BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8287
         (790 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:OSJN00203_1696651 Oryza sativa genomic DNA, chromosome 4, BAC...   168   3e-45   
gb:AY224421_1590623 Oryza sativa (japonica cultivar-group) isola...   168   3e-45   
gb:AE005172_890286 Arabidopsis thaliana chromosome 1, top arm co...   165   5e-45   
gb:AP005885_1859667 Oryza sativa (japonica cultivar-group) genom...   163   9e-44   
gb:AY086095_1571153 Arabidopsis thaliana clone 21249 mRNA, compl...   162   1e-43   
pir|C96657|C96657 hypothetical protein F16M19.7 [imported] - Ara...   162   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AY058092_1564231 Arabidopsis thaliana At1g63170/F16M19_7 mRNA...   157   2e-42   
gb:AY059830_1564674 Arabidopsis thaliana putative protein (At3g6...   157   8e-42   
pir|T47910|T47910 hypothetical protein T20K12.80 - Arabidopsis t...   157   8e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AP003916_1835174 Oryza sativa (japonica cultivar-group) genom...   157   8e-42   
gb:AY057713_1564125 Arabidopsis thaliana AT4g11680/T5C23_110 mRN...   157   3e-37   
pir|T04215|T04215 hypothetical protein T5C23.110 - Arabidopsis t...   141   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AY084480_1569569 Arabidopsis thaliana clone 109181 mRNA, comp...   111   1e-27   
pir|H96703|H96703 probable RING zinc finger protein T23K23.8 [im...   111   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP004880_1846517 Oryza sativa (japonica cultivar-group) genom...    96   1e-22   
gb:AP004057_1837039 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AP002524_1822387 Oryza sativa (japonica cultivar-group) genom...    90   4e-17   
gb:AY168924_1586415 Arabidopsis thaliana RES protein (RES) mRNA,...    89   1e-16   
gb:AY074271_1567432 Arabidopsis thaliana unknown protein (At4g32...    89   1e-16   
pir|T04466|T04466 hypothetical protein F4D11.200 - Arabidopsis t...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
pir|G96835|G96835 probable RING zinc finger protein, 53384-54880...    86   6e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP005879_1859549 Oryza sativa (japonica cultivar-group) genom...    86   8e-16   
gb:AC130610_1740872 Oryza sativa (japonica cultivar-group) chrom...    80   3e-14   
gb:AY085253_1570325 Arabidopsis thaliana clone 141890 mRNA, comp...    78   2e-13   
gb:AP003245_1826151 Oryza sativa (japonica cultivar-group) genom...    70   3e-11   
pir|T08924|T08924 hypothetical protein T15N24.30 - Arabidopsis t...    70   3e-11   Arabidopsis thaliana [mouse-ear cress]
gb:BC075707_2106722 Mus musculus RIKEN cDNA 4732452J19 gene, mRN...    69   8e-11   
gb:AL596086_2070783 Mouse DNA sequence from clone RP23-168C20 on...    69   8e-11   
gb:AK028750_1161140 Mus musculus 10 days neonate skin cDNA, RIKE...    69   8e-11   
gb:CR456397_1992688 Homo sapiens bK175E3.6 full length open read...    68   2e-10   
gb:BC021570_1977511 Homo sapiens zinc and ring finger 3, mRNA (c...    68   2e-10   
gb:AB051436_1867948 Homo sapiens mRNA for KIAA1133 protein, part...    68   2e-10   
gb:AL662853_2072251 Mouse DNA sequence from clone RP23-293J16 on...    67   3e-10   
pir|T06113|T06113 hypothetical protein T5J17.240 - Arabidopsis t...    67   4e-10   Arabidopsis thaliana [mouse-ear cress]
pir|H85474|H85474 hypothetical protein AT4g40070 [imported] - Ar...    67   4e-10   Arabidopsis thaliana [mouse-ear cress]
sp|Q90972|RN13_CHICK|RN13_CHICK RING finger protein 13 (C-RZF).>gb:GGRINGZN...    67   4e-10   Gallus gallus [bantam]
gb:BC065620_2554066 Danio rerio zgc:55660, mRNA (cDNA clone MGC:...    67   5e-10   
gb:BC044449_2548755 Danio rerio zgc:55660, mRNA (cDNA clone MGC:...    67   5e-10   
gb:CR749257_1180888 Homo sapiens mRNA; cDNA DKFZp781H02126 (from...    66   6e-10   
gb:CR627423_1180792 Homo sapiens mRNA; cDNA DKFZp781H0392 (from ...    66   6e-10   
gb:AK000322_1907832 Homo sapiens cDNA FLJ20315 fis, clone HEP07873.    66   8e-10   
gb:OSJN00048_1693847 Oryza sativa genomic DNA, chromosome 4, BAC...    66   8e-10   
gb:AX961982_1484483 Sequence 5 from Patent WO03104275.>gb:AB0818...    66   8e-10   
sp|O43567|RN13_HUMAN|RN13_HUMAN RING finger protein 13.>gb:CR858160_1182347...    66   8e-10   Homo sapiens [man]
sp|Q9WTV7|RN12_MOUSE|RN12_MOUSE RING finger protein 12 (LIM domain interact...    66   8e-10   Mus musculus [mouse]
gb:BC081881_2108127 Rattus norvegicus cDNA clone MGC:93748 IMAGE...    65   1e-09   
gb:BC058182_2103089 Mus musculus ring finger protein 13, mRNA (c...    65   1e-09   
gb:AL807825_2073073 Mouse DNA sequence from clone RP23-453B22 on...    65   1e-09   
gb:AK002414_1151184 Mus musculus adult male kidney cDNA, RIKEN f...    65   1e-09   
sp|O54965|RN13_MOUSE|RN13_MOUSE RING finger protein 13.>gb:AF037205_2051841...    65   1e-09   Mus musculus [mouse]
gb:AL161792_1922220 Human DNA sequence from clone RP11-84P7 on c...    65   1e-09   
gb:AL161792_1922219 Human DNA sequence from clone RP11-84P7 on c...    65   1e-09   
gb:AL161792_1922218 Human DNA sequence from clone RP11-84P7 on c...    65   1e-09   
gb:AK024996_1910206 Homo sapiens cDNA: FLJ21343 fis, clone COL02...    65   1e-09   
gb:AF394047_1900586 Homo sapiens RING finger protein 38 (RNF38) ...    65   1e-09   
gb:AP000836_1820660 Oryza sativa (japonica cultivar-group) genom...    65   1e-09   
gb:AC073395_1541019 Arabidopsis thaliana chromosome 3 BAC F11B9 ...    65   1e-09   
gb:HSM801785_1186449 Homo sapiens mRNA; cDNA DKFZp434A0926 (from...    65   1e-09   
gb:BC012960_2091675 Mus musculus ring finger protein 12, mRNA (c...    65   2e-09   
gb:AP003104_1824709 Oryza sativa (japonica cultivar-group) genom...    65   2e-09   
gb:CR382132_1665163 Yarrowia lipolytica chromosome F of strain C...    65   2e-09   
gb:AY647238_1619867 Zea mays unknown mRNA.                             65   2e-09   
gb:AK029295_1161422 Mus musculus 0 day neonate head cDNA, RIKEN ...    65   2e-09   
gb:AK013207_1157388 Mus musculus 10, 11 days embryo whole body c...    65   2e-09   
gb:BC083548_2108634 Rattus norvegicus ring finger protein 38, mR...    64   2e-09   
gb:BC060730_2104173 Mus musculus ring finger protein 38, mRNA (c...    64   2e-09   
gb:HSA271670_2001866 Homo sapiens Rnf12 gene for RING zinc finge...    64   2e-09   
gb:AL513007_1928657 Human DNA sequence from clone CTD-2530H13 on...    64   2e-09   
gb:AF155109_1886621 Homo sapiens putative ring zinc finger prote...    64   2e-09   
gb:AB033040_1866220 Homo sapiens mRNA for KIAA1214 protein, part...    64   2e-09   
gb:AP003722_1832391 Oryza sativa (japonica cultivar-group) genom...    64   2e-09   
gb:AY099807_1576832 Arabidopsis thaliana putative protein (At4g2...    64   2e-09   
gb:AX876522_1476570 Sequence 11427 from Patent EP1074617.>gb:AK0...    64   2e-09   
gb:AK029650_1161590 Mus musculus adult male testis cDNA, RIKEN f...    64   2e-09   
pir|T05064|T05064 hypothetical protein M3E9.170 - Arabidopsis th...    64   2e-09   Arabidopsis thaliana [mouse-ear cress]
sp|Q9NVW2|RN12_HUMAN|RN12_HUMAN RING finger protein 12 (LIM domain interact...    64   2e-09   Homo sapiens [man]
gb:BC080893_2561808 Xenopus tropicalis rnf13-prov protein, mRNA ...    64   4e-09   
gb:BC080409_2561709 Xenopus laevis MGC86297 protein, mRNA (cDNA ...    64   4e-09   
gb:BC063734_2553587 Xenopus laevis hypothetical protein MGC68556...    64   4e-09   
gb:AP003218_1825423 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
gb:BC082339_2562576 Xenopus laevis XRnf12 protein, mRNA (cDNA cl...    63   5e-09   
gb:BC081009_2561919 Xenopus laevis MGC81562 protein, mRNA (cDNA ...    63   5e-09   
gb:AF329847_2487920 Xenopus laevis ring finger-H2 protein (arkad...    63   5e-09   
gb:AB114039_2465683 Xenopus laevis XRnf12 mRNA for XRnf12, compl...    63   5e-09   
gb:AF480444_2066797 Rattus norvegicus RING finger protein OIP1 (...    63   5e-09   
gb:BC069019_1987750 Homo sapiens zinc and ring finger 3, mRNA (c...    63   5e-09   
gb:AK127467_1916760 Homo sapiens cDNA FLJ45559 fis, clone BRTHA3...    63   5e-09   
gb:AF532623_1809425 Glycine max RING-H2 finger protein mRNA, com...    63   5e-09   
gb:AB114041_2465685 Xenopus laevis XRnf12C mRNA for XRnf12C, com...    63   7e-09   
gb:AB114040_2465684 Xenopus laevis XRnf12B mRNA for XRnf12B, com...    63   7e-09   
gb:AY190520_2078838 Rattus norvegicus Sprague-Dawley liver r-gol...    63   7e-09   
gb:AL627187_2071579 Mouse DNA sequence from clone RP23-319B15 on...    63   7e-09   
gb:AL627187_2071578 Mouse DNA sequence from clone RP23-319B15 on...    63   7e-09   
gb:AP005295_1850046 Oryza sativa (japonica cultivar-group) genom...    63   7e-09   
gb:AP005114_1848115 Oryza sativa (japonica cultivar-group) genom...    63   7e-09   
gb:AC124142_1740408 Oryza sativa (japonica cultivar-group) chrom...    63   7e-09   
gb:AE014297_1138680 Drosophila melanogaster chromosome 3R, compl...    63   7e-09   
gb:AE014297_1138678 Drosophila melanogaster chromosome 3R, compl...    63   7e-09   
gb:BC065244_1986777 Homo sapiens ring finger protein 130, mRNA (...    62   9e-09   
gb:BC017100_1975908 Homo sapiens ring finger protein 130, mRNA (...    62   9e-09   
gb:AF155650_1886659 Human mRNA for goliath protein.                    62   9e-09   
gb:BT020585_1642979 Arabidopsis thaliana At5g45290 gene, complet...    62   9e-09   
gb:AY069873_1566619 Arabidopsis thaliana AT5g45290/K9E15_7 mRNA,...    62   9e-09   
gb:AB045121_1520333 Oryza sativa (japonica cultivar-group) RRF1 ...    62   9e-09   
gb:AB009049_1510600 Arabidopsis thaliana genomic DNA, chromosome...    62   9e-09   
gb:AX083330_1460809 Sequence 22 from Patent WO0112660.>gb:AY0839...    62   9e-09   
gb:AK029824_1161676 Mus musculus adult male testis cDNA, RIKEN f...    62   9e-09   
pir|T45599|T45599 hypothetical protein F12A12.140 - Arabidopsis ...    62   9e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AB095109_1198993 Ciona intestinalis CiGl mRNA, complete cds.        62   1e-08   
gb:AE016959_1022769 Oryza sativa (japonica cultivar-group) chrom...    62   1e-08   
gb:AF171875_2057708 Mus musculus g1-related zinc finger protein ...    62   2e-08   
gb:HSM806331_2018289 Homo sapiens mRNA; cDNA DKFZp686H1966 (from...    62   2e-08   
gb:AP005511_1853145 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:AP001080_1820758 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:AK117391_1815429 Arabidopsis thaliana At3g47990 mRNA for unkn...    62   2e-08   
gb:HSM801486_1186198 Homo sapiens mRNA; cDNA DKFZp434F0721 (from...    62   2e-08   
gb:CR749238_1180869 Homo sapiens mRNA; cDNA DKFZp686P0776 (from ...    62   2e-08   
gb:AE013599_1133914 Drosophila melanogaster chromosome 2R, compl...    62   2e-08   
gb:AE013599_1133913 Drosophila melanogaster chromosome 2R, compl...    62   2e-08   
gb:AE016959_1023878 Oryza sativa (japonica cultivar-group) chrom...    62   2e-08   
pir|T43459|T43459 hypothetical protein DKFZp434F0721.1 - human (...    62   2e-08   Homo sapiens [man]
pir|T06684|T06684 hypothetical protein T17F15.140 - Arabidopsis ...    62   2e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q9Y252|RNF6_HUMAN|RNF6_HUMAN RING finger protein 6 (RING-H2 protein).>gb...    62   2e-08   Homo sapiens [man]
sp|Q06003|GOLI_DROME|GOLI_DROME Goliath protein (G1 protein).>pir|JC1495|JC...    62   2e-08   Drosophila melanogaster
gb:AF329846_2487919 Gallus gallus ring finger protein (arkadia) ...    61   2e-08   
gb:AF069993_2471579 Gallus gallus LIM domain interacting RING fi...    61   2e-08   
gb:BC069835_2106126 Mus musculus ring finger 111, mRNA (cDNA clo...    61   2e-08   
gb:BC060862_1985760 Homo sapiens ring finger protein 111, mRNA (...    61   2e-08   
gb:AK130520_1917626 Homo sapiens cDNA FLJ27010 fis, clone SLV05175.    61   2e-08   
gb:AX405832_1467760 Sequence 247 from Patent WO0222660.                61   2e-08   
gb:HSM802460_1186708 Homo sapiens mRNA; cDNA DKFZp761D081 (from ...    61   2e-08   
gb:CR861381_1185379 Pongo pygmaeus mRNA; cDNA DKFZp459A112 (from...    61   2e-08   
gb:AK048110_1168293 Mus musculus 16 days embryo head cDNA, RIKEN...    61   2e-08   
gb:AK036351_1164439 Mus musculus 16 days neonate cerebellum cDNA...    61   2e-08   
pir|T46904|T46904 hypothetical protein DKFZp761D081.1 - human>gb...    61   2e-08   Homo sapiens [man]
pir|E85092|E85092 hypothetical protein AT4g09130 [imported] - Ar...    61   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC070603_2555582 Xenopus laevis cDNA clone MGC:81253 IMAGE:66...    61   3e-08   
gb:BC054842_2101871 Mus musculus ring finger 111, mRNA (cDNA clo...    61   3e-08   
gb:AY039004_2074365 Mus musculus RNF6 protein mRNA, complete cds.      61   3e-08   
gb:AF330197_2063382 Mus musculus Arkadia (Arkadia) mRNA, complet...    61   3e-08   
gb:BC020984_1977329 Homo sapiens ring finger protein 111, mRNA (...    61   3e-08   
gb:AK131488_1918022 Homo sapiens cDNA FLJ16671 fis, clone THYMU3...    61   3e-08   
gb:AK131304_1917860 Homo sapiens cDNA FLJ16278 fis, clone NT2RI3...    61   3e-08   
gb:AK095327_1914343 Homo sapiens cDNA FLJ38008 fis, clone CTONG2...    61   3e-08   
gb:AC105773_1738245 Oryza sativa (japonica cultivar-group) chrom...    61   3e-08   
gb:AY052711_1562871 Arabidopsis thaliana AT5g59550/f2o15_210 mRN...    61   3e-08   
gb:AB025604_1516269 Arabidopsis thaliana genomic DNA, chromosome...    61   3e-08   
gb:CNS07EGB_1373131 chromosome IV of strain GB-M1 of Encephalito...    61   3e-08   
gb:AK004745_1152558 Mus musculus adult male lung cDNA, RIKEN ful...    61   3e-08   
pir|T00481|T00481 probable RING zinc finger protein [imported] -...    61   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AC136217_1743023 Oryza sativa (japonica cultivar-group) chrom...    60   4e-08   
gb:AC135594_1742644 Oryza sativa chromosome 3 BAC OSJNBa0024F18 ...    60   4e-08   
gb:AC109596_1738739 Oryza sativa (japonica cultivar-group) chrom...    60   4e-08   
gb:AY086415_1571463 Arabidopsis thaliana clone 250127 mRNA, comp...    60   4e-08   
gb:CEY47D3B_1370192 Caenorhabditis elegans YAC Y47D3B, complete ...    60   4e-08   
gb:AE005172_891555 Arabidopsis thaliana chromosome 1, top arm co...    60   4e-08   
pir|T26958|T26958 hypothetical protein Y47D3B.11 - Caenorhabditi...    60   4e-08   Caenorhabditis elegans [roundworm]
pir|T19377|T19377 hypothetical protein C18B12.4 - Caenorhabditis...    60   4e-08   Caenorhabditis elegans [roundworm]
pir|T47692|T47692 hypothetical protein T22E16.190 - Arabidopsis ...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP005399_1851144 Oryza sativa (japonica cultivar-group) genom...    60   5e-08   
gb:AP004071_1837265 Oryza sativa (japonica cultivar-group) genom...    60   5e-08   
gb:AP000603_1820397 Arabidopsis thaliana genomic DNA, chromosome...    60   5e-08   
gb:BT010726_1640672 Arabidopsis thaliana At3g13430 mRNA, complet...    60   5e-08   
gb:BT010323_1640270 Arabidopsis thaliana At1g23980 mRNA, complet...    60   5e-08   
gb:AB045120_1520332 Oryza sativa (japonica cultivar-group) EL5 m...    60   5e-08   
gb:AE005172_891351 Arabidopsis thaliana chromosome 1, top arm co...    60   5e-08   
gb:BC056113_2551695 Xenopus laevis hypothetical protein MGC69137...    60   6e-08   
gb:AP005511_1853144 Oryza sativa (japonica cultivar-group) genom...    60   6e-08   
gb:AP004800_1845299 Oryza sativa (japonica cultivar-group) genom...    60   6e-08   
gb:AP004082_1837425 Oryza sativa (japonica cultivar-group) genom...    60   6e-08   
gb:AC136999_1743328 Oryza sativa (japonica cultivar-group) chrom...    60   6e-08   
gb:CR859911_1184012 Pongo pygmaeus mRNA; cDNA DKFZp469I142 (from...    60   6e-08   
pir|B84584|B84584 probable RING zinc finger protein [imported] -...    60   6e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC017630_2092524 Mus musculus ring finger protein 44, mRNA (c...    59   8e-08   
gb:AK129290_2069521 Mus musculus mRNA for mKIAA1100 protein.           59   8e-08   
gb:AB016984_2043938 Mus musculus mRNA for Sperizin, complete cds.      59   8e-08   
gb:BC039833_1982645 Homo sapiens ring finger protein 44, mRNA (c...    59   8e-08   
gb:AB029023_1865879 Homo sapiens mRNA for KIAA1100 protein, part...    59   8e-08   
gb:AP005775_1857666 Oryza sativa (japonica cultivar-group) genom...    59   8e-08   
gb:AP005522_1853405 Oryza sativa (japonica cultivar-group) genom...    59   8e-08   
gb:AP003104_1824714 Oryza sativa (japonica cultivar-group) genom...    59   8e-08   
gb:AP003104_1824708 Oryza sativa (japonica cultivar-group) genom...    59   8e-08   
gb:AB010699_1511248 Arabidopsis thaliana genomic DNA, chromosome...    59   8e-08   
gb:BT015305_1358382 Drosophila melanogaster AT15166 full insert ...    59   8e-08   
gb:HSM805597_1187613 Homo sapiens mRNA; cDNA DKFZp434F1431 (from...    59   8e-08   
gb:AE014297_1139070 Drosophila melanogaster chromosome 3R, compl...    59   8e-08   
pir|T39476|T39476 probable serine-rich zinc-finger protein - fis...    59   8e-08   Schizosaccharomyces pombe
pir|D84899|D84899 hypothetical protein At2g46160 [imported] - Ar...    59   8e-08   Arabidopsis thaliana [mouse-ear cress]
pir|G96528|G96528 protein F27J15.2 [imported] - Arabidopsis thal...    59   8e-08   Arabidopsis thaliana [mouse-ear cress]
pir|F86458|F86458 unknown protein, 73879-71181 [imported] - Arab...    59   8e-08   Arabidopsis thaliana [mouse-ear cress]
gb:HSM805319_2017870 Homo sapiens mRNA; cDNA DKFZp566H073 (from ...    59   1e-07   
gb:HSM800147_2017112 Homo sapiens mRNA; cDNA DKFZp566H073 (from ...    59   1e-07   
gb:AK025329_1910269 Homo sapiens cDNA: FLJ21676 fis, clone COL09...    59   1e-07   
gb:AP006067_1860833 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AP004048_1836914 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AK118283_1816270 Arabidopsis thaliana At3g19950 mRNA for unkn...    59   1e-07   
gb:AF499720_1806143 Thellungiella halophila putative RING zinc f...    59   1e-07   
gb:OSJN00098_1694868 Oryza sativa genomic DNA, chromosome 4, BAC...    59   1e-07   
gb:AY095995_1575869 Arabidopsis thaliana AT3g19950/MPN9_19 mRNA,...    59   1e-07   
gb:AB025631_1516571 Arabidopsis thaliana genomic DNA, chromosome...    59   1e-07   
gb:AY203930_1176298 Homo sapiens LP2254 mRNA, complete cds.            59   1e-07   
pir|T08729|T08729 RING zinc finger protein homolog DKFZp566H073....    59   1e-07   Homo sapiens [man]
gb:AY533211_2086313 Chinchilla lanigera goliath protein mRNA, pa...    59   1e-07   
gb:AL596117_2070852 Mouse DNA sequence from clone RP23-326P7 on ...    59   1e-07   
gb:AP004213_1838879 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:OSJN00057_1694040 Oryza sativa genomic DNA, chromosome 4, BAC...    59   1e-07   
pir|T51842|T51842 RING-H2 finger protein RHA2a [imported] - Arab...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC083670_2108745 Rattus norvegicus similar to RIKEN cDNA 5730...    58   2e-07   
gb:AP004096_1837667 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:AP003104_1824710 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:BT005844_1638766 Arabidopsis thaliana At4g24010 gene, complet...    58   2e-07   
gb:AY039551_1560264 Arabidopsis thaliana At1g49200/F27J15_35 mRN...    58   2e-07   
pir|T51844|T51844 RING-H2 finger protein RHA3a [imported] - Arab...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|H84566|H84566 probable RING zinc finger protein [imported] -...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|F85097|F85097 hypothetical protein AT4g09560 [imported] - Ar...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|C86358|C86358 Similar to zinc finger protein [imported] - Ar...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC079249_2107374 Rattus norvegicus cDNA clone MGC:94340 IMAGE...    58   2e-07   
gb:AY155441_2076913 Mus musculus goliath-related E3 ubiquitin li...    58   2e-07   
gb:AP004888_1846658 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:AP004564_1841652 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:AF474072_1803110 Hordeum vulgare sp. vulgare cultivar Morex B...    58   2e-07   
gb:SPAP32A8_1718596 S.pombe chromosome I p1 p32A8.                     58   2e-07   
gb:AB026654_1517308 Arabidopsis thaliana genomic DNA, chromosome...    58   2e-07   
gb:AK028082_1160781 Mus musculus adult male testis cDNA, RIKEN f...    58   2e-07   
gb:AE016959_1023658 Oryza sativa (japonica cultivar-group) chrom...    58   2e-07   
pir|T41745|T41745 RING-H2 finger protein RHA3b [imported] - Arab...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC067341_2554700 Danio rerio zgc:77843, mRNA (cDNA clone MGC:...    57   3e-07   
gb:AP005723_1856573 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:AP005511_1853146 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:AP004762_1844616 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:AP003633_1831821 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:AC152974_1745244 Oryza sativa (japonica cultivar-group) chrom...    57   3e-07   
gb:AC134348_1741773 Oryza sativa (japonica cultivar-group) chrom...    57   3e-07   
gb:OSJN00157_1695846 Oryza sativa genomic DNA, chromosome 4, BAC...    57   3e-07   
gb:BT010932_1640878 Arabidopsis thaliana At1g49210 gene, complet...    57   3e-07   
gb:AY054187_1563009 Arabidopsis thaliana AT4g30400/F17I23_260 mR...    57   3e-07   
gb:AC073556_1541133 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...    57   3e-07   
gb:AB010697_1511206 Arabidopsis thaliana genomic DNA, chromosome...    57   3e-07   
gb:AK005843_1153258 Mus musculus adult male testis cDNA, RIKEN f...    57   3e-07   
gb:AE005173_892860 Arabidopsis thaliana chromosome 1, bottom arm...    57   3e-07   
pir|G86275|G86275 F7A19.29 protein - Arabidopsis thaliana>gb:AE0...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
