82  VAEAVKEMELDYVVITSVDRDDLSDGGAQHFANVVKTVKELNPGIIV 128



>sp|Q8R9E1|LIPA_THETN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE013121_289298 Thermoanaerobacter
           tengcongensis MB4, section 148 of 244 of the complete
           genome.>gb:AE008691_1111363 Thermoanaerobacter
           tengcongensis strain MB4, complete genome.
          Length = 284

 Score =  137 bits (345), Expect(2) = 6e-40
 Identities = 67/145 (46%), Positives = 103/145 (71%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           LVPDF G+   +  V ++  DV  HN+ETV  L S VR  +A++ +S+++L   K+  P 
Sbjct: 133 LVPDFMGNEEAIRTVVEAKPDVINHNVETVPRLYSRVRP-KADYIRSLNLLKKVKELDPL 191

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             LTK+ IM+G GET ++V++ M+ +R    D+MT GQY+RPS +H+ V+EY+TPE F++
Sbjct: 192 -ILTKSGIMVGLGETEEEVIEVMKDLRDIDCDMMTIGQYLRPSHKHIEVAEYVTPEQFKR 250

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           Y+ +G ++GF++VASGP+VRSSY A
Sbjct: 251 YEEIGYKLGFKHVASGPLVRSSYHA 275



 Score = 50.4 bits (119), Expect(2) = 6e-40
 Identities = 24/41 (58%), Positives = 30/41 (73%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKAL 829
           VAEA    GL +VV+TSV RDDLPD G+ HF +T+ +LK L
Sbjct: 85  VAEAARRLGLRHVVVTSVTRDDLPDGGASHFAKTIYELKKL 125



>gb:CR543861_104160 Acinetobacter sp. ADP1 complete genome.
          Length = 337

 Score =  125 bits (313), Expect(2) = 3e-37
 Identities = 66/150 (44%), Positives = 95/150 (63%), Gaps = 1/150 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKV-AKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG      ++  +   DVF HNIETV  L   +R   ++++ S+ +L M K+Y P
Sbjct: 165 LVPDFRGRMDIALRIMTECPPDVFNHNIETVPRLYKAMRPG-SDYQHSLTLLKMFKEYCP 223

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK  +M+G GET D+V+  ++ +RA  VD +T GQY++PSK+H P+  ++TPE FE
Sbjct: 224 -DIPTKCGLMVGIGETEDEVIALLDDLRAHDVDYVTIGQYLQPSKQHAPIDRFVTPEEFE 282

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFY 357
           +Y   G ++GFR + S PMVRSSY A   Y
Sbjct: 283 RYAEHGRQLGFRNIWSAPMVRSSYFADRQY 312



 Score = 53.5 bits (127), Expect(2) = 3e-37
 Identities = 25/48 (52%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++AE IA+  L Y VITSVDRDDL D G+ HF + +++ +AL PN L+
Sbjct: 115 HMAETIANLKLKYAVITSVDRDDLLDGGAQHFVDCIKEARALSPNTLL 162



>gb:AP006841_571503 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 288

 Score =  120 bits (302), Expect(2) = 4e-36
 Identities = 60/159 (37%), Positives = 99/159 (62%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R ++  N   +   L+PDF+G    +++V K+  ++ +HN+ETV+ +   VR   AN+  
Sbjct: 125 REIKRLNPETTTEVLIPDFQGRKELIDQVIKACPEIISHNMETVKRISPQVRS-AANYHT 183

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           S++V+   +  A +G   K+ IM+G GETP +V + M+ + + G  ++T GQY++P+ +H
Sbjct: 184 SLEVI---RQIAESGITAKSGIMVGLGETPAEVEELMDDLISVGCKILTIGQYLQPTHKH 240

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
            PV+ YITPE F  Y+  G++ GF  V S P+VRSSY A
Sbjct: 241 FPVAAYITPEQFAVYKETGLKKGFEQVESAPLVRSSYHA 279



 Score = 54.3 bits (129), Expect(2) = 4e-36
 Identities = 24/45 (53%), Positives = 35/45 (77%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           ++VAE+IA   L + VITSVDRDDLPD G+ H+ +T++++K L P
Sbjct: 88  AHVAESIALMKLSHAVITSVDRDDLPDLGAAHWAQTIREIKRLNP 132



>sp|Q57390|LIPA_PELCA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|E36953|E36953 lipoic acid synthase (EC
           2.8.1.-) - Pelobacter carbinolicus>gb:PEJACOA_157794
           Pelobacter carbinolicus acetoin:DCPIP oxidoreductase
           alpha and beta subunits, lipoat synthase,
           dihydrolipoamide dehydrogenase and ferredoxin
           (AcoA,B,C,S, and L) genes, complete
           cds.>gb:U01100_203382 Pelobacter carbinolicus Gra Bd 1
           acetoin dehydrogenase enzyme system (acoA, acoB, acoC,
           acoS, acoL) genes and putative ferrodoxin (orf5) gene,
           complete cds.
          Length = 310

 Score =  130 bits (326), Expect(2) = 6e-36
 Identities = 69/146 (47%), Positives = 96/146 (65%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG      K   + L DVF HN+ETV  L +  R   A + +S+ +L   K+  P
Sbjct: 157 LVPDFRGHVDAALKNLGNCLPDVFNHNLETVPRLYAESRPG-ARYHESLRLLQRFKETYP 215

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
            G  TK+ +MLG GET +++++ M  +R  G D++T GQY+RPS+ H+PV  Y+TPE FE
Sbjct: 216 -GIPTKSGLMLGLGETDEEILEVMRDLRVHGCDMLTIGQYLRPSRHHLPVQRYVTPEQFE 274

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
            ++V G++MGF  VASGP+VRSSY A
Sbjct: 275 AFRVAGLKMGFSQVASGPLVRSSYHA 300



 Score = 44.3 bits (103), Expect(2) = 6e-36
 Identities = 19/40 (47%), Positives = 29/40 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLK 835
           ++A+AI +  L YVVITSV RDDL D G+ HF + ++ ++
Sbjct: 106 HLADAIGAMKLKYVVITSVTRDDLEDGGAAHFAQCIESIR 145



>sp|P44463|LIPA_HAEIN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|G64043|G64043 lipoic acid synthase (EC
           2.8.1.-) - Haemophilus influenzae  (strain Rd
           KW20)>gb:U32688_203717 Haemophilus influenzae Rd KW20
           section 3 of 163 of the complete
           genome.>gb:L42023_1096266 Haemophilus influenzae Rd KW20
           complete genome.>gb:AX083980_1460886 Sequence 15 from
           Patent WO0111033.>gb:AX395041_1466966 Sequence 15 from
           Patent WO0218601.
          Length = 320

 Score =  113 bits (283), Expect(2) = 1e-35
 Identities = 59/146 (40%), Positives = 93/146 (63%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGD-PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     +EK+  +  DVF HN+E V  L   +R   A+++ S+ +L   K+  P
Sbjct: 167 LVPDFRGRITQALEKLKDNPPDVFNHNLENVPRLYKEIRPG-ADYEWSLKLLREFKEIFP 225

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M+ +R  GV ++T GQY++PS+ H+PV+ Y+ P  F+
Sbjct: 226 -NIPTKSGLMVGLGETNEEILQVMQDLRDNGVTMLTLGQYLQPSRHHLPVARYVPPTEFD 284

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           +++    EMGF + A GP VRSSY A
Sbjct: 285 EFRDKANEMGFEHAACGPFVRSSYHA 310



 Score = 60.1 bits (144), Expect(2) = 1e-35
 Identities = 28/47 (59%), Positives = 36/47 (76%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AE I    L YVVITSVDRDDLPD+G+GHF+E V+ ++ L PN+ I
Sbjct: 118 LAETIQDMKLKYVVITSVDRDDLPDRGAGHFSECVKAVRELNPNIKI 164



>gb:CP000030_83679 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 313

 Score =  123 bits (308), Expect(2) = 3e-35
 Identities = 62/151 (41%), Positives = 95/151 (62%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF G P  ++ +A +  DV+ HN+ETV  L S VR  RA +  S+++L   KD +P 
Sbjct: 152 LTPDFLGKPCAIDIIASARPDVYNHNLETVPRLYSRVRP-RAKYFNSLNLLKEVKDKSP- 209

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G  TK+  MLG GE+ ++V + M+ +R AGVD +  GQY++P+K ++ V  Y+ P  FE+
Sbjct: 210 GVFTKSGFMLGLGESKEEVYQVMDDLRCAGVDFIVMGQYLQPTKNNIEVHRYVPPSEFEQ 269

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           Y+++    GF  VA+ P+ RSSY A + + K
Sbjct: 270 YKLMAYAKGFSMVAASPLARSSYHAEDDFRK 300



 Score = 48.9 bits (115), Expect(2) = 3e-35
 Identities = 22/39 (56%), Positives = 30/39 (76%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLK 835
           V  AI+  GL +VVITSVDRDDLPD G+ HF + V++++
Sbjct: 103 VGAAISKLGLKHVVITSVDRDDLPDGGASHFAKCVREIR 141



>gb:AP006618_558081 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 352

 Score =  128 bits (322), Expect(2) = 4e-35
 Identities = 65/172 (37%), Positives = 105/172 (61%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R+++  N       L+PDF  DP  + +V  +  +V AHN+ETV  +   +R     +++
Sbjct: 157 RAIKRLNPATGVELLIPDFNADPDQLAEVFSARPEVLAHNLETVPRIFKRIRP-AFRYER 215

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           S+ VL  A++   AG +TK++++LG GETP++V + M  +  AG D++T  QY+RPS RH
Sbjct: 216 SLSVLTAARE---AGLVTKSNLILGMGETPEEVTEAMRDLHEAGCDILTITQYLRPSPRH 272

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
            PV  ++ PE F ++  +  E+GF  V +GP+VRSSY+AG  Y ++M    R
Sbjct: 273 HPVDRWVKPEEFVEHSRVAEEIGFAGVMAGPLVRSSYRAGRLYAQAMAHHGR 324



 Score = 43.1 bits (100), Expect(2) = 4e-35
 Identities = 21/43 (48%), Positives = 28/43 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE++ + GL Y  IT V RDDL D G+  + ETV+ +K L P
Sbjct: 122 VAESVQAMGLRYSTITGVARDDLEDGGAWLYAETVRAIKRLNP 164



>gb:AE017340_456722 Idiomarina loihiensis L2TR, complete genome.
          Length = 310

 Score =  130 bits (326), Expect(2) = 9e-35
 Identities = 66/146 (45%), Positives = 98/146 (67%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG       + K    DVF HN+ETV  L    R   AN++ S+D+L   K+  P
Sbjct: 157 LVPDFRGRMQVAIDILKGEAPDVFNHNLETVPRLYKAARPG-ANYQWSLDLLQKYKEVRP 215

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M+ +RA  VD++T GQY++PS+ H+PV+ Y+ P+ FE
Sbjct: 216 -DIRTKSGLMVGLGETKEEILEVMKDLRAHDVDMLTIGQYLQPSRHHIPVARYVHPDEFE 274

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +V G+EMGF ++ASGP+VRSSY A
Sbjct: 275 ELRVAGVEMGFSHIASGPLVRSSYHA 300



 Score = 40.4 bits (93), Expect(2) = 9e-35
 Identities = 18/44 (40%), Positives = 28/44 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           + + I    + YVVITSVDRDDL D G+ HF + +++++    N
Sbjct: 107 LGKTIRDMKVKYVVITSVDRDDLRDGGAQHFADCIREIREHSEN 150



>sp|P61199|LIPA_TREDE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017251_416619 Treponema denticola ATCC
           35405, section 6 of 10 of the complete
           genome.>gb:AE017226_1070215 Treponema denticola ATCC
           35405, complete genome.
          Length = 290

 Score =  127 bits (319), Expect(2) = 9e-35
 Identities = 65/145 (44%), Positives = 95/145 (65%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF+G    V  + ++  +V +HN+ETV  L   VR  RA +  S+ VL   K  A +
Sbjct: 144 LIPDFQGHEDLVSMIIEAKPEVISHNLETVRRLSPHVRS-RATYDTSLKVL---KQIADS 199

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G + K+ IMLG GET  ++++TM+ +R     VMT GQY+RPS +++ V EY+ PE FE+
Sbjct: 200 GLVCKSGIMLGLGETRAEILETMDDLRKINCKVMTIGQYLRPSIKNIEVKEYVRPEVFEE 259

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           Y+ +G+E GF +V SGP+VRSSY A
Sbjct: 260 YKQIGLEKGFSFVESGPLVRSSYHA 284



 Score = 43.1 bits (100), Expect(2) = 9e-35
 Identities = 17/45 (37%), Positives = 32/45 (71%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNM 817
           +A+++ +  L +VV+TSVDRDD+ D G+ H+ + ++ +K   PN+
Sbjct: 95  IAQSVEALKLKHVVLTSVDRDDIKDFGASHWVKVIRAVKQKTPNV 139



>sp|Q88DM5|LIPA_PSEPK Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE016792_334183 Pseudomonas putida KT2440
           section 19 of 21 of the complete
           genome.>gb:AE015451_949260 Pseudomonas putida KT2440
           complete genome.
          Length = 338

 Score =  117 bits (292), Expect(2) = 1e-34
 Identities = 61/148 (41%), Positives = 93/148 (62%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPD+RG     +E  A+   DVF HN+ETV  L    R   +++  S+D+L   K   P
Sbjct: 184 LVPDYRGRMDVALEITAQEPPDVFNHNLETVPRLYKAARPG-SDYDWSLDLLQKFKQLVP 242

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +MLG GET ++V++ M ++R   +D++T GQY++PS+ H+PV  ++ P+ F 
Sbjct: 243 H-VPTKSGLMLGLGETDEEVIEVMHRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTFA 301

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            +   G +MGF+ VASGP+VRSSY A +
Sbjct: 302 WFAEEGYKMGFKNVASGPLVRSSYHADQ 329



 Score = 53.1 bits (126), Expect(2) = 1e-34
 Identities = 25/46 (54%), Positives = 34/46 (73%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNM 817
           N+A AIA   L YVVITSVDRDDL D G+ HF + +++++AL P +
Sbjct: 134 NLAVAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRALSPGV 179



>gb:AY659260_2148270 Synthetic construct Peudomonas aeruginosa clone
           FLH046770.01F PA3996 gene, partial cds.
          Length = 328

 Score =  119 bits (297), Expect(2) = 2e-34
 Identities = 63/148 (42%), Positives = 94/148 (63%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPD+RG     +E  A    DVF HN+ETV  L    R   ++F+ S+D+L   K   P
Sbjct: 174 LVPDYRGRMDIALEITANEPPDVFNHNLETVPRLYRSSRPG-SDFEWSLDLLQKFKQMVP 232

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +MLG GET D+V++ M+++R   +D++T GQY++PS+ H+PV  ++ P+ F 
Sbjct: 233 H-VPTKSGLMLGLGETDDEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFA 291

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            +   G +MGF+ VASGP+VRSSY A +
Sbjct: 292 WFAEEGEKMGFKNVASGPLVRSSYHADQ 319



 Score = 50.4 bits (119), Expect(2) = 2e-34
 Identities = 24/47 (51%), Positives = 34/47 (72%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNM 817
           +N+A AIA   L YVVITSVDRDDL D G+ HF + +++++ L P +
Sbjct: 123 TNLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCLREIRKLSPGI 169



>sp|Q9HX25|LIPA_PSEAE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|H83145|H83145 lipoate synthase PA3996
           [imported] - Pseudomonas aeruginosa  (strain
           PAO1)>gb:AE004817_58231 Pseudomonas aeruginosa PAO1,
           section 378 of 529 of the complete
           genome.>gb:AE004091_972331 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 327

 Score =  119 bits (297), Expect(2) = 2e-34
 Identities = 63/148 (42%), Positives = 94/148 (63%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPD+RG     +E  A    DVF HN+ETV  L    R   ++F+ S+D+L   K   P
Sbjct: 174 LVPDYRGRMDIALEITANEPPDVFNHNLETVPRLYRSSRPG-SDFEWSLDLLQKFKQMVP 232

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +MLG GET D+V++ M+++R   +D++T GQY++PS+ H+PV  ++ P+ F 
Sbjct: 233 H-VPTKSGLMLGLGETDDEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFA 291

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            +   G +MGF+ VASGP+VRSSY A +
Sbjct: 292 WFAEEGEKMGFKNVASGPLVRSSYHADQ 319



 Score = 50.4 bits (119), Expect(2) = 2e-34
 Identities = 24/47 (51%), Positives = 34/47 (72%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNM 817
           +N+A AIA   L YVVITSVDRDDL D G+ HF + +++++ L P +
Sbjct: 123 TNLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCLREIRKLSPGI 169



>sp|Q10380|LIPA_MYCTU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|C70787|C70787 probable lipoic acid
           synthetase - Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_22331 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248341_759597
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 8/14.>gb:BX842579_820295 Mycobacterium
           tuberculosis H37Rv complete genome; segment 8/13.
          Length = 311

 Score =  125 bits (315), Expect(2) = 2e-34
 Identities = 65/163 (39%), Positives = 102/163 (62%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R+++  N       L+PDF G+P+ + +V +SG +V AHN+ETV  +   +R     +++
Sbjct: 141 RAIKELNPSTGVELLIPDFNGEPTRLAEVFESGPEVLAHNVETVPRIFKRIRP-AFTYRR 199

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           S+ VL  A+D   AG +TK++++LG GET D+V   +  +R AG D++T  QY+RPS RH
Sbjct: 200 SLGVLTAARD---AGLVTKSNLILGLGETSDEVRTALGDLRDAGCDIVTITQYLRPSARH 256

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFY 357
            PV  ++ PE F ++      +GF  V +GP+VRSSY+AG  Y
Sbjct: 257 HPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLY 299



 Score = 43.5 bits (101), Expect(2) = 2e-34
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           VA+++ + GL Y  +T V RDDLPD G+  +  TV+ +K L P+
Sbjct: 106 VADSVRTMGLRYATVTGVARDDLPDGGAWLYAATVRAIKELNPS 149



>gb:CR767821_116890 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925677_117804 Ehrlichia
           ruminantium str. Gardel, complete
           genome.>gb:CR925678_118765 Ehrlichia ruminantium str.
           Welgevonden, complete genome.
          Length = 292

 Score =  117 bits (294), Expect(2) = 2e-34
 Identities = 62/160 (38%), Positives = 97/160 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      ++K+AK+  DV+ HN+ETV  L + +R  +A +  S+ +L   K   P 
Sbjct: 134 LTPDFLNKHDAIDKIAKAFPDVYNHNVETVPRLYAKIRP-KARYFHSLYLLKTIKQKNPR 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  +++ + M+ +R+A VD +  GQY++P+ +H  V  Y+TPE F+ 
Sbjct: 193 -IFTKSGIMVGLGELKEEIYQVMDDLRSADVDFIVIGQYLQPTSKHAVVDRYVTPEEFDH 251

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA 324
           Y+ +    GF  VASGP+VRSSY A E +    ++ +RAA
Sbjct: 252 YKYVAYSKGFLMVASGPLVRSSYHAEEDF--QRLKKNRAA 289



 Score = 51.6 bits (122), Expect(2) = 2e-34
 Identities = 23/48 (47%), Positives = 36/48 (75%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++A+A++S  L +VVITSVDRDDL D G+GHF E +++++    N+ I
Sbjct: 84  SLAKAVSSLKLQHVVITSVDRDDLEDGGAGHFVECIEEIRKRDSNVTI 131



>gb:AE017321_441936 Wolbachia endosymbiont strain TRS of Brugia
           malayi, complete genome.
          Length = 287

 Score =  117 bits (294), Expect(2) = 3e-34
 Identities = 61/147 (41%), Positives = 89/147 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF       E +A +  DV+ HNIE V  L + +R  RA +  S+ +L M K   P 
Sbjct: 134 LTPDFLNKKGAFEAIAVASPDVYNHNIEMVPRLYARIRP-RARYFHSLYLLKMVKQINPK 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             LTK+ +M+G GET ++V++ M+ +R+A VD +T GQY++P+ +H  +  Y+TPE FE 
Sbjct: 193 -LLTKSGLMVGLGETKEEVLQVMDDLRSAEVDFITIGQYLQPTPKHAKIDRYVTPEEFEH 251

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y+ +    GF  VAS P+ RSSY A E
Sbjct: 252 YKYIAYSKGFLVVASSPLTRSSYHAEE 278



 Score = 50.8 bits (120), Expect(2) = 3e-34
 Identities = 22/48 (45%), Positives = 33/48 (68%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+A+AI    L YVVITSVDRDDLPD G+  F + +++++ + P   +
Sbjct: 84  NLAKAIKKLNLKYVVITSVDRDDLPDGGASQFIKCIEEIRKITPETTV 131



>sp|P57978|LIPA_PASMU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE006230_216818 Pasteurella multocida
           subsp. multocida str. Pm70 section 197 of 204 of the
           complete genome.>gb:AE004439_1119548 Pasteurella
           multocida subsp. multocida str. Pm70, complete genome.
          Length = 320

 Score =  107 bits (268), Expect(2) = 4e-34
 Identities = 57/146 (39%), Positives = 91/146 (62%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGD-PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++K+  +  DVF HN+E V  L   +R   A+++ S+ +L   K   P
Sbjct: 167 LVPDFRGRIEQALDKLKDNPPDVFNHNLENVPRLYREIRPG-ADYQWSLKLLKDFKAMFP 225

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M+ +R  GV ++T GQY++PS+ H+PV+ Y+ P  F+
Sbjct: 226 H-IPTKSGLMVGLGETNEEILQVMQDLRDHGVTMLTLGQYLQPSRHHLPVARYVPPAEFD 284

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           +++     MGF + A GP VRSSY A
Sbjct: 285 EFRDKAQAMGFEHAACGPFVRSSYHA 310



 Score = 60.5 bits (145), Expect(2) = 4e-34
 Identities = 28/47 (59%), Positives = 36/47 (76%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AE I    L YVVITSVDRDDLPD+G+GHF E V++++ L PN+ I
Sbjct: 118 LAETIQDMKLRYVVITSVDRDDLPDRGAGHFAECVKEIRQLNPNIKI 164



>sp|O67368|LIPA_AQUAE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|E70417|E70417 lipoic acid synthase (EC
           2.8.1.-) - Aquifex aeolicus>gb:AE000736_26720 Aquifex
           aeolicus VF5 section 68 of 109 of the complete
           genome.>gb:AE000657_977251 Aquifex aeolicus VF5 complete
           genome.
          Length = 276

 Score =  119 bits (299), Expect(2) = 4e-34
 Identities = 62/147 (42%), Positives = 95/147 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDFRG+   +E V K    V  HN+ETV  L   VR   AN+K+S+++L  +K+   +
Sbjct: 127 LIPDFRGNKKALEVVLKEKPVVLNHNVETVPRLYPSVRIG-ANYKRSLNILKWSKEIDKS 185

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK++++LG GE  ++V+K ME +R+   D +  GQY +PS +H PV +Y + E F++
Sbjct: 186 -VYTKSALILGFGERKEEVIKVMEDLRSVDCDFLVLGQYYQPSLKHHPVVKYYSEEEFKE 244

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGE 363
           ++ +G EMGF++V S P  RSSYKA E
Sbjct: 245 FEEIGYEMGFKFVVSKPNARSSYKAFE 271



 Score = 48.5 bits (114), Expect(2) = 4e-34
 Identities = 22/37 (59%), Positives = 28/37 (75%)
 Frame = -2

Query: 945 EAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLK 835
           EA+ + GL YVVITSV RDDLPD G+ HF + ++ LK
Sbjct: 80  EAVKTLGLKYVVITSVTRDDLPDGGASHFAKCIRVLK 116



>gb:AE016827_343455 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 320

 Score =  108 bits (270), Expect(2) = 7e-34
 Identities = 58/146 (39%), Positives = 91/146 (62%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGD-PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++K+  +  DVF HN+E V  L   +R   A+++ S+ +L   K   P
Sbjct: 167 LVPDFRGRIEQALDKLKDNPPDVFNHNLENVPRLYRDIRPG-ADYQWSLKLLREFKALFP 225

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET ++++  M+ +R  GV ++T GQY++PS+ H+PV+ Y+ PE F+
Sbjct: 226 H-IPTKSGLMVGLGETNEEILNVMQDLRNNGVTMLTLGQYLQPSRFHLPVARYVPPEEFD 284

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           +++     MGF + A GP VRSSY A
Sbjct: 285 EFRTKAEVMGFEHAACGPFVRSSYHA 310



 Score = 58.9 bits (141), Expect(2) = 7e-34
 Identities = 26/47 (55%), Positives = 35/47 (74%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AE I    L YVVITSVDRDDLPD+G+GHF E +++++ + PN  I
Sbjct: 118 LAETIQDMKLKYVVITSVDRDDLPDRGAGHFAECIKEIRKINPNTQI 164



>sp|P73572|LIP2_SYNY3 Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>pir|S77278|S77278 lipoic acid synthetase
           (EC 2.8.1.-) 2 - Synechocystis sp.  (strain PCC
           6803)>gb:BA000022_688391 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 303

 Score =  122 bits (307), Expect(2) = 9e-34
 Identities = 70/166 (42%), Positives = 99/166 (59%), Gaps = 7/166 (4%)
 Frame = -3

Query: 839 LRH*NQICS*XALVPDF-------RGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHR 681
           +R  N       L PDF       R     V  V K+    + HN+ETV  LQ  VR   
Sbjct: 139 IRQDNPATQIEVLTPDFWGGMGRERSQKERVLTVTKAKPVCYNHNLETVARLQGKVR-RG 197

