BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8339
         (814 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003866_1834543 Oryza sativa (japonica cultivar-group) genom...    99   1e-33   
pir|F85225|F85225 hypothetical protein AT4g19900 [imported] - Ar...    89   6e-33   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00177_1696243 Oryza sativa genomic DNA, chromosome 4, BAC...    44   2e-07   
gb:ATAC009326_1542914 Arabidopsis thaliana chromosome III P1 MZB...    35   3e-04   
pir|B96636|B96636 hypothetical protein T7P1.18 [imported] - Arab...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
pir|T45965|T45965 hypothetical protein F7J8.230 - Arabidopsis th...    33   0.002   Arabidopsis thaliana [mouse-ear cress]
pir|T01247|T01247 hypothetical protein At2g38150 [imported] - Ar...    37   0.34    Arabidopsis thaliana [mouse-ear cress]
gb:CR378665_94246 Photobacterium profundum SS9; segment 3/12.          33   8.4     


>gb:AP003866_1834543 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1092_A07.
          Length = 615

 Score = 99.4 bits (246), Expect(2) = 1e-33
 Identities = 45/94 (47%), Positives = 66/94 (70%)
 Frame = -1

Query: 607 NFSSNDNVSNKNMELRLQPSSLFFPISHGNILRYLTAPVTESERFEQDALFKKIXDESFT 428
           N S   + ++ +++++ +PS  F+PIS  +I RY +   +  ER + DALF +I ++S T
Sbjct: 522 NMSDKADDNSGHLDIKFEPSVAFYPISSTDITRYFSEADSTDERAQHDALFSRIVNDSTT 581

Query: 427 FHLWNSITSATVPEPNSLVARIINHHCLHCSEEL 326
           FHLWNSITS+ VPEPNSLV RI+N +CLHC + L
Sbjct: 582 FHLWNSITSSLVPEPNSLVERILNRYCLHCLDVL 615



 Score = 67.0 bits (162), Expect(2) = 1e-33
 Identities = 28/46 (60%), Positives = 38/46 (82%)
 Frame = -3

Query: 749 DGNTLSGAVMAFRKHSPFIMECLNEFYSSYDDSQLRWNGAELLIRV 612
           + ++ SGAV+AF K+SPF+ ECL EF+S+YDD  L+WNGAEL+ RV
Sbjct: 474 ENSSFSGAVLAFEKNSPFLAECLKEFHSTYDDELLQWNGAELMTRV 519



>pir|F85225|F85225 hypothetical protein AT4g19900 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV51_1545829 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           51.>gb:ATF18F4_1549134 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18F4 (ESSA project).
          Length = 1302

 Score = 88.6 bits (218), Expect(2) = 6e-33
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -1

Query: 604 FSSNDNVSNKNMELRLQPSSLFFPISHGNILRYLTAPVTESERFEQDALFKKIXDESFTF 425
           F +  N      EL ++PSS+FFPI+   I  Y   P  E ER +QD  FKKI +ES TF
Sbjct: 552 FLNGKNRRMNQQELNIRPSSVFFPINSQQITNYFAYPAIEDERSQQDESFKKILNESLTF 611

Query: 424 HLWNSITSATVPEPNSLVARIIN 356
           H WNS+TS+ +PEP SLVA++I+
Sbjct: 612 HFWNSVTSSLIPEPESLVAKLIS 634



 Score = 75.5 bits (184), Expect(2) = 6e-33
 Identities = 36/68 (52%), Positives = 48/68 (70%)
 Frame = -3

Query: 812 DIIXXXXXXXXXNTXGMDEGMDGNTLSGAVMAFRKHSPFIMECLNEFYSSYDDSQLRWNG 633
           D+I         NT GM++ + G +L+GAVM+F K SPF++ECLNE+Y +YDD  LR NG
Sbjct: 482 DVIVLGSLSSLRNTIGMEDQVAGESLNGAVMSFEKKSPFLLECLNEYYLTYDDKCLRCNG 541

Query: 632 AELLIRVA 609
           A+LL RVA
Sbjct: 542 ADLLTRVA 549



>gb:OSJN00177_1696243 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0074L08, complete
           sequence.>gb:OSJN00183_1696327 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0081C01, complete
           sequence.
          Length = 445

 Score = 44.3 bits (103), Expect(2) = 2e-07
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = -1

Query: 568 ELRLQPSSLFFPISHGNILRYLTAPVTESERFEQDALFKKIXDESFTFHLWNSITSATVP 389
           +L + P + F+P+    I     AP          A  + I  ESF  HLWN  + +   
Sbjct: 360 DLTVLPPAAFYPVDWNKIGGLFVAPKDRKGERWVKAKVESIKGESFGIHLWNRESRSLEM 419

Query: 388 EPNSLVARIINHHCLHCSEEL 326
           E  S++ R+++  CL C+  +
Sbjct: 420 EEGSVIGRLLSDSCLFCNSSM 440



 Score = 33.5 bits (75), Expect(2) = 2e-07
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = -3

Query: 749 DGNTLSGAVMAFRKHSPFIMECLNEFYSSYDDSQLRWNGAELLIRVA 609
           D   L+ AVM F +  P + E + EF + +D S+   NG  L+ RVA
Sbjct: 300 DWMRLNNAVMVFDRGHPLLREFIAEFAAKFDGSKWGHNGPYLVSRVA 346