pir|E85355|E85355 hypothetical protein AT4g30400 [imported] - Ar...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP005511_1853134 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:AP005425_1851637 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:AP003722_1832388 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:AF211532_1777392 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    57   4e-07   
gb:AC097175_1736469 Oryza sativa (japonica cultivar-group) chrom...    57   4e-07   
gb:NCB24P11_1689926 Neurospora crassa DNA linkage group II BAC c...    57   4e-07   
gb:BT020620_1643014 Arabidopsis thaliana At5g05810 gene, complet...    57   4e-07   
gb:AB023482_1515599 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:AB018118_1513882 Arabidopsis thaliana genomic DNA, chromosome...    57   4e-07   
gb:AB015472_1512531 Arabidopsis thaliana genomic DNA, chromosome...    57   4e-07   
gb:AB005237_1509417 Arabidopsis thaliana genomic DNA, chromosome...    57   4e-07   
pir|F96597|F96597 hypothetical protein T5A14.7 [imported] - Arab...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC070590_2555569 Xenopus laevis hypothetical protein MGC81168...    57   5e-07   
gb:AP005883_1859630 Oryza sativa (japonica cultivar-group) genom...    57   5e-07   
gb:AP004654_1842740 Oryza sativa (japonica cultivar-group) genom...    57   5e-07   
gb:AP003268_1826810 Oryza sativa (japonica cultivar-group) genom...    57   5e-07   
gb:AF499727_1806156 Cucumis melo BAC clone PIT92-60K17, complete...    57   5e-07   
gb:AE017345_1756926 Cryptococcus neoformans var. neoformans JEC2...    57   5e-07   
gb:OSJN00182_1696321 Oryza sativa genomic DNA, chromosome 4, BAC...    57   5e-07   
gb:BT015731_1642349 Arabidopsis thaliana At4g28890 mRNA, complet...    57   5e-07   
gb:AB026654_1517307 Arabidopsis thaliana genomic DNA, chromosome...    57   5e-07   
gb:AB022220_1515142 Arabidopsis thaliana genomic DNA, chromosome...    57   5e-07   
gb:AB011474_1511351 Arabidopsis thaliana genomic DNA, chromosome...    57   5e-07   
gb:CQ834134_1453733 Sequence 5 from Patent WO2004058805.>gb:AF41...    57   5e-07   
pir|T26069|T26069 hypothetical protein W02A11.3 - Caenorhabditis...    57   5e-07   Caenorhabditis elegans [roundworm]
pir|T33407|T33407 hypothetical protein H10E21.5 - Caenorhabditis...    57   5e-07   Caenorhabditis elegans [roundworm]
pir|T08944|T08944 hypothetical protein F25O24.10 - Arabidopsis t...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
pir|F86340|F86340 protein F2D10.34 [imported] - Arabidopsis thal...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
sp|Q9Y4L5|Z364_HUMAN|Z364_HUMAN Zinc finger protein 364 (Fragment).>gb:HST0...    57   5e-07   Homo sapiens [man]
gb:AY155440_2076912 Mus musculus goliath-related E3 ubiquitin li...    56   7e-07   
gb:BC017592_1976183 Homo sapiens zinc and ring finger 4, mRNA (c...    56   7e-07   
gb:AC005764_1875038 Homo sapiens chromosome 19, cosmid R31343, c...    56   7e-07   
gb:AP003221_1825506 Oryza sativa (japonica cultivar-group) genom...    56   7e-07   
gb:AC121489_1740227 Oryza sativa (japonica cultivar-group) chrom...    56   7e-07   
gb:OSJN00062_1694166 Oryza sativa genomic DNA, chromosome 4, BAC...    56   7e-07   
gb:OSJN00044_1693790 Oryza sativa genomic DNA, chromosome 4, BAC...    56   7e-07   
gb:BT014952_1641922 Arabidopsis thaliana At1g24580 gene, complet...    56   7e-07   
gb:AY054245_1563065 Arabidopsis thaliana AT4g17240/dl4655c mRNA,...    56   7e-07   
gb:CR382398_1374901 Plasmodium falciparum chromosome 6, complete...    56   7e-07   
gb:AK017027_1158995 Mus musculus adult male testis cDNA, RIKEN f...    56   7e-07   
pir|T18836|T18836 hypothetical protein C01G6.4 - Caenorhabditis ...    56   7e-07   
pir|T48209|T48209 hypothetical protein T20L15.150 - Arabidopsis ...    56   7e-07   
pir|T51843|T51843 RING-H2 finger protein RHA2b [imported] - Arab...    56   7e-07   
pir|E84455|E84455 probable RING zinc finger protein [imported] -...    56   7e-07   
pir|C84421|C84421 probable RING-H2 finger protein RHA2b [importe...    56   7e-07   
pir|C96775|C96775 probable RING zinc finger protein F1M20.30 [im...    56   7e-07   
pir|D86379|D86379 protein F21J9.24 [imported] - Arabidopsis thal...    56   7e-07   
gb:AP004809_1845434 Oryza sativa (japonica cultivar-group) genom...    56   9e-07   
gb:AP004118_1837832 Oryza sativa (japonica cultivar-group) genom...    56   9e-07   
gb:AP003984_1835933 Oryza sativa (japonica cultivar-group) genom...    56   9e-07   
gb:AP003813_1833720 Oryza sativa (japonica cultivar-group) genom...    56   9e-07   
gb:AP003508_1830071 Oryza sativa (japonica cultivar-group) genom...    56   9e-07   
gb:AF132016_1770849 Arabidopsis thaliana RING-H2 zinc finger pro...    56   9e-07   
gb:AF079183_1766305 Arabidopsis thaliana RING-H2 finger protein ...    56   9e-07   
gb:CR382132_1665814 Yarrowia lipolytica chromosome F of strain C...    56   9e-07   
gb:CR380957_1652624 Candida glabrata strain CBS138 chromosome K ...    56   9e-07   
gb:BT015918_1642536 Arabidopsis thaliana At5g10650 gene, complet...    56   9e-07   
gb:AY099680_1576705 Arabidopsis thaliana Pspzf zinc finger prote...    56   9e-07   
gb:AY080617_1568361 Arabidopsis thaliana putative RING-H2 zinc f...    56   9e-07   
gb:ATMAJ23_1553714 Arabidopsis thaliana DNA chromosome 5, P1 clo...    56   9e-07   
gb:ATAC009177_1542858 Arabidopsis thaliana chromosome III BAC T1...    56   9e-07   
gb:BX538350_1358784 Cryptosporidium parvum chromosome 6, complet...    56   9e-07   
pir|T04066|T04066 hypothetical protein F28M11.80 - Arabidopsis t...    56   9e-07   
pir|T51859|T51859 RING-H2 finger protein RHG1a [imported] - Arab...    56   9e-07   
gb:BC073002_2556917 Xenopus laevis MGC82583 protein, mRNA (cDNA ...    55   1e-06   
gb:AP005823_1858490 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP004704_1843704 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP004159_1838372 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP003912_1835100 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP002521_1822305 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AC152974_1745239 Oryza sativa (japonica cultivar-group) chrom...    55   1e-06   
gb:AC144737_1744138 Oryza sativa (japonica cultivar-group) chrom...    55   1e-06   
gb:OSJN00270_1697704 Oryza sativa genomic DNA, chromosome 4, BAC...    55   1e-06   
gb:BT010696_1640642 Arabidopsis thaliana At1g68180 mRNA, complet...    55   1e-06   
gb:AY579411_1616020 Oryza sativa (japonica cultivar-group) RING/...    55   1e-06   
gb:AY136427_1581928 Arabidopsis thaliana RING finger-like protei...    55   1e-06   
gb:AY090933_1574210 Arabidopsis thaliana putative RING zinc fing...    55   1e-06   
gb:ATAC009895_1543067 Arabidopsis thaliana chromosome III BAC T2...    55   1e-06   
gb:ATAC009327_1542949 Arabidopsis thaliana chromosome III BAC T1...    55   1e-06   
pir|T05077|T05077 hypothetical protein T6K21.90 - Arabidopsis th...    55   1e-06   
pir|T06680|T06680 hypothetical protein T17F15.100 - Arabidopsis ...    55   1e-06   
pir|T47947|T47947 hypothetical protein F2A19.150 - Arabidopsis t...    55   1e-06   
pir|T04065|T04065 hypothetical protein F28M11.70 - Arabidopsis t...    55   1e-06   
pir|E84774|E84774 probable RING zinc finger protein [imported] -...    55   1e-06   
pir|B96705|B96705 unknown protein, 88740-88303 [imported] - Arab...    55   1e-06   
pir|T00428|T00428 hypothetical protein At2g47560 [imported] - Ar...    55   1e-06   
gb:BC050161_2550341 Danio rerio zgc:56424, mRNA (cDNA clone MGC:...    55   1e-06   
gb:AY155439_2076911 Mus musculus goliath-related E3 ubiquitin li...    55   1e-06   
gb:AB070058_1870929 Macaca fascicularis testis cDNA clone:QtsA-1...    55   1e-06   
gb:AP005723_1856570 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP004818_1845652 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP004809_1845435 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP004339_1840432 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP003771_1833365 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP002842_1823059 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AF391808_1795340 Zea mays chromosome 9S bz genomic region str...    55   1e-06   
gb:AC124144_1740447 Oryza sativa (japonica cultivar-group) chrom...    55   1e-06   
gb:AC105259_1737874 Oryza sativa (japonica cultivar-group) chrom...    55   1e-06   
gb:AC084766_1733776 Oryza sativa chromosome 3 BAC OSJNBb0048D20 ...    55   1e-06   
gb:OSJN00128_1695355 Oryza sativa genomic DNA, chromosome 4, BAC...    55   1e-06   
gb:AY664416_1620638 Zea mays cultivar Mo17 locus bz, complete se...    55   1e-06   
gb:AY081329_1568675 Arabidopsis thaliana ABI3-interacting protei...    55   1e-06   
gb:ATAC011708_1543384 Arabidopsis thaliana chromosome III BAC T7...    55   1e-06   
gb:AB025638_1516671 Arabidopsis thaliana genomic DNA, chromosome...    55   1e-06   
pir|B84443|B84443 hypothetical protein At2g03000 [imported] - Ar...    55   1e-06   
gb:BC032328_1980402 Homo sapiens ring finger protein 149, mRNA (...    55   2e-06   
gb:AK098524_1915128 Homo sapiens cDNA FLJ25658 fis, clone TST00370.    55   2e-06   
gb:AC006463_1875153 Homo sapiens BAC clone RP11-395G17 from 7, c...    55   2e-06   
gb:AB070023_1870894 Macaca fascicularis testis cDNA clone:QtsA-1...    55   2e-06   
gb:AP003514_1830218 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:AE017345_1757017 Cryptococcus neoformans var. neoformans JEC2...    55   2e-06   
gb:AC099323_1737045 Oryza sativa chromosome 3 BAC OSJNBa0065F09 ...    55   2e-06   
gb:BT004268_1637347 Arabidopsis thaliana clone RAFL15-29-G07 (R5...    55   2e-06   
gb:AY081260_1568606 Arabidopsis thaliana unknown protein mRNA, c...    55   2e-06   
gb:AB025628_1516517 Arabidopsis thaliana genomic DNA, chromosome...    55   2e-06   
gb:AB008264_1510380 Arabidopsis thaliana genomic DNA, chromosome...    55   2e-06   
gb:CQ783204_1452350 Sequence 3344 from Patent EP1396543.>gb:AK07...    55   2e-06   
gb:CQ782963_1452235 Sequence 3103 from Patent EP1396543.>gb:AX08...    55   2e-06   
gb:PFMAL3P5_1394519 Plasmodium falciparum MAL3P5, complete seque...    55   2e-06   
pir|T04483|T04483 probable ring finger protein - barley>gb:HVCH4...    55   2e-06   
pir|D85092|D85092 hypothetical protein AT4g09120 [imported] - Ar...    55   2e-06   
pir|E96745|E96745 hypothetical protein T9N14.11 [imported] - Ara...    55   2e-06   
gb:BC087570_2565387 Xenopus tropicalis cDNA clone MGC:97679 IMAG...    54   3e-06   
gb:BC029264_1979439 Homo sapiens ring finger protein 148, mRNA (...    54   3e-06   
gb:AP004818_1845645 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AP004818_1845639 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AP004809_1845437 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AP004587_1841965 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AP003104_1824705 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AF436851_1799891 Cucumis melo RING-H2 zinc finger protein mRN...    54   3e-06   
gb:AF417491_1798287 Medicago sativa RING-H2 protein (RH2-1) gene...    54   3e-06   
gb:AC084762_1733688 Oryza sativa chromosome 3 BAC OSJNBa0013O08 ...    54   3e-06   
gb:OSJN00048_1693848 Oryza sativa genomic DNA, chromosome 4, BAC...    54   3e-06   
gb:CR382126_1659490 Kluyveromyces lactis strain NRRL Y-1140 chro...    54   3e-06   
gb:BT002300_1635903 Arabidopsis thaliana At4g31450/F3L17_20 mRNA...    54   3e-06   
gb:AY084453_1569543 Arabidopsis thaliana clone 108568 mRNA, comp...    54   3e-06   
gb:AB025631_1516567 Arabidopsis thaliana genomic DNA, chromosome...    54   3e-06   
gb:AX061659_1458692 Sequence 64 from Patent WO0100806.                 54   3e-06   
gb:AK008329_1154518 Mus musculus adult male small intestine cDNA...    54   3e-06   
gb:AE016959_1023177 Oryza sativa (japonica cultivar-group) chrom...    54   3e-06   
pir|H86477|H86477 protein F15O4.19 [imported] - Arabidopsis thal...    54   3e-06   
pir|D86474|D86474 probable RING zinc finger protein [imported] -...    54   3e-06   
pir|T10675|T10675 hypothetical protein F3L17.20 - Arabidopsis th...    54   3e-06   
sp|Q9D0C1|Z364_MOUSE|Z364_MOUSE Zinc finger protein 364.>gb:AK011584_115648...    54   3e-06   
gb:BC023113_2094037 Mus musculus zinc finger protein 364, mRNA (...    54   3e-06   
gb:AB041548_2045418 Mus musculus brain cDNA, clone MNCb-3816, si...    54   3e-06   
gb:BC056677_1985329 Homo sapiens ring finger protein 128, mRNA (...    54   3e-06   
gb:AK126553_1916357 Homo sapiens cDNA FLJ44589 fis, clone BEAST2...    54   3e-06   
gb:AK074264_1912441 Homo sapiens cDNA FLJ23684 fis, clone HEP098...    54   3e-06   
gb:AF394689_1900599 Homo sapiens GRAIL (GRAIL) mRNA, complete cds.     54   3e-06   
gb:AP005284_1849820 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AP004376_1840970 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:ATH251087_1552167 Arabidopsis thaliana mRNA for ABI3-interact...    54   3e-06   
gb:AB010692_1511100 Arabidopsis thaliana genomic DNA, chromosome...    54   3e-06   
gb:CR857287_1181531 Pongo pygmaeus mRNA; cDNA DKFZp469O2321 (fro...    54   3e-06   
gb:AK018582_1159635 Mus musculus adult male cecum cDNA, RIKEN fu...    54   3e-06   
gb:AK004847_1152639 Mus musculus adult male liver cDNA, RIKEN fu...    54   3e-06   
pir|T51464|T51464 RING-H2 zinc finger protein-like - Arabidopsis...    54   3e-06   
pir|T00480|T00480 probable RING zinc finger protein At2g34990 [i...    54   3e-06   
gb:AP006533_1862349 Oryza sativa (japonica cultivar-group) genom...    54   4e-06   
gb:AP005681_1855893 Oryza sativa (japonica cultivar-group) genom...    54   4e-06   
gb:AP004794_1845206 Oryza sativa (japonica cultivar-group) genom...    54   4e-06   
gb:OSJN00128_1695350 Oryza sativa genomic DNA, chromosome 4, BAC...    54   4e-06   
gb:BT010489_1640435 Arabidopsis thaliana At1g49230 gene, complet...    54   4e-06   
gb:AY780430_1628297 Populus alba x Populus tremula RING-H2 subgr...    54   4e-06   
gb:AY086760_1571803 Arabidopsis thaliana clone 27464 mRNA, compl...    54   4e-06   
gb:CNS07EGF_1373915 chromosome VIII of strain GB-M1 of Encephali...    54   4e-06   
pir|T05432|T05432 hypothetical protein F28A23.200 - Arabidopsis ...    54   4e-06   
pir|C85092|C85092 hypothetical protein AT4g09110 [imported] - Ar...    54   4e-06   
pir|G96791|G96791 probable RING zinc finger protein, 5217-5774 [...    54   4e-06   
gb:AP004794_1845209 Oryza sativa (japonica cultivar-group) genom...    53   6e-06   
gb:AP004299_1839761 Oryza sativa (japonica cultivar-group) genom...    53   6e-06   
gb:AP004299_1839760 Oryza sativa (japonica cultivar-group) genom...    53   6e-06   
gb:AF218808_1778209 Arabidopsis thaliana ReMembR-H2 protein JR70...    53   6e-06   
gb:AC084022_1733307 Oryza sativa chromosome 3 BAC OSJNBa0011H24 ...    53   6e-06   
gb:AY224527_1590724 Oryza sativa (japonica cultivar-group) isola...    53   6e-06   
gb:AY088181_1573203 Arabidopsis thaliana clone 426 mRNA, complet...    53   6e-06   
gb:AY065385_1566497 Arabidopsis thaliana unknown protein (At1g71...    53   6e-06   
gb:CNS07EGE_1373620 chromosome VII of strain GB-M1 of Encephalit...    53   6e-06   
gb:BT001518_1356291 Drosophila melanogaster LP11469 full insert ...    53   6e-06   
gb:AE014297_1140218 Drosophila melanogaster chromosome 3R, compl...    53   6e-06   
pir|T49155|T49155 hypothetical protein T20N10.70 - Arabidopsis t...    53   6e-06   
pir|T52407|T52407 RING-H2 zinc finger protein ATL4 [imported] - ...    53   6e-06   
pir|C84701|C84701 hypothetical protein At2g29840 [imported] - Ar...    53   6e-06   
pir|G96742|G96742 unknown protein F17M19.13 [imported] - Arabido...    53   6e-06   
gb:AP005399_1851151 Oryza sativa (japonica cultivar-group) genom...    53   7e-06   
gb:AP004777_1844928 Oryza sativa (japonica cultivar-group) genom...    53   7e-06   
gb:AP003771_1833362 Oryza sativa (japonica cultivar-group) genom...    53   7e-06   
gb:AP003270_1826865 Oryza sativa (japonica cultivar-group) genom...    53   7e-06   
gb:AK176482_1818470 Arabidopsis thaliana mRNA, complete cds, clo...    53   7e-06   
gb:AF079184_1766306 Arabidopsis thaliana RING-H2 finger protein ...    53   7e-06   
gb:AC091787_1735092 Oryza sativa (japonica cultivar-group) chrom...    53   7e-06   
gb:BT005552_1638492 Arabidopsis thaliana clone U50799 unknown pr...    53   7e-06   
gb:AY090932_1574209 Arabidopsis thaliana unknown protein (At3g18...    53   7e-06   
gb:AY088232_1573253 Arabidopsis thaliana clone 4581 mRNA, comple...    53   7e-06   
gb:AY084564_1569653 Arabidopsis thaliana clone 112003 mRNA, comp...    53   7e-06   
gb:AC004684_1532068 Arabidopsis thaliana chromosome 2 clone F13M...    53   7e-06   
gb:AB022217_1515076 Arabidopsis thaliana genomic DNA, chromosome...    53   7e-06   
pir|T49217|T49217 RING-H2 zinc finger protein ATL4 - Arabidopsis...    53   7e-06   
pir|T48296|T48296 hypothetical protein F9G14.60 - Arabidopsis th...    53   7e-06   
pir|T02524|T02524 probable RING zinc finger protein [imported] -...    53   7e-06   
pir|T51855|T51855 RING-H2 finger protein RHX1a [imported] - Arab...    53   7e-06   
pir|T52079|T52079 probable zinc finger protein [imported] - Arab...    53   7e-06   
pir|H96746|H96746 RING-H2 zinc finger protein (ATL3), 86824-8585...    53   7e-06   
pir|G96745|G96745 hypothetical protein T9N14.22 [imported] - Ara...    53   7e-06   
gb:AK098654_1915174 Homo sapiens cDNA FLJ25788 fis, clone TST06884.    52   1e-05   
gb:AP006067_1860837 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP005114_1848118 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP004687_1843386 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP003252_1826350 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AC134930_1741937 Oryza sativa (japonica cultivar-group) chrom...    52   1e-05   
gb:AY589087_1616542 Phytophthora brassicae Kazal-like serine pro...    52   1e-05   
gb:AY221983_1590566 Hevea brasiliensis putative C3HC4-type RING ...    52   1e-05   
gb:ATTEL3S_1556656 Arabidopsis thaliana DNA chromosome 3, segmen...    52   1e-05   
gb:AC006248_1533846 Arabidopsis thaliana chromosome 2 clone F9O1...    52   1e-05   
gb:AB011474_1511360 Arabidopsis thaliana genomic DNA, chromosome...    52   1e-05   
gb:AE016959_1023948 Oryza sativa (japonica cultivar-group) chrom...    52   1e-05   
pir|G84530|G84530 probable RING-H2 zinc finger protein [imported...    52   1e-05   
pir|G84678|G84678 probable RING zinc finger protein [imported] -...    52   1e-05   
gb:BC042684_1983307 Homo sapiens hypothetical protein FLJ31951, ...    52   1e-05   
gb:AK098802_1915223 Homo sapiens cDNA FLJ25936 fis, clone JTH07108.    52   1e-05   
gb:AK056513_1911751 Homo sapiens cDNA FLJ31951 fis, clone NT2RP7...    52   1e-05   
gb:AP004847_1845913 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AF448416_1800664 Zea mays B73 chromosome 9S bz genomic region.      52   1e-05   
gb:AE016820_1749875 Ashbya gossypii (= Eremothecium gossypii) AT...    52   1e-05   
gb:AC135207_1742048 Oryza sativa (japonica cultivar-group) chrom...    52   1e-05   
gb:AC084022_1733302 Oryza sativa chromosome 3 BAC OSJNBa0011H24 ...    52   1e-05   
gb:AC019018_1538508 Arabidopsis thaliana chromosome 1 BAC F14G24...    52   1e-05   
gb:AX213274_1464189 Sequence 4 from Patent WO0159117.                  52   1e-05   
gb:CQ783132_1452315 Sequence 3272 from Patent EP1396543.>gb:AK07...    52   1e-05   
gb:AK014094_1157779 Mus musculus 13 days embryo head cDNA, RIKEN...    52   1e-05   
pir|F71425|F71425 hypothetical protein - Arabidopsis thaliana>gb...    52   1e-05   
pir|E96663|E96663 probable RING zinc finger protein T12P18.14 [i...    52   1e-05   
sp|P29836|ICP0_BHV1K|ICP0_BHV1K Trans-acting transcriptional protein ICP0 (...    52   1e-05   
sp|P29128|ICP0_BHV1J|ICP0_BHV1J Trans-acting transcriptional protein ICP0 (...    52   1e-05   
gb:BC055485_2102077 Mus musculus RIKEN cDNA 3732413I11 gene, mRN...    52   2e-05   
gb:BC051064_2100605 Mus musculus RIKEN cDNA 3732413I11 gene, mRN...    52   2e-05   
gb:AL603913_2071232 Mouse DNA sequence from clone RP23-103H9 on ...    52   2e-05   
gb:AP005785_1857820 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AP003277_1827066 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AK176621_1818609 Arabidopsis thaliana mRNA for putative RING ...    52   2e-05   
gb:AC084296_1733466 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...    52   2e-05   
gb:AY139990_1582431 Arabidopsis thaliana putative RING zinc fing...    52   2e-05   
gb:AY084377_1569468 Arabidopsis thaliana clone 106078 mRNA, comp...    52   2e-05   
gb:ATAC011708_1543394 Arabidopsis thaliana chromosome III BAC T7...    52   2e-05   
gb:AK043002_1166477 Mus musculus 7 days neonate cerebellum cDNA,...    52   2e-05   
gb:AK014408_1157939 Mus musculus 12 days embryo embryonic body b...    52   2e-05   
pir|T50001|T50001 hypothetical protein F12B17.270 - Arabidopsis ...    52   2e-05   
pir|B84530|B84530 probable RING zinc finger protein [imported] -...    52   2e-05   
pir|B86175|B86175 protein F19P19.21 [imported] - Arabidopsis tha...    52   2e-05   
gb:BC067995_2554979 Xenopus tropicalis hypothetical protein MGC6...    51   2e-05   
gb:BC053118_2550512 Danio rerio ring finger protein 11, mRNA (cD...    51   2e-05   
gb:BC052901_2101347 Mus musculus ring finger protein 139, mRNA (...    51   2e-05   
gb:AP005511_1853139 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:AP005511_1853133 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:AP004818_1845654 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:AC105734_1738079 Oryza sativa (japonica cultivar-group) chrom...    51   2e-05   
gb:AC105734_1738078 Oryza sativa (japonica cultivar-group) chrom...    51   2e-05   