Query: 680 ANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMR 501
           A +++S+DVL   K++ P    TK+ +MLG GET D+VV+T++ +R+ G D +T GQYM+
Sbjct: 198 AKYQRSLDVLRWIKEFDP-DIFTKSGLMLGHGETVDEVVETLKDLRSVGCDRLTLGQYMQ 256

Query: 500 PSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           PS  H+PV +Y TPE F++   +  ++GF +V SGP+VRSSY AGE
Sbjct: 257 PSLDHLPVQKYWTPEEFDQLGEIAKDLGFSHVRSGPLVRSSYHAGE 302



 Score = 44.3 bits (103), Expect(2) = 9e-34
 Identities = 21/43 (48%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAEA+   GL YVV+TSV RDDL D G+G F   +++++   P
Sbjct: 102 VAEAVQLLGLKYVVLTSVARDDLTDGGAGWFVAVMERIRQDNP 144



>sp|Q8PPL8|LIPA_XANAC Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE011695_275628 Xanthomonas axonopodis pv.
           citri str. 306, section 73 of 469 of the complete
           genome.>gb:AE008923_917403 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 337

 Score =  116 bits (290), Expect(2) = 1e-33
 Identities = 69/148 (46%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = -3

Query: 803 LVPDFRGD---PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDY 633
           L PDFRG       +E +A S  DVF HNIETV +L   VR   A+++ S+ +L   K  
Sbjct: 181 LTPDFRGKGRMDRALEILALSPPDVFNHNIETVPDLYPNVRPG-ADYQWSLTLLQRFKAQ 239

Query: 632 APAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA 453
            P+   TK+ IMLG GET +QV  T+  +RA  VD++T GQY++P+  H PV  Y TPE 
Sbjct: 240 HPS-IATKSGIMLGLGETMEQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEE 298

Query: 452 FEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           ++  +  G  +GF +VASGPMVRSSY A
Sbjct: 299 YKALEDYGNALGFSHVASGPMVRSSYHA 326



 Score = 50.4 bits (119), Expect(2) = 1e-33
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +++A  +A  GL YVV+TSVDRDDL D G+ HF + +  ++   PN  I
Sbjct: 130 ASLAATVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRTSSPNTRI 178



>sp|Q9A7I8|LIPA_CAUCR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|C87464|C87464 lipoic acid synthase
           [imported] - Caulobacter crescentus>gb:AE005847_212874
           Caulobacter crescentus CB15 section 173 of 359 of the
           complete genome.>gb:AE005673_922773 Caulobacter
           crescentus CB15 complete genome.
          Length = 325

 Score =  112 bits (280), Expect(2) = 1e-33
 Identities = 58/151 (38%), Positives = 90/151 (59%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF         V  S  DVF HN+ETV  L   +R   A +  S+ +L   K   P+
Sbjct: 164 LTPDFLRKDGAENVVIDSKPDVFNHNLETVPRLYLKIRPG-ARYYNSLRLLDRVKQRDPS 222

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M+G GET ++V++ M+ +R+AGVD +T GQY++P+++H  +  ++TPE F+ 
Sbjct: 223 -QFTKSGLMVGLGETKEEVMQVMDDMRSAGVDFITIGQYLQPTRKHAAIDRFVTPEEFKA 281

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           Y+ +    GF  V+S P+ RSS+ AGE + K
Sbjct: 282 YEAIARAKGFLMVSSSPLTRSSHHAGEDFAK 312



 Score = 54.3 bits (129), Expect(2) = 1e-33
 Identities = 27/47 (57%), Positives = 32/47 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEA+A  GL +VVITSVDRDDL D G+ HF E V  ++A  P   I
Sbjct: 115 VAEAVAKMGLKHVVITSVDRDDLLDGGARHFAEVVTSIRAAAPGTTI 161



>sp|O32962|LIPA_MYCLE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|T44895|T44895 probable lipoic acid
           synthase (EC 2.8.1.-) [imported] - Mycobacterium
           leprae>gb:MLCB22_144811 Mycobacterium leprae cosmid
           B22.>gb:MLEPRTN4_146660 Mycobacterium leprae strain TN
           complete genome; segment 4/10.
          Length = 314

 Score =  121 bits (304), Expect(2) = 2e-33
 Identities = 64/163 (39%), Positives = 97/163 (59%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R+++  N       L+PDF G P+ + +V  S   V AHN+ETV  +   +R     +++
Sbjct: 141 RAIKELNPSTGVELLIPDFNGQPARLAEVFDSRPQVLAHNVETVPRIFKRIRP-AFTYQR 199

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           S+DVL  A++   AG +TK++++LG GET D+V   +  +R  G D++T  QY+RPS RH
Sbjct: 200 SLDVLTAARE---AGLVTKSNLILGLGETADEVRTALADLRKTGCDIVTITQYLRPSMRH 256

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFY 357
            PV  ++ PE F +Y      +GF  V  GP+VRSSY+AG  Y
Sbjct: 257 HPVERWVRPEEFVEYTQYAEGLGFSGVLGGPLVRSSYRAGRLY 299



 Score = 44.7 bits (104), Expect(2) = 2e-33
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           VAE++ + GL Y  +T V RDDLPD G+  +  TV+ +K L P+
Sbjct: 106 VAESVQTMGLRYTTVTGVARDDLPDGGAWLYATTVRAIKELNPS 149



>sp|Q8DFD1|LIPA_VIBVU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>sp|Q7MN17|LIPA_VIBVY Lipoyl synthase (EC
           2.8.1.-) (Lipoic acid synthase) (Lipoate synthase)
           (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion
           protein lipA) (Lip-syn).>gb:AE016797_335070 Vibrio
           vulnificus CMCP6 chromosome I section 1 of 11 of the
           complete sequence.>gb:BA000037_721726 Vibrio vulnificus
           YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1044794 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 321

 Score =  118 bits (295), Expect(2) = 2e-33
 Identities = 61/146 (41%), Positives = 93/146 (63%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     +E +  +  DVF HN+ET   L   VR   AN++ S+D+L   K+  P
Sbjct: 168 LVPDFRGRMDVALEALKDNPPDVFNHNLETAPRLYRKVRPG-ANYQWSLDLLKKFKEQHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++V+ ++ +RA GV ++T GQY+ PS+ H+PV  Y+ P  F+
Sbjct: 227 -DVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + + + +E+GF + A GP VRSSY A
Sbjct: 286 ELKEIALELGFTHAACGPFVRSSYHA 311



 Score = 47.8 bits (112), Expect(2) = 2e-33
 Identities = 23/49 (46%), Positives = 34/49 (69%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           + +A+ IA   L YVVITSVDRDDL D G+ HF +  ++++A  P++ I
Sbjct: 117 TKLAKTIADMKLKYVVITSVDRDDLRDGGAKHFADCNREIRAQSPHIRI 165



>sp|Q8P590|LIPA_XANCP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE012464_282677 Xanthomonas campestris pv.
           campestris str. ATCC 33913, section 372 of 460 of the
           complete genome.>gb:AE008922_915959 Xanthomonas
           campestris pv. campestris str. ATCC 33913, complete
           genome.
          Length = 337

 Score =  116 bits (290), Expect(2) = 3e-33
 Identities = 69/148 (46%), Positives = 91/148 (61%), Gaps = 3/148 (2%)
 Frame = -3

Query: 803 LVPDFRGD---PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDY 633
           L PDFRG       +E +A S  DVF HNIETV +L   VR   A+++ S+ +L   K  
Sbjct: 181 LTPDFRGKGRMDRALEILATSPPDVFNHNIETVPDLYPNVRPG-ADYQWSLTLLQRFKAQ 239

Query: 632 APAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA 453
            P    TK+ IMLG GET +QV  T+  +RA  VD++T GQY++P+  H PV  Y TPE 
Sbjct: 240 HPT-IATKSGIMLGLGETMEQVQVTLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEE 298

Query: 452 FEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           ++  +  G  +GF +VASGPMVRSSY A
Sbjct: 299 YKALEEYGNALGFSHVASGPMVRSSYHA 326



 Score = 49.3 bits (116), Expect(2) = 3e-33
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +++A  +A  GL YVV+TSVDRDDL D G+ HF + +  ++A  P   I
Sbjct: 130 ASLATTVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRASAPKTRI 178



>sp|Q98MY2|LIPA_RHILO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BA000012_666268 Mesorhizobium loti
           MAFF303099 DNA, complete genome.
          Length = 321

 Score =  114 bits (285), Expect(2) = 3e-33
 Identities = 60/151 (39%), Positives = 92/151 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      +E V  +  DVF HN+ETV      VR   A +  S+ +L   K+  P+
Sbjct: 160 LTPDFLRKDGALEIVVAARPDVFNHNLETVPSNYLKVRPG-ARYFHSIRLLQRVKELDPS 218

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  +++++ M+ +R+A VD MT GQY++PSK+H PV  ++TPE F+ 
Sbjct: 219 -IFTKSGIMVGLGEERNEILQLMDDLRSANVDFMTIGQYLQPSKKHHPVIRFVTPEEFKS 277

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           ++ +G   GF  VAS P+ RSS+ AG+ + +
Sbjct: 278 FETIGRTKGFLLVASSPLTRSSHHAGDDFAR 308



 Score = 51.2 bits (121), Expect(2) = 3e-33
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           + VA A+   GL +VVITSVDRDDL D G+ HF + ++ ++A  P+  I
Sbjct: 109 ARVAHAVKQMGLSHVVITSVDRDDLADGGAQHFADVIRAIRAATPSTTI 157



>sp|Q8YXD1|LIP2_ANASP Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>pir|AG1966|AG1966 lipoic acid synthetase
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682273 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 300

 Score =  112 bits (279), Expect(2) = 3e-33
 Identities = 67/155 (43%), Positives = 87/155 (56%), Gaps = 8/155 (5%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDV--------FAHNIETVEELQSVVRDHRANFKQSMDVLM 648
           L PDF G     E   +  + +        F HNIETV  L   VR   A + +S+ VL 
Sbjct: 147 LTPDFWGGAGAGESGQRQRIKMIVEAQPACFNHNIETVRRLTGPVR-RGAKYDRSLRVLS 205

Query: 647 MAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY 468
           + K+  P    TK+ +M+G GET  ++V+ M  +R  G D +T GQYMRPS  H+PV +Y
Sbjct: 206 LVKELNPR-IPTKSGLMVGYGETVAELVEAMTDLRNIGCDRLTIGQYMRPSLEHLPVQKY 264

Query: 467 ITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            TPE FE    L  EMGF +V S P+VRSSY AGE
Sbjct: 265 WTPEEFEHLGKLAREMGFSHVRSAPLVRSSYHAGE 299



 Score = 53.5 bits (127), Expect(2) = 3e-33
 Identities = 25/47 (53%), Positives = 33/47 (70%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEA+   GL YVV+TSV RDDL DQG+ HF +T++ ++ L P   I
Sbjct: 98  VAEAVQLLGLRYVVLTSVARDDLQDQGASHFVQTMEAIRQLNPGTQI 144



>gb:CR543861_103002 Acinetobacter sp. ADP1 complete genome.
          Length = 343

 Score =  111 bits (278), Expect(2) = 4e-33
 Identities = 60/150 (40%), Positives = 89/150 (59%), Gaps = 1/150 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKV-AKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG      K+ A S  DVF HNIETV  L   +R   ++++ S+ +L   K Y P
Sbjct: 171 LVPDFRGRLEIALKILASSPPDVFNHNIETVPRLYRALRPG-SDYQHSLKLLQQFKKYCP 229

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
              +TK  +M+G GE   +V+  +  +R   ++++T GQY++PSK H PV  +++P  FE
Sbjct: 230 -DVVTKCGLMVGLGEVEAEVITLLNDLRDHDIELVTIGQYLQPSKAHAPVHRFVSPTEFE 288

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFY 357
            Y+  G  +GF+ + S P+VRSSY A   Y
Sbjct: 289 HYEQHGKRLGFKNIWSAPLVRSSYHADRQY 318



 Score = 53.5 bits (127), Expect(2) = 4e-33
 Identities = 24/48 (50%), Positives = 36/48 (75%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++AEA+++  L YVVITSVDRDDL D G+ HF + ++ ++A  P+ LI
Sbjct: 121 HLAEAVSNLQLQYVVITSVDRDDLKDGGAQHFVDCIKAIRATNPHTLI 168



>gb:AE013598_297653 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 337

 Score =  115 bits (288), Expect(2) = 4e-33
 Identities = 68/148 (45%), Positives = 92/148 (62%), Gaps = 3/148 (2%)
 Frame = -3

Query: 803 LVPDFRGD---PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDY 633
           L PDFRG       ++ +A S  DVF HNIETV +L   VR   A+++ S+ +L   K  
Sbjct: 181 LTPDFRGKGRMDRALDILALSPPDVFNHNIETVPDLYPNVRPG-ADYQWSLTLLQRFKAQ 239

Query: 632 APAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA 453
            P+   TK+ IMLG GET +QV  T+  +RA  VD++T GQY++P+  H PV  Y TPE 
Sbjct: 240 HPS-IATKSGIMLGLGETMEQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEE 298

Query: 452 FEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           ++  +  G  +GF +VASGPMVRSSY A
Sbjct: 299 YKALEEYGNALGFSHVASGPMVRSSYHA 326



 Score = 49.7 bits (117), Expect(2) = 4e-33
 Identities = 22/49 (44%), Positives = 32/49 (65%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +++A  +A  GL YVV+TSVDRDDL D G+ HF + +  ++   PN  I
Sbjct: 130 ASLAITVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRTSSPNTRI 178



>sp|Q7VKB1|LIPA_HAEDU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017156_393325 Haemophilus ducreyi strain
           35000HP section 6 of 6 of the complete
           genome.>gb:AE017143_1027587 Haemophilus ducreyi strain
           35000HP complete genome.
          Length = 330

 Score =  109 bits (272), Expect(2) = 4e-33
 Identities = 61/160 (38%), Positives = 92/160 (57%), Gaps = 1/160 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFK 669
           R ++  N  C    LVPDFRG       + K    DVF HN+E V  L   +R   A++K
Sbjct: 163 REIKALNPECKVEILVPDFRGRVEQAVAILKQNPPDVFNHNLENVPRLYREIRPG-ADYK 221

Query: 668 QSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
            S+++L + K   P    TK+ +M+G GET ++++  M+ +R  GV ++T GQY++PS+ 
Sbjct: 222 WSLELLKIFKQEFP-NIPTKSGLMVGLGETNEEILAVMQDLRDHGVTMLTVGQYLQPSRH 280

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           H+ V  Y+ P  FE ++    +MGF + A GP VRSSY A
Sbjct: 281 HLRVERYVPPAEFEMFRSEAEKMGFEHAACGPFVRSSYHA 320



 Score = 55.8 bits (133), Expect(2) = 4e-33
 Identities = 26/43 (60%), Positives = 32/43 (74%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE +    L YVVITSVDRDDL D+G+ HF  TV+++KAL P
Sbjct: 128 VAETVQDMKLKYVVITSVDRDDLADRGAAHFAATVREIKALNP 170



>sp|Q8CPW4|LIPA_STAEP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:CP000029_81131 Staphylococcus epidermidis
           RP62A, complete genome.>gb:AE016746_322267
           Staphylococcus epidermidis ATCC 12228, section 3 of 9 of
           the complete genome.>gb:AE015929_1146936 Staphylococcus
           epidermidis ATCC 12228, complete genome.
          Length = 304

 Score =  119 bits (299), Expect(2) = 5e-33
 Identities = 66/172 (38%), Positives = 102/172 (59%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R +R  N   +   L  D  GD   +E +  S  D+  HNIETV  L   VR  RA + +
Sbjct: 128 RKVRERNPFTTIEILPSDMGGDYEALETLMASRPDILNHNIETVRRLTPRVRA-RATYDR 186

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           ++  L  +K+  P    TK+S+M+G GET +++ +TM+ +RA  VD++T GQY++PS++H
Sbjct: 187 TLQFLRRSKELQP-DIPTKSSLMVGLGETMEEIYETMDDLRANDVDILTIGQYLQPSRKH 245

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
           + V +Y TP  F K + + ME GF++  +GP+VRSSY A E   ++  E  R
Sbjct: 246 LKVEKYYTPLEFGKMRKIAMEKGFKHCQAGPLVRSSYHADEQVNEAAKEKQR 297



 Score = 45.1 bits (105), Expect(2) = 5e-33
 Identities = 22/43 (51%), Positives = 30/43 (69%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE++    L +VVIT+V RDDL DQGS  + ETV+K++   P
Sbjct: 93  VAESVELMNLKHVVITAVARDDLRDQGSNVYAETVRKVRERNP 135



>sp|P61200|LIPA_WOLPM Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017257_418171 Wolbachia endosymbiont of
           Drosophila melanogaster, section 2 of 5 of the complete
           genome.>gb:AE017196_1058808 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 287

 Score =  118 bits (295), Expect(2) = 5e-33
 Identities = 60/147 (40%), Positives = 89/147 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF       E +A +  DV+ HNIETV  L + +R  RA +  S+ +L M K   P 
Sbjct: 134 LTPDFLNKKGAFEAIAVASPDVYNHNIETVPRLYAKIRP-RARYFHSLYLLKMVKQINPK 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M+G GET +++++ M+ +R+A VD +T GQY++P+ +H  +  Y+TPE FE 
Sbjct: 193 -VFTKSGLMVGLGETKEEILQVMDDLRSAEVDFITIGQYLQPTPKHAKLDRYVTPEEFEH 251

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y+ +    GF  VAS P+ RSSY A E
Sbjct: 252 YKYIAYSKGFLVVASSPLTRSSYHAEE 278



 Score = 46.6 bits (109), Expect(2) = 5e-33
 Identities = 20/42 (47%), Positives = 31/42 (73%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKAL 829
           N+A+AI    L +VVITSVDRDDLPD G+  F + +++++ +
Sbjct: 84  NLAKAIKKLNLKHVVITSVDRDDLPDGGANQFIQCIEEIRKI 125



>gb:AE017293_433850 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 7 of 14 of the
           complete sequence.>gb:AE016823_1066861 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 301

 Score =  117 bits (294), Expect(2) = 8e-33
 Identities = 58/152 (38%), Positives = 96/152 (63%)
 Frame = -3

Query: 818 CS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAK 639
           C    L+PD +     +E + +   D+F HN+ETV+ L   V   +  +++S+DVL +A 
Sbjct: 148 CKIELLIPDLKVKQEALEIIFECNPDIFNHNLETVKRLFPEVAPQK-RYERSLDVLKIA- 205

Query: 638 DYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP 459
             +  G LTK+ ++LG GET ++V + M+ + + GV ++T GQY++P+  H+PV EY+ P
Sbjct: 206 --SARGFLTKSGLILGMGETLEEVKECMQDLASVGVSLLTLGQYLQPTSTHLPVKEYVVP 263

Query: 458 EAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           + F+  ++ G  +GF+ V SGP+VRSSY A E
Sbjct: 264 QVFKDLRIYGKSIGFKGVFSGPLVRSSYHADE 295



 Score = 46.2 bits (108), Expect(2) = 8e-33
 Identities = 22/47 (46%), Positives = 34/47 (72%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AE+  + GL +VVITSV+RDDL D G+ HF +TV++++   P+  I
Sbjct: 104 IAESSIALGLRHVVITSVNRDDLEDGGAAHFAKTVKEIRKGLPDCKI 150



>sp|Q8NNJ0|LIPA_CORGL Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BA000036_719936 Corynebacterium glutamicum
           ATCC 13032 DNA, complete genome.>gb:BX927154_833743
           Corynebacterium glutamicum ATCC 13032, IS fingerprint
           type 4-5, complete genome; segment
           7/10.>gb:AX064379_1459103 Sequence 661 from Patent
           WO0100843.>gb:AX066607_1460206 Sequence 189 from Patent
           WO0100805.
          Length = 348

 Score =  121 bits (304), Expect(2) = 1e-32
 Identities = 59/153 (38%), Positives = 98/153 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           LVPDF G    +++V +S  +VFAHN+ETV  +   +R     +++S+DV+  A+D+   
Sbjct: 155 LVPDFSGKKDLLQEVFESRPEVFAHNVETVPRIFKRIRP-AFRYERSLDVIRQARDF--- 210

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET +++ + ++ +  AG D++T  QY+RP     P+  ++ PE F +
Sbjct: 211 GLVTKSNLILGMGETKEEITEALQDLHDAGCDIITITQYLRPGPLFHPIERWVKPEEFLE 270

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           +     EMGF  V SGP+VRSSY+AG  Y ++M
Sbjct: 271 HADAAKEMGFAAVMSGPLVRSSYRAGRLYAQAM 303



 Score = 41.6 bits (96), Expect(2) = 1e-32
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           VAE++    L+Y  IT V RDDL D+G+  ++E V+K+  L P+
Sbjct: 106 VAESVREMQLNYSTITGVTRDDLDDEGAWLYSEVVRKIHELNPH 149



>sp|Q8YHE2|LIPA_BRUME Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|AE3359|AE3359 lipoic acid synthetase
           [imported] - Brucella melitensis  (strain
           16M)>gb:AE009527_252777 Brucella melitensis 16M
           chromosome I, section 84 of 195 of the complete
           sequence.>gb:AE014291_308557 Brucella suis 1330
           chromosome I, complete sequence.>gb:AE008917_978689
           Brucella melitensis 16M chromosome I, complete sequence.
          Length = 322

 Score =  112 bits (281), Expect(2) = 1e-32
 Identities = 59/151 (39%), Positives = 91/151 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      +E V K+  DVF HN+ETV      VR   A +  S+ +L   K+  P 
Sbjct: 160 LTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPG-ARYFHSIRLLQRVKELDPT 218

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  +++++ M+ +R+A VD MT GQY++P+++H PV  ++ P+ F+ 
Sbjct: 219 -IFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKS 277

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           ++ +G   GF  VAS P+ RSS+ AGE + K
Sbjct: 278 FETIGKTKGFLLVASSPLTRSSHHAGEDFAK 308



 Score = 50.4 bits (119), Expect(2) = 1e-32
 Identities = 22/44 (50%), Positives = 31/44 (70%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           N+A+A+   GL +VVITSVDRDDL D G+ HF E ++ ++   P
Sbjct: 110 NIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAP 153



>sp|Q9PDW0|LIPA_XYLFA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|C82701|C82701 lipoic acid synthetase
           XF1269 [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE003961_48907 Xylella fastidiosa 9a5c, section
           107 of 229 of the complete genome.>gb:AE003849_1116117
           Xylella fastidiosa 9a5c, complete genome.
          Length = 373

 Score =  115 bits (287), Expect(2) = 3e-32
 Identities = 75/181 (41%), Positives = 102/181 (56%), Gaps = 10/181 (5%)
 Frame = -3

Query: 803 LVPDFRGD---PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDY 633
           L PDFRG       ++ +A    DVF HN+ETV  L   VR   A+++ S+ +L   K  
Sbjct: 181 LTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRPG-ADYQWSLTLLKRFKAQ 239

Query: 632 APAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA 453
            P    TK+ IMLG GET DQV  T+  +RA  VD++T GQY++P+  H PV  Y TP+ 
Sbjct: 240 HPQ-VPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTIGQYLQPTSHHHPVLRYWTPDE 298

Query: 452 FEKYQVLGMEMGFRYVASGPMVRSSY-------KAGEFYIKSMIESDRAASSV*HPVFHT 294
           ++  +  GM +GF +VASGPMVRSSY       +AG  +  ++     A SS  H   HT
Sbjct: 299 YKALEEYGMALGFSHVASGPMVRSSYHADHQAKEAGLGFNATVSLGSPAVSSTEHRERHT 358

Query: 293 I 291
           I
Sbjct: 359 I 359



 Score = 47.0 bits (110), Expect(2) = 3e-32
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++A  +A  GL YVV+TSVDRDDL D G+ HF + +  ++   P   I
Sbjct: 131 SLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFVDCIAAIRQSAPQTRI 178



>sp|Q87VW7|LIPA_PSESM Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE016873_354159 Pseudomonas syringae pv.
           tomato str. DC3000 section 18 of 21 of the complete
           genome.>gb:AE016853_1039334 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 318

 Score =  113 bits (282), Expect(2) = 3e-32
 Identities = 60/148 (40%), Positives = 92/148 (62%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPD+RG     +E  A    DVF HN+ETV  L    R   ++++ S+ +L   K   P
Sbjct: 164 LVPDYRGRMDVALEITAAEPPDVFNHNLETVPRLYKAARPG-SDYQWSLTLLQRFKQMVP 222

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +MLG GET ++V++ M+++R   +D++T GQY++PS+ H+ V  ++ P+ F 
Sbjct: 223 H-VPTKSGLMLGLGETDEEVIEVMKRMREHDIDMLTLGQYLQPSRNHLAVQRFVHPDTFA 281

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            +   G +MGF+ VASGP+VRSSY A E
Sbjct: 282 WFAEEGYKMGFKNVASGPLVRSSYHADE 309



 Score = 48.9 bits (115), Expect(2) = 3e-32
 Identities = 23/46 (50%), Positives = 33/46 (71%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNM 817
           ++A AIA   L YVVITSVDRDDL D G+ HF + +++++ L P +
Sbjct: 114 SLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRLLSPGI 159



>sp|Q99VF2|LIPA_STAAM Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|E89858|E89858 lipoic acid synthetase
           [imported] - Staphylococcus aureus  (strain
           N315)>gb:CP000046_91076 Staphylococcus aureus subsp.
           aureus COL, complete genome.>gb:BA000017_676619
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_679206 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BA000033_711099 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_780337 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_783014 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 305

 Score =  119 bits (298), Expect(2) = 3e-32
 Identities = 66/172 (38%), Positives = 103/172 (59%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R +R  N   +   L  D  GD   +E +  S  D+  HNIETV  L   VR  RA + +
Sbjct: 128 RKVRERNPFTTIEILPSDMGGDYDALETLMASRPDILNHNIETVRRLTPRVRA-RATYDR 186