>gb:ATAC009326_1542914 Arabidopsis thaliana chromosome III P1 MZB10
           genomic sequence, complete
           sequence.>gb:ATAC010871_1543189 Arabidopsis thaliana
           chromosome III BAC T16O11 genomic sequence, complete
           sequence.
          Length = 411

 Score = 35.0 bits (79), Expect(2) = 3e-04
 Identities = 15/68 (22%), Positives = 31/68 (45%)
 Frame = -1

Query: 541 FFPISHGNILRYLTAPVTESERFEQDALFKKIXDESFTFHLWNSITSATVPEPNSLVARI 362
           F+P++   I +    P TE +         ++   S+  HLWN  +     E  S + ++
Sbjct: 337 FYPVNWVEIEKLFKVPRTEKDSKRVQVKVLEMQKRSYGLHLWNKFSRKFEIEQGSAMDKL 396

Query: 361 INHHCLHC 338
           +++ C+ C
Sbjct: 397 VSNQCIIC 404



 Score = 32.0 bits (71), Expect(2) = 3e-04
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = -3

Query: 737 LSGAVMAFRKHSPFIMECLNEFYSSYDDSQLRWNGAELLIRVA 609
           L+ AV+ F K+ PF+++ + EF  +++ +    NG  L+ RVA
Sbjct: 276 LNNAVLIFDKNHPFLLKSIEEFALTFNGNVWGHNGPYLVSRVA 318



>pir|B96636|B96636 hypothetical protein T7P1.18 [imported] -
           Arabidopsis thaliana>gb:AE005173_893776 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC018908_1538453 Arabidopsis thaliana
           chromosome 1 BAC T7P1 genomic sequence, complete
           sequence.
          Length = 435

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/83 (25%), Positives = 42/83 (50%)
 Frame = -1

Query: 583 SNKNMELRLQPSSLFFPISHGNILRYLTAPVTESERFEQDALFKKIXDESFTFHLWNSIT 404
           S+ ++   + P S F+P+    I  +  AP  ES+ + +  L   +   +F  HLWN  +
Sbjct: 347 SSSDLGFSVLPPSAFYPVDWTRIKGFYRAPTNESDAWLRKRL-THLRKNTFAVHLWNRES 405

Query: 403 SATVPEPNSLVARIINHHCLHCS 335
                E  S++ ++++H C+ C+
Sbjct: 406 KKLRIEEGSIIHQLMSHSCIFCN 428



>pir|T45965|T45965 hypothetical protein F7J8.230 - Arabidopsis
           thaliana>gb:ATF7J8_1551004 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F7J8 (ESSA
           project).>gb:BT015324_1642152 Arabidopsis thaliana
           At5g01250 mRNA, complete cds.
          Length = 407

 Score = 32.7 bits (73), Expect(2) = 0.002
 Identities = 15/70 (21%), Positives = 30/70 (42%)
 Frame = -1

Query: 547 SLFFPISHGNILRYLTAPVTESERFEQDALFKKIXDESFTFHLWNSITSATVPEPNSLVA 368
           S+F+ ++   I +    P TE +          +    +  HLWN  +     E  S + 
Sbjct: 331 SVFYSVNWLEIKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMW 390

Query: 367 RIINHHCLHC 338
           ++++ HC+ C
Sbjct: 391 KLVSEHCIIC 400



 Score = 31.2 bits (69), Expect(2) = 0.002
 Identities = 14/43 (32%), Positives = 27/43 (62%)
 Frame = -3

Query: 737 LSGAVMAFRKHSPFIMECLNEFYSSYDDSQLRWNGAELLIRVA 609
           L+ AV+ F K+ P +++ + EF  +++ +   +NG  L+ RVA
Sbjct: 272 LNNAVLIFDKNHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVA 314



>pir|T01247|T01247 hypothetical protein At2g38150 [imported] -
           Arabidopsis thaliana>gb:AC003028_1530972 Arabidopsis
           thaliana chromosome 2 clone F16M14 map ve018, complete
           sequence.
          Length = 736

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 17/68 (25%), Positives = 31/68 (45%)
 Frame = -1

Query: 541 FFPISHGNILRYLTAPVTESERFEQDALFKKIXDESFTFHLWNSITSATVPEPNSLVARI 362
           F+P++   I +    P T  E    +   + +   S+  HLWN +T     E  S++  +
Sbjct: 661 FYPVNWIKIQKLFKKPATTREAKWVEKTVQDMNKGSYMIHLWNKVTRKIKIEEGSVMHTL 720

Query: 361 INHHCLHC 338
           ++ HC  C
Sbjct: 721 VSTHCTVC 728



>gb:CR378665_94246 Photobacterium profundum SS9; segment 3/12.
          Length = 149

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 15/42 (35%), Positives = 26/42 (61%)
 Frame = -3

Query: 740 TLSGAVMAFRKHSPFIMECLNEFYSSYDDSQLRWNGAELLIR 615
           +LSGA +A +  +   +EC + F+   DD +LR  G E+++R
Sbjct: 75  SLSGASLAKKAPNYLHIECRSAFFGFVDDFELRLQGNEIIVR 116


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,432,996
Number of Sequences: 1806583
Number of extensions: 15693101
Number of successful extensions: 37819
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 36520
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37795
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 53504197652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)