>gb:OSJN00203_1696651 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0032E06, complete sequence.
          Length = 324

 Score =  168 bits (425), Expect(2) = 3e-45
 Identities = 74/109 (67%), Positives = 87/109 (79%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           ++DI ++P+YKFRR  + EKQ  +    FGG+MTEC T+ PIE VL PEDAECCICL AY
Sbjct: 216 EDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVLAPEDAECCICLSAY 275

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
           DDG ELRELPC H FHCACIDKWL+INATCPLCKFNI K+ + S SE+V
Sbjct: 276 DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRKSGSSSGSEEV 324



 Score = 37.0 bits (84), Expect(2) = 3e-45
 Identities = 16/19 (84%), Positives = 19/19 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIAILYAV+DQEGA++
Sbjct: 198 LPCIIAILYAVSDQEGASE 216



>gb:AY224421_1590623 Oryza sativa (japonica cultivar-group) isolate
           20115 ring zinc finger protein-like protein mRNA,
           complete cds.
          Length = 250

 Score =  168 bits (425), Expect(2) = 3e-45
 Identities = 74/109 (67%), Positives = 87/109 (79%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           ++DI ++P+YKFRR  + EKQ  +    FGG+MTEC T+ PIE VL PEDAECCICL AY
Sbjct: 142 EDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVLAPEDAECCICLSAY 201

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
           DDG ELRELPC H FHCACIDKWL+INATCPLCKFNI K+ + S SE+V
Sbjct: 202 DDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRKSGSSSGSEEV 250



 Score = 37.0 bits (84), Expect(2) = 3e-45
 Identities = 16/19 (84%), Positives = 19/19 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIAILYAV+DQEGA++
Sbjct: 124 LPCIIAILYAVSDQEGASE 142



>gb:AE005172_890286 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC025417_1539511 Genomic sequence
           for Arabidopsis thaliana BAC T12C24 from chromosome I,
           complete sequence.>gb:AY136370_1581871 Arabidopsis
           thaliana unknown protein (At3g13380:At1g12760) mRNA,
           complete cds.>gb:BT000279_1634557 Arabidopsis thaliana
           unknown protein (At3g13380At1g12760) mRNA, complete cds.
          Length = 408

 Score =  165 bits (417), Expect(2) = 5e-45
 Identities = 74/108 (68%), Positives = 85/108 (78%), Gaps = 1/108 (0%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQ-NGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA 523
           KEDIE+L K+KFR+LGD  K  N E Q +  G+MTEC TDSPIEH L  EDAECCICL A
Sbjct: 300 KEDIEQLTKFKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSA 359

Query: 522 YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           Y+DG ELRELPC H FHC+C+DKWLYINATCPLCK+NI+K+ N    E
Sbjct: 360 YEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREE 407



 Score = 39.3 bits (90), Expect(2) = 5e-45
 Identities = 17/19 (89%), Positives = 19/19 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIA+LYAVADQEGA+K
Sbjct: 282 LPCIIAVLYAVADQEGASK 300



>gb:AP005885_1859667 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0657H12.
          Length = 399

 Score =  163 bits (412), Expect(2) = 9e-44
 Identities = 71/109 (65%), Positives = 86/109 (78%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           ++DI ++P+YKFRR+ + EKQ+  +  S GG+M EC T+ PIE VL  EDAECCICL AY
Sbjct: 291 EDDIRQIPRYKFRRMDEPEKQSVNMTGSSGGIMIECGTNQPIEKVLAAEDAECCICLSAY 350

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
           DDG ELRELPC H FHC CIDKWL+INATCPLCKFN+ KN + S SE+V
Sbjct: 351 DDGAELRELPCGHHFHCVCIDKWLHINATCPLCKFNVRKNSSSSGSEEV 399



 Score = 37.0 bits (84), Expect(2) = 9e-44
 Identities = 16/19 (84%), Positives = 19/19 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIAILYAV+DQEGA++
Sbjct: 273 LPCIIAILYAVSDQEGASE 291



>gb:AY086095_1571153 Arabidopsis thaliana clone 21249 mRNA, complete
           sequence.
          Length = 381

 Score =  162 bits (409), Expect(2) = 1e-43
 Identities = 71/112 (63%), Positives = 86/112 (76%), Gaps = 3/112 (2%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQES---FGGVMTECDTDSPIEHVLPPEDAECCICL 529
           KEDI++L K+KFR++GD  K   + ++     GGVMTEC TDSP+EH LP EDAECCICL
Sbjct: 270 KEDIDQLTKFKFRKVGDTMKHTVDEEQGEGDSGGVMTECGTDSPVEHALPHEDAECCICL 329

Query: 528 CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
            AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N    E+V
Sbjct: 330 SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGEEV 381



 Score = 37.7 bits (86), Expect(2) = 1e-43
 Identities = 16/19 (84%), Positives = 19/19 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIA+LYAVA+QEGA+K
Sbjct: 252 LPCIIAVLYAVAEQEGASK 270



>pir|C96657|C96657 hypothetical protein F16M19.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_893985 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010795_1537097 Arabidopsis thaliana
           chromosome 1 BAC F16M19 genomic sequence, complete
           sequence.
          Length = 381

 Score =  162 bits (409), Expect(2) = 1e-43
 Identities = 71/112 (63%), Positives = 86/112 (76%), Gaps = 3/112 (2%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQES---FGGVMTECDTDSPIEHVLPPEDAECCICL 529
           KEDI++L K+KFR++GD  K   + ++     GGVMTEC TDSP+EH LP EDAECCICL
Sbjct: 270 KEDIDQLTKFKFRKVGDTMKHTVDEEQGQGDSGGVMTECGTDSPVEHALPHEDAECCICL 329

Query: 528 CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
            AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+ N    E+V
Sbjct: 330 SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSNYEEGEEV 381



 Score = 37.7 bits (86), Expect(2) = 1e-43
 Identities = 16/19 (84%), Positives = 19/19 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIA+LYAVA+QEGA+K
Sbjct: 252 LPCIIAVLYAVAEQEGASK 270



>gb:AY058092_1564231 Arabidopsis thaliana At1g63170/F16M19_7 mRNA,
           complete cds.
          Length = 381

 Score =  157 bits (398), Expect(2) = 2e-42
 Identities = 69/112 (61%), Positives = 84/112 (75%), Gaps = 3/112 (2%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQES---FGGVMTECDTDSPIEHVLPPEDAECCICL 529
           KEDI++L K+KFR++GD  K   + ++     GGVMTEC TDSP+EH LP EDAECCICL
Sbjct: 270 KEDIDQLTKFKFRKVGDTMKHTVDEEQGQGDSGGVMTECGTDSPVEHALPHEDAECCICL 329

Query: 528 CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
            AY+D  ELRELPC H FHC C+DKWLYINATCPLCK+NI+K+      E +
Sbjct: 330 SAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILKSSGGGGGEKI 381



 Score = 37.7 bits (86), Expect(2) = 2e-42
 Identities = 16/19 (84%), Positives = 19/19 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIA+LYAVA+QEGA+K
Sbjct: 252 LPCIIAVLYAVAEQEGASK 270



>gb:AY059830_1564674 Arabidopsis thaliana putative protein
           (At3g61180; T20K12.80) mRNA, complete
           cds.>gb:AY064638_1566089 Arabidopsis thaliana putative
           protein (At3g61180; T20K12.80) mRNA, complete cds.
          Length = 379

 Score =  157 bits (397), Expect(2) = 8e-42
 Identities = 73/110 (66%), Positives = 85/110 (77%)
 Frame = -2

Query: 702 PKEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA 523
           P E+IERL K+KF  + + EK NGEI+E+ GG+MT  DT+S  E +L  EDAEC ICLCA
Sbjct: 270 PDEEIERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLDTESQTERMLLSEDAECSICLCA 329

Query: 522 YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
           Y+DGVELRELPCRH FH  C+DKWL INATCPLCKFNI+KN   S SE V
Sbjct: 330 YEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSEQV 379



 Score = 36.2 bits (82), Expect(2) = 8e-42
 Identities = 16/17 (94%), Positives = 17/17 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGA 704
           LPCIIAILYA+ADQEGA
Sbjct: 253 LPCIIAILYALADQEGA 269



>pir|T47910|T47910 hypothetical protein T20K12.80 - Arabidopsis
           thaliana>gb:ATT20K12_1554957 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20K12.
          Length = 362

 Score =  157 bits (397), Expect(2) = 8e-42
 Identities = 73/110 (66%), Positives = 85/110 (77%)
 Frame = -2

Query: 702 PKEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA 523
           P E+IERL K+KF  + + EK NGEI+E+ GG+MT  DT+S  E +L  EDAEC ICLCA
Sbjct: 253 PDEEIERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLDTESQTERMLLSEDAECSICLCA 312

Query: 522 YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV 373
           Y+DGVELRELPCRH FH  C+DKWL INATCPLCKFNI+KN   S SE V
Sbjct: 313 YEDGVELRELPCRHHFHSLCVDKWLRINATCPLCKFNILKNGEPSGSEQV 362



 Score = 36.2 bits (82), Expect(2) = 8e-42
 Identities = 16/17 (94%), Positives = 17/17 (100%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGA 704
           LPCIIAILYA+ADQEGA
Sbjct: 236 LPCIIAILYALADQEGA 252



>gb:AP003916_1835174 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1634_H04.
          Length = 361

 Score =  157 bits (396), Expect(2) = 8e-42
 Identities = 67/101 (66%), Positives = 78/101 (77%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           +EDI  L K+KFR +GD +K    I    GGVMTEC T+ P+EH L  EDAECCICLC Y
Sbjct: 255 EEDINNLSKFKFRTMGDADKLVAGIAAPVGGVMTECGTNPPVEHFLSAEDAECCICLCPY 314

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           +DG ELRELPC H FHC CIDKWL+INATCPLCKFNI+K++
Sbjct: 315 EDGAELRELPCNHHFHCTCIDKWLHINATCPLCKFNIIKSN 355



 Score = 36.6 bits (83), Expect(2) = 8e-42
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIAILYAV DQEGA++
Sbjct: 237 LPCIIAILYAVTDQEGASE 255



>gb:AY057713_1564125 Arabidopsis thaliana AT4g11680/T5C23_110 mRNA,
           complete cds.>gb:BT010750_1640696 Arabidopsis thaliana
           At4g11680/T5C23_110 gene, complete cds.
          Length = 390

 Score =  157 bits (396), Expect = 3e-37
 Identities = 67/102 (65%), Positives = 82/102 (80%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DI+++PK++F + G+ EK +G+ +    G+MTEC TDSPIE  L PEDAECCICLC Y
Sbjct: 290 KNDIDQMPKFRFTKTGNVEKLSGKAR----GIMTECGTDSPIERSLSPEDAECCICLCEY 345

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN 394
           +DGVELRELPC H FHC CIDKWL+IN+ CPLCKFNI+KN N
Sbjct: 346 EDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILKNAN 387



 Score = 40.4 bits (93), Expect = 0.038
 Identities = 21/33 (63%), Positives = 23/33 (69%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATKGRH*TTAKVQIQKT 656
           LPCIIAILYAVADQEGA+K       K +  KT
Sbjct: 272 LPCIIAILYAVADQEGASKNDIDQMPKFRFTKT 304



>pir|T04215|T04215 hypothetical protein T5C23.110 - Arabidopsis
           thaliana>gb:ATCHRIV32_1544933 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 32.>gb:ATT5C23_1556104
           Arabidopsis thaliana DNA chromosome 4, BAC clone T5C23
           (ESSA project).
          Length = 419

 Score =  141 bits (356), Expect = 1e-32
 Identities = 67/131 (51%), Positives = 82/131 (62%), Gaps = 29/131 (22%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDA--------- 547
           K DI+++PK++F + G+ EK +G+ +    G+MTEC TDSPIE  L PEDA         
Sbjct: 290 KNDIDQMPKFRFTKTGNVEKLSGKAR----GIMTECGTDSPIERSLSPEDAVQSHFHILI 345

Query: 546 --------------------ECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCP 427
                               ECCICLC Y+DGVELRELPC H FHC CIDKWL+IN+ CP
Sbjct: 346 KLYILKVCKIDNAWLLMILQECCICLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCP 405

Query: 426 LCKFNIVKNDN 394
           LCKFNI+KN N
Sbjct: 406 LCKFNILKNAN 416



 Score = 40.4 bits (93), Expect = 0.038
 Identities = 21/33 (63%), Positives = 23/33 (69%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATKGRH*TTAKVQIQKT 656
           LPCIIAILYAVADQEGA+K       K +  KT
Sbjct: 272 LPCIIAILYAVADQEGASKNDIDQMPKFRFTKT 304



>gb:AY084480_1569569 Arabidopsis thaliana clone 109181 mRNA,
           complete sequence.
          Length = 343

 Score =  111 bits (277), Expect(2) = 1e-27
 Identities = 55/104 (52%), Positives = 66/104 (63%), Gaps = 3/104 (2%)
 Frame = -2

Query: 693 DIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPI---EHVLPPEDAECCICLCA 523
           D+  LPKY+F  + + EKQ+       GG M   D  S     E VL PEDA+CCICL +
Sbjct: 244 DLSILPKYRFHTMNNDEKQSDG-----GGKMIPVDAASENLGNERVLLPEDADCCICLSS 298

Query: 522 YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ 391
           Y+DG EL  LPC H FH  CI KWL +NATCPLCKFNI+K + Q
Sbjct: 299 YEDGAELVSLPCNHHFHSTCIVKWLKMNATCPLCKFNILKGNEQ 342



 Score = 34.7 bits (78), Expect(2) = 1e-27
 Identities = 15/19 (78%), Positives = 18/19 (94%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIA+LYAVA QEGA++
Sbjct: 224 LPCIIALLYAVAGQEGASE 242



>pir|H96703|H96703 probable RING zinc finger protein T23K23.8
           [imported] - Arabidopsis thaliana>gb:AE005173_894429
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012563_1537747 Arabidopsis thaliana
           chromosome 1 BAC T23K23 genomic sequence, complete
           sequence.
          Length = 343

 Score =  111 bits (277), Expect(2) = 1e-27
 Identities = 55/104 (52%), Positives = 66/104 (63%), Gaps = 3/104 (2%)
 Frame = -2

Query: 693 DIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPI---EHVLPPEDAECCICLCA 523
           D+  LPKY+F  + + EKQ+       GG M   D  S     E VL PEDA+CCICL +
Sbjct: 244 DLSILPKYRFHTMNNDEKQSDG-----GGKMIPVDAASENLGNERVLLPEDADCCICLSS 298

Query: 522 YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ 391
           Y+DG EL  LPC H FH  CI KWL +NATCPLCKFNI+K + Q
Sbjct: 299 YEDGAELVSLPCNHHFHSTCIVKWLKMNATCPLCKFNILKGNEQ 342



 Score = 34.7 bits (78), Expect(2) = 1e-27
 Identities = 15/19 (78%), Positives = 18/19 (94%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGATK 698
           LPCIIA+LYAVA QEGA++
Sbjct: 224 LPCIIALLYAVAGQEGASE 242



>gb:AP004880_1846517 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0487D09.
          Length = 180

 Score = 95.5 bits (236), Expect(2) = 1e-22
 Identities = 47/102 (46%), Positives = 62/102 (60%)
 Frame = -2

Query: 693 DIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDD 514
           DI  LP+Y++    + + Q G  +     V+    T S  E +L  EDAECCICL +Y+D
Sbjct: 81  DIGFLPRYRYSDPSE-DGQKGTDEGVMIPVLNNSGT-STSERILLHEDAECCICLSSYED 138

Query: 513 GVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQS 388
           G EL  LPC H FH  CI KWL ++ATCPLCK+NI+K    +
Sbjct: 139 GAELSALPCNHHFHWTCITKWLRMHATCPLCKYNILKGSESA 180



 Score = 33.5 bits (75), Expect(2) = 1e-22
 Identities = 14/18 (77%), Positives = 17/18 (94%)
 Frame = -1

Query: 754 LPCIIAILYAVADQEGAT 701
           LPC+IAILYA+A QEGA+
Sbjct: 61  LPCVIAILYALAGQEGAS 78



>gb:AP004057_1837039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1316_E06.>gb:AP005535_1853669 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0054K20.
          Length = 199

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 48/105 (45%), Positives = 56/105 (53%)
 Frame = -2

Query: 696 EDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD 517
           E I  LP YKF+          E +   GG++    TD   E  L  EDA CCICL  Y 
Sbjct: 82  ESINSLPTYKFKTKKRRHSSGNEAEGQDGGIVA-AGTDK--ERSLSAEDAVCCICLAKYA 138

Query: 516 DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
              ELRELPC H FH  C+DKWL INA CPLCK  I  +   S++
Sbjct: 139 HNDELRELPCTHCFHKECVDKWLKINALCPLCKSEIASSSGTSDT 183



>gb:AP002524_1822387 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP002903_1823791 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0509B06.
          Length = 405

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 48/105 (45%), Positives = 62/105 (59%)
 Frame = -2

Query: 696 EDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD 517
           E I+ L  YKF+     + Q+GE  E  GGV+    TD   E  +  EDA CCICL  + 
Sbjct: 286 EAIDALVAYKFQSK---KFQDGEAGEDNGGVLA-AGTDK--ERTISAEDAVCCICLSKFS 339