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           +++ L  +K+  P    TK+SIM+G GET +++ +TM+ +RA  VD++T GQY++PS++H
Sbjct: 187 TLEFLRRSKELQP-DIPTKSSIMVGLGETIEEIYETMDDLRANDVDILTIGQYLQPSRKH 245

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
           + V +Y TP  F K + + M+ GF++  +GP+VRSSY A E   ++  E  R
Sbjct: 246 LKVQKYYTPLEFGKLRKVAMDKGFKHCQAGPLVRSSYHADEQVNEAAKEKQR 297



 Score = 42.7 bits (99), Expect(2) = 3e-32
 Identities = 21/43 (48%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE++    L +VVIT+V RDDL D GS  + ETV+K++   P
Sbjct: 93  VAESVELMNLKHVVITAVARDDLRDAGSNVYAETVRKVRERNP 135



>sp|Q8DLC2|LIP1_SYNEL Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>gb:BA000039_726358 Thermosynechococcus
           elongatus BP-1 DNA, complete genome.
          Length = 290

 Score =  111 bits (278), Expect(2) = 3e-32
 Identities = 62/153 (40%), Positives = 89/153 (58%), Gaps = 6/153 (3%)
 Frame = -3

Query: 803 LVPDFRGDPS------CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMA 642
           L PDFR D        C+ ++  +    + HN+ETV  LQ  VR   A ++ S+ VL   
Sbjct: 138 LSPDFRMDRGRLSQRDCIAQIVAAQPACYNHNLETVRRLQGPVR-RGATYESSLRVLATV 196

Query: 641 KDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYIT 462
           K+  P    TK+ +MLG GET  ++++T++ +R  G D +T GQY+ PS  H+PV +Y T
Sbjct: 197 KELNP-DIPTKSGLMLGLGETEAEIIETLKDLRRVGCDRLTLGQYLPPSLSHLPVVKYWT 255

Query: 461 PEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           PE F     +  E+GF +V SGP+VRSSY A E
Sbjct: 256 PEEFNTLGNIARELGFSHVRSGPLVRSSYHAAE 288



 Score = 50.4 bits (119), Expect(2) = 3e-32
 Identities = 23/45 (51%), Positives = 32/45 (71%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           + +A A+A+ GL YVV+TSV RDDLPDQG+G F  T+  ++   P
Sbjct: 87  TKIAAAVATLGLRYVVLTSVARDDLPDQGAGQFVATMAAIRQRCP 131



>gb:AE004969_60536 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 327

 Score =  110 bits (275), Expect(2) = 4e-32
 Identities = 65/157 (41%), Positives = 94/157 (59%), Gaps = 1/157 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKV-AKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG      K+ A++  DV  HN+ET   L    R   AN++ S+D+L   K+  P
Sbjct: 166 LVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPG-ANYQHSLDLLKRYKEMMP 224

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ IM+G GET + V + M  +RA  ++++T GQY++PS  H+PV  Y+TPE F+
Sbjct: 225 H-IPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFK 283

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIES 336
            ++    E+GF   A G MVRSSY A E   +++ ES
Sbjct: 284 IFEKEAYELGFTNAAIGAMVRSSYHADEQAAEALRES 320



 Score = 51.2 bits (121), Expect(2) = 4e-32
 Identities = 23/48 (47%), Positives = 33/48 (68%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+AE++ +  L YVVITSVDRDDL D G+ HF + ++ ++   PN  I
Sbjct: 116 NLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKI 163



>sp|Q9JZA5|LIPA_NEIMB Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|D81109|D81109 lipoic acid synthetase
           NMB1216 [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002469_46643 Neisseria meningitidis
           serogroup B strain MC58 section 111 of 206 of the
           complete genome.>gb:AE002098_896756 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 327

 Score =  110 bits (275), Expect(2) = 4e-32
 Identities = 65/157 (41%), Positives = 94/157 (59%), Gaps = 1/157 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKV-AKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG      K+ A++  DV  HN+ET   L    R   AN++ S+D+L   K+  P
Sbjct: 166 LVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPG-ANYQHSLDLLKRYKEMMP 224

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ IM+G GET + V + M  +RA  ++++T GQY++PS  H+PV  Y+TPE F+
Sbjct: 225 H-IPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFK 283

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIES 336
            ++    E+GF   A G MVRSSY A E   +++ ES
Sbjct: 284 IFEKEAYELGFSNAAIGAMVRSSYHADEQAAEALRES 320



 Score = 51.2 bits (121), Expect(2) = 4e-32
 Identities = 23/48 (47%), Positives = 33/48 (68%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+AE++ +  L YVVITSVDRDDL D G+ HF + ++ ++   PN  I
Sbjct: 116 NLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKI 163



>sp|Q9JUC8|LIPA_NEIMA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|D81907|D81907 probable lipoic acid
           synthetase NMA1378 [imported] - Neisseria meningitidis
           (strain Z2491 serogroup A)>gb:NMA4Z2491_154280 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 4/7.
          Length = 327

 Score =  110 bits (275), Expect(2) = 4e-32
 Identities = 65/157 (41%), Positives = 94/157 (59%), Gaps = 1/157 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKV-AKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG      K+ A++  DV  HN+ET   L    R   AN++ S+D+L   K+  P
Sbjct: 166 LVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPG-ANYQHSLDLLKRYKEMMP 224

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ IM+G GET + V + M  +RA  ++++T GQY++PS  H+PV  Y+TPE F+
Sbjct: 225 H-IPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFK 283

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIES 336
            ++    E+GF   A G MVRSSY A E   +++ ES
Sbjct: 284 IFEKEAYELGFSNAAIGAMVRSSYHADEQAAEALRES 320



 Score = 51.2 bits (121), Expect(2) = 4e-32
 Identities = 23/48 (47%), Positives = 33/48 (68%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+AE++ +  L YVVITSVDRDDL D G+ HF + ++ ++   PN  I
Sbjct: 116 NLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKI 163



>gb:BC087803_2565453 Xenopus tropicalis hypothetical LOC496674, mRNA
           (cDNA clone MGC:108245 IMAGE:7017428), complete cds.
          Length = 327

 Score =  140 bits (353), Expect = 4e-32
 Identities = 74/128 (57%), Positives = 91/128 (71%)
 Frame = -3

Query: 839 LRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSM 660
           L+  NQ      L PDFRG+   VE VA SGLDV+AHN+ETV  LQ  VRD RANF QS+
Sbjct: 200 LKERNQTILIECLTPDFRGNLKAVETVAGSGLDVYAHNVETVPALQRHVRDPRANFDQSV 259

Query: 659 DVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 480
           +VL  AK+  P   ++KTSIMLG GET +Q+  TM+ +R AGVD +T GQYM+P+KRH+ 
Sbjct: 260 NVLKHAKNVRPE-LISKTSIMLGLGETDEQIYSTMKALREAGVDCLTLGQYMQPTKRHLK 318

Query: 479 VSEYITPE 456
           V EYITPE
Sbjct: 319 VEEYITPE 326



 Score = 59.7 bits (143), Expect = 9e-08
 Identities = 28/48 (58%), Positives = 34/48 (70%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N A+AIA WGLDYVV+TSVDRDD+ D G+ H  +TV  LK     +LI
Sbjct: 162 NTAKAIADWGLDYVVLTSVDRDDISDGGAEHIAKTVSLLKERNQTILI 209



>sp|Q8UFG1|LIPA_AGRT5 Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|AD2753|AD2753 lipoic Acid Synthetase
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>pir|B97534|B97534 lipoic acid synthetase
           (lip-syn) (lipoate synthase) [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>gb:AE008069_233167
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 127 of 254 of the complete
           sequence.>gb:AE009104_248469 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 130 of 256 of the
           complete sequence.>gb:AE007869_1082836 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1086312 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 323

 Score =  109 bits (273), Expect(2) = 5e-32
 Identities = 57/147 (38%), Positives = 89/147 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF   P  +E+V  +  DVF HN+ETV      VR   A +  S+ +L   K+  P 
Sbjct: 161 LTPDFLKKPGALERVVAAKPDVFNHNMETVPGNYLTVRPG-ARYFHSVRLLQRVKELDPT 219

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  ++V++ M+ +R+A VD +T GQY++P+++H  V  ++TPE F+ 
Sbjct: 220 -MFTKSGIMVGLGEERNEVLQLMDDLRSADVDFLTIGQYLQPTRKHHKVEAFVTPEEFKS 278

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y+ +    GF  V+S P+ RSS+ AG+
Sbjct: 279 YETVAYAKGFLMVSSSPLTRSSHHAGD 305



 Score = 51.6 bits (122), Expect(2) = 5e-32
 Identities = 24/48 (50%), Positives = 32/48 (66%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           NVA+A+   GL +VVITSVDRDDL D G+ HF + +  ++A  P   I
Sbjct: 111 NVAKAVKQMGLSHVVITSVDRDDLADGGAEHFEKVIWAIRAASPTTTI 158



>gb:CR378672_96216 Photobacterium profundum SS9; segment 10/12.
          Length = 322

 Score =  112 bits (279), Expect(2) = 5e-32
 Identities = 57/146 (39%), Positives = 92/146 (63%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  +VF HN+ET   L    R   AN++ S+D+L   K+  P
Sbjct: 169 LVPDFRGRMDRALDILQGTPPNVFNHNLETAPRLYRKARPG-ANYQWSLDLLKNFKEIHP 227

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ ++ +RA GV ++T GQY+ PS+ H+PV  Y+ P  F+
Sbjct: 228 E-VPTKSGVMMGLGETKEEIIQVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFD 286

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + + + +E+GF + A GP VRSSY A
Sbjct: 287 ELKEIALELGFTHAACGPFVRSSYHA 312



 Score = 49.3 bits (116), Expect(2) = 5e-32
 Identities = 23/49 (46%), Positives = 34/49 (69%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           S++A+ IA   L YVVITSVDRDDL D G+ HF + +++++   P + I
Sbjct: 118 SHLAQTIADMKLKYVVITSVDRDDLRDGGAQHFVDCIREIREKSPEIHI 166



>sp|Q8F3V7|LIPA_LEPIN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE011399_272529 Leptospira interrogans
           serovar lai str. 56601 chromosome I, section 208 of 397
           of the complete sequence.>gb:AE010300_1005928 Leptospira
           interrogans serovar lai str. 56601 chromosome I,
           complete sequence.
          Length = 301

 Score =  117 bits (294), Expect(2) = 5e-32
 Identities = 58/152 (38%), Positives = 96/152 (63%)
 Frame = -3

Query: 818 CS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAK 639
           C    L+PD +     +E + +   D+F HN+ETV+ L   V   +  +++S+DVL +A 
Sbjct: 148 CKIELLIPDLKVKQEALEIIFECNPDIFNHNLETVKRLFPEVAPQK-RYERSLDVLKIA- 205

Query: 638 DYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP 459
             +  G LTK+ ++LG GET ++V + M+ + + GV ++T GQY++P+  H+PV EY+ P
Sbjct: 206 --SARGFLTKSGLILGMGETLEEVKECMQDLASVGVSLLTLGQYLQPTSTHLPVKEYVVP 263

Query: 458 EAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           + F+  ++ G  +GF+ V SGP+VRSSY A E
Sbjct: 264 QVFKDLRIYGKSIGFKGVFSGPLVRSSYHADE 295



 Score = 43.5 bits (101), Expect(2) = 5e-32
 Identities = 21/47 (44%), Positives = 33/47 (70%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AE+  +  L +VVITSV+RDDL D G+ HF +TV++++   P+  I
Sbjct: 104 IAESSIALDLRHVVITSVNRDDLEDGGAAHFAKTVKEIRKGLPDCKI 150



>gb:AE016851_348988 Tropheryma whipplei str. Twist, section 2 of 3
           of the complete genome.>gb:AE014184_1029184 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 354

 Score =  125 bits (313), Expect(2) = 6e-32
 Identities = 58/153 (37%), Positives = 104/153 (67%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G P  ++++ ++  +V+AHNIETV  +   +R     + +S+DV+   +    A
Sbjct: 177 LIPDFNGKPELLQQIFEAQPEVYAHNIETVPRIFRRIRP-AFRYDRSLDVISQGQK---A 232

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET ++V + +  +++AG D++T  QY+RPS RH+PV+ ++ P+ F +
Sbjct: 233 GMITKSNLILGMGETGEEVTQALRDLKSAGCDIVTITQYLRPSPRHLPVARWVKPQEFIE 292

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           Y+    E+GF  V +GP+VRSSY+AG+ + +S+
Sbjct: 293 YKEQAKEIGFSGVLAGPLVRSSYRAGKLWAQSV 325



 Score = 35.8 bits (81), Expect(2) = 6e-32
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKL 838
           V +++A   L Y  +T V RDDLPD G   + ET++++
Sbjct: 128 VGQSVAQMKLRYATVTGVARDDLPDGGVWLYAETIREI 165



>sp|Q83NN8|LIPA_TROW8 Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>sp|Q83MU9|LIPA_TROWT Lipoyl synthase (EC
           2.8.1.-) (Lipoic acid synthase) (Lipoate synthase)
           (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion
           protein lipA) (Lip-syn).>gb:BX251411_764502 Tropheryma
           whipplei TW08/27, complete genome; segment 2/3.
          Length = 351

 Score =  125 bits (313), Expect(2) = 6e-32
 Identities = 58/153 (37%), Positives = 104/153 (67%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G P  ++++ ++  +V+AHNIETV  +   +R     + +S+DV+   +    A
Sbjct: 174 LIPDFNGKPELLQQIFEAQPEVYAHNIETVPRIFRRIRP-AFRYDRSLDVISQGQK---A 229

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET ++V + +  +++AG D++T  QY+RPS RH+PV+ ++ P+ F +
Sbjct: 230 GMITKSNLILGMGETGEEVTQALRDLKSAGCDIVTITQYLRPSPRHLPVARWVKPQEFIE 289

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           Y+    E+GF  V +GP+VRSSY+AG+ + +S+
Sbjct: 290 YKEQAKEIGFSGVLAGPLVRSSYRAGKLWAQSV 322



 Score = 35.8 bits (81), Expect(2) = 6e-32
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKL 838
           V +++A   L Y  +T V RDDLPD G   + ET++++
Sbjct: 125 VGQSVAQMKLRYATVTGVARDDLPDGGVWLYAETIREI 162



>gb:BA000039_726397 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 302

 Score =  117 bits (294), Expect(2) = 6e-32
 Identities = 59/145 (40%), Positives = 93/145 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PD  G+   ++++  +G +V  HN ETV  L   VR  + N+++S+++L   +D AP 
Sbjct: 139 LIPDLCGNWQALDQILAAGPEVLNHNTETVPRLYRRVRP-QGNYQRSLELLQRVRDRAP- 196

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              +K+ IM+G GET ++VV  M+ +R  G D++T GQY++PS +H+ V  +I PE FE+
Sbjct: 197 WIYSKSGIMVGLGETSEEVVALMQDLRQVGCDILTIGQYLQPSPKHLAVQAFIPPEQFEE 256

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           ++ LG  MGF  V S P+ RSSY A
Sbjct: 257 WRRLGESMGFLQVVSSPLTRSSYHA 281



 Score = 43.1 bits (100), Expect(2) = 6e-32
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AEA+    L++VVITSV+RDDL D G+  F  T++ ++   P   I
Sbjct: 90  LAEAVVRMRLNHVVITSVNRDDLADGGASQFVATIEAVRQRSPQTTI 136



>sp|Q8DL83|LIP2_SYNEL Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).
          Length = 298

 Score =  117 bits (294), Expect(2) = 6e-32
 Identities = 59/145 (40%), Positives = 93/145 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PD  G+   ++++  +G +V  HN ETV  L   VR  + N+++S+++L   +D AP 
Sbjct: 135 LIPDLCGNWQALDQILAAGPEVLNHNTETVPRLYRRVRP-QGNYQRSLELLQRVRDRAP- 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              +K+ IM+G GET ++VV  M+ +R  G D++T GQY++PS +H+ V  +I PE FE+
Sbjct: 193 WIYSKSGIMVGLGETSEEVVALMQDLRQVGCDILTIGQYLQPSPKHLAVQAFIPPEQFEE 252

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           ++ LG  MGF  V S P+ RSSY A
Sbjct: 253 WRRLGESMGFLQVVSSPLTRSSYHA 277



 Score = 43.1 bits (100), Expect(2) = 6e-32
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AEA+    L++VVITSV+RDDL D G+  F  T++ ++   P   I
Sbjct: 86  LAEAVVRMRLNHVVITSVNRDDLADGGASQFVATIEAVRQRSPQTTI 132



>gb:BX248358_762912 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 5/8.
          Length = 362

 Score =  119 bits (298), Expect(2) = 8e-32
 Identities = 57/153 (37%), Positives = 98/153 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF G P  +++V ++  +VFAHN+ETV  +   +R     +++S+DV+  A+D+   
Sbjct: 168 LTPDFSGKPDLLQEVFEARPEVFAHNLETVPRIFKRIRP-AFRYERSLDVIRQARDF--- 223

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET D++   +  + +AG D++T  QY+RP   + P+  ++ PE F  
Sbjct: 224 GLVTKSNLILGMGETVDEIRDALVDLHSAGCDIITITQYLRPGPMYHPIDRWVKPEEFID 283

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           +     E+GF  V SGP+VRSSY+AG+ Y +++
Sbjct: 284 HADFARELGFGAVMSGPLVRSSYRAGKLYAEAL 316



 Score = 41.2 bits (95), Expect(2) = 8e-32
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           VAE++    L+Y  IT V RDDL D+G+  + E V+K+  L P+
Sbjct: 119 VAESVREMQLNYSTITGVTRDDLEDEGAWLYAEVVRKIHELNPH 162



>sp|P61194|LIPA_CORDI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).
          Length = 349

 Score =  119 bits (298), Expect(2) = 8e-32
 Identities = 57/153 (37%), Positives = 98/153 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF G P  +++V ++  +VFAHN+ETV  +   +R     +++S+DV+  A+D+   
Sbjct: 155 LTPDFSGKPDLLQEVFEARPEVFAHNLETVPRIFKRIRP-AFRYERSLDVIRQARDF--- 210

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET D++   +  + +AG D++T  QY+RP   + P+  ++ PE F  
Sbjct: 211 GLVTKSNLILGMGETVDEIRDALVDLHSAGCDIITITQYLRPGPMYHPIDRWVKPEEFID 270

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           +     E+GF  V SGP+VRSSY+AG+ Y +++
Sbjct: 271 HADFARELGFGAVMSGPLVRSSYRAGKLYAEAL 303



 Score = 41.2 bits (95), Expect(2) = 8e-32
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           VAE++    L+Y  IT V RDDL D+G+  + E V+K+  L P+
Sbjct: 106 VAESVREMQLNYSTITGVTRDDLEDEGAWLYAEVVRKIHELNPH 149



>sp|Q92Q94|LIPA_RHIME Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:SME591787_185470 Sinorhizobium meliloti
           1021 complete chromosome; segment 6/12.
          Length = 322

 Score =  110 bits (276), Expect(2) = 8e-32
 Identities = 58/158 (36%), Positives = 92/158 (58%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF   P  +E+V  +  DV  HN+ETV      VR   A +  S+ +L   K+  P 
Sbjct: 161 LTPDFLRKPGALERVVAAKPDVINHNLETVPSNYLTVRPG-ARYFHSIRLLQRVKELDPT 219

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  ++V++ M+ +R A VD +T GQY++PS++H  V +++TPE F+ 
Sbjct: 220 -MFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPSRKHHKVEKFVTPEEFKS 278

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDR 330
           Y+ +    GF  V+S P+ RSS+ AG+ + +     +R
Sbjct: 279 YETVAYTKGFLMVSSSPLTRSSHHAGDDFARLKAARER 316



 Score = 49.7 bits (117), Expect(2) = 8e-32
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +NVA+A+   GL +VVITSVDRDDL D G+ HF + +  ++   P   I
Sbjct: 110 ANVAKAVKQMGLSHVVITSVDRDDLDDGGAEHFEKVIFAIREASPETTI 158



>sp|Q87DZ9|LIPA_XYLFT Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE012555_283951 Xylella fastidiosa
           Temecula1, section 3 of 9 of the complete
           genome.>gb:AE009442_960527 Xylella fastidiosa Temecula1,
           complete genome.
          Length = 373

 Score =  112 bits (281), Expect(2) = 1e-31
 Identities = 67/148 (45%), Positives = 90/148 (60%), Gaps = 3/148 (2%)
 Frame = -3

Query: 803 LVPDFRGD---PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDY 633
           L PDFRG       ++ +A    DVF HN+ETV  L   VR   A+++ S+ +L   K  
Sbjct: 181 LTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRPG-ADYQWSLTLLKRFKAQ 239

Query: 632 APAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA 453
            P    TK+ IMLG GET DQV  T+  +RA  VD++T GQY++P+  H PV  Y TP+ 
Sbjct: 240 HPQ-VPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTVGQYLQPTPHHHPVLRYWTPDE 298

Query: 452 FEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           ++  +  GM +GF +VASGPMVRSSY A
Sbjct: 299 YKALEEYGMALGFSHVASGPMVRSSYHA 326



 Score = 47.0 bits (110), Expect(2) = 1e-31
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++A  +A  GL YVV+TSVDRDDL D G+ HF + +  ++   P   I
Sbjct: 131 SLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFVDCIAAIRQSAPQTRI 178



>gb:AP008231_582187 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 300

 Score =  113 bits (282), Expect(2) = 1e-31
 Identities = 64/156 (41%), Positives = 91/156 (58%), Gaps = 11/156 (7%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLD-----------VFAHNIETVEELQSVVRDHRANFKQSMD 657
           L PDF G     ++  ++  D            F HN+ETVE LQ  VR   A + +S+ 
Sbjct: 142 LTPDFWGGEPDRDRAEQAQADRLAVVLAEQPACFNHNLETVERLQGQVR-RGARYDRSLR 200

Query: 656 VLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV 477
           +L +AK  AP    TK+ +MLG GET  +V++TM+ +R  G D +T GQY++PS  H+PV
Sbjct: 201 LLALAKQQAPM-IPTKSGLMLGLGETQAEVIETMQALRQVGCDRLTLGQYLQPSLAHLPV 259

Query: 476 SEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
             Y TP  FE+   +  ++GF+ V SGP+VRSSY A
Sbjct: 260 QRYWTPAEFEELGAIARDLGFQQVRSGPLVRSSYHA 295



 Score = 46.6 bits (109), Expect(2) = 1e-31
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEA+ + GL YVV+T+V RDD PDQG+  F  T+Q +    P   I
Sbjct: 93  VAEAVETLGLQYVVLTAVARDDRPDQGATQFAATMQAITQRCPQTQI 139



>sp|Q89LR6|LIP1_BRAJA Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>gb:BA000040_732737 Bradyrhizobium japonicum
           USDA 110 DNA, complete genome.
          Length = 318

 Score =  102 bits (254), Expect(2) = 2e-31
 Identities = 58/160 (36%), Positives = 91/160 (56%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      +E V  +  DVF HN+ETV      VR   A +  S+ +L   K+   A
Sbjct: 160 LTPDFLRKEGALEVVVAARPDVFNHNLETVPSRYLTVRPG-ARYFHSIRLLQRVKEL-DA 217

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE   +V + M+ +R+A VD +T GQY++P+++H  V  Y+ P+ F  
Sbjct: 218 SIFTKSGIMVGLGEERHEVQQVMDDLRSADVDFLTIGQYLQPTRKHHAVMRYVPPDEFSS 277

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA 324
           Y+ +    GF  V++ P+ RSS+ AGE + +  +++ RAA
Sbjct: 278 YEKVAYTKGFLMVSASPLTRSSHHAGEDFAR--LKAARAA 315



 Score = 57.0 bits (136), Expect(2) = 2e-31
 Identities = 27/48 (56%), Positives = 36/48 (75%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           NVAEA+A  GL +VVITSVDRDDL D G+ HF +T++ ++A  P+  I
Sbjct: 110 NVAEAVAKLGLAHVVITSVDRDDLADGGAEHFAQTIRAIRAACPSTTI 157



>gb:AE017197_402689 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 297

 Score =  107 bits (268), Expect(2) = 2e-31
 Identities = 59/151 (39%), Positives = 88/151 (58%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      VE +A S  DVF HN+ETV  L   +R   A +  S+ +L   K  +P 
Sbjct: 137 LTPDFLRKAGAVEVIANSKPDVFNHNVETVPSLYKTIRPG-ARYYNSLSLLHNIKKLSPE 195

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M+G GE  ++VV+ M+ +R A VD +T GQY++P+K H  V +Y+TPE F+ 
Sbjct: 196 -IFTKSGMMVGLGEEINEVVQVMDDLREANVDFLTIGQYLQPTKSHAEVIKYVTPEEFKY 254

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
            + +    GF  V++ P+ RSSY A + + K
Sbjct: 255 LERIAKTKGFLMVSATPLTRSSYHADKDFQK 285



 Score = 51.2 bits (121), Expect(2) = 2e-31
 Identities = 23/47 (48%), Positives = 32/47 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AEA+    L++VVITSVDRDDL D G+ HF E + +++   PN  I
Sbjct: 88  LAEAVQKLNLNHVVITSVDRDDLEDGGASHFAECINEIRRSSPNTTI 134



>sp|Q8YWC1|LIP1_ANASP Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>pir|AH2017|AH2017 lipoic acid synthetase
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682683 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 291

 Score =  111 bits (278), Expect(2) = 2e-31
 Identities = 55/145 (37%), Positives = 92/145 (63%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PD  G+   +  + ++  +V  HN ET+  L   VR  + N+ +++++L  ++  AP 
Sbjct: 135 LIPDLCGNWEALRIILQASPEVLNHNTETIPRLYRRVRP-QGNYDRTLELLQRSRQIAP- 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GET  +V + M+ +RA   D++T GQY++PS++H+ V++++TPE F  
Sbjct: 193 WLYTKSGIMVGLGETNAEVRQVMQDLRAVDCDILTIGQYLQPSQKHLQVNDFVTPEQFAA 252

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           +QV G E+GF  V S P+ RSSY A
Sbjct: 253 WQVYGEELGFLQVVSSPLTRSSYHA 277



 Score = 47.4 bits (111), Expect(2) = 2e-31
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           + +AEA+    L++VVITSV+RDDLPD G+  F + + +++A+ P   I
Sbjct: 84  TRLAEAVRRMRLNHVVITSVNRDDLPDGGASQFVKCIAEVRAVSPQTTI 132



>gb:AE016822_340105 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 329

 Score =  117 bits (293), Expect(2) = 3e-31
 Identities = 58/153 (37%), Positives = 98/153 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           LVPDF GDP  + +V  +  +VFAHN+ETV  +   +R     +++S+DV+   +    A
Sbjct: 155 LVPDFSGDPELLGEVFGARPEVFAHNVETVPRIFKRIRP-AFRYERSLDVIAQGR---AA 210

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GE   ++ + ++ +  AG D++T  QY+RPS RH+PV+ ++ P+ F +
Sbjct: 211 GLITKSNLILGMGEERQEISQALQDLHDAGTDIITITQYLRPSPRHLPVARWVRPDEFVE 270

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
            +     +GF  V +GP+VRSSY+AG  + +SM
Sbjct: 271 LRDEAEAIGFLGVLAGPLVRSSYRAGRLWAQSM 303



 Score = 41.2 bits (95), Expect(2) = 3e-31
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE++A  GL Y  +T V RDDL D+G+  + ET++++    P
Sbjct: 106 VAESVARMGLRYSTVTGVARDDLEDEGAWLYAETIREIHRQSP 148



>gb:BX950851_840044 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 321

 Score =  111 bits (277), Expect(2) = 3e-31
 Identities = 61/146 (41%), Positives = 91/146 (62%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     +E +  +  DVF HN+E V  +   VR   AN++ S+ +L   K+  P
Sbjct: 168 LVPDFRGRMDRALEILTATPPDVFNHNLENVPRVYRQVRPG-ANYEWSLKLLENFKNAHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
             T TK+ +M+G GET  ++V+ M  +R  GV ++T GQY++PS+ H+PV  Y++P+ F+
Sbjct: 227 DIT-TKSGLMVGLGETNAEIVEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   M MGF + A GP VRSSY A
Sbjct: 286 EMKAEAMAMGFTHAACGPFVRSSYHA 311



 Score = 47.4 bits (111), Expect(2) = 3e-31
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ I   GL YVVITSVDRDDL D G+ HF + +  ++   P++ I
Sbjct: 119 LAQTIHDMGLRYVVITSVDRDDLRDGGAQHFADCISAIRRKNPHIRI 165



>sp|Q82UJ5|LIPA_NITEU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BX321861_773817 Nitrosomonas europaea ATCC
           19718, complete genome; segment 6/10.
          Length = 314

 Score =  112 bits (280), Expect(2) = 3e-31
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 3/150 (2%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     +EK++    DV  HN+ETV  L    R   A++  S+ +L   KD+  
Sbjct: 161 LVPDFRGRLEVALEKLSACPPDVMNHNLETVPRLYKQCRPG-ADYMHSLQLL---KDFKA 216

Query: 626 A--GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA 453
           A     TK+ +MLG GET +++++ M  +RA  VD++T GQY++PSK H PV  Y++PE 
Sbjct: 217 AFPHIPTKSGLMLGLGETDEEIIEVMRDLRAHQVDMLTVGQYLQPSKGHHPVMRYVSPED 276

Query: 452 FEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           F+ ++ +   +GF + A GPMVRSSY A +
Sbjct: 277 FKTFERIATNLGFSHAACGPMVRSSYHADQ 306



 Score = 46.2 bits (108), Expect(2) = 3e-31
 Identities = 22/48 (45%), Positives = 32/48 (66%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++A +IA   L+YVVITSVDRDDL D G+ HF + ++ ++   P   I
Sbjct: 111 HLANSIAVLKLNYVVITSVDRDDLRDGGAQHFADCIRAIRTQSPQTRI 158



>gb:AE017312_439158 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 4 of 12 of the complete
           genome.>gb:AE017285_1072319 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 298

 Score =  110 bits (276), Expect(2) = 4e-31
 Identities = 56/149 (37%), Positives = 87/149 (58%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDFRGD + +  V  +   +  HN+ET     + +R  +A+++QS+++L   K    A
Sbjct: 143 LIPDFRGDHAALRTVMAAAPHIVNHNVETPPAHYARIRP-QADYRQSLELLRRVK---AA 198

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G + K+ +M+G GE   +V   +  +   G D++T GQYMRPS++H PV  Y+ P+ FE 
Sbjct: 199 GGVAKSGLMVGLGENDTEVEGVLADLADCGCDIVTIGQYMRPSRQHPPVERYVHPDTFES 258

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFY 357
           +   G  MG  +V S P+VRSSY A   Y
Sbjct: 259 FAACGRGMGIPFVFSAPLVRSSYNAESAY 287



 Score = 47.4 bits (111), Expect(2) = 4e-31
 Identities = 23/43 (53%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAEA A   L +VV+TSV RDDL D G+ HF  T+ +L+A  P
Sbjct: 94  VAEAAARLALRHVVVTSVTRDDLDDGGAAHFAATITRLRAALP 136



>gb:CP000010_864515 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 329

 Score =  105 bits (262), Expect(2) = 7e-31
 Identities = 58/146 (39%), Positives = 86/146 (58%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           L PDFRG       +  +   DV  HN+ETV  L    R   +++  S+ +L   K   P
Sbjct: 176 LTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPG-SDYAHSLKLLKDFKALHP 234

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET D++++ M  +RA  VD++T GQY++PS+ H+PV EY+ P+ F+
Sbjct: 235 -DVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFK 293

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
            Y+    +MGF + A G MVRSSY A
Sbjct: 294 MYEEEAYKMGFTHAAVGAMVRSSYHA 319



 Score = 52.0 bits (123), Expect(2) = 7e-31
 Identities = 24/44 (54%), Positives = 32/44 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           N+A  IA+  L YVVITSVDRDDL D G+GHF E +++++   P
Sbjct: 126 NLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSP 169



>gb:BX571965_790190 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 329

 Score =  105 bits (262), Expect(2) = 7e-31
 Identities = 58/146 (39%), Positives = 86/146 (58%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           L PDFRG       +  +   DV  HN+ETV  L    R   +++  S+ +L   K   P
Sbjct: 176 LTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPG-SDYAHSLKLLKDFKALHP 234

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET D++++ M  +RA  VD++T GQY++PS+ H+PV EY+ P+ F+
Sbjct: 235 -DVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFK 293

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
            Y+    +MGF + A G MVRSSY A
Sbjct: 294 MYEEEAYKMGFTHAAVGAMVRSSYHA 319



 Score = 52.0 bits (123), Expect(2) = 7e-31
 Identities = 24/44 (54%), Positives = 32/44 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           N+A  IA+  L YVVITSVDRDDL D G+GHF E +++++   P
Sbjct: 126 NLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSP 169



>gb:AE008692_240870 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 323

 Score =  111 bits (278), Expect(2) = 9e-31
 Identities = 60/147 (40%), Positives = 89/147 (60%), Gaps = 1/147 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           L PDFRG P   ++ + K+  DVF HN+ETV  L   +R   A +  S+ +L   ++  P
Sbjct: 153 LTPDFRGKPDHALDMIVKARPDVFNHNLETVPRLYPTIRPG-ARYFTSLRLLEKVRERDP 211

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
           +   TK+ +MLG GE   +V + M+ +R A VD +T GQY++P+ RH+ V E++TP++F+
Sbjct: 212 S-IFTKSGLMLGLGEDRLEVHQVMDDMRQADVDFLTLGQYLQPTPRHVRVEEFVTPDSFK 270

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAG 366
            Y       GF  VAS P+ RSSY AG
Sbjct: 271 AYAATARAKGFSMVASSPLTRSSYYAG 297



 Score = 45.4 bits (106), Expect(2) = 9e-31
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +VA+  A   L+++VITSVDRDDL D G+  F + ++ ++A  P   I
Sbjct: 103 HVADVAAEMNLEHIVITSVDRDDLEDGGASQFVKVIEAVRARTPKTTI 150



>sp|Q9RNY7|LIPA_ZYMMO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AF176314_485689 Zymomonas mobilis fosmid
           clone 42B11, complete sequence.
          Length = 323

 Score =  111 bits (278), Expect(2) = 9e-31
 Identities = 60/147 (40%), Positives = 89/147 (60%), Gaps = 1/147 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           L PDFRG P   ++ + K+  DVF HN+ETV  L   +R   A +  S+ +L   ++  P
Sbjct: 153 LTPDFRGKPDHALDMIVKARPDVFNHNLETVPRLYPTIRPG-ARYFTSLRLLEKVRERDP 211

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
           +   TK+ +MLG GE   +V + M+ +R A VD +T GQY++P+ RH+ V E++TP++F+
Sbjct: 212 S-IFTKSGLMLGLGEDRLEVHQVMDDMRQADVDFLTLGQYLQPTPRHVRVEEFVTPDSFK 270

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAG 366
            Y       GF  VAS P+ RSSY AG
Sbjct: 271 AYAATARAKGFSMVASSPLTRSSYYAG 297



 Score = 45.4 bits (106), Expect(2) = 9e-31
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +VA+  A   L+++VITSVDRDDL D G+  F + ++ ++A  P   I
Sbjct: 103 HVADVAAEMNLEHIVITSVDRDDLEDGGASQFVKVIEAVRARTPKTTI 150



>sp|O05941|LIPA_RHIET Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:RELIPAGEN_162877 R.etli lipA gene.
          Length = 322

 Score =  111 bits (278), Expect(2) = 9e-31
 Identities = 58/151 (38%), Positives = 90/151 (59%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF   P  +E+V  +  DVF HN+ETV      VR   A +  S+ +L   K+  P 
Sbjct: 160 LTPDFLKKPGALERVVAAKPDVFNHNMETVAGNYLTVRPG-ARYFHSIRLLQRVKELDPT 218

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  ++V++ M+ +R A VD +T GQY++P+++H  V  ++TPE F+ 
Sbjct: 219 -MFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHKVESFVTPEEFKS 277

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           Y+ +    GF  VAS P+ RSS+ AG+ + +
Sbjct: 278 YETVAYSKGFLMVASSPLTRSSHHAGDDFAR 308



 Score = 45.4 bits (106), Expect(2) = 9e-31
 Identities = 21/44 (47%), Positives = 30/44 (68%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           NVA+A+  W   +VVITSVDRDDL D G+ HF + +  +++  P
Sbjct: 111 NVAKAVRRWA-QHVVITSVDRDDLEDGGAQHFEKVIWAIRSASP 153



>sp|O05959|LIPA_RICPR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|B71634|B71634 lipoic acid synthetase
           (lipA) RP742 - Rickettsia prowazekii>gb:RPNTH_166717
           R.prowazekii nth, grlA, glyA, lipA, tlyC, tlcD
           genes.>gb:RPXX04_167504 Rickettsia prowazekii strain
           Madrid E, complete genome; segment 4/4.
          Length = 297

 Score =  106 bits (264), Expect(2) = 9e-31
 Identities = 57/151 (37%), Positives = 88/151 (58%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      VE +A +  DVF HN+ETV  L   +R   A +  S+ +L   K  +P 
Sbjct: 137 LTPDFLRKEGAVEIIANAKPDVFNHNVETVPSLYKTIRPG-ARYYNSLSLLHNIKKLSPE 195

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M+G GE  ++VV+ M+ +R A VD +T GQY++P+K H  + +Y+TPE F+ 
Sbjct: 196 -IFTKSGMMVGLGEEINEVVQVMDDLREANVDFLTIGQYLQPTKSHAEIRKYVTPEEFKY 254

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
            + +    GF  V++ P+ RSSY A + + K
Sbjct: 255 LERIAKTKGFLMVSATPLTRSSYHADKDFQK 285



 Score = 50.8 bits (120), Expect(2) = 9e-31
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AEA+    L +VVITSVDRDDL D G+ HF E + +++   PN  I
Sbjct: 88  LAEAVQKLNLQHVVITSVDRDDLEDGGASHFAECINEIRRSSPNTTI 134



>gb:BX897699_827206 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 320

 Score =  110 bits (276), Expect(2) = 1e-30
 Identities = 58/147 (39%), Positives = 89/147 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFR     +E V  +  DVF HN+ETV      VR   A +  S+ +L   K+  P 
Sbjct: 159 LTPDFRHKDGALEIVVAAKPDVFNHNLETVPSKYLKVRPG-ARYFHSIRLLQRVKELDPT 217

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  +++++ M+ +R+A VD MT GQY++P+++H PV  ++ PE FE 
Sbjct: 218 -IFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVPPEEFES 276

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGE 363
           +  +G   GF ++AS P+ RSS+ AG+
Sbjct: 277 FAKIGKVKGFLHMASNPLTRSSHHAGD 303



 Score = 45.8 bits (107), Expect(2) = 1e-30
 Identities = 22/47 (46%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+A+A   L +VVITSVDRDDL D G+ HF + +  ++   P   I
Sbjct: 110 VADAVARMELKHVVITSVDRDDLADGGAEHFAKVIYAIRRKAPKTTI 156



>sp|Q8ZDH0|LIPA_YERPE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|AB0317|AB0317 lipoic acid synthetase
           [imported] - Yersinia pestis (strain
           CO92)>gb:AE013720_299490 Yersinia pestis KIM section 120
           of 415 of the complete genome.>gb:AJ414153_524391
           Yersinia pestis strain CO92 complete genome; segment
           13/20.>gb:BX936398_835736 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.>gb:AE009952_929673
           Yersinia pestis KIM complete genome.
          Length = 321

 Score =  107 bits (267), Expect(2) = 1e-30
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   AN+  S+ +L   K+  P
Sbjct: 168 LVPDFRGRMDRALDILTATPPDVFNHNLENVPRVYRQVRPG-ANYDWSLKLLERFKEAHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET  ++V+ M  +R  GV ++T GQY++PS+ H+PV  Y++P  F+
Sbjct: 227 -DIPTKSGLMVGLGETNAEIVEVMHDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPAEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   M MGF + A GP VRSSY A
Sbjct: 286 EMKAEAMAMGFTHAACGPFVRSSYHA 311



 Score = 49.3 bits (116), Expect(2) = 1e-30
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ I   GL YVVITSVDRDDL D G+ HF + +  ++A  P + I
Sbjct: 119 LAQTIQDMGLRYVVITSVDRDDLRDGGAQHFADCISAIRAKNPTIKI 165



>gb:AE017131_386938 Yersinia pestis biovar Medievalis str. 91001
           section 5 of 16 of the complete
           genome.>gb:AE017042_1143504 Yersinia pestis biovar
           Medievalis str. 91001 complete genome.
          Length = 315

 Score =  107 bits (267), Expect(2) = 1e-30
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   AN+  S+ +L   K+  P
Sbjct: 162 LVPDFRGRMDRALDILTATPPDVFNHNLENVPRVYRQVRPG-ANYDWSLKLLERFKEAHP 220

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET  ++V+ M  +R  GV ++T GQY++PS+ H+PV  Y++P  F+
Sbjct: 221 -DIPTKSGLMVGLGETNAEIVEVMHDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPAEFD 279

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   M MGF + A GP VRSSY A
Sbjct: 280 EMKAEAMAMGFTHAACGPFVRSSYHA 305



 Score = 49.3 bits (116), Expect(2) = 1e-30
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ I   GL YVVITSVDRDDL D G+ HF + +  ++A  P + I
Sbjct: 113 LAQTIQDMGLRYVVITSVDRDDLRDGGAQHFADCISAIRAKNPTIKI 159



>sp|P61196|LIPA_GEOSL Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017180_398685 Geobacter sulfurreducens
           PCA, complete genome.
          Length = 303

 Score =  111 bits (277), Expect(2) = 1e-30
 Identities = 57/148 (38%), Positives = 89/148 (60%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G  + +  V  +   +  HN+ETV  L ++     A++ +S+ VL   ++ AP 
Sbjct: 135 LIPDFLGSRAALADVVAAAPRIIGHNVETVPRLYAIRAG--ADYGRSLAVLRTLRELAP- 191

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G  TK+ +MLG GET ++V+  M  +R      ++ GQY+ PS+ H PV E++ PE F++
Sbjct: 192 GCATKSGLMLGLGETEEEVLAVMADLRRVDCTYLSLGQYLAPSRFHHPVREFVLPETFDR 251

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEF 360
            + L  +MGFR+V SGP VRSSY A  +
Sbjct: 252 LKELAEKMGFRHVESGPYVRSSYHAAGY 279



 Score = 45.4 bits (106), Expect(2) = 1e-30
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           + VA+A+    L +VVITS  RDDLPD G+GH+  TV  +  + P  ++
Sbjct: 84  ARVAQAVVRLSLAHVVITSPTRDDLPDGGAGHYVATVATIGRVAPATVV 132



>sp|Q83C63|LIPA_COXBU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE016964_368464 Coxiella burnetii strain
           RSA 493, section 5 of 7 of the complete
           genome.>gb:AE016828_1009200 Coxiella burnetii strain RSA
           493, complete genome.
          Length = 315

 Score =  112 bits (279), Expect(2) = 2e-30
 Identities = 64/146 (43%), Positives = 90/146 (61%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGD-PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++++A+   DVF HNIET   L    R   A++  S+ +L   K   P
Sbjct: 162 LVPDFRGRMEKALDQLAQGLPDVFNHNIETAPRLYKQARPG-ADYPWSLALLQTFKKRFP 220

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
            G  TK+ +MLG GET ++V   M  +R   VD +T GQY++P++ HMPV  Y+TP+ F+
Sbjct: 221 -GIPTKSGMMLGLGETREEVEMVMRDLRQHEVDRLTLGQYLQPTRYHMPVDRYVTPQEFQ 279

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           +   L  ++GF  VASGP+VRSSY A
Sbjct: 280 ELGELAKKLGFSNVASGPLVRSSYHA 305



 Score = 44.3 bits (103), Expect(2) = 2e-30
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+A  ++   L YVVITSVDRDDL D G+ H+ + +  ++   P + +
Sbjct: 112 NLANTVSIMSLRYVVITSVDRDDLRDGGAQHYAQCINAVREKNPGIKV 159



>pir|A97843|A97843 lipoic acid synthetase [imported] - Rickettsia
           conorii  (strain Malish 7)>gb:AE008663_239509 Rickettsia
           conorii str. Malish 7, section 95 of 114 of the complete
           genome.>gb:AE006914_1121627 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 302

 Score =  105 bits (263), Expect(2) = 2e-30
 Identities = 57/151 (37%), Positives = 88/151 (58%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF       E +A +  DVF HN+ETV  L   +R   A +  S+ +L   K  +P 
Sbjct: 143 LTPDFLRKEGAAEIIANAKPDVFNHNVETVPSLYKTIRPG-ARYYNSLSLLHNIKKLSPE 201

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M+G GE  ++VV+ ++ +R A VD +T GQY++P+K H  V++Y+TPE F+ 
Sbjct: 202 -IFTKSGMMVGLGEEINEVVQVIDDLREAKVDFLTIGQYLQPTKNHAEVAKYVTPEEFKY 260

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
            + +    GF  V++ P+ RSSY A E + K
Sbjct: 261 LERVAKTKGFLMVSASPLTRSSYHADEDFQK 291



 Score = 50.4 bits (119), Expect(2) = 2e-30
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AEA+    L +VVITSVDRDDL D G+ HF E + +++   PN  I
Sbjct: 94  LAEAVQKLNLKHVVITSVDRDDLEDGGASHFAECISEIRKSSPNTTI 140



>sp|Q92GH8|LIPA_RICCN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).
          Length = 296

 Score =  105 bits (263), Expect(2) = 2e-30
 Identities = 57/151 (37%), Positives = 88/151 (58%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF       E +A +  DVF HN+ETV  L   +R   A +  S+ +L   K  +P 
Sbjct: 137 LTPDFLRKEGAAEIIANAKPDVFNHNVETVPSLYKTIRPG-ARYYNSLSLLHNIKKLSPE 195

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M+G GE  ++VV+ ++ +R A VD +T GQY++P+K H  V++Y+TPE F+ 
Sbjct: 196 -IFTKSGMMVGLGEEINEVVQVIDDLREAKVDFLTIGQYLQPTKNHAEVAKYVTPEEFKY 254

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
            + +    GF  V++ P+ RSSY A E + K
Sbjct: 255 LERVAKTKGFLMVSASPLTRSSYHADEDFQK 285



 Score = 50.4 bits (119), Expect(2) = 2e-30
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AEA+    L +VVITSVDRDDL D G+ HF E + +++   PN  I
Sbjct: 88  LAEAVQKLNLKHVVITSVDRDDLEDGGASHFAECISEIRKSSPNTTI 134



>sp|Q7W222|LIPA_BORPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BX640423_808424 Bordetella parapertussis
           strain 12822, complete genome; segment 1/14.
          Length = 333

 Score =  103 bits (258), Expect(2) = 2e-30
 Identities = 58/148 (39%), Positives = 86/148 (58%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG       +  SG  DV  HN+ETV  L    R   +++  S+ +L+  K   P
Sbjct: 180 LVPDFRGRLDRALHILNSGPPDVMNHNLETVPRLYKQARPG-SDYAHSLKLLVEFKKLHP 238

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +MLG GET +++++ M  +R   VD++T GQY++PS+ H+PV  Y+ P+ F 
Sbjct: 239 E-VPTKSGLMLGLGETDEEILQVMRDMREHNVDMLTIGQYLQPSEHHLPVLRYVHPDTFA 297

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            ++     MGF + A G MVRSSY A +
Sbjct: 298 MFEREAYAMGFTHAAVGAMVRSSYHADQ 325



 Score = 52.0 bits (123), Expect(2) = 2e-30
 Identities = 25/48 (52%), Positives = 32/48 (66%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+A  IA+  L YVVITSVDRDDL D G+ HF E + K++   P+  I
Sbjct: 130 NLARTIAALKLSYVVITSVDRDDLRDGGAAHFVECIAKVREYSPDTRI 177



>gb:BX897700_828734 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 320

 Score =  109 bits (273), Expect(2) = 2e-30
 Identities = 58/147 (39%), Positives = 88/147 (59%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDFR     +E V  +  DVF HN+ETV      VR   A +  S+ +L   K+  P 
Sbjct: 159 LTPDFRHKDGALEIVVAAKPDVFNHNLETVPSKYLKVRPG-ARYFHSIRLLQRVKELDPT 217

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE  +++++ M+ +R+A VD MT GQY++P+++H PV  +  PE FE 
Sbjct: 218 -IFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFFPPEEFES 276

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGE 363
           +  +G   GF ++AS P+ RSS+ AG+
Sbjct: 277 FAKIGKVKGFLHMASNPLTRSSHHAGD 303



 Score = 46.2 bits (108), Expect(2) = 2e-30
 Identities = 22/47 (46%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+A+A   L +VVITSVDRDDL D G+ HF + +  ++   P   I
Sbjct: 110 VADAVAQMELKHVVITSVDRDDLADGGAQHFAKVIYAIRRKAPKTTI 156



>sp|Q7WR00|LIPA_BORBR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>sp|Q7W0K8|LIPA_BORPE Lipoyl synthase (EC
           2.8.1.-) (Lipoic acid synthase) (Lipoate synthase)
           (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion
           protein lipA) (Lip-syn).>gb:BX640411_804554 Bordetella
           pertussis strain Tohama I, complete genome; segment
           1/12.>gb:BX640437_812826 Bordetella bronchiseptica
           strain RB50, complete genome; segment 1/16.
          Length = 333

 Score =  103 bits (256), Expect(2) = 3e-30
 Identities = 58/148 (39%), Positives = 85/148 (57%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG       +  SG  DV  HN+ETV  L    R   +++  S+ +L   K   P
Sbjct: 180 LVPDFRGRLDRALHILNSGPPDVMNHNLETVPRLYKQARPG-SDYAHSLKLLAEFKKLHP 238

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +MLG GET +++++ M  +R   VD++T GQY++PS+ H+PV  Y+ P+ F 
Sbjct: 239 E-VPTKSGLMLGLGETDEEILQVMRDMREHNVDMLTIGQYLQPSEHHLPVLRYVHPDTFA 297

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            ++     MGF + A G MVRSSY A +
Sbjct: 298 MFEREAYAMGFTHAAVGAMVRSSYHADQ 325



 Score = 52.0 bits (123), Expect(2) = 3e-30
 Identities = 25/48 (52%), Positives = 32/48 (66%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+A  IA+  L YVVITSVDRDDL D G+ HF E + K++   P+  I
Sbjct: 130 NLARTIAALKLSYVVITSVDRDDLRDGGAAHFVECIAKVREYSPDTRI 177



>sp|Q8ZR04|LIPA_SALTY Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:CP000026_76879 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008725_242356 Salmonella typhimurium LT2,
           section 33 of 220 of the complete
           genome.>gb:AE016841_346293 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 8 of 16 of the
           complete genome.>gb:AE014613_983625 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_999438 Salmonella typhimurium LT2,
           complete genome.
          Length = 321