Query: 516 DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           +  +LRELPC H FH  C+DKWL INA CPLCK ++  + N  +S
Sbjct: 340 NNEDLRELPCNHVFHLECVDKWLKINALCPLCKADLGGSTNAPDS 384



>gb:AY168924_1586415 Arabidopsis thaliana RES protein (RES) mRNA,
           complete cds.
          Length = 359

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 36/57 (63%), Positives = 42/57 (73%)
 Frame = -2

Query: 573 EHVLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
           E  L  EDA+CCICL +Y+DG EL  LPC H FH  CI KWL + ATCPLCK+NI+K
Sbjct: 297 ERTLLAEDADCCICLSSYEDGAELHALPCNHHFHSTCIVKWLKMRATCPLCKYNILK 353



>gb:AY074271_1567432 Arabidopsis thaliana unknown protein
           (At4g32600) mRNA, complete cds.>gb:AY081300_1568646
           Arabidopsis thaliana putative protein (At4g32600) mRNA,
           complete cds.>gb:AY096655_1576191 Arabidopsis thaliana
           unknown protein (At4g32600) mRNA, complete cds.
          Length = 453

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 50/116 (43%), Positives = 66/116 (56%), Gaps = 3/116 (2%)
 Frame = -2

Query: 696 EDIERLPKYKFRRLGDFEKQNGE---IQESFGGVMTECDTDSPIEHVLPPEDAECCICLC 526
           E I  LP +KF+      + NG+      S GGV+    TD+  E  +  EDA CCICL 
Sbjct: 314 ESINALPTHKFKLKKS--RSNGDDNGSSTSEGGVVA-AGTDN--ERAISGEDAVCCICLA 368

Query: 525 AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV*ASNS 358
            Y +  ELRELPC H FH  C+DKWL INA+CPLCK  + + ++   S+ +  S S
Sbjct: 369 KYANNEELRELPCSHFFHKECVDKWLKINASCPLCKSEVGEKNSDLTSQGILTSLS 424



>pir|T04466|T04466 hypothetical protein F4D11.200 - Arabidopsis
           thaliana>gb:ATCHRIV77_1547180 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 77.>gb:ATF4D11_1550652
           Arabidopsis thaliana DNA chromosome 4, BAC clone F4D11
           (ESSAII project).
          Length = 495

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 50/116 (43%), Positives = 66/116 (56%), Gaps = 3/116 (2%)
 Frame = -2

Query: 696 EDIERLPKYKFRRLGDFEKQNGE---IQESFGGVMTECDTDSPIEHVLPPEDAECCICLC 526
           E I  LP +KF+      + NG+      S GGV+    TD+  E  +  EDA CCICL 
Sbjct: 314 ESINALPTHKFKLKKS--RSNGDDNGSSTSEGGVVA-AGTDN--ERAISGEDAVCCICLA 368

Query: 525 AYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV*ASNS 358
            Y +  ELRELPC H FH  C+DKWL INA+CPLCK  + + ++   S+ +  S S
Sbjct: 369 KYANNEELRELPCSHFFHKECVDKWLKINASCPLCKSEVGEKNSDLTSQGILTSLS 424



>pir|G96835|G96835 probable RING zinc finger protein, 53384-54880
           [imported] - Arabidopsis thaliana>gb:AE005173_895553
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC018848_1538410 Arabidopsis thaliana
           chromosome 1 BAC F5I6 genomic sequence, complete
           sequence.>gb:AY062845_1565501 Arabidopsis thaliana
           putative RING zinc finger protein (At1g80400; F5I6.15)
           mRNA, complete cds.>gb:BT000070_1634348 Arabidopsis
           thaliana putative RING zinc finger protein (At1g80400)
           mRNA, complete cds.
          Length = 407

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 44/104 (42%), Positives = 60/104 (57%)
 Frame = -2

Query: 696 EDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD 517
           E I  LP Y+F+     + +  E  E  GG +      S  + ++  EDA CCICL  Y 
Sbjct: 309 EAINALPVYRFKSKSRNDLEFSE--EGEGGFLL---LGSQKKRLISGEDASCCICLTRYG 363

Query: 516 DGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           D  ++RELPC H FH  C+DKWL INATCPLCK  + ++ + S+
Sbjct: 364 DDEQVRELPCSHVFHVDCVDKWLKINATCPLCKNEVGESSSASS 407



>gb:AP005879_1859549 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBb0024J13.
          Length = 414

 Score = 85.9 bits (211), Expect = 8e-16
 Identities = 45/100 (45%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGD---FEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICL 529
           +E I+ LP YKF+        +  +     S GG++      +  E ++  EDA CCICL
Sbjct: 286 QELIDALPTYKFKPKRSKMWVDHASSSENLSEGGIL---GPGTKKERIVSAEDAVCCICL 342

Query: 528 CAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
             Y D  ELRELPC H FH  C+DKWL INA CPLCK  I
Sbjct: 343 TKYGDDDELRELPCTHFFHVQCVDKWLKINAVCPLCKTEI 382



>gb:AC130610_1740872 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0478F09, complete sequence.
          Length = 407

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 35/55 (63%), Positives = 38/55 (69%)
 Frame = -2

Query: 573 EHVLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           E V+  EDA CCICL  Y D  +LRELPC H FH  C+DKWL INA CPLCK  I
Sbjct: 324 ERVISAEDAVCCICLARYVDNDDLRELPCAHFFHKDCVDKWLKINALCPLCKAEI 378



>gb:AY085253_1570325 Arabidopsis thaliana clone 141890 mRNA,
           complete sequence.
          Length = 343

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 36/93 (38%), Positives = 49/93 (52%)
 Frame = -2

Query: 696 EDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYD 517
           + I  LP +KF+R+ D                    +DS  +     +D ECCICL  Y 
Sbjct: 264 DQISSLPSWKFKRIDDSA------------------SDSDSDSATVTDDPECCICLAKYK 305

Query: 516 DGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           D  E+R+LPC H+FH  C+D+WL I + CPLCK
Sbjct: 306 DKEEVRKLPCSHKFHSKCVDQWLRIISCCPLCK 338



>gb:AP003245_1826151 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0421H07.
          Length = 304

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 26/46 (56%), Positives = 34/46 (73%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +D ECCICL  Y +  E+R+LPC H FH  C+D+WL I ++CPLCK
Sbjct: 255 DDQECCICLAQYKEKEEVRQLPCTHMFHLKCVDRWLRIISSCPLCK 300



>pir|T08924|T08924 hypothetical protein T15N24.30 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546539 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           65.>gb:ATT15N24_1554546 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T15N24 (ESSA project).
          Length = 464

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 27/45 (60%), Positives = 33/45 (73%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           D ECCICL  Y +  E+R+LPC HRFH  C+D+WL I + CPLCK
Sbjct: 415 DPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISCCPLCK 459



>gb:BC075707_2106722 Mus musculus RIKEN cDNA 4732452J19 gene, mRNA
           (cDNA clone IMAGE:3989267), partial cds.
          Length = 703

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 28/54 (51%), Positives = 36/54 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           C ICL  + +G ELR + C H FH  C+D WLY + TCPLC FNIV+ D+ S +
Sbjct: 189 CAICLEEFSEGQELRVISCLHEFHRTCVDPWLYQHRTCPLCMFNIVEGDSFSQA 242



>gb:AL596086_2070783 Mouse DNA sequence from clone RP23-168C20 on
           chromosome 11 Contains the 3' end of the Tex14 gene for
           testis expressed gene 14, complete
           sequence.>gb:AL604022_2071257 Mouse DNA sequence from
           clone RP23-449P23 on chromosome 11 Contains the 3' end
           of a novel gene (4732452J19Rik), the Supt4h gene for
           suppressor of Ty 4 homolog (S. cerevisiae), a novel gene
           (A430104N18Rik), the Bzrap1 gene for benzodiazapine
           receptor associated protein 1, the Mpo gene for
           myeloperoxidase, a novel gene, the 3' end of the Lpo
           gene for lactoperoxidase and a CpG island, complete
           sequence.
          Length = 784

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 28/54 (51%), Positives = 36/54 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           C ICL  + +G ELR + C H FH  C+D WLY + TCPLC FNIV+ D+ S +
Sbjct: 272 CAICLEEFSEGQELRVISCLHEFHRTCVDPWLYQHRTCPLCMFNIVEGDSFSQA 325



>gb:AK028750_1161140 Mus musculus 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732452J19
           product:hypothetical Serine-rich region/Histidine-rich
           region/RING finger containing protein, full insert
           sequence.
          Length = 657

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 28/54 (51%), Positives = 36/54 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           C ICL  + +G ELR + C H FH  C+D WLY + TCPLC FNIV+ D+ S +
Sbjct: 145 CAICLEEFSEGQELRVISCLHEFHRTCVDPWLYQHRTCPLCMFNIVEGDSFSQA 198



>gb:CR456397_1992688 Homo sapiens bK175E3.6 full length open reading
           frame (ORF) cDNA clone (cDNA clone
           C22ORF:pGEM.bK175E3.6.V4).>gb:HS175E3_1997293 Human DNA
           sequence from clone CTA-175E3 on chromosome 22q12.1,
           complete sequence.>gb:HS747E2_1999421 Human DNA sequence
           from clone CTA-747E2 on chromosome 22q12.1, complete
           sequence.
          Length = 836

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV* 370
           ++C ICL  Y DG ELR +PC HRFH  C+D WL  + TCP C+ NI++     ++  V 
Sbjct: 191 SDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVE 250

Query: 369 ASN 361
            SN
Sbjct: 251 TSN 253



>gb:BC021570_1977511 Homo sapiens zinc and ring finger 3, mRNA (cDNA
           clone IMAGE:4125718), partial cds.
          Length = 653

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV* 370
           ++C ICL  Y DG ELR +PC HRFH  C+D WL  + TCP C+ NI++     ++  V 
Sbjct: 8   SDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVE 67

Query: 369 ASN 361
            SN
Sbjct: 68  TSN 70



>gb:AB051436_1867948 Homo sapiens mRNA for KIAA1133 protein, partial
           cds.
          Length = 891

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV* 370
           ++C ICL  Y DG ELR +PC HRFH  C+D WL  + TCP C+ NI++     ++  V 
Sbjct: 246 SDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVE 305

Query: 369 ASN 361
            SN
Sbjct: 306 TSN 308



>gb:AL662853_2072251 Mouse DNA sequence from clone RP23-293J16 on
           chromosome 11 Contains the Kremen gene for kringle
           containing transmembrane protein, the 3' end of a novel
           gene and a CpG island, complete
           sequence.>gb:AL662876_2072265 Mouse DNA sequence from
           clone RP23-288K19 on chromosome 11 Contains the 5' end
           of a novel gene, a pseudogene similar to human
           polymerase (RNA) II (DNA directed) polypeptide D POLR2D,
           two novel genes, the Xbp1 gene for X-box binding protein
           1, the gene for a novel ankyrin repeat containing
           protein and three CpG islands, complete sequence.
          Length = 913

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 29/63 (46%), Positives = 38/63 (60%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV* 370
           ++C ICL  Y DG ELR +PC HRFH  C+D WL  + TCP C+ NI++      +  V 
Sbjct: 288 SDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPGAVCVE 347

Query: 369 ASN 361
            SN
Sbjct: 348 TSN 350



>pir|T06113|T06113 hypothetical protein T5J17.240 - Arabidopsis
           thaliana  (fragment)
          Length = 253

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -2

Query: 573 EHVLPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           E  +  +D EC ICL   +D   +R LP C H FH  CID WLY +ATCP+C+ N+    
Sbjct: 113 ESKIGSKDLECAICLNELEDHETVRLLPICNHLFHIDCIDTWLYSHATCPVCRSNLTAKS 172

Query: 396 NQSNSED 376
           N+   ED
Sbjct: 173 NKPGDED 179



>pir|H85474|H85474 hypothetical protein AT4g40070 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV92_1547991 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           92.>gb:ATT5J17_1556170 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T5J17 (ESSA project).
          Length = 322

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -2

Query: 573 EHVLPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           E  +  +D EC ICL   +D   +R LP C H FH  CID WLY +ATCP+C+ N+    
Sbjct: 113 ESKIGSKDLECAICLNELEDHETVRLLPICNHLFHIDCIDTWLYSHATCPVCRSNLTAKS 172

Query: 396 NQSNSED 376
           N+   ED
Sbjct: 173 NKPGDED 179



>sp|Q90972|RN13_CHICK RING finger protein 13
           (C-RZF).>gb:GGRINGZNF_2573380 G.gallus mRNA for RING
           zinc finger.
          Length = 381

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y+DG +LR LPC H +HC C+D WL     TCP+CK  +V +   S+SE
Sbjct: 240 CAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSE 295



>gb:BC065620_2554066 Danio rerio zgc:55660, mRNA (cDNA clone
           MGC:77194 IMAGE:6961887), complete cds.
          Length = 377

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y++G  LR LPC H +HC C+D WL     TCP+CK  +V +D  S S+
Sbjct: 240 CAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSDGDSESD 295



>gb:BC044449_2548755 Danio rerio zgc:55660, mRNA (cDNA clone
           MGC:55660 IMAGE:3815403), complete cds.
          Length = 377

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y++G  LR LPC H +HC C+D WL     TCP+CK  +V +D  S S+
Sbjct: 240 CAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSDGDSESD 295



>gb:CR749257_1180888 Homo sapiens mRNA; cDNA DKFZp781H02126 (from
           clone DKFZp781H02126).
          Length = 783

 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 27/54 (50%), Positives = 35/54 (64%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           C ICL  + +G ELR + C H FH  C+D WL+ + TCPLC FNI + D+ S S
Sbjct: 272 CAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQHRTCPLCMFNITEGDSFSQS 325



>gb:CR627423_1180792 Homo sapiens mRNA; cDNA DKFZp781H0392 (from
           clone DKFZp781H0392).
          Length = 783

 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 27/54 (50%), Positives = 35/54 (64%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           C ICL  + +G ELR + C H FH  C+D WL+ + TCPLC FNI + D+ S S
Sbjct: 272 CAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQHRTCPLCMFNITEGDSFSQS 325



>gb:AK000322_1907832 Homo sapiens cDNA FLJ20315 fis, clone HEP07873.
          Length = 783

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 27/54 (50%), Positives = 35/54 (64%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           C ICL  + +G ELR + C H FH  C+D WL+ + TCPLC FNI + D+ S S
Sbjct: 272 CAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQHRTCPLCVFNITEGDSFSQS 325



>gb:OSJN00048_1693847 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0086B14, complete sequence.
          Length = 387

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
 Frame = -2

Query: 576 IEHVLPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVK 403
           ++H +     EC +CL ++DDG +LR LP C H FH  CID WL    TCPLC+ N+ K
Sbjct: 122 VKHKIGKSVLECAVCLTSFDDGDDLRLLPHCSHAFHPECIDPWLESRVTCPLCRANLEK 180



>gb:AX961982_1484483 Sequence 5 from Patent
           WO03104275.>gb:AB081837_1871797 Homo sapiens urcc mRNA,
           complete cds.
          Length = 783

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 27/54 (50%), Positives = 35/54 (64%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNS 382
           C ICL  + +G ELR + C H FH  C+D WL+ + TCPLC FNI + D+ S S
Sbjct: 272 CAICLEEFSEGQELRVISCLHEFHRNCVDPWLHQHRTCPLCVFNITEGDSFSQS 325



>sp|O43567|RN13_HUMAN RING finger protein 13.>gb:CR858160_1182347
           Pongo pygmaeus mRNA; cDNA DKFZp468B0312 (from clone
           DKFZp468B0312).>gb:AF037204_1878066 Homo sapiens RING
           zinc finger protein (RZF) mRNA, complete
           cds.>gb:AF070558_1880740 Homo sapiens clone 24450 RING
           zinc finger protein RZF mRNA, complete
           cds.>gb:BC009781_1972253 Homo sapiens ring finger
           protein 13, transcript variant 4, mRNA (cDNA clone
           MGC:13487 IMAGE:3683407), complete
           cds.>gb:BC009803_1972272 Homo sapiens ring finger
           protein 13, transcript variant 1, mRNA (cDNA clone
           MGC:13689 IMAGE:4274992), complete
           cds.>gb:CR456804_1993011 Homo sapiens full open reading
           frame cDNA clone RZPDo834C1118D for gene RNF13, ring
           finger protein 13; complete cds, incl. stopcodon.
          Length = 381

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y+DG +LR LPC H +HC C+D WL     TCP+CK  +V +   S+S+
Sbjct: 240 CAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSD 295



>sp|Q9WTV7|RN12_MOUSE RING finger protein 12 (LIM domain interacting
           RING finger protein) (RING finger LIM domain-binding
           protein) (R-LIM).>gb:AF069992_2053283 Mus musculus LIM
           domain interacting RING finger protein (R-lim) mRNA,
           complete cds.
          Length = 600

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 23/53 (43%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H FH  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 546 CSVCITEYTEGDKLRKLPCSHEFHVHCIDRWLSENSTCPICRRAVLSSGNRES 598



>gb:BC081881_2108127 Rattus norvegicus cDNA clone MGC:93748
           IMAGE:7108181, complete cds.
          Length = 380

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y+DG +LR LPC H +HC C+D WL     TCP+CK  +V +   S+S+
Sbjct: 240 CAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSD 295



>gb:BC058182_2103089 Mus musculus ring finger protein 13, mRNA (cDNA
           clone MGC:68150 IMAGE:5324040), complete cds.
          Length = 381

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y+DG +LR LPC H +HC C+D WL     TCP+CK  +V +   S+S+
Sbjct: 240 CAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSD 295



>gb:AL807825_2073073 Mouse DNA sequence from clone RP23-453B22 on
           chromosome 11 Contains a transformer 2 alpha homolog
           (Drosophila) (Tra2a) pseudogene, three novel genes, the
           Sf3a1 gene for splicing factor 3a subunit 1, the
           ortholog of human EBP50-PDZ interactor EPI64, a
           ribosomal protein L18a (Rpl18a) pseudogene, the Osm gene
           for oncostatin M and two CpG islands, complete sequence.
          Length = 379

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = -2

Query: 570 HVLPPEDAE-CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKN 400
           H LP    E C +CL  + +   LR LPC+H FH  C+D WL +  TCPLCKFN++ N
Sbjct: 317 HSLPEPGTETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQTCPLCKFNVLGN 374



>gb:AK002414_1151184 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610009J22
           product:hypothetical RING finger containing protein,
           full insert sequence.
          Length = 379

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 1/58 (1%)
 Frame = -2

Query: 570 HVLPPEDAE-CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKN 400
           H LP    E C +CL  + +   LR LPC+H FH  C+D WL +  TCPLCKFN++ N
Sbjct: 317 HSLPEPGTETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQTCPLCKFNVLGN 374



>sp|O54965|RN13_MOUSE RING finger protein 13.>gb:AF037205_2051841
           Mus musculus RING zinc finger protein (Rzf) mRNA,
           complete cds.
          Length = 381

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y+DG +LR LPC H +HC C+D WL     TCP+CK  +V +   S+S+
Sbjct: 240 CAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSD 295



>gb:AL161792_1922220 Human DNA sequence from clone RP11-84P7 on
           chromosome 9 Contains a high-mobility group box
           pseudogene, two novel gene and the 3' end of the RNF38
           gene for ring finger protein 38, complete
           sequence.>gb:AL354935_1923569 Human DNA sequence from
           clone RP11-117L14 on chromosome 9 Contains the 5' end of
           the RNF38 gene for ring finger protein 38 and a CpG
           island, complete sequence.>gb:BC033786_1981055 Homo
           sapiens ring finger protein 38, transcript variant 3,
           mRNA (cDNA clone MGC:44972 IMAGE:5166325), complete cds.
          Length = 465

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 390 KADIEQLPSYRF---------------------------NPNNH--QSEQTLCVVCMCDF 420

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 421 ESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 454



>gb:AL161792_1922219 Human DNA sequence from clone RP11-84P7 on
           chromosome 9 Contains a high-mobility group box
           pseudogene, two novel gene and the 3' end of the RNF38
           gene for ring finger protein 38, complete
           sequence.>gb:AL354935_1923570 Human DNA sequence from
           clone RP11-117L14 on chromosome 9 Contains the 5' end of
           the RNF38 gene for ring finger protein 38 and a CpG
           island, complete sequence.
          Length = 515

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 440 KADIEQLPSYRF---------------------------NPNNH--QSEQTLCVVCMCDF 470

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 471 ESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 504



>gb:AL161792_1922218 Human DNA sequence from clone RP11-84P7 on
           chromosome 9 Contains a high-mobility group box
           pseudogene, two novel gene and the 3' end of the RNF38
           gene for ring finger protein 38, complete
           sequence.>gb:AL354935_1923571 Human DNA sequence from
           clone RP11-117L14 on chromosome 9 Contains the 5' end of
           the RNF38 gene for ring finger protein 38 and a CpG
           island, complete sequence.
          Length = 439

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 364 KADIEQLPSYRF---------------------------NPNNH--QSEQTLCVVCMCDF 394

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 395 ESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 428



>gb:AK024996_1910206 Homo sapiens cDNA: FLJ21343 fis, clone
           COL02679.
          Length = 332

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 257 KADIEQLPSYRF---------------------------NPNNH--QSEQTLCVVCMCDF 287

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 288 ESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 321



>gb:AF394047_1900586 Homo sapiens RING finger protein 38 (RNF38)
           mRNA, complete cds.
          Length = 432

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 357 KADIEQLPSYRF---------------------------NPNNH--QSEQTLCVVCMCDF 387

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 388 ESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 421



>gb:AP000836_1820660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0038F12.
          Length = 329

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 24/58 (41%), Positives = 38/58 (65%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           D+ C +CL  Y  G    E+PCRHRFH  CI  WL ++++CP+C+F +  +D+  +S+
Sbjct: 210 DSACAVCLEDYAAGERATEMPCRHRFHAKCIVPWLKMHSSCPVCRFQLPTDDDDDSSK 267



>gb:AC073395_1541019 Arabidopsis thaliana chromosome 3 BAC F11B9
           genomic sequence, complete
           sequence.>gb:ATAC009991_1543111 Arabidopsis thaliana
           chromosome III BAC F9F8 genomic sequence, complete
           sequence.
          Length = 158

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           E+ ECCICL  +++G +++ LP C H +HC C+D+WL   ++CPLC+ +I
Sbjct: 103 EEKECCICLGGFEEGEKMKVLPPCSHCYHCECVDRWLKTESSCPLCRVSI 152