 Score =  106 bits (264), Expect(2) = 4e-30
 Identities = 57/146 (39%), Positives = 89/146 (60%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   A++  S+ +L   K+  P
Sbjct: 168 LVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPG-ADYNWSLKLLERFKEAHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET  ++++ M  +R  GV ++T GQY++PS+ H+PV  Y++PE F+
Sbjct: 227 E-IPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   + MGF + A GP VRSSY A
Sbjct: 286 EMKAEALAMGFTHAACGPFVRSSYHA 311



 Score = 48.5 bits (114), Expect(2) = 4e-30
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ IA   L YVVITSVDRDDL D G+ HF + +  ++A  P + I
Sbjct: 119 LAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKI 165



>sp|Q89NW6|LIP2_BRAJA Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>gb:BA000040_731977 Bradyrhizobium japonicum
           USDA 110 DNA, complete genome.
          Length = 322

 Score =  100 bits (248), Expect(2) = 4e-30
 Identities = 55/151 (36%), Positives = 86/151 (56%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      +E V  +  DV  HN+ETV      VR   A +  S+ +L  AK+  P 
Sbjct: 167 LTPDFLRKHGALETVVAARPDVLNHNLETVPSKYLAVRPG-ARYFHSVRLLQRAKELDPR 225

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE   +V++ M+ +R+A VD +T GQY++P+++H  V  ++ P+ FE 
Sbjct: 226 -IFTKSGIMVGLGEDRSEVLQLMDDLRSADVDFLTIGQYLQPTRKHHAVMRFVPPDEFEA 284

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           Y+      GF  V++ P+ RSS+ AG+ + K
Sbjct: 285 YEKTAYAKGFLMVSATPLTRSSHHAGDDFRK 315



 Score = 54.7 bits (130), Expect(2) = 4e-30
 Identities = 23/43 (53%), Positives = 33/43 (76%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+A+A  GL++VV+TSVDRDDL D G+ HF  T+  ++A+ P
Sbjct: 118 VADAVAKLGLEHVVVTSVDRDDLADGGAAHFAATIAAIRAMSP 160



>sp|P61198|LIPA_RHOPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BX572601_802200 Rhodopseudomonas palustris
           CGA009 complete genome; segment 9/16.
          Length = 319

 Score =  107 bits (266), Expect(2) = 4e-30
 Identities = 61/160 (38%), Positives = 93/160 (58%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      +E V  +  DVF HN+ETV      VR   A +  S+ +L   K+  P+
Sbjct: 161 LTPDFLRKDGALEVVVAAKPDVFNHNLETVPSRYLSVRPG-ARYFHSIRLLQRVKELDPS 219

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GE   +V++ M+ +R+A VD +T GQY++P+++H  V  Y+TP+ F  
Sbjct: 220 -IFTKSGIMVGLGEERHEVLQVMDDLRSAEVDFLTIGQYLQPTRKHHAVMRYVTPDEFAG 278

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA 324
           YQ      GF  V++ PM RSS+ AG+ + K  +++ RAA
Sbjct: 279 YQTTAYAKGFLMVSASPMTRSSHHAGDDFAK--LKAARAA 316



 Score = 47.8 bits (112), Expect(2) = 4e-30
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEA    GL ++VITSVDRDDL D G+ HF  T++ ++   P   I
Sbjct: 112 VAEATRKLGLQHLVITSVDRDDLADGGAAHFAATIRAVREACPTTTI 158



>sp|Q7V507|LIP1_PROMM Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>gb:BX572100_799117 Prochlorococcus marinus
           MIT9313 complete genome; segment 6/7.
          Length = 294

 Score =  114 bits (284), Expect(2) = 4e-30
 Identities = 59/148 (39%), Positives = 93/148 (62%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G+   + KV  +  +V  HNIETV  L    R  +A++ +S+++L   +   P 
Sbjct: 139 LIPDFNGNWDALAKVMGAAPEVLNHNIETVPRLYKRARP-QADYMRSLELLYQVRQGWPK 197

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              +K+ +M+G GET  +V++ +E +R   VD++T GQY+ PS +H+PV  ++TPE FE 
Sbjct: 198 -VYSKSGLMVGLGETDAEVIEVLEDLRRHRVDIVTIGQYLSPSPKHLPVDRFVTPEQFEY 256

Query: 443 YQVLG-MEMGFRYVASGPMVRSSYKAGE 363
           ++ +G  E+GF  V S P+ RSSY AGE
Sbjct: 257 FRSMGETELGFLQVVSTPLTRSSYHAGE 284



 Score = 40.8 bits (94), Expect(2) = 4e-30
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           ++EA+A   L +VVITSV+RDDL D G+  F   ++ ++   P
Sbjct: 90  LSEAVAQMNLRHVVITSVNRDDLSDGGASQFVACIEAIRQRSP 132



>sp|Q8Z8I3|LIPA_SALTI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|AD0580|AD0580 lipoic acid synthetase
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)>gb:AL627267_540955 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 3/20.
          Length = 321

 Score =  105 bits (263), Expect(2) = 6e-30
 Identities = 57/146 (39%), Positives = 89/146 (60%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   A++  S+ +L   K+  P
Sbjct: 168 LVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPG-ADYNWSLKLLERFKEAHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET  ++++ M  +R  GV ++T GQY++PS+ H+PV  Y++PE F+
Sbjct: 227 E-IPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   + MGF + A GP VRSSY A
Sbjct: 286 EMKAEALAMGFTHAACGPCVRSSYHA 311



 Score = 48.5 bits (114), Expect(2) = 6e-30
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ IA   L YVVITSVDRDDL D G+ HF + +  ++A  P + I
Sbjct: 119 LAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKI 165



>gb:ECOLIPAB_129280 E.coli lipoic acid biosynthesis lipA, lipB, and
           ORFs 1, 2 and 3 genes, complete cds; dacA gene, 3' end.
          Length = 321

 Score =  107 bits (267), Expect(2) = 7e-30
 Identities = 56/146 (38%), Positives = 90/146 (61%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   A++  S+ +L   K+  P
Sbjct: 168 LVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPG-ADYNWSLKLLERFKEAHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M  +R  GV ++T GQY++PS+ H+PV  Y++P+ F+
Sbjct: 227 E-IPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   + MGF + A GP VRSSY A
Sbjct: 286 EMKAEALAMGFTHAACGPFVRSSYHA 311



 Score = 46.6 bits (109), Expect(2) = 7e-30
 Identities = 22/47 (46%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ IA   L YVVITSVDRDDL D G+ HF + +  ++   P + I
Sbjct: 119 LAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKI 165



>sp|P60718|LIPA_ECO57 Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>sp|P60717|LIPA_ECOL6 Lipoyl synthase (EC
           2.8.1.-) (Lipoic acid synthase) (Lipoate synthase)
           (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion
           protein lipA) (Lip-syn).>sp|P60716|LIPA_ECOLI Lipoyl
           synthase (EC 2.8.1.-) (Lipoic acid synthase) (Lipoate
           synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur
           insertion protein lipA) (Lip-syn).>sp|P60719|LIPA_SHIFL
           Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)
           (Lipoate synthase) (Lipoyl-acyl-carrier protein
           synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|B90712|B90712 lipoate synthesis protein
           LipA [imported] - Escherichia coli (strain O157:H7,
           substrain RIMD 0509952)>pir|B64797|B64797 lipoic acid
           synthase (EC 2.8.1.-) [validated] - Escherichia coli
           (strain K-12)>gb:AE005674_70235 Shigella flexneri 2a
           str. 301, complete genome.>gb:D90703_121325 Escherichia
           coli K12 genomic DNA. (14.0 - 14.4
           min).>gb:ECU82598_134731 Escherichia coli genomic
           sequence of minutes 9 to 12.>gb:U00096_199722
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE016757_324760 Escherichia coli CFT073
           section 3 of 18 of the complete
           genome.>gb:AE016980_370607 Shigella flexneri 2a str.
           2457T section 3 of 16 of the complete
           genome.>gb:BA000007_658678 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_955344 Escherichia coli
           CFT073 complete genome.>gb:AE014073_995357 Shigella
           flexneri 2a str. 2457T complete
           genome.>gb:CQ774697_1451910 Sequence 1 from Patent
           WO2004013314.
          Length = 321

 Score =  107 bits (267), Expect(2) = 7e-30
 Identities = 56/146 (38%), Positives = 90/146 (61%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   A++  S+ +L   K+  P
Sbjct: 168 LVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPG-ADYNWSLKLLERFKEAHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M  +R  GV ++T GQY++PS+ H+PV  Y++P+ F+
Sbjct: 227 E-IPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   + MGF + A GP VRSSY A
Sbjct: 286 EMKAEALAMGFTHAACGPFVRSSYHA 311



 Score = 46.6 bits (109), Expect(2) = 7e-30
 Identities = 22/47 (46%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ IA   L YVVITSVDRDDL D G+ HF + +  ++   P + I
Sbjct: 119 LAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKI 165



>sp|Q8D325|LIPA_WIGBR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BA000021_686922 Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis DNA, complete
           genome.
          Length = 316

 Score =  110 bits (274), Expect(2) = 7e-30
 Identities = 55/146 (37%), Positives = 93/146 (63%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     +  ++    D+F HN+E++  L S VR   AN+K+S+++L       P
Sbjct: 166 LVPDFRGCTELALNNISTYPPDIFNHNLESIPRLYSKVRPG-ANYKRSLELLEKFNLINP 224

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +MLG GET +++++ M+ +R + V ++T GQY+RP+K H+ V+ Y+ P+ F 
Sbjct: 225 -NIPTKSGLMLGLGETKEEIIEVMKDLRKSYVSMITIGQYLRPTKNHLTVNRYVHPKEFR 283

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           +  ++  ++GF++   GP+VRSSY A
Sbjct: 284 ELNLIAFDLGFKHAMCGPLVRSSYHA 309



 Score = 43.9 bits (102), Expect(2) = 7e-30
 Identities = 20/48 (41%), Positives = 32/48 (66%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N+++A     L ++VITSVDRDDL D GS HF+  ++ ++   P++ I
Sbjct: 116 NLSKAAIKMKLKHIVITSVDRDDLKDGGSEHFSNCIRFIRKKNPDIKI 163



>sp|Q7NTF9|LIPA_CHRVO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE016921_358058 Chromobacterium violaceum
           ATCC 12472 section 12 of 16 of the complete
           genome.>gb:AE016825_1043212 Chromobacterium violaceum
           ATCC 12472 complete genome.
          Length = 315

 Score =  105 bits (263), Expect(2) = 7e-30
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     V+ + ++  DV  HN+ETV  L    R   A++  S+ +L   K   P
Sbjct: 163 LVPDFRGRLDIAVDILTQTPPDVMNHNLETVPRLYKQARPG-ADYAHSLQLLKDYKAKNP 221

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M  +RA  VD++T GQY++PS  H+PV  Y+ P+ F+
Sbjct: 222 -NVRTKSGLMVGLGETDEEILEVMRDLRAHNVDMLTIGQYLQPSDGHLPVLRYVHPDVFK 280

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
            ++    EMGF + A G MVRSSY A
Sbjct: 281 MFEEKAYEMGFVHAAVGAMVRSSYHA 306



 Score = 48.1 bits (113), Expect(2) = 7e-30
 Identities = 20/44 (45%), Positives = 32/44 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           ++AE++A+  L YVV+TSVDRDDL D G+ HF + +  ++ + P
Sbjct: 113 HLAESVAAMRLKYVVVTSVDRDDLRDGGAQHFADCINAVREMSP 156



>gb:ECOLIP_129273 Escherichia coli lipoic acid synthetase (lip)
           gene, complete cds.
          Length = 281

 Score =  107 bits (267), Expect(2) = 8e-30
 Identities = 56/146 (38%), Positives = 90/146 (61%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   A++  S+ +L   K+  P
Sbjct: 128 LVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPG-ADYNWSLKLLERFKEAHP 186

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M  +R  GV ++T GQY++PS+ H+PV  Y++P+ F+
Sbjct: 187 E-IPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFD 245

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   + MGF + A GP VRSSY A
Sbjct: 246 EMKAEALAMGFTHAACGPFVRSSYHA 271



 Score = 46.6 bits (109), Expect(2) = 8e-30
 Identities = 22/47 (46%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ IA   L YVVITSVDRDDL D G+ HF + +  ++   P + I
Sbjct: 79  LAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKI 125



>pir|F85562|F85562 lipoate synthesis, sulfur insertion [imported] -
           Escherichia coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_64895 Escherichia coli O157:H7
           EDL933, complete genome.
          Length = 321

 Score =  107 bits (266), Expect(2) = 1e-29
 Identities = 56/146 (38%), Positives = 89/146 (60%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +  +  DVF HN+E V  +   VR   A++  S+ +L   K+  P
Sbjct: 168 LVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPG-ABYNWSLKLLERFKEAHP 226

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET + +++ M  +R  GV ++T GQY++PS+ H+PV  Y++P+ F+
Sbjct: 227 E-IPTKSGLMVGLGETNEXIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFD 285

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
           + +   + MGF + A GP VRSSY A
Sbjct: 286 EMKAEALAMGFTHAACGPFVRSSYHA 311



 Score = 46.6 bits (109), Expect(2) = 1e-29
 Identities = 22/47 (46%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ IA   L YVVITSVDRDDL D G+ HF + +  ++   P + I
Sbjct: 119 LAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKI 165



>sp|Q9S2P2|LIPA_STRCO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|T35310|T35310 probable lipoic acid
           synthetase - Streptomyces coelicolor>gb:SCO939111_175868
           Streptomyces coelicolor A3(2) complete genome; segment
           8/29.
          Length = 317

 Score =  114 bits (285), Expect(2) = 1e-29
 Identities = 60/161 (37%), Positives = 103/161 (63%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF   P  + +V +S  +VFAHN+ETV  +   +R     +++S+ V+  A+D+   
Sbjct: 161 LAPDFNAVPELLREVFESRPEVFAHNVETVPRIFKRIRPG-FRYERSLKVITDARDF--- 216

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET +++ + ++++  AG +++T  QY+RPS RH PV  ++ P+ F +
Sbjct: 217 GLVTKSNLILGMGETREEISEALKQLHEAGCELITITQYLRPSVRHHPVERWVKPQEFVE 276

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS 321
            +    ++GF  V SGP+VRSSY+AG  Y  +M E  R+A+
Sbjct: 277 LKEEAEQIGFSGVMSGPLVRSSYRAGRLYGMAM-EQRRSAT 316



 Score = 39.3 bits (90), Expect(2) = 1e-29
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKL 838
           V E++ +  L+Y  IT V RDDLPD G+  + ETV+++
Sbjct: 107 VGESVVTMDLNYATITGVARDDLPDGGAWLYAETVRQI 144



>sp|Q82AP7|LIPA_STRAW Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BA000030_703896 Streptomyces avermitilis
           MA-4680 genomic DNA, complete genome.
          Length = 328

 Score =  115 bits (287), Expect(2) = 2e-29
 Identities = 59/153 (38%), Positives = 96/153 (62%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF  +P  + +V  +  +VFAHN+ETV  +   +R     +++S+ V+  A+DY   
Sbjct: 161 LAPDFNAEPDQLAEVFSARPEVFAHNVETVPRIFKRIRPG-FRYERSLKVITEARDY--- 216

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET ++V + + ++  AG +++T  QY+RPS RH PV  ++ P  F +
Sbjct: 217 GLVTKSNLILGMGETREEVSEALRQLHDAGCELITITQYLRPSVRHHPVERWVKPHEFVE 276

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
            +    E+GF  V SGP+VRSSY+AG  Y  +M
Sbjct: 277 LKEEAEEIGFSGVMSGPLVRSSYRAGRLYQMAM 309



 Score = 37.4 bits (85), Expect(2) = 2e-29
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKA 832
           V E++ +  L+Y  IT V RDDL D G+  + ETV+++ A
Sbjct: 107 VGESVVTMDLNYATITGVARDDLEDGGAWLYAETVRQIHA 146



>sp|Q7U4D9|LIP1_SYNPX Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>gb:BX569694_777032 Synechococcus sp. WH8102
           complete genome; segment 6/7.
          Length = 289

 Score =  106 bits (264), Expect(2) = 2e-29
 Identities = 55/148 (37%), Positives = 89/148 (60%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G+   +  V  +   V  HNIETV  +  + R  +  +++S+++L   +D  P 
Sbjct: 134 LIPDFCGNWDALATVMAAAPHVLNHNIETVPRMYRLARP-QGIYERSLELLQRVRDDWPR 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              +K+ +M+G GET D+V+  +  +R   VD++T GQY+ P  +H+ V  ++TPE F+ 
Sbjct: 193 A-YSKSGLMVGLGETDDEVIDVLRDLRTHRVDIVTIGQYLSPGPKHLAVDRFVTPEQFDT 251

Query: 443 YQVLG-MEMGFRYVASGPMVRSSYKAGE 363
           Y+ +G  E+GF  V S P+ RSSY AGE
Sbjct: 252 YRRIGEEELGFLQVVSTPLTRSSYHAGE 279



 Score = 46.2 bits (108), Expect(2) = 2e-29
 Identities = 21/43 (48%), Positives = 30/43 (69%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           + EA+A  GL +VVITSV+RDDLPD G+  F   ++++K   P
Sbjct: 85  LGEAVARLGLKHVVITSVNRDDLPDGGATQFVACIEQVKQRSP 127



>gb:CP000009_864270 Gluconobacter oxydans 621H, complete genome.
          Length = 322

 Score =  103 bits (256), Expect(2) = 3e-29
 Identities = 57/151 (37%), Positives = 83/151 (54%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      +E V  +  DVF HNIET+  L   +R   A + QS+ +L   K   P+
Sbjct: 161 LTPDFLRKDGALEVVVAARPDVFNHNIETIPRLYPTIRPG-ARYYQSVRLLDGVKKLDPS 219

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +MLG GE   +V + M+  R A VD +T GQY++PS +H  V +++TP+ F+ 
Sbjct: 220 -IFTKSGLMLGLGEERMEVAQVMDDFRIADVDFLTLGQYLQPSAKHAAVEKFVTPDEFDG 278

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           Y       GF  V++ P+ RSSY A   + K
Sbjct: 279 YAAAARSKGFLQVSASPLTRSSYHADSDFAK 309



 Score = 48.9 bits (115), Expect(2) = 3e-29
 Identities = 23/47 (48%), Positives = 29/47 (61%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           V EA+A  GL +VVITSVDRDDL D G+ HF   +  ++   P   I
Sbjct: 112 VGEAVAKLGLKHVVITSVDRDDLEDGGAMHFARVIHAIRETSPQTTI 158



>sp|Q9Z774|LIPA_CHLPN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|B72031|B72031 lipoic acid synthetase
           CP1038 [imported] - Chlamydophila pneumoniae (strains
           CWL029 and AR39)>pir|F86594|F86594 lipoate synthetase
           [imported] - Chlamydophila pneumoniae  (strain
           J138)>gb:AB035942_5658 Chlamydophila pneumoniae lipA
           gene for lipoate synthetase, complete
           cds.>gb:AE001663_37682 Chlamydia pneumoniae section 79
           of 103 of the complete genome.>gb:AE002261_44508
           Chlamydophila pneumoniae AR39, section 88 of 94 of the
           complete genome.>gb:AE017160_394202 Chlamydophila
           pneumoniae TW-183, section 4 of 4 of the complete
           genome.>gb:BA000008_664203 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886633
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_942239 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028464 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 307

 Score =  117 bits (292), Expect(2) = 4e-29
 Identities = 59/145 (40%), Positives = 95/145 (65%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DF+G+ S +  +  SG+ ++ HN+ETV  L  +VR H+A + +SM +L  A +Y P 
Sbjct: 153 LASDFQGNVSALHTLLDSGITIYNHNVETVARLSPLVR-HKATYARSMFMLEQAANYLPD 211

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             + K+ IM+G GE   +V +T++ + + GV ++T GQY+RPS++H+ V  Y+TPE F+ 
Sbjct: 212 LKI-KSGIMVGLGEMEGEVKQTLQDLASIGVRIVTIGQYLRPSRKHLQVKSYVTPETFDY 270

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           Y+ +G  MG  +V +GP VRSS+ A
Sbjct: 271 YRRVGEAMGL-FVYAGPFVRSSFNA 294



 Score = 34.7 bits (78), Expect(2) = 4e-29
 Identities = 18/43 (41%), Positives = 25/43 (58%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           +A +    GL +VVIT V RDDL D G+    + +QKL+   P
Sbjct: 104 IALSAKELGLKHVVITMVARDDLEDGGAQGLVDIIQKLREELP 146



>sp|P72980|LIP1_SYNY3 Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>pir|S74959|S74959 lipoic acid synthetase
           (EC 2.8.1.-) 1 - Synechocystis sp.  (strain PCC
           6803)>gb:BA000022_687778 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 289

 Score =  110 bits (274), Expect(2) = 5e-29
 Identities = 56/145 (38%), Positives = 90/145 (62%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PD  G+   +  + ++  +V  HN+ETV  L   VR  +A++ QS+++   AK   P 
Sbjct: 135 LIPDLCGNWQALAALLEAAPEVLNHNMETVPRLYKRVRP-QADYDQSLELFNQAKRILPK 193

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ IM+G GET  +V + ME +R    D++T GQY++PS++H+ V E++TPE F+ 
Sbjct: 194 -VYTKSGIMVGLGETDAEVRQVMEDLRRVDCDILTIGQYLQPSQKHLGVKEFVTPEQFDV 252

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           +++ G  +GF  V S P+ RSSY A
Sbjct: 253 WRIYGESIGFLQVVSSPLTRSSYHA 277



 Score = 41.2 bits (95), Expect(2) = 5e-29
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A A+    L +VVIT+V+RDDLPD G+  F   ++ ++ + P   I
Sbjct: 86  LAIAVKRLNLKHVVITAVNRDDLPDGGASQFVSCIEAIRKISPGTTI 132



>sp|Q8ERL8|LIPA_OCEIH Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BA000028_695671 Oceanobacillus iheyensis
           HTE831 DNA, complete genome.
          Length = 314

 Score =  130 bits (326), Expect = 5e-29
 Identities = 68/169 (40%), Positives = 104/169 (61%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  N  C+   L  D +GD   +  +  SG D+F HNIETV  L   VR
Sbjct: 119 AAVFAETVRAIRRKNPGCTIEILPSDMKGDYESLHTLMDSGPDIFNHNIETVRRLTKRVR 178

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA + +S+++L   K+ AP  T TK+SIM+G GE  D++++ M+ + A  VD++T GQ
Sbjct: 179 A-RAMYDRSLELLRRVKEIAP-NTPTKSSIMVGLGEEKDEIIQAMDDLLAHNVDIVTLGQ 236

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++P+K+H+ V  Y  P+ FE+ + + +E GF +  SGP+VRSSY A E
Sbjct: 237 YLQPTKKHLEVVRYYHPDEFEELKNIALEKGFSHCESGPLVRSSYHADE 285



 Score = 42.4 bits (98), Expect = 0.014
 Identities = 20/47 (42%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+++   GL +VV+T+V RDDL D G+  F ETV+ ++   P   I
Sbjct: 92  VADSVTVMGLKHVVVTAVARDDLNDGGAAVFAETVRAIRRKNPGCTI 138



>sp|O84562|LIPA_CHLTR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|F71500|F71500 probable lipoate synthetase
           - Chlamydia trachomatis  (serotype D, strain
           UW3/Cx)>gb:AE001326_34495 Chlamydia trachomatis
           D/UW-3/CX section 53 of 87 of the complete
           genome.>gb:AE001273_1098521 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 311

 Score =  115 bits (288), Expect(2) = 6e-29
 Identities = 58/163 (35%), Positives = 104/163 (63%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DF G+ + +  +  + + ++ HN+ETVE L   VR H+A +++S+ +L  A  Y P 
Sbjct: 148 LASDFEGNIAALHHLLDAHIAIYNHNVETVERLTPFVR-HKATYRRSLMMLENAAKYLP- 205

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             +TK+ IM+G GE   +V +T++ +   GV ++T GQY+RPS+RH+PV  Y++PE F+ 
Sbjct: 206 NLMTKSGIMVGLGEQESEVKQTLKDLADHGVKIVTIGQYLRPSRRHIPVKSYVSPETFDY 265

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 315
           Y+ +G  +G  ++ +GP VRSS+ A   + ++M + + + S++
Sbjct: 266 YRSVGESLGL-FIYAGPFVRSSFNADSVF-EAMRQRETSTSAL 306



 Score = 35.4 bits (80), Expect(2) = 6e-29
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           + +AE+  + GL ++VIT V RDDL D G+      ++ L    P   I
Sbjct: 97  AKIAESAKALGLKHIVITMVSRDDLEDGGASALVHIIETLHTELPTATI 145



>gb:AP006840_569342 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 320

 Score =  129 bits (324), Expect = 9e-29
 Identities = 71/169 (42%), Positives = 103/169 (60%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A I     R++R  N       L+PDF G+   +  V  +  DV  HNIETV  L   VR
Sbjct: 134 ASIFAETIRAIRRKNPFTGVEVLIPDFGGNWDALAVVMDAEPDVLNHNIETVRRLSDRVR 193

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA + +S+++L  AK+  P  + TK+SIM+G GET  ++ + M+ +RAAGVD++TFGQ
Sbjct: 194 S-RAKYDRSLELLRRAKEMKPHVS-TKSSIMVGLGETMQELYEAMDDLRAAGVDIVTFGQ 251

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y+RP+ RH+ V ++ TP  FE  +   ++ GF +  SGP+VRSSY A E
Sbjct: 252 YLRPTARHLAVEKFYTPAEFEHLREEALKRGFAHCESGPLVRSSYHADE 300



 Score = 42.4 bits (98), Expect = 0.014
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+A    GL +VV+TSV RDDL D G+  F ET++ ++   P
Sbjct: 107 VADACVQLGLRHVVVTSVARDDLSDGGASIFAETIRAIRRKNP 149