>gb:HSM801785_1186449 Homo sapiens mRNA; cDNA DKFZp434A0926 (from
           clone DKFZp434A0926).
          Length = 515

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 440 KADIEQLPSYRF---------------------------NPNNH--QSEQTLCVVCMCDF 470

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 471 ESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 504



>gb:BC012960_2091675 Mus musculus ring finger protein 12, mRNA (cDNA
           clone MGC:13712 IMAGE:4193003), complete cds.
          Length = 600

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 546 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRES 598



>gb:AP003104_1824709 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0038J17.
          Length = 231

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 36/101 (35%), Positives = 47/101 (46%), Gaps = 1/101 (0%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           ++ I  LPK+++R  GD                 ECD              EC ICLCA 
Sbjct: 120 EDAIAALPKFEYRGTGD-----------------ECDR------------WECSICLCAV 150

Query: 519 DDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKN 400
            DG   R+LP C H FH  C+D WL  + TCP+C+  +V N
Sbjct: 151 ADGEVARQLPRCMHLFHRGCVDMWLVAHTTCPVCRAEVVVN 191



>gb:CR382132_1665163 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 687

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINAT-CPLCKFNIVKNDNQSNSE 379
           ED  C IC   ++D   +R+LPC HRFH  C+D WL  +++ CP+C+ N+ K +N++   
Sbjct: 342 EDDNCAICFDNFEDNQIIRQLPCTHRFHADCVDHWLLNSSSQCPMCRMNLRKEENETTEN 401

Query: 378 D 376
           +
Sbjct: 402 E 402



>gb:AY647238_1619867 Zea mays unknown mRNA.
          Length = 68

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKND 397
           E A+C ICL  Y++G  LR LPC H FH  C+DKWL  I+  CPLC+ ++ ++D
Sbjct: 8   EAAQCYICLVEYEEGDCLRILPCHHEFHLTCVDKWLKEIHRVCPLCRGDVCRSD 61



>gb:AK029295_1161422 Mus musculus 0 day neonate head cDNA, RIKEN
           full-length enriched library, clone:4832416C16
           product:Hoxa1 regulated gene, full insert sequence.
          Length = 600

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 546 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRES 598



>gb:AK013207_1157388 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810430O10 product:Hoxa1 regulated gene, full
           insert sequence.
          Length = 600

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 546 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLSSGNRES 598



>gb:BC083548_2108634 Rattus norvegicus ring finger protein 38, mRNA
           (cDNA clone MGC:93195 IMAGE:7134112), complete cds.
          Length = 432

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 357 KADIEQLPSYRF---------------------------NPSNH--QSEQTLCVVCMCDF 387

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 388 ESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICR 421



>gb:BC060730_2104173 Mus musculus ring finger protein 38, mRNA (cDNA
           clone MGC:67600 IMAGE:6408623), complete
           cds.>gb:BC062976_2105116 Mus musculus ring finger
           protein 38, mRNA (cDNA clone MGC:86160 IMAGE:6848803),
           complete cds.
          Length = 464

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 389 KADIEQLPSYRF---------------------------NPSNH--QSEQTLCVVCMCDF 419

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 420 ESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICR 453



>gb:HSA271670_2001866 Homo sapiens Rnf12 gene for RING zinc finger
           LIM domani binding protein.
          Length = 624

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 570 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRES 622



>gb:AL513007_1928657 Human DNA sequence from clone CTD-2530H13 on
           chromosome X Contains the RNF12 gene for ring finger
           protein 12, a cytoplasmic poly(A) binding protein
           (PABPC) pseudogene and a CpG island, complete
           sequence.>gb:BC013357_1974064 Homo sapiens ring finger
           protein 12, transcript variant 1, mRNA (cDNA clone
           MGC:15161 IMAGE:3834870), complete cds.
          Length = 624

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 570 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRES 622



>gb:AF155109_1886621 Homo sapiens putative ring zinc finger protein
           NY-REN-43 antigen mRNA, complete cds.
          Length = 483

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 429 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRES 481



>gb:AB033040_1866220 Homo sapiens mRNA for KIAA1214 protein, partial
           cds.
          Length = 462

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 36/93 (38%), Positives = 49/93 (52%), Gaps = 4/93 (4%)
 Frame = -2

Query: 669 KFRRLGDFEKQN-GEIQESF---GGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVEL 502
           K+RRLGD  K+   ++Q      G   TE D D+            C +C+  Y     +
Sbjct: 268 KYRRLGDAAKKAISKLQIRTIKKGDKETESDFDN------------CAVCIEGYKPNDVV 315

Query: 501 RELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
           R LPCRH FH +C+D WL  + TCP+CK NI+K
Sbjct: 316 RILPCRHLFHKSCVDPWLLDHRTCPMCKMNILK 348



>gb:AP003722_1832391 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1011A07.>gb:AP003934_1835486 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551A11.
          Length = 198

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIV 406
           +AEC +C+    DG E R LP C HRFH +C+D WL ++ TCPLC+ ++V
Sbjct: 123 EAECAVCIAELRDGDECRALPRCGHRFHASCVDGWLRLHTTCPLCRASVV 172



>gb:AY099807_1576832 Arabidopsis thaliana putative protein
           (At4g26400) mRNA, complete cds.>gb:BT000305_1634583
           Arabidopsis thaliana putative protein (At4g26400) mRNA,
           complete cds.
          Length = 356

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           E  +C ICL  +D G E +E+PC+H+FH  CI  WL ++++CP+C++ +  +D
Sbjct: 237 ESLQCSICLDDFDKGSEAKEMPCKHKFHIRCIVPWLELHSSCPVCRYELPPDD 289



>gb:AX876522_1476570 Sequence 11427 from Patent
           EP1074617.>gb:AK001334_1908378 Homo sapiens cDNA
           FLJ10472 fis, clone NT2RP2000054.
          Length = 624

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 570 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRES 622



>gb:AK029650_1161590 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930426I11
           product:HYPOTHETICAL 43.9 KDA PROTEIN homolog [Homo
           sapiens], full insert sequence.
          Length = 518

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 443 KADIEQLPSYRF---------------------------NPSNH--QSEQTLCVVCMCDF 473

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 474 ESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICR 507



>pir|T05064|T05064 hypothetical protein M3E9.170 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546521 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 65.>gb:ATM3E9_1553630
           Arabidopsis thaliana DNA chromosome 4, P1 clone M3E9
           (ESSA project).
          Length = 344

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           E  +C ICL  +D G E +E+PC+H+FH  CI  WL ++++CP+C++ +  +D
Sbjct: 225 ESLQCSICLDDFDKGSEAKEMPCKHKFHIRCIVPWLELHSSCPVCRYELPPDD 277



>sp|Q9NVW2|RN12_HUMAN RING finger protein 12 (LIM domain interacting
           RING finger protein) (RING finger LIM domain-binding
           protein) (R-LIM) (NY-REN-43 antigen).
          Length = 624

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 22/53 (41%), Positives = 37/53 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++ + N+ +
Sbjct: 570 CSVCITEYTEGNKLRKLPCSHEYHVHCIDRWLSENSTCPICRRAVLASGNRES 622



>gb:BC080893_2561808 Xenopus tropicalis rnf13-prov protein, mRNA
           (cDNA clone MGC:79504 IMAGE:6977064), complete cds.
          Length = 383

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C +CL  Y++G +LR LPC H +HC C+D WL     TCP+CK  +V +   S S+
Sbjct: 241 CAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSESD 296



>gb:BC080409_2561709 Xenopus laevis MGC86297 protein, mRNA (cDNA
           clone MGC:86297 IMAGE:7020633), complete cds.
          Length = 341

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 1/132 (0%)
 Frame = -2

Query: 771 LLFAVVFHV*LQSYMQ*QIRKEQPKEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTEC 592
           ++  +V  V    Y +   R    KE + ++P +KF++  D++                 
Sbjct: 188 IIMCIVMVVRCVQYRKRMRRNRLSKEQLNKIPIHKFKKGDDYDV---------------- 231

Query: 591 DTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKF 415
                           C ICL  Y++G +LR LPC H +H +C+D WL     +CP+CK 
Sbjct: 232 ----------------CAICLEEYEEGDKLRVLPCSHAYHSSCVDPWLTKTKKSCPVCKN 275

Query: 414 NIVKNDNQSNSE 379
            + ++D+ S+S+
Sbjct: 276 RVFRSDSDSDSD 287



>gb:BC063734_2553587 Xenopus laevis hypothetical protein MGC68556,
           mRNA (cDNA clone MGC:68556 IMAGE:4031366), complete cds.
          Length = 381

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C +CL  Y++G +LR LPC H +HC C+D WL     TCP+CK  +V +   S S+
Sbjct: 240 CAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSESD 295



>gb:AP003218_1825423 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0021A09.
          Length = 197

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 27/46 (58%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           DA C ICL  Y DG  LR +P CRHRFH  C+D WL  NA+CP+C+
Sbjct: 119 DAMCSICLSEYADGEMLRVMPDCRHRFHVCCLDAWLRRNASCPVCR 164



>gb:BC082339_2562576 Xenopus laevis XRnf12 protein, mRNA (cDNA clone
           MGC:78888 IMAGE:4174178), complete cds.
          Length = 622

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++   N+ +
Sbjct: 568 CSVCITEYTEGNKLRKLPCSHEYHIHCIDRWLSENSTCPICRRAVLVASNRES 620



>gb:BC081009_2561919 Xenopus laevis MGC81562 protein, mRNA (cDNA clone
            MGC:81562 IMAGE:6863030), complete cds.
          Length = 967

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (3%)
 Frame = -2

Query: 561  PPEDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            P ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 907  PEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 959



>gb:AF329847_2487920 Xenopus laevis ring finger-H2 protein (arkadia)
            mRNA, partial cds.
          Length = 923

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (3%)
 Frame = -2

Query: 561  PPEDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            P ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 863  PEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 915



>gb:AB114039_2465683 Xenopus laevis XRnf12 mRNA for XRnf12, complete
           cds.
          Length = 616

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++   N+ +
Sbjct: 562 CSVCITEYTEGNKLRKLPCSHEYHIHCIDRWLSENSTCPICRRAVLVASNRES 614



>gb:AF480444_2066797 Rattus norvegicus RING finger protein OIP1
           (Oip1) mRNA, complete cds.
          Length = 432

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 32/94 (34%), Positives = 42/94 (44%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C+C +
Sbjct: 357 KADIEQLPFYRF---------------------------NPSNH--QSEQTLCVVCMCDF 387

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 388 ESRQLLRVLPCNHEFHAKCVDKWLKGNRTCPICR 421



>gb:BC069019_1987750 Homo sapiens zinc and ring finger 3, mRNA (cDNA
           clone IMAGE:3530674), partial cds.
          Length = 643

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 28/59 (47%), Positives = 36/59 (61%)
 Frame = -2

Query: 537 ICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV*ASN 361
           ICL  Y DG ELR +PC HRFH  C+D WL  + TCP C+ NI++     ++  V  SN
Sbjct: 2   ICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVETSN 60



>gb:AK127467_1916760 Homo sapiens cDNA FLJ45559 fis, clone
           BRTHA3003225.
          Length = 346

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 33/89 (37%), Positives = 47/89 (52%)
 Frame = -2

Query: 675 KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
           KYK RR  D + +  E +ES        DTD            +C ICL   +DG ++R 
Sbjct: 269 KYKKRRPQDGKGKKDEGEES--------DTDE-----------KCTICLSMLEDGEDVRR 309

Query: 495 LPCRHRFHCACIDKWLYINATCPLCKFNI 409
           LPC H FH  C+D+WL ++  CP+C+ +I
Sbjct: 310 LPCMHLFHQLCVDQWLAMSKKCPICRVDI 338



>gb:AF532623_1809425 Glycine max RING-H2 finger protein mRNA,
           complete cds.
          Length = 246

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 32/83 (38%), Positives = 43/83 (51%)
 Frame = -2

Query: 624 QESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLY 445
           QE F    +E   DS +         +C ICL ++ DG EL  LPC H+FH  C+D W+ 
Sbjct: 170 QEVFSSNASEIGLDSRVLQ-------DCSICLESFTDGDELIRLPCGHKFHSVCLDPWIR 222

Query: 444 INATCPLCKFNIVKNDNQSNSED 376
               CP C+  IV N + S +ED
Sbjct: 223 CCGDCPYCRRCIVVNTHSSLNED 245



>gb:AB114041_2465685 Xenopus laevis XRnf12C mRNA for XRnf12C,
           complete cds.
          Length = 825

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++   N+ +
Sbjct: 771 CSVCITEYTEGNKLRKLPCSHEYHIHCIDRWLSENSTCPICRRAVLVAGNRES 823



>gb:AB114040_2465684 Xenopus laevis XRnf12B mRNA for XRnf12B,
           complete cds.
          Length = 757

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CID+WL  N+TCP+C+  ++   N+ +
Sbjct: 703 CSVCITEYTEGNKLRKLPCSHEYHIHCIDRWLSENSTCPICRRAVLVAGNRES 755



>gb:AY190520_2078838 Rattus norvegicus Sprague-Dawley liver
           r-goliath mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 419

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 232 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRVLPCK 283

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI+K
Sbjct: 284 HVFHKSCVDPWLSEHCTCPMCKLNILK 310



>gb:AL627187_2071579 Mouse DNA sequence from clone RP23-319B15 on
           chromosome 11 Contains the 3' end of the Rnf130 gene for
           ring finger protein 130, a heterogeneous nuclear
           ribonucleoprotein A family pseudogene, a novel gene,
           genes 2700008N14Rik and 3010026O09Rik, the Sqstm1 gene
           for sequestosome 1, the Mgat4b gene for mannoside
           acetylglucosaminyltransferase 4 isoenzyme B, the Ltc4s
           gene for leukotriene C4 synthase and four CpG islands,
           complete sequence.>gb:AL645913_2072011 Mouse DNA
           sequence from clone RP23-194G14 on chromosome 11
           Contains the 3' end of gene 9130006A14Rik, the 5' end of
           the Rnf130 gene for ring finger protein 130 and a CpG
           island, complete sequence.
          Length = 384

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 232 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRVLPCK 283

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI+K
Sbjct: 284 HVFHKSCVDPWLSEHCTCPMCKLNILK 310



>gb:AL627187_2071578 Mouse DNA sequence from clone RP23-319B15 on
           chromosome 11 Contains the 3' end of the Rnf130 gene for
           ring finger protein 130, a heterogeneous nuclear
           ribonucleoprotein A family pseudogene, a novel gene,
           genes 2700008N14Rik and 3010026O09Rik, the Sqstm1 gene
           for sequestosome 1, the Mgat4b gene for mannoside
           acetylglucosaminyltransferase 4 isoenzyme B, the Ltc4s
           gene for leukotriene C4 synthase and four CpG islands,
           complete sequence.>gb:AL645913_2072012 Mouse DNA
           sequence from clone RP23-194G14 on chromosome 11
           Contains the 3' end of gene 9130006A14Rik, the 5' end of
           the Rnf130 gene for ring finger protein 130 and a CpG
           island, complete sequence.>gb:BC018199_2092578 Mus
           musculus ring finger protein 130, mRNA (cDNA clone
           MGC:25596 IMAGE:4017435), complete
           cds.>gb:BC048901_2099861 Mus musculus ring finger
           protein 130, mRNA (cDNA clone MGC:56732 IMAGE:6390079),
           complete cds.
          Length = 419

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 232 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRVLPCK 283

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI+K
Sbjct: 284 HVFHKSCVDPWLSEHCTCPMCKLNILK 310



>gb:AP005295_1850046 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1695_D07.
          Length = 389

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 23/47 (48%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNI 409
           +C ICL  Y+DG ++R LPC+H FH  C+DKWL  ++  CPLC+ ++
Sbjct: 338 QCHICLTEYEDGDQIRSLPCKHEFHLLCVDKWLKEVHRVCPLCRGDV 384



>gb:AP005114_1848115 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0689H05.
          Length = 349

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVK 403
           EC +CL  +DDG +LR LP C H FH  CID WL  + TCPLC+ N+ K
Sbjct: 122 ECAVCLTVFDDGDDLRLLPQCSHAFHPDCIDPWLEGHVTCPLCRANLEK 170



>gb:AC124142_1740408 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0015A05, complete sequence.
          Length = 386

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKN 400
           +P + +EC ICL  +  G E+R LPC H FH  CID+WL +N  CP C+ ++  N
Sbjct: 227 VPTDCSECPICLEEFHVGNEVRGLPCAHNFHVECIDQWLRLNVKCPRCRCSVFPN 281



>gb:AE014297_1138680 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003683_1220673 Drosophila melanogaster
            chromosome 3R, section 21 of 118 of the complete
            sequence.
          Length = 1173

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 31/96 (32%), Positives = 44/96 (45%)
 Frame = -2

Query: 699  KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
            + +I++LP YKF      E  NG+                          + C +C+C +
Sbjct: 1054 RNEIDQLPSYKFNP----EVHNGD-------------------------QSSCVVCMCDF 1084

Query: 519  DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFN 412
            +    LR LPC H FH  C+DKWL  N TCP+C+ N
Sbjct: 1085 ELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN 1120



>gb:AE014297_1138678 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138679 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003683_1220671
           Drosophila melanogaster chromosome 3R, section 21 of 118
           of the complete sequence.>gb:AE003683_1220672 Drosophila
           melanogaster chromosome 3R, section 21 of 118 of the
           complete sequence.>gb:AY094811_1297985 Drosophila
           melanogaster LD30050 full insert cDNA.
          Length = 868

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 31/96 (32%), Positives = 44/96 (45%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           + +I++LP YKF      E  NG+                          + C +C+C +
Sbjct: 749 RNEIDQLPSYKFNP----EVHNGD-------------------------QSSCVVCMCDF 779

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCKFN 412
           +    LR LPC H FH  C+DKWL  N TCP+C+ N
Sbjct: 780 ELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGN 815



>gb:BC065244_1986777 Homo sapiens ring finger protein 130, mRNA
           (cDNA clone IMAGE:6065399), partial cds.
          Length = 306

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 119 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRILPCK 170

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI+K
Sbjct: 171 HVFHKSCVDPWLSEHCTCPMCKLNILK 197



>gb:BC017100_1975908 Homo sapiens ring finger protein 130, mRNA
           (cDNA clone IMAGE:3535930), partial cds.
          Length = 418

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 231 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRILPCK 282

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI+K
Sbjct: 283 HVFHKSCVDPWLSEHCTCPMCKLNILK 309



>gb:AF155650_1886659 Human mRNA for goliath protein.
          Length = 276

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 89  RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRILPCK 140

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI+K
Sbjct: 141 HVFHKSCVDPWLSEHCTCPMCKLNILK 167



>gb:BT020585_1642979 Arabidopsis thaliana At5g45290 gene, complete
           cds.>gb:BT020597_1642991 Arabidopsis thaliana At5g45290
           gene, complete cds.
          Length = 545

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQS 388
           + ++C ICL  Y++   +R LPC H FH  C+DKWL  I+  CPLC+ +I ++D  S
Sbjct: 486 DPSQCYICLVEYEEADSIRTLPCHHEFHKTCVDKWLKEIHRVCPLCRGDICRHDPSS 542



>gb:AY069873_1566619 Arabidopsis thaliana AT5g45290/K9E15_7 mRNA,
           complete cds.
          Length = 545

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQS 388
           + ++C ICL  Y++   +R LPC H FH  C+DKWL  I+  CPLC+ +I ++D  S
Sbjct: 486 DPSQCYICLVEYEEADSIRALPCHHEFHKTCVDKWLKEIHRVCPLCRGDICRHDPSS 542



>gb:AB045121_1520333 Oryza sativa (japonica cultivar-group) RRF1
           mRNA for RING finger 1, complete
           cds.>gb:AP005637_1855230 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0711A01.>gb:AP005838_1858800 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0041C07.
          Length = 392

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 25/44 (56%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           +C +CLC +D G  LR LP C H FH ACID WL  ++TCPLC+
Sbjct: 151 DCAVCLCEFDGGDRLRLLPLCGHAFHAACIDTWLRSSSTCPLCR 194



>gb:AB009049_1510600 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCD7.>gb:AY063905_1565852 Arabidopsis thaliana
           unknown protein (At5g56340) mRNA, complete
           cds.>gb:AY091194_1574403 Arabidopsis thaliana unknown
           protein (At5g56340) mRNA, complete cds.
          Length = 396

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 20/49 (40%), Positives = 35/49 (71%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           E  +C +CL  ++ G E +E+PC+H+FH  CI  WL ++++CP+C+F +
Sbjct: 255 EPLQCSVCLDDFEKGTEAKEMPCKHKFHVRCIVPWLELHSSCPVCRFEL 303



>gb:AX083330_1460809 Sequence 22 from Patent
           WO0112660.>gb:AY083998_1936176 Homo sapiens goliath
           protein mRNA, complete cds.
          Length = 419

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 232 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRILPCK 283

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI+K
Sbjct: 284 HVFHKSCVDPWLSEHCTCPMCKLNILK 310



>gb:AK029824_1161676 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930595M18
           product:hypothetical RNA-binding region RNP-1 (RNA
           recognition motif)/RING finger containing protein, full
           insert sequence.
          Length = 829

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 24/54 (44%), Positives = 36/54 (66%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN 394
           E + C ICL  Y    ++R LPC H +H  CID+WL  N+TCP+C+ +I+ +D+
Sbjct: 771 EISHCSICLTQYIKNSKIRVLPCFHEYHDKCIDRWLSDNSTCPICRKHIINSDD 824



>pir|T45599|T45599 hypothetical protein F12A12.140 - Arabidopsis
           thaliana>gb:ATF12A12_1548303 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F12A12.>gb:AY093203_1575157
           Arabidopsis thaliana putative protein (At3g46620) mRNA,
           complete cds.>gb:BT008859_1640055 Arabidopsis thaliana
           At3g46620 mRNA, complete cds.
          Length = 395

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ-SNSED 376
           +A C +C   ++ G+E RE+PC+H FH  CI  WL I  +CP+C+F +  +  Q SN E+
Sbjct: 212 EANCAVCTEVFEAGIEGREMPCKHIFHGDCIVPWLSIRNSCPVCRFELPSDPIQRSNEEE 271

Query: 375 V*ASNSLW 352
                ++W
Sbjct: 272 HAVGMTIW 279



>gb:AB095109_1198993 Ciona intestinalis CiGl mRNA, complete cds.
          Length = 693

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIV 406
           C ICL  +++  ELR +PC H FH  C+D WL    TCPLC FNI+
Sbjct: 254 CAICLEVFNENEELRVIPCSHEFHKHCVDPWLKEKLTCPLCNFNIL 299