>gb:CR555306_107126 Azoarcus sp. EbN1 complete genome.
          Length = 315

 Score =  103 bits (256), Expect(2) = 1e-28
 Identities = 58/148 (39%), Positives = 88/148 (59%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     +E   ++  DV  HN+ETV  L    R   A++  S+ +L   K   P
Sbjct: 162 LVPDFRGRLDVALEIFDQAPPDVMNHNLETVPRLYKQARPG-ADYAYSLRLLKEFKARHP 220

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET D+++  +  +RA  V+++T GQY++PS  H+PV  Y+ P+ F+
Sbjct: 221 -DVPTKSGLMVGLGETDDEILDVLRDLRAHDVEMLTIGQYLQPSTGHLPVLRYVHPDTFK 279

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            ++   + MGF+  A GPMVRSSY A +
Sbjct: 280 MFETEALAMGFKNAACGPMVRSSYWADQ 307



 Score = 46.6 bits (109), Expect(2) = 1e-28
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A  I +  L+YVVITSVDRDDL D G+ HF + +++ +A  P   I
Sbjct: 113 LAATIGAMRLNYVVITSVDRDDLRDGGAQHFVDCIRETRAASPKTRI 159



>sp|Q7V9Z9|LIP1_PROMA Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>gb:AE017166_396125 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 section 6 of 6 of the
           complete genome.>gb:AE017126_1031794 Prochlorococcus
           marinus subsp. marinus str. CCMP1375 complete genome.
          Length = 294

 Score =  110 bits (274), Expect(2) = 1e-28
 Identities = 56/148 (37%), Positives = 89/148 (60%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G+    +KV  +  +V  HNIETV  L    R  +  +K+S+++L   +  +P 
Sbjct: 139 LIPDFCGNWDAFKKVMNASPNVLNHNIETVPRLYKRARP-QGLYKRSLELLRRVRQESP- 196

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              +K+ +M+G GET D+V++ +  +    VD++T GQY+ P  +H+PV  ++TP+ F+K
Sbjct: 197 NVYSKSGLMVGLGETDDEVLQVLSDLHDNNVDIVTIGQYLSPGTKHLPVDRFVTPDQFQK 256

Query: 443 YQVLGM-EMGFRYVASGPMVRSSYKAGE 363
           Y+  G    GF  V S P+ RSSY AGE
Sbjct: 257 YKEEGQTRFGFLQVVSSPLTRSSYHAGE 284



 Score = 39.7 bits (91), Expect(2) = 1e-28
 Identities = 18/40 (45%), Positives = 26/40 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKA 832
           + EA+   GL +VVITSV+RDDL D G+  F   +  ++A
Sbjct: 90  LGEAVKRLGLKHVVITSVNRDDLEDGGASQFVSCIDAVRA 129



>sp|Q7V0Z8|LIP2_PROMP Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>gb:BX572092_796722 Prochlorococcus marinus
           MED4 complete genome; segment 3/5.
          Length = 299

 Score =  101 bits (251), Expect(2) = 2e-28
 Identities = 56/135 (41%), Positives = 83/135 (61%)
 Frame = -3

Query: 770 VEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLG 591
           ++K+ +     F HN+ETVE LQ  VR   AN+K S+ +L  AK  AP    TK+ IMLG
Sbjct: 167 LKKILEQRPICFNHNLETVERLQKEVR-RGANYKNSIGLLEKAKSIAP-NIQTKSGIMLG 224

Query: 590 CGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFR 411
            GET  ++  T+  ++    + +T GQY+RPS +H+ V +Y  P+ FE  +    ++GF+
Sbjct: 225 LGETLKEIETTILDLKKVDCNQITIGQYLRPSLKHLSVKKYWAPKEFEYLKSFCSKLGFK 284

Query: 410 YVASGPMVRSSYKAG 366
            V+ GP+VRSSY AG
Sbjct: 285 KVSCGPLVRSSYHAG 299



 Score = 48.1 bits (113), Expect(2) = 2e-28
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VAEA+    L YVV+TSV RDDLPD G+  F  T+ +++ + P + I
Sbjct: 96  VAEAVKILNLKYVVLTSVARDDLPDHGANLFVSTINQIRKIDPKIQI 142



>sp|Q8Y2L3|LIPA_RALSO Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AL646058_545250 Ralstonia solanacearum
           GMI1000 chromosome, complete sequence; segment 2/19.
          Length = 333

 Score =  100 bits (248), Expect(2) = 2e-28
 Identities = 56/148 (37%), Positives = 85/148 (57%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGD-PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           LVPDFRG     ++ +     DV  HN+ETV  L    R   A++  S+ +L   K   P
Sbjct: 180 LVPDFRGRLEKALDILQACPPDVMNHNMETVPRLYKQARPG-ADYAHSLKLLKDFKARNP 238

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET +++++ M  +R   +D++T GQY+ PS  H+PV  Y+ P+ F+
Sbjct: 239 -NLPTKSGLMVGLGETDEEILEVMRDMREHDIDMLTIGQYLAPSGHHLPVLRYVHPDTFK 297

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKAGE 363
            ++    EMGF + A G MVRSSY A +
Sbjct: 298 MFEEKAYEMGFTHAAVGAMVRSSYHADQ 325



 Score = 48.9 bits (115), Expect(2) = 2e-28
 Identities = 22/44 (50%), Positives = 31/44 (70%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           N+A+ IA   L+YVVITSVDRDDL D G+ H+ + + + + L P
Sbjct: 130 NLAKTIAQLRLNYVVITSVDRDDLRDGGAQHYVDCISRTRELSP 173



>gb:AP008231_580674 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 297

 Score =  106 bits (264), Expect(2) = 2e-28
 Identities = 51/147 (34%), Positives = 93/147 (63%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PD  G+   +E +  +  +V  HNIETV  L   VR  + ++++S+++L  +++ AP 
Sbjct: 135 LIPDLCGNWEALEIILSAAPEVLNHNIETVSRLYRRVRP-QGDYQRSLELLRRSREQAP- 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M+G GET ++V + +  +R+   D++T GQY++P+++H+ V  ++TP  F+ 
Sbjct: 193 WIYTKSGLMVGLGETAEEVQQVLVDLRSVDCDIVTIGQYLQPTQKHLGVDRFVTPAEFDA 252

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGE 363
           +Q  G ++GF  V + P+ RSSY A E
Sbjct: 253 WQQQGSQLGFLQVVASPLTRSSYHAEE 279



 Score = 42.7 bits (99), Expect(2) = 2e-28
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           + EA+    L++VVITSV+RDDLPD G+  F   ++ +++  P   I
Sbjct: 86  LTEAVGRLNLNHVVITSVNRDDLPDGGAEQFKRCIEAVRSRSPQTTI 132



>sp|Q8A029|LIPA_BACTN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE016944_363558 Bacteroides
           thetaiotaomicron VPI-5482, section 19 of 21 of the
           complete genome.>gb:AE015928_990046 Bacteroides
           thetaiotaomicron VPI-5482, complete genome.
          Length = 282

 Score =  127 bits (320), Expect = 3e-28
 Identities = 64/159 (40%), Positives = 99/159 (62%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R ++  N   +   L+PDF+G    V+ V ++  D+ +HN+ETV  +  +VR   AN+  
Sbjct: 123 REIKRLNPQTTIEVLIPDFQGRMELVDLVIEANPDIISHNMETVRRISPLVRS-AANYDT 181

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           S+ V+      A +GT +K+ IM+G GETP +V   M+ + A G  ++T GQY++P+ RH
Sbjct: 182 SLQVI---GHIARSGTKSKSGIMVGLGETPQEVETIMDDLLAVGCQILTIGQYLQPTHRH 238

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
            PV+EY+TP+ F  Y+ +G+E GF  V S P+VRSSY A
Sbjct: 239 YPVAEYVTPQQFATYKTIGLEKGFSIVESAPLVRSSYHA 277



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++VAE+IA   LD+ V+TSVDRDDLPD G+GH+  T++++K L P   I
Sbjct: 86  THVAESIALMKLDHAVVTSVDRDDLPDLGAGHWAHTIREIKRLNPQTTI 134



>sp|Q7UZY1|LIP1_PROMP Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>gb:BX572094_797140 Prochlorococcus marinus
           MED4 complete genome; segment 5/5.
          Length = 297

 Score =  109 bits (272), Expect(2) = 3e-28
 Identities = 57/148 (38%), Positives = 90/148 (60%), Gaps = 1/148 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PD  G+ S +EK+  S  +V  HNIETV  L   VR  + N+++++++L   ++Y P+
Sbjct: 142 LIPDLCGNWSALEKILDSRPNVLNHNIETVSALYRKVRP-QGNYQRTLELLKRTREYFPS 200

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+  MLG GE  D+V+  +  +R   VD++T GQY+ P  +H+ V  ++TP  F  
Sbjct: 201 -VYTKSGFMLGLGEKDDEVLTLLMDLRKNDVDIVTIGQYLSPGPKHLQVQRFVTPSKFNY 259

Query: 443 YQVLG-MEMGFRYVASGPMVRSSYKAGE 363
           +++ G  E+GF  V S P+ RSSY A E
Sbjct: 260 FKLFGENELGFMQVVSSPLTRSSYHAEE 287



 Score = 39.3 bits (90), Expect(2) = 3e-28
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AEA+    L +VVITSV+RDDL D G+  F + V +++   P   I
Sbjct: 93  LAEAVFRLKLKHVVITSVNRDDLDDGGASQFYKCVSEVRKKSPETTI 139



>sp|P61197|LIPA_MYCPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017234_412664 Mycobacterium avium subsp.
           paratuberculosis str. k10, section 8 of 16 of the
           complete genome.>gb:AE016958_1056068 Mycobacterium avium
           subsp. paratuberculosis str. k10, complete genome.
          Length = 307

 Score =  127 bits (318), Expect = 4e-28
 Identities = 68/175 (38%), Positives = 104/175 (59%)
 Frame = -3

Query: 881 PTKEAVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQ 702
           P   A +     R+++  N       L+PDF G P  + +V  S  +V AHN+ETV  + 
Sbjct: 129 PDGGAWLYAETVRAIKELNPSTGVELLIPDFNGRPDRLAEVFGSRPEVLAHNVETVPRIF 188

Query: 701 SVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVM 522
             +R     +++S+DVL  A++   AG +TK++++LG GETPD+V   +  +R AG D++
Sbjct: 189 KRIRP-AFTYRRSLDVLTAARE---AGLVTKSNLILGLGETPDEVRTALADLRGAGCDII 244

Query: 521 TFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFY 357
           T  QY+RPS RH PV  ++ PE F ++     E+GF  V +GP+VRSSY+AG  Y
Sbjct: 245 TITQYLRPSARHHPVERWVKPEEFVEFARHAEELGFSGVLAGPLVRSSYRAGRLY 299



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 20/44 (45%), Positives = 30/44 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           VA+++ + GL Y  +T V RDDLPD G+  + ETV+ +K L P+
Sbjct: 106 VADSVRTMGLRYATVTGVARDDLPDGGAWLYAETVRAIKELNPS 149



>sp|Q9PJI2|LIPA_CHLMU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|C81658|C81658 lipoic acid synthetase
           TC0847 [imported] - Chlamydia muridarum (strain
           Nigg)>gb:AE002351_45429 Chlamydia muridarum Nigg section
           78 of 85 of the complete genome.>gb:AE002160_1149569
           Chlamydia muridarum Nigg, complete genome.
          Length = 308

 Score =  116 bits (291), Expect(2) = 7e-28
 Identities = 57/163 (34%), Positives = 104/163 (63%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DF G+   +  +  + + ++ HN+ETVE L  +VR H+A +++S+ +L  A  Y P 
Sbjct: 149 LASDFEGNIDALHHLLDARIAIYNHNVETVERLSPLVR-HKATYRRSLMMLEQAAQYLP- 206

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             + K+ IM+G GE   ++ +T++ +   GV ++T GQY+RPS+RH+PV  Y++PE F+ 
Sbjct: 207 DLMIKSGIMVGLGEQESEIKQTLKDLADHGVKIVTIGQYLRPSRRHIPVKSYVSPETFDY 266

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASSV 315
           Y+ +G  +G  ++ +GP VRSS+ A   + ++M + +R ++S+
Sbjct: 267 YRSVGEALGL-FIYAGPFVRSSFNADAVF-EAMSQRERLSASI 307



 Score = 30.8 bits (68), Expect(2) = 7e-28
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A +  + GL ++VIT V RDDL D G+      +  L    P   I
Sbjct: 100 IAASAKALGLKHIVITMVSRDDLEDGGADALARIITTLHIELPEATI 146



>sp|Q821K6|LIPA_CHLCV Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE016997_374988 Chlamydophila caviae GPIC
           section 4 of 4 of the complete
           genome.>gb:AE015925_994667 Chlamydophila caviae GPIC
           complete genome.
          Length = 312

 Score =  119 bits (297), Expect(2) = 9e-28
 Identities = 60/145 (41%), Positives = 94/145 (64%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DF+G+   +  +  SGL ++ HN+ETVE L  VVR H+A +++S+ +L  A  Y P 
Sbjct: 152 LASDFQGNIDALHTLLDSGLTIYNHNVETVERLTPVVR-HKATYRRSLFMLEQAAMYLPD 210

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             + K+ IM+G GE   +V +T++ +   GV ++T GQY+RPS+ H+PV  Y+TPE F+ 
Sbjct: 211 LKI-KSGIMVGLGEQESEVKQTLKDLADHGVKIVTIGQYLRPSRSHIPVKSYVTPETFDY 269

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           Y+ +G  +G  +V +GP VRSS+ A
Sbjct: 270 YRTIGTSLGL-FVYAGPFVRSSFNA 293



 Score = 28.1 bits (61), Expect(2) = 9e-28
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AE+     L ++V+T V RDDL D G+      +  L    P   +
Sbjct: 103 IAESAKILQLKHIVLTMVARDDLEDGGASFLVRIIDTLHQELPESTV 149



>gb:CR522870_99141 Desulfotalea psychrophila LSv54 chromosome.
          Length = 299

 Score =  102 bits (255), Expect(2) = 1e-27
 Identities = 54/152 (35%), Positives = 91/152 (59%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PD  G+   ++ +  +  DV  HNIETV  L SV R   A +++S+++L   +  AP 
Sbjct: 145 LIPDLAGNWGALQTILDARPDVLNHNIETVPRLYSVARPG-AEYRRSLELLREVRRRAPQ 203

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
             +TKT +MLG GE  +++  T + +R +  D++T GQY++P+  H+ V  ++ P  F++
Sbjct: 204 -MVTKTGMMLGLGEETEELYATWQDLRESDCDILTMGQYLQPTVDHLLVQRFVEPTEFDR 262

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKS 348
              + +   F  VASGP VRSSY+A + + K+
Sbjct: 263 LGDVALAKDFLAVASGPFVRSSYEAEKLFRKA 294



 Score = 43.9 bits (102), Expect(2) = 1e-27
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+A++  GL Y VITSV RDDL D G+  F   ++ ++   P  LI
Sbjct: 96  VADAVSLLGLRYAVITSVTRDDLADGGASCFVRVIEAIRKKNPKTLI 142



>sp|Q9EYP3|LIPA_BURPS Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AF317284_499275 Burkholderia pseudomallei
           PEP carboxylase gene, partial cds; and lipoate
           synthetase gene, complete cds.
          Length = 288

 Score = 99.8 bits (247), Expect(2) = 1e-27
 Identities = 57/146 (39%), Positives = 84/146 (57%), Gaps = 1/146 (0%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP 627
           L PDFRG       +  +   DV  H +ETV  L    R   +++  S+ +L   K   P
Sbjct: 134 LTPDFRGRLDRALAILNAAPPDVMNHWLETVPRLYKEARTG-SDYAHSLKLLKDFKALHP 192

Query: 626 AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE 447
               TK+ +M+G GET D++++ M  +RA  VD++T GQY++PS+ H+PV EY+ P+ F+
Sbjct: 193 -DVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFK 251

Query: 446 KYQVLGMEMGFRYVASGPMVRSSYKA 369
            Y+    +MGF   A G MVRSSY A
Sbjct: 252 MYEEEAYKMGFSDAAVGAMVRSSYHA 277



 Score = 47.0 bits (110), Expect(2) = 1e-27
 Identities = 24/46 (52%), Positives = 32/46 (69%), Gaps = 2/46 (4%)
 Frame = -2

Query: 954 NVAEAIASWGLD--YVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           N+A  IA+  L   YVVITSVDRDDL D G+GHF E +++++   P
Sbjct: 82  NLARTIAALKLKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSP 127



>sp|Q7NFJ9|LIP1_GLOVI Lipoyl synthase 1 (EC 2.8.1.-) (Lipoic acid
           synthase 1) (Lipoate synthase 1) (Lipoyl-acyl-carrier
           protein synthase 1) (Sulfur insertion protein lipA1)
           (Lip-syn 1).>gb:BA000045_743601 Gloeobacter violaceus
           PCC 7421 DNA, complete genome.
          Length = 289

 Score =  125 bits (314), Expect = 1e-27
 Identities = 72/173 (41%), Positives = 100/173 (57%)
 Frame = -3

Query: 881 PTKEAVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQ 702
           P + A    R   S+R  N       L PDFRG+ +C+  V  +    F HNIETV  LQ
Sbjct: 117 PDQGAGWFVRTMESIRARNCAVEIEVLTPDFRGEEACIATVVAARPVCFNHNIETVRRLQ 176

Query: 701 SVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVM 522
           S  R   A + +S+ VL   K    A   TK+ +MLG GET ++V++T+  +R  G D +
Sbjct: 177 SYAR-RAATYARSLAVLAAVKRL-DAEIFTKSGLMLGHGETREEVLETLLDLRKVGCDRV 234

Query: 521 TFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           T GQY++PSK H+PV +Y TP  F +   +  ++GF +V SGP+VRSSY AGE
Sbjct: 235 TLGQYLQPSKDHLPVHKYWTPAEFAELGAVARDLGFAHVRSGPLVRSSYHAGE 287



 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 25/40 (62%), Positives = 32/40 (80%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKA 832
           VAEA+A  GL YVV+TSV RDDLPDQG+G F  T++ ++A
Sbjct: 94  VAEAVALLGLKYVVLTSVARDDLPDQGAGWFVRTMESIRA 133



>sp|Q7MWT4|LIPA_PORGI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017173_396838 Porphyromonas gingivalis
           W83 section 2 of 8 of the complete
           genome.>gb:AE015924_1032449 Porphyromonas gingivalis W83
           complete genome.
          Length = 282

 Score =  125 bits (313), Expect = 2e-27
 Identities = 67/160 (41%), Positives = 103/160 (64%), Gaps = 1/160 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           + +R  N   +   L+PDF+G    V+ + ++  DV +HN+ETV  L   VR   A +  
Sbjct: 123 QEIRRINSGVTLEVLIPDFKGRMDLVDMIIEASPDVISHNLETVRRLTPSVRSV-ATYDT 181

Query: 665 SMDVLMMAKDYAPAGTL-TKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
           S+ VL   +  A +G +  KT +MLG GET +++++ M+   AAGV V+T GQY++PS++
Sbjct: 182 SLAVL---RHIAQSGKMPAKTGMMLGLGETEEEILELMDDALAAGVSVITIGQYLQPSRK 238

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           ++PV EYITPE FE  +++G+E GFR + S P+VRSSY A
Sbjct: 239 NLPVVEYITPEQFEHLRLVGIEKGFRTIESAPLVRSSYHA 278



 Score = 49.7 bits (117), Expect = 9e-05
 Identities = 20/49 (40%), Positives = 36/49 (73%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           ++VA +I   GL++ V+TSVDRDDLPD G+ H+ +T+Q+++ +   + +
Sbjct: 86  THVALSIKLMGLNHAVVTSVDRDDLPDYGAAHWVKTIQEIRRINSGVTL 134



>sp|Q89AL7|LIPA_BUCBP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE014016_302661 Buchnera aphidicola str.
           Bp (Baizongia pistaciae), section 1 of 2 of the complete
           genome.>gb:AE016826_981262 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 314

 Score =  104 bits (260), Expect(2) = 2e-27
 Identities = 57/151 (37%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = -3

Query: 803 LVPDFRG--DPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYA 630
           LVPDFRG    SC + ++ +  +VF HN+E V  L  ++R   A++ +S+ +L   K   
Sbjct: 166 LVPDFRGMMRESC-KIISMNPPNVFNHNLENVPRLYKLIRPG-ASYIRSLKLLEFFKKLN 223

Query: 629 PAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF 450
           P    TK+ ++LG GET  ++V  +  +   GV ++T GQY++PS +H PV +YITP+ F
Sbjct: 224 P-NVPTKSGLILGLGETYKEIVHVINDLLDHGVTILTIGQYLQPSSKHFPVQKYITPDEF 282

Query: 449 EKYQVLGMEMGFRYVASGPMVRSSYKAGEFY 357
           +K +   + +GF+ V  GP++RSSY A +++
Sbjct: 283 KKIKNYALSIGFKKVFCGPLIRSSYHAEKYF 313



 Score = 41.2 bits (95), Expect(2) = 2e-27
 Identities = 18/39 (46%), Positives = 28/39 (71%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLK 835
           +A  I    ++YVVITSV RDDL D+G+ HF+  +Q+++
Sbjct: 118 LARVIFDMKINYVVITSVVRDDLKDRGAQHFSNCIQEIR 156



>sp|Q7UH37|LIPA_RHOBA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BX294141_767704 Pirellula sp. strain 1
           complete genome; segment 9/24.
          Length = 316

 Score =  103 bits (258), Expect(2) = 3e-27
 Identities = 53/145 (36%), Positives = 86/145 (59%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L PDF      + +V ++   VF HN+ETV  L   VR  ++++  +++++   K Y  A
Sbjct: 166 LTPDFVHCKEALARVIEAKPTVFNHNMETVPRLYRRVRGPKSDYAWTLEMMRQVKRY-DA 224

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +MLG GE   +++  +  +R   VD +T GQY++P ++++PV  Y+ PE F++
Sbjct: 225 EVKTKSGLMLGLGEERGELLDALSDLREHDVDFLTLGQYLQPGEKYLPVVRYVPPEEFDE 284

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
              +   MGF+ VASGP VRSSY A
Sbjct: 285 LADIAKSMGFKKVASGPFVRSSYHA 309



 Score = 41.2 bits (95), Expect(2) = 3e-27
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETV 847
           +A+A    GL +VVITSV RDDLPD G+ HF   V
Sbjct: 118 IAKAAERLGLKHVVITSVTRDDLPDGGADHFHNCV 152



>sp|Q8K9Q2|LIPA_BUCAP Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE014102_303177 Buchnera aphidicola str.
           Sg (Schizaphis graminum) section 27 of 57 of the
           complete genome.>gb:AE013218_935155 Buchnera aphidicola
           str. Sg (Schizaphis graminum) complete genome.
          Length = 319

 Score = 99.8 bits (247), Expect(2) = 4e-27
 Identities = 59/147 (40%), Positives = 86/147 (58%), Gaps = 2/147 (1%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVL-MMAKDYA 630
           LVPDFRG    + K+  SGL DVF HN+E V  L   VR   A++K+S+ +L    K Y+
Sbjct: 165 LVPDFRGRVELILKIFNSGLPDVFNHNVENVPRLYKKVRPG-ADYKKSLFLLESFKKKYS 223

Query: 629 PAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF 450
                TK+ +MLG GE   ++++ M+ + + GV ++T GQY++PS  H+PV  YI    F
Sbjct: 224 --NIPTKSGLMLGLGEKDTEIIQVMKDLYSNGVTLLTVGQYLQPSINHIPVQRYIPLSEF 281

Query: 449 EKYQVLGMEMGFRYVASGPMVRSSYKA 369
           +  +   + +GF     GP VRSSY A
Sbjct: 282 KNIKKEALSIGFTNAFCGPFVRSSYHA 308



 Score = 45.1 bits (105), Expect(2) = 4e-27
 Identities = 20/41 (48%), Positives = 29/41 (70%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLK 835
           +N+A+ I   G+DYVVITSV RDDL D G+ HF   ++ ++
Sbjct: 115 NNLAKTIFDMGIDYVVITSVVRDDLYDGGAQHFVNCIKSIR 155



>gb:HSAJ4162_2010364 Homo sapiens mRNA for putative lipoic acid
           synthetase, partial.
          Length = 113

 Score =  121 bits (304), Expect = 2e-26
 Identities = 58/105 (55%), Positives = 79/105 (75%)
 Frame = -3

Query: 656 VLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV 477
           VL  AK   P   ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P++RH+ V
Sbjct: 2   VLKHAKKVQP-DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKV 60

Query: 476 SEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMI 342
            EYITPE F+ ++ +G E+GF Y ASGP+VRSSYKAGEF++K+++
Sbjct: 61  EEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV 105



>sp|Q8KDH2|LIPA_CHLTE Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE012871_286553 Chlorobium tepidum TLS
           section 92 of 194 of the complete
           genome.>gb:AE006470_933721 Chlorobium tepidum TLS
           complete genome.
          Length = 290

 Score =  120 bits (302), Expect = 3e-26
 Identities = 64/162 (39%), Positives = 101/162 (62%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           R++R  N   S   L+PDF G+   ++ V +   +V  HNIETV    + VR  +A +++
Sbjct: 125 RAIREVNPGVSLECLIPDFSGNEQSLDLVMQELPEVLNHNIETVPSRYAAVRP-QALYER 183

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           S+ V+  AK      T  K+ +M+G GET +++  ++  +R  G D++T GQY++P+  H
Sbjct: 184 SLAVIERAKRQFRLAT--KSGMMVGMGETEEELEASLHDLRGHGCDMVTIGQYLQPTAAH 241

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEF 360
           +PVS Y+TPE FE+Y+ + ++ GFR+V SGP VRSSY A  F
Sbjct: 242 LPVSRYVTPEEFERYREIALDAGFRHVQSGPFVRSSYHAEAF 283



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 19/47 (40%), Positives = 33/47 (70%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNM 817
           S +AEA+ +  L + V+TSV+RDDL D G+ H+ ET++ ++ + P +
Sbjct: 88  SKIAEAVKTMKLRHAVLTSVNRDDLADGGATHWVETIRAIREVNPGV 134



>sp|Q9K7C9|LIPA_BACHD Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|C84079|C84079 lipoic acid synthetase
           BH3435 [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_657381 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 303

 Score =  120 bits (302), Expect = 3e-26
 Identities = 62/169 (36%), Positives = 103/169 (60%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  N  C+   L  D  G+   ++ +  +  ++  HNIETV  L   VR
Sbjct: 119 AGVFAETVRAVRRRNPFCTIEVLPSDMMGNDDNLKTLMDARPNILNHNIETVRRLTPRVR 178

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA +++S++ L  AK+  P    TK+S+M+G GET D++++TM+ +RA  VD+MT GQ
Sbjct: 179 A-RATYERSLEFLRRAKEMQP-DIPTKSSLMIGLGETKDEIIETMDDLRANNVDIMTIGQ 236

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++P+K+H+ V +Y  P+ F + + + +  GF +  +GP+VRSSY A E
Sbjct: 237 YLQPTKKHLKVQKYYHPDEFAELKEIALSKGFSHCEAGPLVRSSYHADE 285



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 21/43 (48%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE++   GL + VIT+V RDDL D G+G F ETV+ ++   P
Sbjct: 92  VAESVEIMGLKHAVITAVARDDLKDGGAGVFAETVRAVRRRNP 134



>gb:AE017283_430478 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 330

 Score =  100 bits (250), Expect(2) = 3e-26
 Identities = 54/153 (35%), Positives = 91/153 (59%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L  DF G    ++ V ++  +VF HN+ETV  +   +R     + +S+ VL  A +   A
Sbjct: 155 LAQDFSGKQDLLDIVFEARPEVFGHNLETVPRIFKRIRPG-FRYDRSLAVLDSAHE---A 210

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
           G +TK++++LG GET +++ + M  +  A  D++T  QY+RP+    P+  ++TP+ F++
Sbjct: 211 GLITKSNLILGMGETREEISQAMRALHDANTDLLTITQYLRPNSYLHPIDRWVTPQEFDE 270

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
                 E+GF  V SGP+VRSSY+AG  Y ++M
Sbjct: 271 LAEEAREIGFVGVMSGPLVRSSYRAGRLYRQAM 303



 Score = 40.8 bits (94), Expect(2) = 3e-26
 Identities = 18/45 (40%), Positives = 29/45 (64%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNM 817
           VAE++   GL Y  +TSV RDDL D+G+    ET++++  + P +
Sbjct: 106 VAESVKQMGLRYATVTSVCRDDLEDEGAWLCAETIRQIHQVTPGV 150



>gb:AP006627_565268 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 309

 Score =  119 bits (299), Expect = 7e-26
 Identities = 61/169 (36%), Positives = 104/169 (61%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  N  C+   L  D  G+ S ++ +  +  ++  HNIETV  L   VR
Sbjct: 122 AAVFAETVRAVRRKNPFCTIEVLPSDMLGNESSLQTLMDARPNIMNHNIETVRRLTPKVR 181

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA + ++++ L  AK+  P    TK+S+M+G GET +++++TM+ +RA  VD++T GQ
Sbjct: 182 A-RAKYDRTLEFLRRAKEMHP-DIPTKSSLMVGLGETKEEILETMDDLRANNVDILTIGQ 239

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++P+K+H+ V +Y  P+ F + + + M+ GF +  +GP+VRSSY A E
Sbjct: 240 YLQPTKKHLKVIKYYHPDEFAELKEIAMQKGFSHCEAGPLVRSSYHADE 288



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 21/43 (48%), Positives = 30/43 (69%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE++ + GL +VVIT+V RDDL D G+  F ETV+ ++   P
Sbjct: 95  VAESVETMGLKHVVITAVARDDLKDGGAAVFAETVRAVRRKNP 137



>gb:CP000020_870918 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 321

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/160 (40%), Positives = 97/160 (60%), Gaps = 1/160 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFK 669
           R +R  N       LVPDFRG     +E +  +  DVF HN+ET   L   VR   AN++
Sbjct: 154 REIRALNPEIRIETLVPDFRGRMDRALEAMIDNPPDVFNHNLETAPRLYRKVRPG-ANYQ 212

Query: 668 QSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
            S+D+L   K+  P    TK+ +M+G GET +++V+ ++ +RA GV ++T GQY+ PS+ 
Sbjct: 213 WSLDLLKKFKEQHP-NVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRH 271

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           H+PV  Y+ P  F++ + + +E+GF + A GP VRSSY A
Sbjct: 272 HLPVERYVPPAEFDELKEIALELGFTHAACGPFVRSSYHA 311



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 23/47 (48%), Positives = 32/47 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ I    L YVVITSVDRDDL D G+ HF +  ++++AL P + I
Sbjct: 119 LAKTIQDMKLKYVVITSVDRDDLRDGGAQHFADCNREIRALNPEIRI 165



>sp|Q9KTF9|LIPA_VIBCH Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|B82259|B82259 lipoic acid synthetase
           VC0943 [imported] - Vibrio cholerae  (strain N16961
           serogroup O1)>gb:AE004177_51335 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, section 85 of 251
           of the complete chromosome.>gb:AE003852_1052109 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome I,
           complete chromosome.
          Length = 321

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/160 (40%), Positives = 97/160 (60%), Gaps = 1/160 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFK 669
           R +R  N       LVPDFRG     +E +  +  DVF HN+ET   L   VR   AN+K
Sbjct: 154 REIRALNPHIKIETLVPDFRGRMEVALEALKDNPPDVFNHNLETAPRLYRKVRPG-ANYK 212

Query: 668 QSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
            S+++L   K+  P    TK+ +M+G GET +++V+ ++ +RA GV ++T GQY+ PS+ 
Sbjct: 213 WSLELLRQFKEQHPH-VPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRH 271

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           H+PV  Y+ P  F++ + + +E+GF + A GP VRSSY A
Sbjct: 272 HLPVERYVPPAEFDELKEVALELGFTHAACGPFVRSSYHA 311



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ I    L YVVITSVDRDDL D G+ HF +  ++++AL P++ I
Sbjct: 119 LAQTIHDMKLKYVVITSVDRDDLRDGGAQHFADCNREIRALNPHIKI 165



>gb:CP000002_859003 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 298

 Score =  116 bits (291), Expect = 6e-25
 Identities = 63/169 (37%), Positives = 102/169 (60%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  +   +   L  D  GD + ++ +  +  D+  HNIETV  L   VR
Sbjct: 119 AGVFAETVRAVRRKSPFTTIEVLPSDMGGDYNNLKTLMDTRPDILNHNIETVRRLTPRVR 178

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA +++S++ L  AK+  P    TK+SIM+G GET +++++TM+ + A  VD+M  GQ
Sbjct: 179 A-RATYERSLEFLRRAKEMQP-DIPTKSSIMIGLGETKEEIIETMDDLLANNVDIMAIGQ 236

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++PSK+H+ V +Y  P+ F + + + ME GF +  +GP+VRSSY A E
Sbjct: 237 YLQPSKKHIKVQKYYHPDEFAELKEIAMEKGFSHCEAGPLVRSSYHADE 285



 Score = 40.8 bits (94), Expect = 0.041
 Identities = 19/43 (44%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA++++   L + VIT+V RDDL D G+G F ETV+ ++   P
Sbjct: 92  VADSVSIMNLKHAVITAVARDDLKDGGAGVFAETVRAVRRKSP 134



>gb:AE017333_449212 Bacillus licheniformis DSM 13, complete genome.
          Length = 303

 Score =  116 bits (291), Expect = 6e-25
 Identities = 63/169 (37%), Positives = 102/169 (60%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  +   +   L  D  GD + ++ +  +  D+  HNIETV  L   VR
Sbjct: 124 AGVFAETVRAVRRKSPFTTIEVLPSDMGGDYNNLKTLMDTRPDILNHNIETVRRLTPRVR 183

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA +++S++ L  AK+  P    TK+SIM+G GET +++++TM+ + A  VD+M  GQ
Sbjct: 184 A-RATYERSLEFLRRAKEMQP-DIPTKSSIMIGLGETKEEIIETMDDLLANNVDIMAIGQ 241

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++PSK+H+ V +Y  P+ F + + + ME GF +  +GP+VRSSY A E
Sbjct: 242 YLQPSKKHIKVQKYYHPDEFAELKEIAMEKGFSHCEAGPLVRSSYHADE 290



 Score = 40.8 bits (94), Expect = 0.041
 Identities = 19/43 (44%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA++++   L + VIT+V RDDL D G+G F ETV+ ++   P
Sbjct: 97  VADSVSIMNLKHAVITAVARDDLKDGGAGVFAETVRAVRRKSP 139



>sp|Q87RR1|LIPA_VIBPA Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BA000031_706176 Vibrio parahaemolyticus
           RIMD 2210633 DNA, chromosome 1, complete sequence.
          Length = 321

 Score =  116 bits (291), Expect = 6e-25
 Identities = 62/160 (38%), Positives = 94/160 (58%), Gaps = 1/160 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFK 669
           R +R  N       LVPDFRG       + K    DVF HN+ET   L    R   AN+K
Sbjct: 154 REIRELNPDIKIETLVPDFRGRMDVALDLMKDNPPDVFNHNLETAPRLYRKARPG-ANYK 212

Query: 668 QSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
            S+++L   K+  P    TK+ +M+G GET +++++ ++ +RA GV ++T GQY+ PS+ 
Sbjct: 213 WSLELLKKFKEQHP-DVPTKSGLMMGLGETKEEIIEVLKDLRAHGVTMLTLGQYLAPSRH 271

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           H+PV  Y+ P  F++ + + +E+GF + A GP VRSSY A
Sbjct: 272 HLPVERYVPPSEFDELKEVALELGFTHAACGPFVRSSYHA 311



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 23/47 (48%), Positives = 32/47 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A  IA   L YVVITSVDRDDL D G+ HF +  ++++ L P++ I
Sbjct: 119 LARTIADMKLKYVVITSVDRDDLRDGGAQHFADCNREIRELNPDIKI 165



>sp|Q816A0|LIPA_BACCR Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017014_379801 Bacillus cereus ATCC 14579
           section 17 of 18 of the complete
           genome.>gb:AE016877_1020051 Bacillus cereus ATCC 14579
           complete genome.
          Length = 297

 Score =  116 bits (291), Expect = 6e-25
 Identities = 63/169 (37%), Positives = 99/169 (58%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  N   S   L  D  G    ++ +  +  D+  HNIETV  L   VR
Sbjct: 119 AAVFAETVRAVRRKNPFTSIEVLPSDMGGVEENLKMLMDAKPDILNHNIETVRRLSDRVR 178

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA +++S++ L  AK+  P    TK+SIM+G GET + +++ M+ +RA  VD++T GQ
Sbjct: 179 A-RAKYERSLEFLRRAKEMQP-DIPTKSSIMVGLGETREDLIEAMDDLRANNVDILTLGQ 236

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++PSK+H+PV +Y  P  F + + + +  GF +  +GP+VRSSY A E
Sbjct: 237 YLQPSKKHLPVLKYYPPAEFAELKEIALSKGFSHCEAGPLVRSSYHADE 285



 Score = 42.7 bits (99), Expect = 0.011
 Identities = 20/43 (46%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+++   GL +VVIT+V RDDL D G+  F ETV+ ++   P
Sbjct: 92  VADSVVQMGLKHVVITAVARDDLKDGGAAVFAETVRAVRRKNP 134



>sp|P57357|LIPA_BUCAI Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>pir|C84961|C84961 lipoic acid synthetase
           [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653633 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 323

 Score = 97.1 bits (240), Expect(2) = 6e-25
 Identities = 56/147 (38%), Positives = 84/147 (57%), Gaps = 2/147 (1%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGL-DVFAHNIETVEELQSVVRDHRANFKQSMDVL-MMAKDYA 630
           LVPDFRG    +  +    L D+F HNIE V  L   +R   AN+++S+ +L    K Y 
Sbjct: 164 LVPDFRGRIELILNIFNKALPDIFNHNIENVPRLFKKIRPG-ANYQRSLLLLESFKKKYC 222

Query: 629 PAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF 450
               LTK+ +MLG GE   ++++ M+ + ++GV ++T GQY++PS  H+PV  YI    F
Sbjct: 223 --SVLTKSGLMLGLGEKDVEIIQVMKDLYSSGVTLLTVGQYLQPSIHHLPVKRYIPLSEF 280

Query: 449 EKYQVLGMEMGFRYVASGPMVRSSYKA 369
           E  +   + +GF     GP +RSSY A
Sbjct: 281 ENIKKEALSIGFTNAFCGPFIRSSYHA 307



 Score = 40.4 bits (93), Expect(2) = 6e-25
 Identities = 18/39 (46%), Positives = 27/39 (69%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLK 835
           +++ I   G++YVVITSV RDDL D G+ HF   ++ +K
Sbjct: 116 LSDTIFDMGINYVVITSVVRDDLYDGGAEHFVNCIKAIK 154



>sp|Q8FNP4|LIPA_COREF Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BA000035_716883 Corynebacterium efficiens
           YS-314 DNA, complete genome.
          Length = 348

 Score =  116 bits (290), Expect = 8e-25
 Identities = 61/179 (34%), Positives = 104/179 (58%)
 Frame = -3

Query: 881 PTKEAVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQ 702
           P + A +     R +   N       LVPDF G    +++V +S  +VFAHN+ETV  + 
Sbjct: 129 PDEGAWLYSEVVRKIHELNPNTGVENLVPDFSGKRDLLQEVFESRPEVFAHNLETVPRIF 188

Query: 701 SVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVM 522
             +R     + +S+DV+  A+D+   G +TK++++LG GET +++ + +  + +AG D++
Sbjct: 189 KRIRP-AFRYDRSLDVIRQARDF---GLVTKSNLILGMGETREEISEALRDLHSAGTDII 244

Query: 521 TFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIKSM 345
           T  QY+RP     P+  ++ PE F +      E+GF  V SGP+VRSSY+AG+ Y +++
Sbjct: 245 TITQYLRPGPLFHPIERWVKPEEFLELSDEAYEIGFAAVMSGPLVRSSYRAGKLYAQAL 303



 Score = 46.6 bits (109), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 30/44 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPN 820
           VAE++    L+Y  IT V RDDLPD+G+  ++E V+K+  L PN
Sbjct: 106 VAESVREMRLNYSTITGVTRDDLPDEGAWLYSEVVRKIHELNPN 149



>sp|Q81XM8|LIPA_BACAN Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE017040_385116 Bacillus anthracis str.
           Ames section 17 of 18 of the complete
           genome.>gb:AE017225_410210 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017334_454963 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE017355_465968 Bacillus thuringiensis
           serovar konkukian str. 97-27, complete
           genome.>gb:AE016879_1014821 Bacillus anthracis str. Ames
           complete genome.
          Length = 298

 Score =  116 bits (290), Expect = 8e-25
 Identities = 63/169 (37%), Positives = 99/169 (58%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  N   S   L  D  G    ++ +  +  D+  HNIETV  L + VR
Sbjct: 119 AAVFAETVRAVRRKNPFTSIEVLPSDMGGVEENLKMLMDAKPDILNHNIETVRRLSNRVR 178

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA + +S++ L  AK+  P    TK+SIM+G GET + +++ M+ +RA  VD++T GQ
Sbjct: 179 A-RAKYDRSLEFLRRAKEMQP-DIPTKSSIMVGLGETREDLIEAMDDLRANNVDILTLGQ 236

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++PSK+H+PV +Y  P  F + + + +  GF +  +GP+VRSSY A E
Sbjct: 237 YLQPSKKHLPVLKYYPPAEFAELKEIALSKGFSHCEAGPLVRSSYHADE 285



 Score = 42.7 bits (99), Expect = 0.011
 Identities = 20/43 (46%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+++   GL +VVIT+V RDDL D G+  F ETV+ ++   P
Sbjct: 92  VADSVVQMGLKHVVITAVARDDLKDGGAAVFAETVRAVRRKNP 134



>gb:AE017280_426309 Bacillus cereus ATCC 10987, section 17 of 18 of
           the complete genome.>gb:CP000001_855290 Bacillus cereus
           ZK, complete genome.>gb:AE017194_1064728 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 298

 Score =  115 bits (289), Expect = 1e-24
 Identities = 63/169 (37%), Positives = 98/169 (57%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  N   S   L  D  G    ++ +  +  D+  HNIETV  L   VR
Sbjct: 119 AAVFAETVRAVRRKNPFTSIEVLPSDMGGVEENLKMLMDAKPDILNHNIETVRRLSDRVR 178

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA + +S++ L  AK+  P    TK+SIM+G GET + +++ M+ +RA  VD++T GQ
Sbjct: 179 A-RAKYDRSLEFLRRAKEMQP-DIPTKSSIMVGLGETREDLIEAMDDLRANNVDILTLGQ 236

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++PSK+H+PV +Y  P  F + + + +  GF +  +GP+VRSSY A E
Sbjct: 237 YLQPSKKHLPVLKYYPPAEFAELKEIALSKGFSHCEAGPLVRSSYHADE 285



 Score = 42.7 bits (99), Expect = 0.011
 Identities = 20/43 (46%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+++   GL +VVIT+V RDDL D G+  F ETV+ ++   P
Sbjct: 92  VADSVVQMGLKHVVITAVARDDLKDGGAAVFAETVRAVRRKNP 134



>gb:AE017282_426946 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 322

 Score =  115 bits (288), Expect = 1e-24
 Identities = 66/162 (40%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFK 669
           R+LR  +   S   L PDFRG     ++ +A    DVF HNIETV  L    R   A+++
Sbjct: 156 RALRTRSPALSVEILTPDFRGRMEIALDLLAADPPDVFNHNIETVPRLYRQARPG-ADYR 214

Query: 668 QSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
           QS+++L   +D  P G  TK+ +MLG GET D+V + +  +R  G +++T GQY++PS+ 
Sbjct: 215 QSLELLARFRDKVP-GVPTKSGLMLGLGETLDEVREALRDLRGHGCEMLTLGQYLQPSRD 273

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           H+PV  Y+ P  F++      E+GF  VAS P+VRSSY A +
Sbjct: 274 HLPVVRYVPPAEFDELAGYARELGFASVASAPLVRSSYHADQ 315



 Score = 46.6 bits (109), Expect = 8e-04
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +AE IA   L YVVITSVDRDDL D G+ HF   ++ L+   P + +
Sbjct: 121 LAETIALLRLRYVVITSVDRDDLRDGGAAHFAACIRALRTRSPALSV 167



>gb:BA000043_739551 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 311

 Score =  112 bits (280), Expect = 1e-23
 Identities = 60/169 (35%), Positives = 101/169 (59%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A +     R++R  N   +   L  D  G    ++ +  +  D+  HNIETV  L   VR
Sbjct: 132 AAVFAETVRAIRRKNPFTTIEVLPSDMGGVYENLKILMDARPDILNHNIETVRRLTPRVR 191

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA +++S++ L  AK+  P    TK+SIM+G GET +++++ M+ +RA  VD++T GQ
Sbjct: 192 A-RATYERSLEFLRRAKELQP-DIPTKSSIMVGLGETKEEIIEAMDDLRANHVDILTIGQ 249

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++P+K+H+ V +Y  P+ F++ + + +  GF +  +GP+VRSSY A E
Sbjct: 250 YLQPTKKHLKVVKYYHPDEFQELKEIALSKGFSHCEAGPLVRSSYHADE 298



 Score = 40.4 bits (93), Expect = 0.054
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VAE++    L +VV+T+V RDDL D G+  F ETV+ ++   P
Sbjct: 105 VAESVRIMNLKHVVVTAVARDDLKDGGAAVFAETVRAIRRKNP 147



>sp|Q7V6S0|LIP2_PROMM Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>gb:BX572098_798418 Prochlorococcus marinus
           MIT9313 complete genome; segment 4/7.
          Length = 306

 Score =  111 bits (278), Expect = 2e-23
 Identities = 68/184 (36%), Positives = 98/184 (53%), Gaps = 11/184 (5%)
 Frame = -3

Query: 881 PTKEAVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLD-----------VF 735
           P     I      ++R  N +     L PDF G  + + K  ++  +            F
Sbjct: 124 PDHGVSIFTETMAAIRQRNPLIEIEVLTPDFWGGVADLAKALEAQRERLTQLLMAAPVCF 183

Query: 734 AHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTM 555
            HN+ETVE LQS VR   A +  S+ +L  A++ AP    TK+ +MLG GE  ++VV+T+
Sbjct: 184 NHNLETVERLQSKVR-RGATYHHSLSLLAAARELAP-NIPTKSGLMLGLGEEQEEVVQTL 241

Query: 554 EKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSY 375
           E +R+     +T GQY+RPS  H+PV  Y  PE F+    +  ++GF  V SGP+VRSSY
Sbjct: 242 EDLRSVDCQRVTLGQYLRPSLAHIPVHRYWHPEDFKNLAEVACKLGFAQVRSGPLVRSSY 301

Query: 374 KAGE 363
            AGE
Sbjct: 302 HAGE 305



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 23/43 (53%), Positives = 29/43 (67%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+A+   GL YVV+TSV RDDLPD G   FTET+  ++   P
Sbjct: 101 VADAVQQMGLRYVVLTSVARDDLPDHGVSIFTETMAAIRQRNP 143



>sp|Q7NLU2|LIP2_GLOVI Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>gb:BA000045_741104 Gloeobacter violaceus
           PCC 7421 DNA, complete genome.
          Length = 298

 Score = 91.3 bits (225), Expect(2) = 3e-23
 Identities = 49/145 (33%), Positives = 83/145 (57%)
 Frame = -3

Query: 803 LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA 624
           L+PDF G  + ++ V  +   V  HN ETV  L   VR  + ++ +++ +L   +  A +
Sbjct: 135 LIPDFCGSEAALDIVIAAHPQVINHNTETVPRLYRRVRP-QGDYGRTLQLLERVRAKA-S 192

Query: 623 GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK 444
              TK+ +M G GE+  +V+  M  +RA   D++T GQY++P+ +H+ V  ++ P  FE+
Sbjct: 193 HIYTKSGLMAGLGESEAEVLAVMADLRAVYCDILTIGQYLQPTPKHLKVEAFVEPALFER 252

Query: 443 YQVLGMEMGFRYVASGPMVRSSYKA 369
           ++  G  MGF  + S P+ RSSY A
Sbjct: 253 WRRAGEGMGFLQMVSSPLTRSSYHA 277



 Score = 40.8 bits (94), Expect(2) = 3e-23
 Identities = 19/47 (40%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+A+   GL +VVITSV+RDDL D G+  F   ++ ++ + P   I
Sbjct: 86  LAQAVRRMGLRHVVITSVNRDDLADGGALQFARCIEAVRRVMPQTTI 132



>gb:YSCLIPOIC_1729812 Saccharomyces cerevisiae (clone pg189/ST3)
           lipoic acid synthase (LIP) gene, 5' end cds.
          Length = 322

 Score = 67.8 bits (164), Expect(2) = 3e-23
 Identities = 36/65 (55%), Positives = 46/65 (70%)
 Frame = -3

Query: 794 DFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTL 615
           DFRGD   V+ +A+ GLDV+AHN+ETVE L   VRD RA ++QS+ VL  AK   P+  +
Sbjct: 259 DFRGDLKMVDIMAQCGLDVYAHNLETVESLTPHVRDRRATYRQSLSVLERAKATVPS-LI 317

Query: 614 TKTSI 600
           TKTSI
Sbjct: 318 TKTSI 322



 Score = 63.9 bits (154), Expect(2) = 3e-23
 Identities = 29/48 (60%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI  WGL YVV+T+VDRDDL D G+ H  ETV+K+K   PN L+
Sbjct: 206 NTAEAIKRWGLGYVVLTTVDRDDLVDGGANHLAETVRKIKQKAPNTLV 253



>pir|D70023|D70023 lipoic acid synthetase (EC 2.8.1.-) yutB -
           Bacillus subtilis
          Length = 268

 Score =  110 bits (275), Expect = 4e-23
 Identities = 60/169 (35%), Positives = 99/169 (58%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A I     R++R  +   +   L  D  G+   ++ +  +  D+  HNIETV  L   VR
Sbjct: 89  AGIFAETVRAIRRKSPFTTIEVLPSDMGGNYDNLKTLMDTRPDILNHNIETVRRLTPRVR 148

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA + +S++ L  AK+  P    TK+SIM+G GET +++++ M+ + A  VD+M  GQ
Sbjct: 149 A-RATYDRSLEFLRRAKEMQP-DIPTKSSIMIGLGETKEEIIEVMDDLLANNVDIMAIGQ 206

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++P+K+H+ V +Y  P+ F + + + M+ GF +  +GP+VRSSY A E
Sbjct: 207 YLQPTKKHLKVQKYYHPDEFAELKEIAMQKGFSHCEAGPLVRSSYHADE 255



 Score = 40.0 bits (92), Expect = 0.070
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+++A   L + VIT+V RDD  D G+G F ETV+ ++   P
Sbjct: 62  VADSVALMNLKHAVITAVARDDQKDGGAGIFAETVRAIRRKSP 104