>gb:AE016959_1022769 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017098_1752588
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 52 of 77 of the complete sequence.
          Length = 133

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELPCRHRFHCACIDKWLYI---NATCPLCKFNI 409
           A CC+C+  + DG E+R LPC H FH  C+D+WL +     TCPLC+ ++
Sbjct: 51  AGCCVCISGFRDGEEVRRLPCGHAFHRDCVDRWLALYCRRRTCPLCRLHV 100



>gb:AF171875_2057708 Mus musculus g1-related zinc finger protein
           (G1rp) mRNA, complete cds.
          Length = 419

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 30/87 (34%), Positives = 46/87 (52%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 232 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRVLPCK 283

Query: 483 HRFHCACIDKWLYINATCPLCKFNIVK 403
           H FH +C+D WL  + TCP+CK NI++
Sbjct: 284 HVFHKSCVDPWLSEHCTCPMCKLNILR 310



>gb:HSM806331_2018289 Homo sapiens mRNA; cDNA DKFZp686H1966 (from
            clone DKFZp686H1966); complete cds.
          Length = 986

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 27/68 (39%), Positives = 38/68 (55%)
 Frame = -2

Query: 612  GGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINAT 433
            GG  TE DT+            +C ICL   ++G ++R LPC H FH  C+D+WL  N  
Sbjct: 922  GGEGTEEDTEE-----------KCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKK 970

Query: 432  CPLCKFNI 409
            CP+C+ +I
Sbjct: 971  CPICRVDI 978



>gb:AP005511_1853145 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0011N12.
          Length = 166

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 25/48 (52%), Positives = 33/48 (68%), Gaps = 1/48 (2%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           A+C ICL    DG  +R LP C+H FH  C+D WLY +ATCPLC+ ++
Sbjct: 108 AQCAICLGVVRDGEAVRRLPECKHLFHVECVDMWLYSHATCPLCRRDV 155



>gb:AP001080_1820758 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0499C11.
          Length = 204

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELPCRHRFHCACIDKWLYI-NATCPLCK 418
           +C  CL   DDG E+REL CRH FH AC+D WL +  ATCPLC+
Sbjct: 102 DCVFCLSRVDDGEEVRELRCRHVFHRACLDAWLVLPRATCPLCR 145



>gb:AK117391_1815429 Arabidopsis thaliana At3g47990 mRNA for unknown
           protein, complete cds, clone: RAFL16-97-K12.
          Length = 358

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           +P +  EC ICL  +  G E+R LPC H FH  CID+WL +N  CP C+ ++
Sbjct: 228 VPDDCGECLICLEEFHIGHEVRGLPCAHNFHVECIDQWLRLNVKCPRCRCSV 279



>gb:HSM801486_1186198 Homo sapiens mRNA; cDNA DKFZp434F0721 (from
           clone DKFZp434F0721).
          Length = 366

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 23/53 (43%), Positives = 35/53 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y  G +LR+LPC H FH  CID+WL  N TCP+C+  ++ ++  +N
Sbjct: 313 CSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANN 365



>gb:CR749238_1180869 Homo sapiens mRNA; cDNA DKFZp686P0776 (from
           clone DKFZp686P0776).
          Length = 685

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 23/53 (43%), Positives = 35/53 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y  G +LR+LPC H FH  CID+WL  N TCP+C+  ++ ++  +N
Sbjct: 632 CSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANN 684



>gb:AE013599_1133914 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003466_1211213 Drosophila melanogaster
           chromosome 2R, section 74 of 74 of the complete
           sequence.
          Length = 286

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = -2

Query: 552 DAECC-ICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
           D++CC IC+ AY     +R LPC+H FH  CID WL  + TCP+CK +++K
Sbjct: 124 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLK 174



>gb:AE013599_1133913 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003466_1211212 Drosophila melanogaster
           chromosome 2R, section 74 of 74 of the complete
           sequence.>gb:AY069169_1293899 Drosophila melanogaster
           GH20973 full length cDNA.
          Length = 461

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = -2

Query: 552 DAECC-ICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
           D++CC IC+ AY     +R LPC+H FH  CID WL  + TCP+CK +++K
Sbjct: 299 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLK 349



>gb:AE016959_1023878 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC087599_1734141
           Oryza sativa chromosome 10 BAC OSJNBa0057L21 genomic
           sequence, complete sequence.>gb:AE017120_1753697 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           74 of 77 of the complete sequence.
          Length = 354

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           LP    +C +C  A+ D  ELR LP CRH FH  C+D WL  N +CPLC+ +I
Sbjct: 122 LPKSSRDCAVCQSAFRDDDELRLLPACRHAFHSRCVDPWLRANPSCPLCRASI 174



>pir|T43459|T43459 hypothetical protein DKFZp434F0721.1 - human
           (fragment)
          Length = 366

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 23/53 (43%), Positives = 35/53 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y  G +LR+LPC H FH  CID+WL  N TCP+C+  ++ ++  +N
Sbjct: 313 CSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANN 365



>pir|T06684|T06684 hypothetical protein T17F15.140 - Arabidopsis
           thaliana>gb:ATT17F15_1554705 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T17F15.
          Length = 292

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           +P +  EC ICL  +  G E+R LPC H FH  CID+WL +N  CP C+ ++
Sbjct: 162 VPDDCGECLICLEEFHIGHEVRGLPCAHNFHVECIDQWLRLNVKCPRCRCSV 213



>sp|Q9Y252|RNF6_HUMAN RING finger protein 6 (RING-H2
           protein).>gb:AL138966_1920156 Human DNA sequence from
           clone RP11-380N8 on chromosome 13 Contains the RNF6 gene
           for ring finger protein (C3H2C3 type) 6, a
           protein-kinase, interferon-inducible double stranded RNA
           dependent inhibitor, repressor of (P58
           repressor)(inhibitor of protein kinase PKR) (PRKRIR)
           pseudogene, a TcD37 homolog (HTCD37) pseudogene, a
           pseudogene similar to part of ATPase, aminophospholipid
           transporter (APLT), Class I, type 8A, member 1 (ATPase
           II aminophospholipid translocase) (ATP8A1)(ATPIA, ATPP2,
           ATPASEII) and 2 CpG islands, complete
           sequence.>gb:AY009109_1934135 Homo sapiens ring-H2
           protein mRNA, complete cds.>gb:BC034688_1981350 Homo
           sapiens ring finger protein (C3H2C3 type) 6, transcript
           variant 1, mRNA (cDNA clone MGC:21246 IMAGE:4508997),
           complete cds.>gb:HSA010346_1999964 Homo sapiens mRNA for
           RING-H2 protein RNF6, alternative exon
           1a.>gb:HSA010347_1999965 Homo sapiens mRNA for RING-H2
           protein RNF6, alternative exon 1b.
          Length = 685

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 23/53 (43%), Positives = 35/53 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y  G +LR+LPC H FH  CID+WL  N TCP+C+  ++ ++  +N
Sbjct: 632 CSVCISDYVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANN 684



>sp|Q06003|GOLI_DROME Goliath protein (G1
           protein).>pir|JC1495|JC1495 regulatory protein G1 -
           fruit fly (Drosophila melanogaster)>gb:DROGOLTHA_1382076
           Fruitfly goliath protein gene, complete cds.
          Length = 284

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = -2

Query: 552 DAECC-ICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
           D++CC IC+ AY     +R LPC+H FH  CID WL  + TCP+CK +++K
Sbjct: 122 DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLK 172



>gb:AF329846_2487919 Gallus gallus ring finger protein (arkadia) mRNA,
            partial cds.
          Length = 879

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675  KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
            KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 803  KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 842

Query: 495  LPCRHRFHCACIDKWLYINATCPLCKFNI 409
            LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 843  LPCMHLFHQVCVDQWLITNKKCPICRVDI 871



>gb:AF069993_2471579 Gallus gallus LIM domain interacting RING
           finger protein (R-LIM) mRNA, complete cds.
          Length = 593

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 21/53 (39%), Positives = 36/53 (67%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  Y +G +LR+LPC H +H  CI +WL  N+TCP+C+  ++ + N+ +
Sbjct: 539 CSVCITEYTEGNKLRKLPCSHEYHVHCIARWLSENSTCPICRRAVLASGNRES 591



>gb:BC069835_2106126 Mus musculus ring finger 111, mRNA (cDNA clone
            MGC:76599 IMAGE:30094289), complete cds.
          Length = 981

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675  KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
            KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 905  KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 944

Query: 495  LPCRHRFHCACIDKWLYINATCPLCKFNI 409
            LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 945  LPCMHLFHQVCVDQWLITNKKCPICRVDI 973



>gb:BC060862_1985760 Homo sapiens ring finger protein 111, mRNA (cDNA
            clone MGC:71797 IMAGE:30336202), complete cds.
          Length = 985

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675  KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
            KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 909  KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 948

Query: 495  LPCRHRFHCACIDKWLYINATCPLCKFNI 409
            LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 949  LPCMHLFHQVCVDQWLITNKKCPICRVDI 977



>gb:AK130520_1917626 Homo sapiens cDNA FLJ27010 fis, clone SLV05175.
          Length = 297

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 35/91 (38%), Positives = 47/91 (51%), Gaps = 4/91 (4%)
 Frame = -2

Query: 663 RRLGDFEKQN-GEIQESF---GGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
           RRLGD  K+   ++Q      G   TE D D+            C +C+  Y     +R 
Sbjct: 105 RRLGDAAKKAISKLQIRTIKKGDKETESDFDN------------CAVCIEGYKPNDVVRI 152

Query: 495 LPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
           LPCRH FH +C+D WL  + TCP+CK NI+K
Sbjct: 153 LPCRHLFHKSCVDPWLLDHRTCPMCKMNILK 183



>gb:AX405832_1467760 Sequence 247 from Patent WO0222660.
          Length = 371

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675 KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
           KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 295 KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 334

Query: 495 LPCRHRFHCACIDKWLYINATCPLCKFNI 409
           LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 335 LPCMHLFHQVCVDQWLITNKKCPICRVDI 363



>gb:HSM802460_1186708 Homo sapiens mRNA; cDNA DKFZp761D081 (from
           clone DKFZp761D081).
          Length = 178

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675 KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
           KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 102 KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 141

Query: 495 LPCRHRFHCACIDKWLYINATCPLCKFNI 409
           LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 142 LPCMHLFHQVCVDQWLITNKKCPICRVDI 170



>gb:CR861381_1185379 Pongo pygmaeus mRNA; cDNA DKFZp459A112 (from
            clone DKFZp459A112).
          Length = 986

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675  KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
            KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 910  KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 949

Query: 495  LPCRHRFHCACIDKWLYINATCPLCKFNI 409
            LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 950  LPCMHLFHQVCVDQWLITNKKCPICRVDI 978



>gb:AK048110_1168293 Mus musculus 16 days embryo head cDNA, RIKEN
            full-length enriched library, clone:C130035E22
            product:arkadia, full insert sequence.
          Length = 981

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675  KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
            KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 905  KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 944

Query: 495  LPCRHRFHCACIDKWLYINATCPLCKFNI 409
            LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 945  LPCMHLFHQVCVDQWLITNKKCPICRVDI 973



>gb:AK036351_1164439 Mus musculus 16 days neonate cerebellum cDNA,
            RIKEN full-length enriched library, clone:9630060A01
            product:arkadia, full insert sequence.
          Length = 981

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675  KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
            KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 905  KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 944

Query: 495  LPCRHRFHCACIDKWLYINATCPLCKFNI 409
            LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 945  LPCMHLFHQVCVDQWLITNKKCPICRVDI 973



>pir|T46904|T46904 hypothetical protein DKFZp761D081.1 -
           human>gb:BC010369_1972594 Homo sapiens ring finger
           protein 111, mRNA (cDNA clone IMAGE:4049734), complete
           cds.
          Length = 137

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 47/89 (52%)
 Frame = -2

Query: 675 KYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRE 496
           KYK R+L    KQ+GE         TE DT+            +C ICL   ++G ++R 
Sbjct: 61  KYKKRKLHC--KQDGEEG-------TEEDTEE-----------KCTICLSILEEGEDVRR 100

Query: 495 LPCRHRFHCACIDKWLYINATCPLCKFNI 409
           LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 101 LPCMHLFHQVCVDQWLITNKKCPICRVDI 129



>pir|E85092|E85092 hypothetical protein AT4g09130 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV26_1544628 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 26.
          Length = 357

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 1/105 (0%)
 Frame = -2

Query: 720 QIRKEQPKEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAEC 541
           ++R+   K+ IE  P + +  +  F+  NG +                          EC
Sbjct: 87  RVRRGIDKDVIESFPAFLYSEVKAFKIGNGGV--------------------------EC 120

Query: 540 CICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
            ICLC ++D   LR +P C H FH  CID+WL   +TCP+C+ N+
Sbjct: 121 AICLCEFEDEEPLRWMPPCSHTFHANCIDEWLSSRSTCPVCRANL 165



>gb:BC070603_2555582 Xenopus laevis cDNA clone MGC:81253
            IMAGE:6631223, complete cds.
          Length = 959

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 555  EDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 901  EDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 951



>gb:BC054842_2101871 Mus musculus ring finger 111, mRNA (cDNA clone
           IMAGE:6485999), partial cds.
          Length = 185

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 555 EDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 127 EDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 177



>gb:AY039004_2074365 Mus musculus RNF6 protein mRNA, complete cds.
          Length = 667

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 31/91 (34%), Positives = 44/91 (48%)
 Frame = -2

Query: 690 IERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDG 511
           I RL  +     GD +   G  +E    + T       ++  L      C +C+  Y  G
Sbjct: 568 ILRLAHFFLLNEGDDDPIRGLTKEQIDNLSTRSYEQDGVDSEL---GKVCSVCISDYVAG 624

Query: 510 VELRELPCRHRFHCACIDKWLYINATCPLCK 418
            +LR+LPC H FH  CID+WL  N TCP+C+
Sbjct: 625 NKLRQLPCLHEFHIHCIDRWLSENCTCPVCR 655



>gb:AF330197_2063382 Mus musculus Arkadia (Arkadia) mRNA, complete
            cds.
          Length = 989

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 555  EDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 931  EDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 981



>gb:BC020984_1977329 Homo sapiens ring finger protein 111, mRNA
           (cDNA clone IMAGE:3851753), partial cds.
          Length = 441

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 555 EDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 383 EDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 433



>gb:AK131488_1918022 Homo sapiens cDNA FLJ16671 fis, clone
           THYMU3001428.
          Length = 602

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 555 EDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 544 EDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 594



>gb:AK131304_1917860 Homo sapiens cDNA FLJ16278 fis, clone
            NT2RI3001132, highly similar to Mus musculus Arkadia
            (Arkadia) mRNA.
          Length = 994

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 555  EDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 936  EDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLVTNKKCPICRVDI 986



>gb:AK095327_1914343 Homo sapiens cDNA FLJ38008 fis, clone
           CTONG2012452, highly similar to Mus musculus Arkadia
           (Arkadia) mRNA.
          Length = 370

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 555 EDAE--CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           ED E  C ICL   ++G ++R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 312 EDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 362



>gb:AC105773_1738245 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1562_H01, complete sequence.
          Length = 549

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 34/103 (33%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = -2

Query: 702 PKEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCA 523
           PKE +ERLP   +RR    + +                           E A+C ICL  
Sbjct: 466 PKEVVERLPVKVYRRSLKHQTE---------------------------EAAQCYICLVE 498

Query: 522 YDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKND 397
           Y +G  +R LPC H FH  C+DKWL  I+  CPLC+ ++ +++
Sbjct: 499 YAEGDCVRILPCNHEFHLTCVDKWLKEIHRVCPLCRGDVCRSN 541



>gb:AY052711_1562871 Arabidopsis thaliana AT5g59550/f2o15_210 mRNA,
           complete cds.>gb:AY063719_1565711 Arabidopsis thaliana
           AT5g59550/f2o15_210 mRNA, complete cds.
          Length = 407

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ---SNS 382
           +A C +C   ++   E RE+PC+H FH  CI  WL I  +CP+C+F +    N+   +N 
Sbjct: 196 EANCAVCTEIFETETEAREMPCKHLFHDDCIVPWLSIRNSCPVCRFELPSEPNRRSNNNE 255

Query: 381 EDV*ASNSLW 352
           ED     ++W
Sbjct: 256 EDNAVGMTIW 265



>gb:AB025604_1516269 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F2O15.
          Length = 512

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ---SNS 382
           +A C +C   ++   E RE+PC+H FH  CI  WL I  +CP+C+F +    N+   +N 
Sbjct: 301 EANCAVCTEIFETETEAREMPCKHLFHDDCIVPWLSIRNSCPVCRFELPSEPNRRSNNNE 360

Query: 381 EDV*ASNSLW 352
           ED     ++W
Sbjct: 361 EDNAVGMTIW 370



>gb:CNS07EGB_1373131 chromosome IV of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 246

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 25/45 (55%), Positives = 30/45 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
           C IC   Y  G++L+ LPC H FH  CID+WL +  TCPLCK NI
Sbjct: 188 CTICFDNYIPGIKLKFLPCGHHFHQECIDEWLDLKDTCPLCKRNI 232



>gb:AK004745_1152558 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200013I08
           product:similar to RING FINGER PROTEIN 6 [Homo sapiens],
           full insert sequence.
          Length = 667

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 31/91 (34%), Positives = 44/91 (48%)
 Frame = -2

Query: 690 IERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDG 511
           I RL  +     GD +   G  +E    + T       ++  L      C +C+  Y  G
Sbjct: 568 ILRLAHFFLLNEGDDDPIRGLTKEQIDNLSTRSYEQDGVDSEL---GKVCSVCISDYVAG 624

Query: 510 VELRELPCRHRFHCACIDKWLYINATCPLCK 418
            +LR+LPC H FH  CID+WL  N TCP+C+
Sbjct: 625 NKLRQLPCLHEFHIHCIDRWLSENCTCPVCR 655



>pir|T00481|T00481 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC004238_1531571 Arabidopsis
           thaliana chromosome 2 clone F19I3 map ve016, complete
           sequence.>gb:BT015733_1642351 Arabidopsis thaliana
           At2g35000 mRNA, complete cds.>gb:BT020192_1642587
           Arabidopsis thaliana At2g35000 mRNA, complete cds.
          Length = 378

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED 376
           EC +CLC ++D   LR +P C H FH  C+D WL  ++TCPLC+ ++V N  Q + +D
Sbjct: 134 ECAVCLCEFEDDETLRLMPPCCHVFHADCVDVWLSEHSTCPLCRADLVLN-QQGDDDD 190



>gb:AC136217_1743023 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0030I14, complete
           sequence.>gb:AC144455_1744106 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0086G17,
           complete sequence.
          Length = 385

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 25/51 (49%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           EC +CL  +DD   LR LP CRH FH  C+D+WL   A+CPLC+  +   D
Sbjct: 123 ECAVCLARFDDADLLRLLPRCRHAFHLDCVDRWLESKASCPLCRARVDAED 173



>gb:AC135594_1742644 Oryza sativa chromosome 3 BAC OSJNBa0024F18
           genomic sequence, complete sequence.>gb:AC137507_1743432
           Oryza sativa chromosome 3 BAC OSJNBb0033J23 genomic
           sequence, complete sequence.
          Length = 369

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 20/55 (36%), Positives = 38/55 (69%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           C +CL  ++ G E +E+PC+H+FH  CI  WL ++++CP+C+F +   ++++  E
Sbjct: 255 CSVCLEDFEMGTEAKEMPCQHKFHSQCILPWLELHSSCPICRFQLPTEESKNPCE 309



>gb:AC109596_1738739 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1593_C11, complete sequence.
          Length = 207

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 24/46 (52%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           +A C ICLC Y +G   R +P CRHRFH  C+D WL  +A+CP+C+
Sbjct: 129 EAACSICLCEYKEGEMQRMMPECRHRFHLMCLDAWLRRSASCPVCR 174



>gb:AY086415_1571463 Arabidopsis thaliana clone 250127 mRNA,
           complete sequence.
          Length = 204

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI-VKNDNQSNSED 376
           + EC ICL  +     ++E+PC+HRFH  CI+KWL  + +CP+C++ + V  D      +
Sbjct: 110 EGECVICLEEWKSEETVKEMPCKHRFHGGCIEKWLGFHGSCPVCRYEMPVDGDEIGKKRN 169

Query: 375 V*ASNSLWIK 346
               N +W++
Sbjct: 170 --DGNEIWVR 177



>gb:CEY47D3B_1370192 Caenorhabditis elegans YAC Y47D3B, complete
           sequence.
          Length = 487

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIV 406
           C ICL  Y++G ELR L C H FH  C+D WL     CPLC+F++V
Sbjct: 317 CVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLCQFDVV 362



>gb:AE005172_891555 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC006535_1534421 Genomic sequence
           for Arabidopsis thaliana BAC T24P13 from chromosome I,
           complete sequence.>gb:AY052705_1562865 Arabidopsis
           thaliana At1g26800/T24P13_21 mRNA, complete
           cds.>gb:AY055097_1563358 Arabidopsis thaliana
           At1g26800/T24P13_21 mRNA, complete
           cds.>gb:AF361638_1791384 Arabidopsis thaliana
           At1g26800/T24P13_21 mRNA, complete cds.
          Length = 204

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI-VKNDNQSNSED 376
           + EC ICL  +     ++E+PC+HRFH  CI+KWL  + +CP+C++ + V  D      +
Sbjct: 110 EGECVICLEEWKSEETVKEMPCKHRFHGGCIEKWLGFHGSCPVCRYEMPVDGDEIGKKRN 169

Query: 375 V*ASNSLWIK 346
               N +W++
Sbjct: 170 --DGNEIWVR 177



>pir|T26958|T26958 hypothetical protein Y47D3B.11 - Caenorhabditis
           elegans
          Length = 377

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIV 406
           C ICL  Y++G ELR L C H FH  C+D WL     CPLC+F++V
Sbjct: 317 CVICLEEYEEGTELRVLFCGHEFHPKCVDPWLLSKRRCPLCQFDVV 362



>pir|T19377|T19377 hypothetical protein C18B12.4 - Caenorhabditis
           elegans>gb:CEC18B12_1360563 Caenorhabditis elegans
           cosmid C18B12, complete sequence.
          Length = 456

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 2/59 (3%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNI-VKNDNQSNSEDV 373
           C ICL ++  G +LR LPCRH FHC CID WL      CPLCK  I   +D++ ++ D+
Sbjct: 247 CAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCKRKIGTDSDSECSTNDL 305



>pir|T47692|T47692 hypothetical protein T22E16.190 - Arabidopsis
           thaliana>gb:ATT22E16_1555257 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T22E16.>gb:BT006305_1639197
           Arabidopsis thaliana At3g55530 mRNA, complete
           cds.>gb:AF386995_1794800 Arabidopsis thaliana putative
           protein (T22E16.19) mRNA, complete cds.
          Length = 273

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 36/96 (37%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDA-ECCICLCA 523
           +E+I  LP +K++ L D E      +++      E   DS  E     ED   C +CL  
Sbjct: 159 EEEINALPVHKYKVL-DPENGCSLAKQASTSSSAEKMLDSANESKKGTEDELTCSVCLEQ 217

Query: 522 YDDGVELRELPCRHRFHCACIDKWLYINATCPLCKF 415
              G  +R LPC H+FH  CID WL    TCP+CKF
Sbjct: 218 VTVGEIVRTLPCLHQFHAGCIDPWLRQQGTCPVCKF 253



>gb:AP005399_1851144 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0676H02.
          Length = 392

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           EC +C+  +DD   LR LP C H FH  CID WL  +ATCP+C+ N+V   ++  S+
Sbjct: 124 ECAVCISEFDDDETLRLLPKCSHVFHQDCIDTWLASHATCPVCRANLVDGASEPASD 180



>gb:AP004071_1837265 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1717_A09.
          Length = 189

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           E  EC ICL  ++DG  +R LP C HRFH ACID WL  +++CP C+
Sbjct: 96  EAEECAICLVEFEDGQAVRVLPQCDHRFHAACIDTWLRAHSSCPSCR 142



>gb:AP000603_1820397 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MRP15.
          Length = 315

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 20/63 (31%), Positives = 40/63 (63%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV*A 367
           +C +CL  ++ G+E +E+PC+H+FH  C+  WL ++++CP+C++ +   D+     D   
Sbjct: 224 QCSVCLDDFEIGMEAKEMPCKHKFHSDCLLPWLELHSSCPVCRYLLPTGDDDEPKTDAET 283

Query: 366 SNS 358
           S +
Sbjct: 284 SRN 286



>gb:BT010726_1640672 Arabidopsis thaliana At3g13430 mRNA, complete
           cds.>gb:BT011661_1641183 Arabidopsis thaliana At3g13430
           mRNA, complete cds.
          Length = 315

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 20/63 (31%), Positives = 40/63 (63%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV*A 367
           +C +CL  ++ G+E +E+PC+H+FH  C+  WL ++++CP+C++ +   D+     D   
Sbjct: 224 QCSVCLDDFEIGMEAKEMPCKHKFHSDCLLPWLELHSSCPVCRYLLPTGDDDEPKTDAET 283

Query: 366 SNS 358
           S +
Sbjct: 284 SRN 286



>gb:BT010323_1640270 Arabidopsis thaliana At1g23980 mRNA, complete
           cds.>gb:AK119101_1817043 Arabidopsis thaliana At1g23980
           mRNA for unknown protein, complete cds, clone:
           RAFL21-45-G23.
          Length = 369

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           E  +C +CLC + +  +LR LP C H FH  CID WL  N+TCPLC+  +    +Q    
Sbjct: 140 EPFDCAVCLCEFSEDDKLRLLPNCSHAFHIDCIDTWLLSNSTCPLCRGTLFSLGHQFEYP 199

Query: 378 D 376
           D
Sbjct: 200 D 200



>gb:AB045120_1520332 Oryza sativa (japonica cultivar-group) EL5
           mRNA, complete cds.>gb:AP005883_1859609 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859613 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859617 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859621 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859624 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859629 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.
          Length = 325

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIV 406
           +  EC +CL   +DG E R LP C H FH  C+D WL  ++TCPLC+  +V
Sbjct: 130 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 180



>gb:AE005172_891351 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC002423_1530732 Genomic sequence
           for Arabidopsis thaliana BAC T23E23, complete sequence.
          Length = 406

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           E  +C +CLC + +  +LR LP C H FH  CID WL  N+TCPLC+  +    +Q    
Sbjct: 177 EPFDCAVCLCEFSEDDKLRLLPNCSHAFHIDCIDTWLLSNSTCPLCRGTLFSLGHQFEYP 236

Query: 378 D 376
           D
Sbjct: 237 D 237



>gb:BC056113_2551695 Xenopus laevis hypothetical protein MGC69137,
           mRNA (cDNA clone MGC:69137 IMAGE:5048403), complete cds.
          Length = 336

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 1/56 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSE 379
           C ICL  Y++G +LR LPC H +H +C+D WL     +CP+CK  +  +D+ S+++
Sbjct: 235 CAICLEEYEEGDKLRVLPCSHAYHSSCVDPWLTKTKKSCPVCKNRVFSSDSDSDTD 290



>gb:AP005511_1853144 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0011N12.
          Length = 177

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 22/48 (45%), Positives = 34/48 (70%), Gaps = 1/48 (2%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           A+C +CL    +G  +R+LP C+H FH  CID WL+ ++TCPLC+ ++
Sbjct: 114 AQCAVCLSIVQEGETVRQLPACKHLFHVGCIDMWLHSHSTCPLCRASV 161



>gb:AP004800_1845299 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0585G03.>gb:AP005297_1850076 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1734_E02.
          Length = 396

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           E  +C +CLC +D    LR LP C H FH  CID WL  N+TCPLC+
Sbjct: 148 EPFDCAVCLCEFDGEDRLRLLPVCGHAFHLHCIDTWLLSNSTCPLCR 194



>gb:AP004082_1837425 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1149_C12.
          Length = 184

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           + AEC ICL  +  G ELR LP C H FH +CID WL  +ATCP C+  +
Sbjct: 95  QQAECAICLAEFAGGEELRLLPHCGHAFHVSCIDTWLGTHATCPSCRATV 144



>gb:AC136999_1743328 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0009L15, complete sequence.
          Length = 223

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIV 406
           EC IC+  + DG E R LP C HRFH  C+D W  +++TCPLC+  ++
Sbjct: 135 ECAICIAEFADGEEGRLLPRCGHRFHARCVDMWFQLHSTCPLCRAGVL 182



>gb:CR859911_1184012 Pongo pygmaeus mRNA; cDNA DKFZp469I142 (from
           clone DKFZp469I142).
          Length = 685

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 22/53 (41%), Positives = 35/53 (66%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSN 385
           C +C+  +  G +LR+LPC H FH  CID+WL  N TCP+C+  ++ ++  +N
Sbjct: 632 CSVCISDHVTGNKLRQLPCMHEFHIHCIDRWLSENCTCPICRQPVLGSNIANN 684



>pir|B84584|B84584 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC006081_1533438 Arabidopsis
           thaliana chromosome 2 clone T2G17 map mi148, complete
           sequence.
          Length = 390

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQS 388
           EC +CL  ++D   LR LP CRH FH  CID+WL  +ATCPLC+  +   D+ S
Sbjct: 123 ECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRNRVNIEDDLS 176



>gb:BC017630_2092524 Mus musculus ring finger protein 44, mRNA (cDNA
           clone MGC:28849 IMAGE:4507289), complete
           cds.>gb:BC035548_2097840 Mus musculus ring finger
           protein 44, mRNA (cDNA clone MGC:40655 IMAGE:4221284),
           complete cds.
          Length = 339

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 31/94 (32%), Positives = 40/94 (42%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C   +
Sbjct: 264 KADIEQLPSYRF---------------------------NPDSH--QSEQTLCVVCFSDF 294

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 295 EVRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 328



>gb:AK129290_2069521 Mus musculus mRNA for mKIAA1100 protein.
          Length = 384

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 31/94 (32%), Positives = 40/94 (42%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C   +
Sbjct: 309 KADIEQLPSYRF---------------------------NPDSH--QSEQTLCVVCFSDF 339

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 340 EVRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 373



>gb:AB016984_2043938 Mus musculus mRNA for Sperizin, complete cds.
          Length = 326

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSEDV 373
           C ICL  Y++G  L+ LPC H +HC CID W     A+CPLCK ++    + S    V
Sbjct: 209 CAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAGASCPLCKQSVASTHDGSTDGSV 266



>gb:BC039833_1982645 Homo sapiens ring finger protein 44, mRNA (cDNA
           clone MGC:48792 IMAGE:5535911), complete
           cds.>gb:BC063297_1986138 Homo sapiens ring finger
           protein 44, mRNA (cDNA clone MGC:71656 IMAGE:30349418),
           complete cds.
          Length = 432

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 31/94 (32%), Positives = 40/94 (42%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C   +
Sbjct: 357 KADIEQLPSYRF---------------------------NPDSH--QSEQTLCVVCFSDF 387

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 388 EARQLLRVLPCNHEFHTKCVDKWLKANRTCPICR 421



>gb:AB029023_1865879 Homo sapiens mRNA for KIAA1100 protein, partial
           cds.
          Length = 444

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 31/94 (32%), Positives = 40/94 (42%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C   +
Sbjct: 369 KADIEQLPSYRF---------------------------NPDSH--QSEQTLCVVCFSDF 399

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 400 EARQLLRVLPCNHEFHTKCVDKWLKANRTCPICR 433



>gb:AP005775_1857666 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBb0005A04.>gb:AP006060_1860696 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0135D07.
          Length = 210

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           +DA+C ICL  Y++   LR +P CRH FH +CID WL    TCP+C+ ++
Sbjct: 105 DDAQCSICLGEYNEKEILRIMPKCRHNFHLSCIDVWLQKQTTCPICRISL 154



>gb:AP005522_1853405 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0479H10.
          Length = 436

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 25/47 (53%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           E  +C +CLC +D    LR LP C H FH  CID WL  N+TCPLC+
Sbjct: 186 EPFDCAVCLCEFDAEDRLRLLPLCGHAFHLHCIDTWLLSNSTCPLCR 232



>gb:AP003104_1824714 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0038J17.
          Length = 237

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           A+C +CL    DG ++RELP CRH FH  C+D WL    TCPLC+
Sbjct: 127 ADCAVCLSELADGEKVRELPNCRHVFHVECVDAWLRSRTTCPLCR 171



>gb:AP003104_1824708 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0038J17.
          Length = 166

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 9/62 (14%)
 Frame = -2

Query: 567 VLPPED--------AECCICLCAYDDGVELRELPC-RHRFHCACIDKWLYINATCPLCKF 415
           VLPP          AEC +CL A ++G  +R LPC  H FH  C+D WL +  TCPLC+ 
Sbjct: 85  VLPPRRGGSAAAAAAECAVCLGAVEEGETVRALPCCPHAFHARCVDAWLRLRPTCPLCRA 144

Query: 414 NI 409
           ++
Sbjct: 145 DV 146



>gb:AB010699_1511248 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSN9.>gb:AK176313_1818301 Arabidopsis thaliana
           mRNA for RING finger -like protein, complete cds, clone:
           RAFL23-27-L12.
          Length = 376

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 24/47 (51%), Positives = 31/47 (65%), Gaps = 1/47 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           E  +C +CLC + +  +LR LP C H FH  CID WL  N+TCPLC+
Sbjct: 139 EPFDCAVCLCEFSEKDKLRLLPMCSHAFHLNCIDTWLQSNSTCPLCR 185



>gb:BT015305_1358382 Drosophila melanogaster AT15166 full insert cDNA.
          Length = 1256

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query: 555  EDAE-CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            EDAE C ICL  ++   E+R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 1182 EDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI 1231



>gb:HSM805597_1187613 Homo sapiens mRNA; cDNA DKFZp434F1431 (from
           clone DKFZp434F1431).
          Length = 354

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 31/94 (32%), Positives = 40/94 (42%)
 Frame = -2

Query: 699 KEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAY 520
           K DIE+LP Y+F                           +P  H    E   C +C   +
Sbjct: 279 KADIEQLPSYRF---------------------------NPDSH--QSEQTLCVVCFSDF 309

Query: 519 DDGVELRELPCRHRFHCACIDKWLYINATCPLCK 418
           +    LR LPC H FH  C+DKWL  N TCP+C+
Sbjct: 310 EARQLLRVLPCNHEFHTKCVDKWLKANRTCPICR 343



>gb:AE014297_1139070 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1139071 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE003692_1221063
            Drosophila melanogaster chromosome 3R, section 30 of 118
            of the complete sequence.>gb:AE003692_1221064 Drosophila
            melanogaster chromosome 3R, section 30 of 118 of the
            complete sequence.>gb:AY058520_1291674 Drosophila
            melanogaster LD22771 full length cDNA.
          Length = 1256

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query: 555  EDAE-CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            EDAE C ICL  ++   E+R LPC H FH  C+D+WL  N  CP+C+ +I
Sbjct: 1182 EDAEKCAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI 1231



>pir|T39476|T39476 probable serine-rich zinc-finger protein -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC15C4_1719024 S.pombe chromosome II cosmid
           c15C4.
          Length = 556

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = -2

Query: 651 DFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVEL-RELPCRHRF 475
           D++    E  +  G V+T  +  S        +  EC ICLC Y +   L RELPC H F
Sbjct: 467 DWKLDKSESFDGQGNVVTTAERGSKYF-----DQRECTICLCEYSEESPLYRELPCHHIF 521

Query: 474 HCACIDKWLYINA-TCPLCK---FNIVKNDNQSN 385
           H ACID +L  N+  CPLCK    N+++N ++ N
Sbjct: 522 HPACIDPYLLKNSDLCPLCKQSVTNMLENASEDN 555



>pir|D84899|D84899 hypothetical protein At2g46160 [imported] -
           Arabidopsis thaliana>gb:AC005397_1532660 Arabidopsis
           thaliana chromosome 2 clone T3F17 map CIC02E07, complete
           sequence.>gb:AY074641_1567643 Arabidopsis thaliana
           At2g46160/T3F17.19 mRNA, complete cds.
          Length = 214

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 22/46 (47%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           D  C ICLC Y +   LR +P C+H FH  C+D WL +N +CP+C+
Sbjct: 135 DTTCSICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCR 180



>pir|G96528|G96528 protein F27J15.2 [imported] - Arabidopsis
           thaliana>gb:AE005173_892861 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016041_1538065 Genomic sequence for
           Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.
          Length = 426

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVK 403
           LP  D EC ICL  +  G +LR LP C H FH  CIDKWL  + TCP C+  +V+
Sbjct: 128 LPGLDEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRNCLVE 182



 Score = 38.1 bits (87), Expect = 0.19
 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATC 430
           LP  D EC ICL  +     ++ LP C H FH  CIDK   I  TC
Sbjct: 343 LPGLDTECAICLSEFVAEERVKLLPTCHHGFHVRCIDKHCLIQ-TC 387



>pir|F86458|F86458 unknown protein, 73879-71181 [imported] -
           Arabidopsis thaliana>gb:AE005172_892162 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC051630_1540100 Arabidopsis thaliana
           chromosome 1 BAC F10C21 genomic sequence, complete
           sequence.
          Length = 508

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 22/60 (36%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED 376
           D++C +CL  Y    +L+++P C+H FH  CID WL  + TCPLC+  ++ + ++ + +D
Sbjct: 97  DSQCSVCLGDYQPNDKLQQIPVCKHTFHMDCIDLWLTSHTTCPLCRLALIPSRSRQSQDD 156



>gb:HSM805319_2017870 Homo sapiens mRNA; cDNA DKFZp566H073 (from
           clone DKFZp566H073).
          Length = 349

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSED 376
           C ICL  Y+DG +LR LPC H +H  C+D WL     TCP+CK  + +     + E+
Sbjct: 229 CAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEE 285



>gb:HSM800147_2017112 Homo sapiens mRNA; cDNA DKFZp566H073 (from
           clone DKFZp566H073); partial cds.
          Length = 324

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSED 376
           C ICL  Y+DG +LR LPC H +H  C+D WL     TCP+CK  + +     + E+
Sbjct: 204 CAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEE 260



>gb:AK025329_1910269 Homo sapiens cDNA: FLJ21676 fis, clone
           COL09164.>gb:BC010139_1972512 Homo sapiens ring finger
           protein 167, mRNA (cDNA clone MGC:19468 IMAGE:4128232),
           complete cds.>gb:CR457340_1993547 Homo sapiens full open
           reading frame cDNA clone RZPDo834B0918D for gene
           DKFZP566H073, DKFZP566H073 protein; complete cds, incl.
           stopcodon.
          Length = 350

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSED 376
           C ICL  Y+DG +LR LPC H +H  C+D WL     TCP+CK  + +     + E+
Sbjct: 230 CAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEE 286



>gb:AP006067_1860833 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0569E11.
          Length = 325

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 21/51 (41%), Positives = 32/51 (62%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDN 394
           +C IC   ++DG  L  LPC+H +H  CI++WL IN  CP+C   +  +D+
Sbjct: 272 QCVICRVEFEDGESLIALPCKHSYHPECINQWLQINKVCPMCSAEVSTSDS 322



>gb:AP004048_1836914 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1202_E07.>gb:AP004878_1846457 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0474F11.
          Length = 320

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQ 391
           + +EC +C+  + +   +R LP C H FH  CID WL  NA CPLC+  I  ND+Q
Sbjct: 138 DSSECAVCISEFQEEERVRLLPSCLHVFHVDCIDTWLQGNANCPLCRAAIATNDSQ 193



>gb:AK118283_1816270 Arabidopsis thaliana At3g19950 mRNA for unknown
           protein, complete cds, clone: RAFL19-57-J08.
          Length = 121

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 19/57 (33%), Positives = 39/57 (68%)
 Frame = -2

Query: 567 VLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           +L  E  +C +C+  ++DG +++++PC+H FH  C+  WL ++ +CP+C+F +  +D
Sbjct: 1   MLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDD 57



>gb:AF499720_1806143 Thellungiella halophila putative RING zinc
           finger protein-like protein mRNA, complete cds.
          Length = 164

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIV 406
           ED EC +CL  +++  E+ +L C H FH  C++KW+ Y N TCPLC+  +V
Sbjct: 98  EDNECSVCLSKFEEDSEINKLKCGHLFHKTCLEKWIDYWNITCPLCRTPLV 148



>gb:OSJN00098_1694868 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0016D16, complete
           sequence.>gb:OSJN00157_1695859 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0013K16, complete
           sequence.
          Length = 359

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           LP    +C +CL  +    ELR LP CRH FH AC+D WL    +CPLC+  +
Sbjct: 121 LPKSSPDCAVCLSPFTLDAELRLLPACRHAFHAACVDAWLRTTPSCPLCRATV 173



>gb:AY095995_1575869 Arabidopsis thaliana AT3g19950/MPN9_19 mRNA,
           complete cds.>gb:BT000583_1634861 Arabidopsis thaliana
           unknown protein (At3g19950/MPN9_19) mRNA, complete cds.
          Length = 328

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 19/57 (33%), Positives = 39/57 (68%)
 Frame = -2

Query: 567 VLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           +L  E  +C +C+  ++DG +++++PC+H FH  C+  WL ++ +CP+C+F +  +D
Sbjct: 208 MLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDD 264



>gb:AB025631_1516571 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPN9.
          Length = 386

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 19/57 (33%), Positives = 39/57 (68%)
 Frame = -2

Query: 567 VLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           +L  E  +C +C+  ++DG +++++PC+H FH  C+  WL ++ +CP+C+F +  +D
Sbjct: 266 MLKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLELHNSCPVCRFELPTDD 322



>gb:AY203930_1176298 Homo sapiens LP2254 mRNA, complete cds.
          Length = 229

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSED 376
           C ICL  Y+DG +LR LPC H +H  C+D WL     TCP+CK  + +     + E+
Sbjct: 109 CAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEE 165



>pir|T08729|T08729 RING zinc finger protein homolog DKFZp566H073.1 -
           human  (fragment)
          Length = 324

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSED 376
           C ICL  Y+DG +LR LPC H +H  C+D WL     TCP+CK  + +     + E+
Sbjct: 204 CAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEE 260



>gb:AY533211_2086313 Chinchilla lanigera goliath protein mRNA,
           partial cds.
          Length = 193

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 29/84 (34%), Positives = 43/84 (51%)
 Frame = -2

Query: 663 RRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCR 484
           RRLGD  K+      +      + +TD   +H        C +C+ +Y     +R LPC+
Sbjct: 118 RRLGDAAKKAISKLTTRTVKKGDKETDPDFDH--------CAVCIESYKQNDVVRILPCK 169

Query: 483 HRFHCACIDKWLYINATCPLCKFN 412
           H FH +C+D WL  + TCP+CK N
Sbjct: 170 HVFHKSCVDPWLSEHCTCPMCKLN 193



>gb:AL596117_2070852 Mouse DNA sequence from clone RP23-326P7 on
           chromosome 11 Contains the Gp1ba gene for glycoprotein
           1b alpha polypeptide, the Slc25a11 gene for solute
           carrier family 25 (mitochondrial carrier; oxoglutarate
           carrier) member 11, the gene for a novel PA domain and
           C3HC4 type zinc finger (RING finger) containing protein,
           the Pfn1 gene for profilin 1, five novel genes, the Eno3
           gene for muscle enolase 3 beta, the Spag7 gene for sperm
           associated antigen 7, the Kif1c gene for kinesin family
           member 1C, a ribosomal protein 37A (Rpl37a) pseudogene,
           the gene for a novel zinc finger protein and six CpG
           islands, complete sequence.>gb:BC010777_2091109 Mus
           musculus ring finger protein 167, mRNA (cDNA clone
           MGC:18686 IMAGE:4241357), complete cds.
          Length = 347

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSED 376
           C ICL  Y+DG +LR LPC H +H  C+D WL     TCP+CK  + +       E+
Sbjct: 230 CAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEEQEE 286



>gb:AP004213_1838879 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1111_H02.>gb:AP005918_1860105 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0419H09.
          Length = 413

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 24/47 (51%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           EC +CL  +DD   LR LP C H FH  CID WL  + TCP+C+ N+
Sbjct: 144 ECAVCLSEFDDDETLRLLPRCSHAFHADCIDAWLASHVTCPVCRANL 190



>gb:OSJN00057_1694040 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0010D21, complete sequence.
          Length = 667

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 23/52 (44%), Positives = 31/52 (59%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKN 400
           E+  CCIC   Y DG +L  L C H FH  C+ +WL +  TCP+CK   +K+
Sbjct: 616 EEEPCCICQEEYVDGDDLGTLDCGHDFHVGCVRQWLVVKNTCPICKNTALKS 667



>pir|T51842|T51842 RING-H2 finger protein RHA2a [imported] -
           Arabidopsis thaliana>gb:AE005172_890506 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AY075590_1567744 Arabidopsis thaliana
           At1g15100/F9L1_3 mRNA, complete cds.>gb:AY088303_1573323
           Arabidopsis thaliana clone 5398 mRNA, complete
           sequence.>gb:AY094057_1575563 Arabidopsis thaliana
           At1g15100/F9L1_3 mRNA, complete cds.>gb:F9L1_1678712
           Arabidopsis thaliana chromosome 1 BAC F9L1 sequence,
           complete sequence.>gb:AF078822_1766277 Arabidopsis
           thaliana RING-H2 finger protein RHA2a mRNA, complete
           cds.
          Length = 155