>sp|Q8EHQ6|LIPA_SHEON Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:AE015560_315570 Shewanella oneidensis MR-1
           section 109 of 457 of the complete
           genome.>gb:AE014299_951167 Shewanella oneidensis MR-1
           complete genome.
          Length = 321

 Score =  110 bits (275), Expect = 4e-23
 Identities = 61/160 (38%), Positives = 95/160 (59%), Gaps = 1/160 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDFRGD-PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFK 669
           R +R  N       LVPDFRG   + ++ ++    DVF HN+ET        R   AN++
Sbjct: 154 REIRKLNPEIKIEILVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPG-ANYQ 212

Query: 668 QSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
            S+D+L   K+  P    TK+ +M+G GET D++ + +  +R   V+++T GQY++PSK 
Sbjct: 213 WSLDLLKRFKERHP-NVPTKSGLMMGLGETNDEIAQVLRDLREHKVEMLTLGQYLQPSKF 271

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           H+PV  Y++P  F++ + L  E+GF + A GP+VRSSY A
Sbjct: 272 HLPVERYVSPAEFDELKALADELGFTHAACGPLVRSSYHA 311



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/47 (46%), Positives = 32/47 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ I    L YVVITSVDRDDL D G+ HF + +++++ L P + I
Sbjct: 119 LAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPEIKI 165



>sp|O32129|LIPA_BACSU Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BSUB0017_755198 Bacillus subtilis complete
           genome (section 17 of 21): from 3213330 to 3414388.
          Length = 298

 Score =  110 bits (275), Expect = 4e-23
 Identities = 60/169 (35%), Positives = 99/169 (58%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVR 690
           A I     R++R  +   +   L  D  G+   ++ +  +  D+  HNIETV  L   VR
Sbjct: 119 AGIFAETVRAIRRKSPFTTIEVLPSDMGGNYDNLKTLMDTRPDILNHNIETVRRLTPRVR 178

Query: 689 DHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQ 510
             RA + +S++ L  AK+  P    TK+SIM+G GET +++++ M+ + A  VD+M  GQ
Sbjct: 179 A-RATYDRSLEFLRRAKEMQP-DIPTKSSIMIGLGETKEEIIEVMDDLLANNVDIMAIGQ 236

Query: 509 YMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           Y++P+K+H+ V +Y  P+ F + + + M+ GF +  +GP+VRSSY A E
Sbjct: 237 YLQPTKKHLKVQKYYHPDEFAELKEIAMQKGFSHCEAGPLVRSSYHADE 285



 Score = 40.0 bits (92), Expect = 0.070
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKP 823
           VA+++A   L + VIT+V RDD  D G+G F ETV+ ++   P
Sbjct: 92  VADSVALMNLKHAVITAVARDDQKDGGAGIFAETVRAIRRKSP 134



>sp|Q7U7Q2|LIP2_SYNPX Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>gb:BX569691_775831 Synechococcus sp. WH8102
           complete genome; segment 3/7.
          Length = 299

 Score =  109 bits (273), Expect = 7e-23
 Identities = 65/180 (36%), Positives = 96/180 (53%), Gaps = 11/180 (6%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRG---DPSCVEKVAKSGLDV--------FAHNI 723
           A +      ++R  N + +   L PDF G   DP       +  L          F HN+
Sbjct: 122 AALFTTTMEAIRARNPLIAIEVLTPDFWGGCPDPQQAVAAQRERLSTVLAADPVCFNHNL 181

Query: 722 ETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVR 543
           ETV+ LQ  VR   A +++S+ +L   ++ AP    TK+ +MLG GE+ D+V+  M  +R
Sbjct: 182 ETVQRLQGEVR-RGATYERSLGLLAACRELAPT-IPTKSGLMLGLGESRDEVIAAMRDLR 239

Query: 542 AAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGE 363
           A     +T GQY+RPS  H+PV  Y TPE F++   +  ++GF  V SGP+VRSSY A +
Sbjct: 240 AVDCQRLTLGQYLRPSLAHIPVDRYWTPEEFDELGAVARDLGFAQVRSGPLVRSSYHAAD 299



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 21/47 (44%), Positives = 32/47 (68%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+A+ +  L YVV+T+V RDDL D G+  FT T++ ++A  P + I
Sbjct: 95  VADAVEAMQLRYVVLTAVARDDLADHGAALFTTTMEAIRARNPLIAI 141



>sp|Q7N767|LIPA_PHOLL Lipoyl synthase (EC 2.8.1.-) (Lipoic acid
           synthase) (Lipoate synthase) (Lipoyl-acyl-carrier
           protein synthase) (Sulfur insertion protein lipA)
           (Lip-syn).>gb:BX571863_786149 Photorhabdus luminescens
           subsp. laumondii TTO1 complete genome; segment 5/17.
          Length = 321

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/159 (37%), Positives = 94/159 (59%), Gaps = 1/159 (0%)
 Frame = -3

Query: 842 SLRH*NQICS*XALVPDFRGDPS-CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQ 666
           ++R  N       LVPDFRG     +E +  +  DVF HN+E V  +   VR   AN++ 
Sbjct: 155 AIREKNPSIKIETLVPDFRGRMDRALEILTATPPDVFNHNLENVPRVYRQVRPG-ANYEW 213

Query: 665 SMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           S+ +L   K+  P    TK+ +M+G GET ++++  M  +R  GV ++T GQY++PS+ H
Sbjct: 214 SLKLLEKFKEAHP-DIPTKSGLMVGLGETNEEILDVMRDLRRHGVTMLTLGQYLQPSRHH 272

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           +PV  Y++P+ F++ +   + MGF + A GP VRSSY A
Sbjct: 273 LPVQRYVSPQEFDEMKEEALAMGFTHAACGPFVRSSYHA 311



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 21/47 (44%), Positives = 30/47 (63%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           +A+ I    L YVVITSVDRDDL D G+ HF + +  ++   P++ I
Sbjct: 119 LAQTIKDMALRYVVITSVDRDDLRDGGAQHFADCISAIREKNPSIKI 165



>gb:CP000031_86130 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 316

 Score =  107 bits (268), Expect = 3e-22
 Identities = 62/166 (37%), Positives = 95/166 (57%), Gaps = 1/166 (0%)
 Frame = -3

Query: 845 RSLRH*NQICS*XALVPDF-RGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFK 669
           R++RH +   +   L PDF +  P  +E V  S  DVF HN+ETV  L   VR   A + 
Sbjct: 141 RAIRHRSPSTTIEILTPDFLKCAPEVLEVVVASKPDVFNHNLETVPGLYPEVRPG-ARYF 199

Query: 668 QSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKR 489
            S+ +L   K+  P+   TK+ IM+G GET  QV + M+ +RAA +D +T GQY++P+ +
Sbjct: 200 HSLRLLQRVKELDPS-IFTKSGIMVGLGETEQQVRQVMDDMRAADIDFLTIGQYLQPTPK 258

Query: 488 HMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKAGEFYIK 351
           H  V  ++ P+ F  Y+      GF  V++ P+ RSSY AG+ + +
Sbjct: 259 HHRVDRFVHPDEFASYEKAAYGKGFLMVSATPLTRSSYHAGDDFAR 304



 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA A+   GL++VVITSVDRDDL D G+ HF +T++ ++   P+  I
Sbjct: 106 VAHAVEKLGLNHVVITSVDRDDLADGGAEHFAQTIRAIRHRSPSTTI 152



>sp|Q7VBJ3|LIP2_PROMA Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid
           synthase 2) (Lipoate synthase 2) (Lipoyl-acyl-carrier
           protein synthase 2) (Sulfur insertion protein lipA2)
           (Lip-syn 2).>gb:AE017164_395555 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 section 4 of 6 of the
           complete genome.>gb:AE017126_1031224 Prochlorococcus
           marinus subsp. marinus str. CCMP1375 complete genome.
          Length = 308

 Score =  104 bits (260), Expect = 2e-21
 Identities = 61/180 (33%), Positives = 100/180 (55%), Gaps = 13/180 (7%)
 Frame = -3

Query: 869 AVILQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLD-------------VFAH 729
           A+   R   ++R  +   S   L PDF G   C++K+  + +               F H
Sbjct: 128 AIHFSRTIHAIRKTSPTTSIEVLTPDFWG--GCIDKIKATKIQRERLKIVLKAKPVCFNH 185

Query: 728 NIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEK 549
           N+ETVE LQ  VR   A + +S+++L  +++       TK+ +MLG GE  D++++T++ 
Sbjct: 186 NLETVERLQKEVR-RGATYHRSLELLKASREIDNE-IPTKSGLMLGLGERSDEIIQTLKD 243

Query: 548 VRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           +R+     +T GQY+RPS  H+PV +Y  P+ FE ++ +   +GF+ V SGP+VRSSY A
Sbjct: 244 LRSVNCQQVTIGQYLRPSLAHIPVQKYWLPKDFEHFKRIAEGLGFKKVNSGPLVRSSYHA 303



 Score = 44.3 bits (103), Expect = 0.004
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = -2

Query: 951 VAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           VA+A+    L YVV+TSV RDDL D G+ HF+ T+  ++   P   I
Sbjct: 101 VAKAVLKLQLKYVVLTSVARDDLDDHGAIHFSRTIHAIRKTSPTTSI 147



>gb:BX908798_829708 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 323

 Score =  102 bits (255), Expect = 9e-21
 Identities = 52/159 (32%), Positives = 95/159 (59%), Gaps = 1/159 (0%)
 Frame = -3

Query: 842 SLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQS 663
           ++R  N+  +   L  DF G+   +  V ++  ++F HNIETV  L   VR H+A ++++
Sbjct: 149 AIRQTNEDVTIEVLTSDFEGNRKALSFVLQAKPEIFNHNIETVRRLTPRVR-HKATYERT 207

Query: 662 MDVLMMAKDYAPAGTL-TKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRH 486
           + VL  A        L  K+ IM+G GET +++ +T+  ++  G +++T GQY++P+++ 
Sbjct: 208 LSVLEQAAQKKYHSQLKVKSGIMVGLGETEEEIFETLLDLKRVGCEIVTIGQYLQPNRQK 267

Query: 485 MPVSEYITPEAFEKYQVLGMEMGFRYVASGPMVRSSYKA 369
           + V  ++ P+ F+KY+  G+ +G  ++  GP VRSSY A
Sbjct: 268 LLVKSFVHPDIFKKYEQYGLSIGIPHLYCGPFVRSSYNA 306



 Score = 41.6 bits (96), Expect = 0.024
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = -2

Query: 957 SNVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           S VA ++   GL +VVIT V RDDL D GS H  E ++ ++    ++ I
Sbjct: 111 SRVALSVQQLGLKHVVITMVARDDLSDGGSSHLVEVIEAIRQTNEDVTI 159



>gb:AB004538_1509129 Schizosaccharomyces pombe 39 kb genomic DNA,
           clone c568.
          Length = 244

 Score = 61.6 bits (148), Expect(2) = 2e-19
 Identities = 26/48 (54%), Positives = 35/48 (72%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRDDLPDQGSGHFTETVQKLKALKPNMLI 811
           N AEAI  W L Y+V+TSVDRDDL D G+ H  +T+QK+K   P++L+
Sbjct: 156 NTAEAIKQWNLGYIVLTSVDRDDLTDLGANHIAKTIQKIKEKAPHILV 203



 Score = 57.4 bits (137), Expect(2) = 2e-19
 Identities = 29/40 (72%), Positives = 30/40 (75%)
 Frame = -3

Query: 806 ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRD 687
           AL PDF G    VE VAKSGLDVFAHN+ETVEEL   VRD
Sbjct: 205 ALTPDFSGRMDLVEIVAKSGLDVFAHNVETVEELTPFVRD 244



>gb:AE014296_1137188 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003591_1216887 Drosophila melanogaster
           chromosome 3L, section 72 of 83 of the complete
           sequence.
          Length = 190

 Score = 42.4 bits (98), Expect = 0.014
 Identities = 18/22 (81%), Positives = 20/22 (90%)
 Frame = -2

Query: 954 NVAEAIASWGLDYVVITSVDRD 889
           N A AIASWGLDY+V+TSVDRD
Sbjct: 162 NTATAIASWGLDYIVLTSVDRD 183



>pir|F72462|F72462 hypothetical protein APE2345 - Aeropyrum pernix
           (strain K1)>gb:BA000002_653102 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 127

 Score = 35.4 bits (80), Expect(2) = 0.100
 Identities = 32/93 (34%), Positives = 41/93 (44%)
 Frame = +1

Query: 529 STPAARTFSIVLTTWSGVSPQPNIIDVLVSVPAGA*SFAIIKTSMDCLKLARXXXXXXXX 708
           STP      I   T    SP+P+ +  LV+ P+   S AI +T   CL  A         
Sbjct: 2   STPTLLKSLIASITSLLSSPRPSSMLDLVTTPS---SLAISRTLRLCLYPALLSLTRGVS 58

Query: 709 XXXXXIL*AKTSNPDFATFSTQLGSPLKSGTSA 807
                IL A+TS+P  AT  T   +P KSG  A
Sbjct: 59  LSTVSILWARTSSPLAATSLTCSSTPWKSGMRA 91



 Score = 23.5 bits (49), Expect(2) = 0.100
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = +2

Query: 818 IFGFNALSFCTVSVK*PLPWSGKSSRSTLVITT 916
           + G +     TV+ K   P SG+SS STLV  T
Sbjct: 95  VSGLSLFIALTVAAKWLAPPSGRSSLSTLVRVT 127



>gb:AC117072_1207653 Dictyostelium discoideum chromosome 2 map
           3879572-4071762 strain AX4, complete sequence.
          Length = 1501

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = -2

Query: 696 CTRSPC*L*AVHGCLNDGKGLCSCWYAHQDINNVGLWRN-TRPSC*NNG--KGTSSRC*C 526
           CT + C     HG  +  KG+C C+   QDI+    ++N   P+C NNG  K T+  C C
Sbjct: 786 CTSNNC---NGHGVCDTSKGICQCYPEWQDIDCQTPFKNCLDPTCSNNGICKNTTGICEC 842

Query: 525 N 523
           N
Sbjct: 843 N 843



>pir|B69037|B69037 conserved hypothetical protein MTH1279 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000893_28957 Methanobacterium
           thermoautotrophicum from bases 1154519 to 1165808
           (section 99 of 148) of the complete
           genome.>gb:AE000666_926039 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 234

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 4/99 (4%)
 Frame = -3

Query: 800 VPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRAN----FKQSMDVLMMAKDY 633
           + D  G P  +     S LD++   +  +     V R          K   D++ M +  
Sbjct: 10  IRDITGSPVWLNTGINSELDIYGPEVAGITGALEVARPDLQRRLCPSKPREDIISMLEKA 69

Query: 632 APAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTF 516
              G     +I+LG GETPD +    E +R   +D +TF
Sbjct: 70  GELGFRKGITIILGLGETPDDLTHLFEFIRDLKIDRVTF 108



>pir|AD0673|AD0673 osmotically inducible protein C [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:CP000026_76137 Salmonella enterica
           subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:SEN313032_182080 Salmonella typhi clyA gene,
           o211 gene and osmC gene.>gb:AE008768_243253 Salmonella
           typhimurium LT2, section 72 of 220 of the complete
           genome.>gb:AE016839_345583 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 6 of 16 of the
           complete genome.>gb:AL627270_541699 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 6/20.>gb:AE014613_982915 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1000335 Salmonella typhimurium LT2,
           complete genome.
          Length = 143

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 2/86 (2%)
 Frame = -3

Query: 686 HRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKT--MEKVRAAGVDVMTFG 513
           H A F  ++ +++    + P    T   + L   E    + K     KV  A +D  TF 
Sbjct: 56  HAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVEAGFAITKIALQSKVAVADIDASTFD 115

Query: 512 QYMRPSKRHMPVSEYITPEAFEKYQV 435
           Q ++ +K   PVS+ +  E    YQ+
Sbjct: 116 QIIQKAKAGCPVSQVLNAEITLDYQL 141



>gb:BX572599_801658 Rhodopseudomonas palustris CGA009 complete
           genome; segment 7/16.
          Length = 336

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = -3

Query: 767 EKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGC 588
           +++A +GLD + HNI+T EE  + V   R +F   +D L   +D   AG       +LG 
Sbjct: 153 KQLADAGLDYYNHNIDTSEEFYASVVKSR-SFGDRLDTLEKVQD---AGIKVCCGGILGL 208

Query: 587 GETPDQVVKTM 555
           GE P   V+ +
Sbjct: 209 GEKPTDRVEML 219



>pir|AI3047|AI3047 biotin synthetase [imported] - Agrobacterium
           tumefaciens  (strain C58, Dupont)>pir|B98238|B98238 bioB
           protein (AF311738) [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>gb:AE008283_235370
           Agrobacterium tumefaciens str. C58 linear chromosome,
           section 87 of 187 of the complete
           sequence.>gb:AE009331_250826 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 101 of 187 of the
           complete sequence.>gb:AE007870_1080483 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.>gb:AE008689_1088669 Agrobacterium tumefaciens
           str. C58 linear chromosome, complete sequence.
          Length = 339

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = -3

Query: 779 PSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSI 600
           P   E++A +GLD + HN++T E   S +   R  F+  ++ L   +D   AG       
Sbjct: 151 PEQSERLADAGLDYYNHNVDTSERFYSEIITTR-TFEDRLETLANVRD---AGIKVCAGG 206

Query: 599 MLGCGETPDQVVKTM 555
           +LG GET +  +  +
Sbjct: 207 ILGMGETVEDRISML 221



>gb:AE017255_417773 Treponema denticola ATCC 35405, section 10 of 10
           of the complete genome.>gb:AE017226_1071369 Treponema
           denticola ATCC 35405, complete genome.
          Length = 246

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 8/108 (7%)
 Frame = -3

Query: 728 NIETVEELQSVVRDHRANFKQSMDVL--------MMAKDYAPAGTLTKTSIMLGCGETPD 573
           N+ +V  + S VRD R  F+  + +         ++   Y   G  + TS+ L CG TPD
Sbjct: 129 NLVSVANIPSGVRDMRGCFEGCIRLKTAPVIPYGVLEMSYCFKGCKSLTSVTLKCGCTPD 188

Query: 572 QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLG 429
               T +   A GVD +   +            ++IT EA  K  V G
Sbjct: 189 WFEDTFKDCNALGVDSIKVPK--------AAYHQFITAEALNKMAVPG 228



>pir|C84465|C84465 hypothetical protein At2g05120 [imported] -
            Arabidopsis thaliana>gb:AC007018_1534977 Arabidopsis
            thaliana chromosome 2 clone F5G3 map RNS1, complete
            sequence.
          Length = 1234

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 17/26 (65%), Positives = 19/26 (73%)
 Frame = -3

Query: 659  DVLMMAKDYAPAGTLTKTSIMLGCGE 582
            DVLM  KD+A AG L  T+IMLGC E
Sbjct: 1195 DVLMSHKDFAEAGKLMLTAIMLGCVE 1220



>gb:CP000009_864011 Gluconobacter oxydans 621H, complete genome.
          Length = 346

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 21/67 (31%), Positives = 34/67 (50%)
 Frame = -3

Query: 782 DPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTS 603
           D    E++ K+GLD + HN++T EE    +   R  ++Q +D L   +D   AG      
Sbjct: 143 DAQQTERLKKAGLDYYNHNLDTSEEFYGSIISTR-TYQQRLDTLSNVRD---AGINVCCG 198

Query: 602 IMLGCGE 582
            ++G GE
Sbjct: 199 GIVGMGE 205



>gb:AE014292_310062 Brucella suis 1330 chromosome II, complete
           sequence.
          Length = 328

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 23/67 (34%), Positives = 34/67 (50%)
 Frame = -3

Query: 782 DPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTS 603
           D    EK+A +GLD + HNI+T E     V   R +F+  +D L   ++   AG    + 
Sbjct: 145 DSDKAEKLADAGLDYYNHNIDTSERFYPAVITTR-SFEDRLDTLANVRN---AGIKVCSG 200

Query: 602 IMLGCGE 582
            +LG GE
Sbjct: 201 GILGLGE 207



>pir|AC1715|AC1715 hypothetical protein homolog lin2263 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596171_539605
           Listeria innocua Clip11262 complete genome, segment
           9/12.
          Length = 322

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 5/114 (4%)
 Frame = -3

Query: 557 MEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA-----FEKYQVLGMEMGFRYVASGP 393
           ++KV+AAG+D +  G    P   H P  E +  EA      EK+   G+ +        P
Sbjct: 19  LDKVKAAGLDAVEIGTGGNPGNHHCPTDELLASEAARKEYLEKFTSRGLTISAFSCHDNP 78

Query: 392 MVRSSYKAGEFYIKSMIESDRAASSV*HPVFHTIEFTASVVCFMCSPNCLVYFW 231
           +  +  +A     + + +S + AS +  PV +T   TA       +PN  V  W
Sbjct: 79  ISPNKEEAAA-SDEILRKSIKLASLMNVPVVNTFSGTAGDSDDAKAPNWPVIPW 131



>pir|AH1344|AH1344 hypothetical protein lmo2160 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591982_536651
           Listeria monocytogenes strain EGD, complete genome,
           segment 10/12.
          Length = 322

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 5/114 (4%)
 Frame = -3

Query: 557 MEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA-----FEKYQVLGMEMGFRYVASGP 393
           ++KV+AAG+D +  G    P   H P  E +  EA      EK+   G+ +        P
Sbjct: 19  LDKVKAAGLDAVEIGTGGNPGNHHCPTDELLASEAARKEYLEKFTSRGLTISAFSCHDNP 78

Query: 392 MVRSSYKAGEFYIKSMIESDRAASSV*HPVFHTIEFTASVVCFMCSPNCLVYFW 231
           +  +  +A     + + +S + AS +  PV +T   TA       +PN  V  W
Sbjct: 79  ISPNKEEAAA-SDEILRKSIKLASLMNVPVVNTFSGTAGDSDDAKAPNWPVIPW 131



>pir|AF3606|AF3606 biotin synthase (EC 2.8.1.6) [imported] -
           Brucella melitensis (strain 16M)>gb:AE009712_254754
           Brucella melitensis 16M chromosome II, section 74 of 107
           of the complete sequence.>gb:AE008918_980666 Brucella
           melitensis 16M chromosome II, complete sequence.
          Length = 346

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 23/67 (34%), Positives = 34/67 (50%)
 Frame = -3

Query: 782 DPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTS 603
           D    EK+A +GLD + HNI+T E     V   R +F+  +D L   ++   AG    + 
Sbjct: 163 DSDKAEKLADAGLDYYNHNIDTSERFYPAVITTR-SFEDRLDTLANVRN---AGIKVCSG 218

Query: 602 IMLGCGE 582
            +LG GE
Sbjct: 219 GILGLGE 225



>sp|P36569|BIOB_SERMA Biotin synthase (EC 2.8.1.6) (Biotin
           synthetase).>gb:SMABIO_183880 S. marcescens biotin
           operon, complete sequence.
          Length = 346

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 782 DPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTS 603
           D +  E++A++GLD + HN++T  E    +   R ++++ +D L   +D   AG    + 
Sbjct: 136 DGTQAERLAEAGLDYYNHNLDTSPEFYGSIITTR-SYQERLDTLDKVRD---AGIKVCSG 191

Query: 602 IMLGCGET 579
            ++G GET
Sbjct: 192 GIVGLGET 199



>gb:AE017231_411988 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 5 of 16 of the complete
           genome.>gb:AE016958_1055392 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 344

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = -3

Query: 770 VEKVAKSGLDVFAHNIETVEE-LQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIML 594
           VE++A+ G+  + HN+ET      +VV  H   +++  D L M +D   AG       +L
Sbjct: 166 VEQLAEMGVHRYNHNLETARSFFPNVVTTH--TWEERWDTLSMVRD---AGMEVCCGGIL 220

Query: 593 GCGETPDQVVKTMEKVRAAGVD 528
           G GET +Q  +   ++   G D
Sbjct: 221 GMGETLEQRAEFAAELAELGPD 242



>gb:AB031297_1194870 Sarcophaga peregrina mRNA for 120-kDa protein,
           complete cds.
          Length = 765

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 4/64 (6%)
 Frame = -2

Query: 657 CLNDG---KGLCSCWYAHQDINNVGLW-RNTRPSC*NNGKGTSSRC*CNDVWSVYETLKA 490
           C+N        C CW  ++D  +  L     RP+C N      ++C CN+ + V  +   
Sbjct: 507 CINSNCVEPNTCECWDGYEDTKHSNLCVARCRPTCENGKCVAPNKCQCNEGYKVTNS-SM 565

Query: 489 PHAC 478
           PH C
Sbjct: 566 PHNC 569



>gb:AE017329_444610 Listeria monocytogenes str. 4b F2365, section 8
           of 10 of the complete genome.>gb:AE017262_1076966
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 322

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 5/114 (4%)
 Frame = -3

Query: 557 MEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEA-----FEKYQVLGMEMGFRYVASGP 393
           ++KV+AAG+D +  G    P   H P  E +  EA      +K+   G+ +        P
Sbjct: 19  LDKVKAAGLDAVEIGTGGNPGNHHCPTDELLASEAARKEYLDKFTSRGLTISAFSCHDNP 78

Query: 392 MVRSSYKAGEFYIKSMIESDRAASSV*HPVFHTIEFTASVVCFMCSPNCLVYFW 231
           +  +  +A     + + +S + AS +  PV +T   TA       +PN  V  W
Sbjct: 79  ISPNKEEAAA-SDEILRKSIKLASLMNVPVVNTFSGTAGDSDDAKAPNWPVIPW 131


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,050,145,898
Number of Sequences: 1806583
Number of extensions: 22229631
Number of successful extensions: 56392
Number of sequences better than 10.0: 204
Number of HSP's better than 10.0 without gapping: 53686
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56173
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 71931210200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)