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELPCRHRFHCACIDKWLY-INATCPLCKFNIVKNDNQSNSE 379
           ++C +CL    +G E+R+L CRH FH  C++ WL+  N TCPLC+  +V +D  S ++
Sbjct: 84  SDCVVCLSKLKEGEEVRKLECRHVFHKKCLEGWLHQFNFTCPLCRSALVSDDCVSKTQ 141



>gb:BC083670_2108745 Rattus norvegicus similar to RIKEN cDNA
           5730408C10 (predicted), mRNA (cDNA clone MGC:94514
           IMAGE:7135651), complete cds.
          Length = 349

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNSED 376
           C ICL  Y+DG +LR LPC H +H  C+D WL     TCP+CK  + +       E+
Sbjct: 230 CAICLDEYEDGDKLRILPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEEQEE 286



>gb:AP004096_1837667 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1743_B12.
          Length = 502

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           LP    +C +CL  +    ELR LP CRH FH +C+D WL    +CPLC+  +
Sbjct: 271 LPKSSPDCAVCLSPFAPEAELRLLPACRHAFHASCVDAWLRTTPSCPLCRATV 323



>gb:AP003104_1824710 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0038J17.
          Length = 233

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 32/92 (34%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = -2

Query: 690 IERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDG 511
           I RLP + + R  D    +GE+ +S                       EC +CL A D+G
Sbjct: 89  IARLPSFPYVRARD----DGEVSDSASS-----------------SSVECAVCLSAVDEG 127

Query: 510 VELRELP-CRHRFHCACIDKWLYINATCPLCK 418
             +R+LP C H FH  CID WL   A+CP+C+
Sbjct: 128 ETVRQLPACGHVFHRECIDMWLSSRASCPVCR 159



>gb:BT005844_1638766 Arabidopsis thaliana At4g24010 gene, complete
           cds.
          Length = 174

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 1/64 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQS 388
           L   D+ CC+CL  ++   EL E+P C+H FH  CI  WLY + TCPLC+ ++  +  ++
Sbjct: 98  LGTRDSLCCVCLGEFELKEELVEMPLCKHIFHLDCIHLWLYSHNTCPLCRSSVSISSTKT 157

Query: 387 NSED 376
           + +D
Sbjct: 158 SVDD 161



>gb:AY039551_1560264 Arabidopsis thaliana At1g49200/F27J15_35 mRNA,
           complete cds.>gb:AY093753_1575413 Arabidopsis thaliana
           At1g49200/F27J15_35 mRNA, complete cds.
          Length = 226

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/105 (35%), Positives = 48/105 (45%), Gaps = 17/105 (16%)
 Frame = -2

Query: 666 FRRLGDFEKQNGEIQESFGGVMTECDTDS-----------PI-----EHVLPPEDAECCI 535
           FRR   F      I E   G+ T C + +           P+     E  LP    EC I
Sbjct: 84  FRRTSSFM-----ISEPIAGLSTPCGSSNKGINKKALRMFPVVSYSPEMNLPGLGEECVI 138

Query: 534 CLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVK 403
           CL  +  G ++R LP C H FH  CIDKWL  + TCP C+  +V+
Sbjct: 139 CLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQQHLTCPKCRHCLVE 183



>pir|T51844|T51844 RING-H2 finger protein RHA3a [imported] -
           Arabidopsis thaliana>gb:AC007584_1535964 Arabidopsis
           thaliana chromosome 2 clone MJB20 map mi398, complete
           sequence.>gb:AY062961_1565551 Arabidopsis thaliana
           putative RING zinc finger protein (At2g17450) mRNA,
           complete cds.>gb:AF078824_1766279 Arabidopsis thaliana
           RING-H2 finger protein RHA3a mRNA, complete
           cds.>gb:AF370239_1792124 Arabidopsis thaliana putative
           RING zinc finger protein (At2g17450) mRNA, complete cds.
          Length = 185

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 24/47 (51%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           +  EC ICL  + DG E+R LP C H FH  CIDKWL   ++CP C+
Sbjct: 98  DSTECAICLTDFADGEEIRVLPLCGHSFHVECIDKWLVSRSSCPSCR 144



>pir|H84566|H84566 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC005724_1532943 Arabidopsis
           thaliana chromosome 2 clone MSF3 map CIC06E08, complete
           sequence.
          Length = 423

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 1/48 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIV 406
           +C +CLC ++   +LR LP C H FH  CID WL  ++TCPLC+ N++
Sbjct: 125 DCPVCLCEFETEDKLRLLPKCSHAFHVECIDTWLLSHSTCPLCRSNLL 172



>pir|F85097|F85097 hypothetical protein AT4g09560 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV27_1544670 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 27.
          Length = 431

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCK 418
           CCICL  Y+ G +LR LPC H+FH AC+D WL    + CP+CK
Sbjct: 217 CCICLENYEKGDKLRILPCHHKFHVACVDLWLGQRKSFCPVCK 259



>pir|C86358|C86358 Similar to zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AE005172_891204 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC006551_1534442 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.>gb:BT011235_1640985 Arabidopsis thaliana
           At1g22500 gene, complete cds.>gb:BT012542_1641612
           Arabidopsis thaliana At1g22500 gene, complete cds.
          Length = 381

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 27/62 (43%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           E  EC +CL  ++D   LR +P C H FH  CID WL    TCPLC+ N+V    +S S 
Sbjct: 114 EALECPVCLNEFEDDETLRLIPQCCHVFHPGCIDAWLRSQTTCPLCRANLVPVPGESVSS 173

Query: 378 DV 373
           ++
Sbjct: 174 EI 175



>gb:BC079249_2107374 Rattus norvegicus cDNA clone MGC:94340
           IMAGE:7133029, complete cds.
          Length = 381

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 29/76 (38%), Positives = 43/76 (56%)
 Frame = -2

Query: 630 EIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELPCRHRFHCACIDKW 451
           E++++FG +      +   E V P  D+ C IC  AY     +R L C+H FH  CID W
Sbjct: 229 ELKKAFGQLQVRILKEGD-EEVSPNADS-CVICFEAYKPNEIVRILTCKHFFHKNCIDPW 286

Query: 450 LYINATCPLCKFNIVK 403
           +  + TCP+CK +I+K
Sbjct: 287 ILAHGTCPMCKCDILK 302



>gb:AY155441_2076913 Mus musculus goliath-related E3 ubiquitin
           ligase 2 (Greul2) mRNA, partial cds.
          Length = 340

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 1/97 (1%)
 Frame = -2

Query: 690 IERLPKYKFRRLG-DFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDD 514
           + R+   +++RL  + +K  G++Q     V+ E D     E V P  D+ C IC  AY  
Sbjct: 174 VARIENRRWKRLTRELKKAFGQLQVR---VLKEGD-----EEVNPNADS-CVICFEAYKP 224

Query: 513 GVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
              +R L C+H FH  CID W+  + TCP+CK +I+K
Sbjct: 225 NEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDILK 261



>gb:AP004888_1846658 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005751_1857171 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0072H09.
          Length = 320

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 1/96 (1%)
 Frame = -2

Query: 633 GEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDDGVELRELP-CRHRFHCACID 457
           G+   + GG+  E   + P  HV+     EC +CL A+  G   R LP C H FH  C+D
Sbjct: 222 GQHDVARGGLSAEQVGELPC-HVVKEGAGECAVCLEAFRAGDRRRVLPRCEHGFHAQCVD 280

Query: 456 KWLYINATCPLCKFNIVKNDNQSNSEDV*ASNSLWI 349
            WL ++  CP+C+  +  +  +     V  + SL I
Sbjct: 281 SWLRVSRLCPICRAEVAASRGKEGDAPVAEAASLEI 316



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           EC +CL A+  G   R LP C H FH  C+D WL  +  CP+C+  +
Sbjct: 78  ECAVCLEAFQAGDRCRVLPRCEHGFHARCVDSWLRQSRVCPICRAEV 124



>gb:AP004564_1841652 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0479C12.>gb:AP004764_1844656 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0708B04.
          Length = 501

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIV 406
           +C +CLC + D   LR LP C H FH  CID WL  ++TCPLC+ +++
Sbjct: 152 DCAVCLCEFADDDRLRLLPKCSHAFHVDCIDTWLLSHSTCPLCRRSLL 199



>gb:AF474072_1803110 Hordeum vulgare sp. vulgare cultivar Morex BAC
           clone 773k14, complete sequence.
          Length = 194

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query: 546 ECCICLCAYDDGVE--LRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED 376
           EC +CL  +D   +  LR LP CRH FH  C+D WL  ++TCP+C+  + K D  +   +
Sbjct: 111 ECAVCLGTFDPAADELLRVLPKCRHAFHADCVDTWLEAHSTCPVCRRRVGKEDAFAVIPE 170

Query: 375 V*ASNSLW 352
           + A+++ W
Sbjct: 171 LEAADADW 178



>gb:SPAP32A8_1718596 S.pombe chromosome I p1 p32A8.
          Length = 513

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSED 376
           E+ EC IC+  +    ++ +LPC+H FH  CI  WL +N TC +C+  +  N  Q N+  
Sbjct: 392 EEGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTCAICRAPVDPNSQQRNNTS 451

Query: 375 V*ASN 361
             ++N
Sbjct: 452 TDSAN 456



>gb:AB026654_1517308 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MVE11.
          Length = 222

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVK 403
           LP  D EC ICL  +  G  ++ LP C H FH  CIDKWL  +++CP C+  +++
Sbjct: 131 LPGLDTECAICLSEFASGERVKLLPKCHHGFHVRCIDKWLSSHSSCPTCRHCLIQ 185



>gb:AK028082_1160781 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700042K15
           product:hypothetical Protease associated (PA)
           domain/RING finger containing protein, full insert
           sequence.
          Length = 339

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 1/97 (1%)
 Frame = -2

Query: 690 IERLPKYKFRRLG-DFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDD 514
           + R+   +++RL  + +K  G++Q     V+ E D     E V P  D+ C IC  AY  
Sbjct: 172 VARIENRRWKRLTRELKKAFGQLQVR---VLKEGD-----EEVNPNADS-CVICFEAYKP 222

Query: 513 GVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
              +R L C+H FH  CID W+  + TCP+CK +I+K
Sbjct: 223 NEIVRILTCKHFFHKNCIDPWILAHGTCPMCKCDILK 259



>gb:AE016959_1023658 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC073166_1540974
           Oryza sativa chromosome 10 BAC OSJNBb0064P21 genomic
           sequence, complete sequence.>gb:AE017116_1753477 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           70 of 77 of the complete sequence.
          Length = 255

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           AEC ICL  + +  E+R +P C H FH AC+D WL  N++CP C+  IV +D
Sbjct: 156 AECAICLSEFGEREEVRVMPQCGHGFHVACVDTWLRSNSSCPSCRRPIVLDD 207



>pir|T41745|T41745 RING-H2 finger protein RHA3b [imported] -
           Arabidopsis thaliana>gb:ATCHRIV83_1547508 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           83.>gb:ATF15J1_1548714 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F15J1, partial sequence (ESSA
           project).>gb:AY087082_1572118 Arabidopsis thaliana clone
           31493 mRNA, complete sequence.>gb:AF078825_1766280
           Arabidopsis thaliana RING-H2 finger protein RHA3b mRNA,
           complete cds.
          Length = 200

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           EC IC+  + +G E+R LP C H FH ACIDKWL   ++CP C+
Sbjct: 112 ECAICITEFSEGEEIRILPLCSHAFHVACIDKWLTSRSSCPSCR 155



>gb:BC067341_2554700 Danio rerio zgc:77843, mRNA (cDNA clone
           MGC:77843 IMAGE:7002238), complete cds.
          Length = 389

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 7/97 (7%)
 Frame = -2

Query: 672 YKFRRLGDFEKQN-------GEIQESFGGVMTECDTDSPIEHVLPPEDAECCICLCAYDD 514
           Y  RRL    +QN        E +++ G +          E  + P+   C +C+ +Y  
Sbjct: 208 YSARRLNSLRQQNRSQKKLKAEAKKAIGQLQVRTLRQGDQE--IGPDADACAVCIDSYKA 265

Query: 513 GVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVK 403
           G  L  L C H FH +CI+ WL  + TCP+CK +I+K
Sbjct: 266 GDVLSILTCNHFFHKSCIEPWLLEHRTCPMCKCDILK 302



>gb:AP005723_1856573 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0001B21.
          Length = 251

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIV 406
           +CC+CL    +   LR+LP C HRFH  CI KWL  + TCP+C+   V
Sbjct: 184 KCCVCLAGMREAQALRDLPRCGHRFHAKCIGKWLTAHPTCPVCRTTAV 231



>gb:AP005511_1853146 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0011N12.
          Length = 317

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = -2

Query: 552 DAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           +AEC +CL    DG  +R LP C H FH  C+D WL  + TCP+C+
Sbjct: 117 EAECAVCLSGMQDGDAVRALPGCGHAFHAGCVDAWLRAHGTCPVCR 162



>gb:AP004762_1844616 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686H11.
          Length = 167

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELPCRHRFHCACIDKWL-YINATCPLCKFNIVKNDNQSNS 382
           A+C +CL  ++    +  LPC H FH AC++KWL Y +ATCPLC+  ++    +S S
Sbjct: 98  ADCRVCLARFEPESVVNRLPCGHLFHRACLEKWLDYDHATCPLCRHRLLPATTESPS 154



>gb:AP003633_1831821 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0637D03.
          Length = 181

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = -2

Query: 558 PEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           P  A C ICL  + DG  +R LP C HRFH  CID+WL  + +CP C+
Sbjct: 106 PSVAGCAICLSDFADGERVRLLPACGHRFHVVCIDRWLLAHCSCPTCR 153



>gb:AC152974_1745244 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNOa0153K02, complete sequence.
          Length = 200

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 23/45 (51%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           AEC +C+  + DG   R LP C HRFH  CI  WL +++TCPLC+
Sbjct: 131 AECAVCIVEFRDGDRARLLPRCGHRFHADCIGAWLQLHSTCPLCR 175



>gb:AC134348_1741773 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0530H10, complete sequence.
          Length = 202

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 23/45 (51%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           AEC +C+  + DG   R LP C HRFH  CI  WL +++TCPLC+
Sbjct: 131 AECAVCIVEFRDGDRARLLPRCGHRFHADCIGAWLQLHSTCPLCR 175



>gb:OSJN00157_1695846 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0013K16, complete sequence.
          Length = 192

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           E +EC ICL  ++ G  +R LP C H FH ACIDKWL  +++CP C+
Sbjct: 104 EQSECAICLSDFEHGDAMRVLPQCGHAFHAACIDKWLRGHSSCPSCR 150



>gb:BT010932_1640878 Arabidopsis thaliana At1g49210 gene, complete
           cds.>gb:BT011647_1641169 Arabidopsis thaliana At1g49210
           mRNA, complete cds.
          Length = 225

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVK 403
           LP    EC ICL  +  G +LR LP C H FH  CIDKWL  + TCP C+  +V+
Sbjct: 128 LPGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCLVE 182



>gb:AY054187_1563009 Arabidopsis thaliana AT4g30400/F17I23_260 mRNA,
           complete cds.>gb:AY103309_1578137 Arabidopsis thaliana
           AT4g30400/F17I23_260 mRNA, complete cds.
          Length = 472

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKN 400
           +C +CLC ++   +LR LP C H FH  CID WL  ++TCPLC+ +++ +
Sbjct: 133 DCAVCLCEFETEDKLRLLPKCSHAFHMDCIDTWLLSHSTCPLCRSSLLSD 182



>gb:AC073556_1541133 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 537

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 25/43 (58%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINAT-CPLCK 418
           C ICL  Y+ G +LR LPCRH+FH AC+D WL    T CP+CK
Sbjct: 240 CAICLEDYNVGEKLRVLPCRHKFHAACVDLWLTTWRTFCPVCK 282



>gb:AB010697_1511206 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MOJ9.
          Length = 159

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = -2

Query: 558 PEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           P +  C ICLC Y+    +R +P C H FH  C+D+WL  +ATCPLC+
Sbjct: 89  PNNGPCSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCR 136



>gb:AK005843_1153258 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700010L20
           product:SPERIZIN homolog [Mus musculus], full insert
           sequence.
          Length = 327

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 2/59 (3%)
 Frame = -2

Query: 543 CCICLCAYDDGVELRELPCRHRFHCACIDKWLYINA--TCPLCKFNIVKNDNQSNSEDV 373
           C ICL  Y++G  L+ LPC H +HC CID W    A  +CPLCK ++    + S    V
Sbjct: 209 CAICLDDYEEGERLKILPCAHAYHCRCIDPWFSRAAQRSCPLCKQSVASTHDGSTDGSV 267



>gb:AE005173_892860 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC016041_1538066 Genomic sequence
           for Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.
          Length = 319

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 27/55 (49%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = -2

Query: 564 LPPEDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVK 403
           LP    EC ICL  +  G +LR LP C H FH  CIDKWL  + TCP C+  +V+
Sbjct: 222 LPGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCLVE 276



>pir|G86275|G86275 F7A19.29 protein - Arabidopsis
           thaliana>gb:AE005172_890411 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007576_1535958 Arabidopsis thaliana
           chromosome I BAC F7A19 genomic sequence, complete
           sequence.>gb:BT004591_1637625 Arabidopsis thaliana
           At1g14200 gene, complete cds.
          Length = 179

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 29/104 (27%), Positives = 47/104 (45%)
 Frame = -2

Query: 720 QIRKEQPKEDIERLPKYKFRRLGDFEKQNGEIQESFGGVMTECDTDSPIEHVLPPEDAEC 541
           Q R    K ++E +P+             GE +E +GG                     C
Sbjct: 80  QGRSPALKSEVENMPRVVI----------GEDKEKYGG--------------------SC 109

Query: 540 CICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNI 409
            ICL  +  G    E+PC+H+FH  C+++WL  +ATCP+C++ +
Sbjct: 110 AICLDEWSKGDVAAEMPCKHKFHSKCVEEWLGRHATCPMCRYEM 153



>pir|E85355|E85355 hypothetical protein AT4g30400 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV73_1546961 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 73.
          Length = 465

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKN 400
           +C +CLC ++   +LR LP C H FH  CID WL  ++TCPLC+ +++ +
Sbjct: 126 DCAVCLCEFETEDKLRLLPKCSHAFHMDCIDTWLLSHSTCPLCRSSLLSD 175



>gb:AP005511_1853134 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBa0011N12.>gb:AP005614_1854976 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0090H18.
          Length = 189

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = -2

Query: 549 AECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           A C +CL     G  +R+LP CRH FH  CID WL+ ++TCPLC+ N+
Sbjct: 109 ALCSVCLEDVQAGEMVRQLPACRHLFHVGCIDMWLHSHSTCPLCRCNV 156



>gb:AP005425_1851637 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0644A02.
          Length = 442

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 24/47 (51%), Positives = 31/47 (65%), Gaps = 1/47 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           EC +CL  +DD  ELR LP C H FH  CI +WL  + TCP+C+ N+
Sbjct: 153 ECAVCLSEFDDDEELRLLPKCSHAFHPDCIGEWLAGHVTCPVCRCNL 199



>gb:AP003722_1832388 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1011A07.>gb:AP003934_1835483 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551A11.
          Length = 399

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 22/47 (46%), Positives = 31/47 (65%), Gaps = 1/47 (2%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNI 409
           +C +CL  ++ G + R LP C HRFH  CID W   N+TCPLC+ ++
Sbjct: 296 DCAVCLAEFEAGDKARALPRCGHRFHVECIDAWFRENSTCPLCRADV 342



>gb:AF211532_1777392 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
           protein 132 (ACRE132) mRNA, complete cds.
          Length = 256

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSEDV* 370
           EC +CL    +G   R LP C H FH  CID W + ++TCPLC+  + +   +S SE + 
Sbjct: 105 ECSVCLSEVSEGENTRVLPKCNHGFHVDCIDMWFHSHSTCPLCRNPVSEQSAESISETIG 164

Query: 369 AS 364
           +S
Sbjct: 165 SS 166



>gb:AC097175_1736469 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1119_H02, complete sequence.
          Length = 323

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 19/59 (32%), Positives = 37/59 (62%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELPCRHRFHCACIDKWLYINATCPLCKFNIVKNDNQSNSE 379
           E   C +CL   + G + +++PC H+FH +CI  WL ++++CP+C+F +   + +  +E
Sbjct: 195 EVVSCSVCLDDLEVGSQAKQMPCEHKFHSSCILPWLELHSSCPVCRFELPSEETKDLNE 253



>gb:NCB24P11_1689926 Neurospora crassa DNA linkage group II BAC
           clone B24P11.
          Length = 529

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 2/71 (2%)
 Frame = -2

Query: 615 FGGVMTECDTDSPIEHVLPPE-DAECCICLCAYDDGVELRELPCRHRFHCACIDKWLY-I 442
           +G      +T   IE+  P + +  C IC   +  G ++R LPC HR+H AC+D WL  I
Sbjct: 330 YGAQTGMTNTAGDIENTTPDDINLGCPICTEDFTIGEDVRVLPCNHRYHPACVDPWLVNI 389

Query: 441 NATCPLCKFNI 409
           + TCPLC+ ++
Sbjct: 390 SGTCPLCRLDL 400



>gb:BT020620_1643014 Arabidopsis thaliana At5g05810 gene, complete
           cds.
          Length = 353

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 1/51 (1%)
 Frame = -2

Query: 546 ECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCKFNIVKND 397
           EC +CL  ++    LR LP C+H FH  C+D WL  ++TCPLC++ +   D
Sbjct: 91  ECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPED 141



>gb:AB023482_1515599 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone P0680A03.>gb:AP002864_1823306
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, BAC clone:OSJNBa0033B09.
          Length = 363

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 24/47 (51%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = -2

Query: 555 EDAECCICLCAYDDGVELRELP-CRHRFHCACIDKWLYINATCPLCK 418
           E  +C +CLC +     LR LP C H FH  CID WL  N+TCPLC+
Sbjct: 127 EPFDCAVCLCEFAGDDRLRLLPVCGHAFHIDCIDTWLLSNSTCPLCR 173


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 859,491,002
Number of Sequences: 1806583
Number of extensions: 18692563
Number of successful extensions: 47236
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 44439
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46912
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 50612078860
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)