BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8221
         (764 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|D96499|D96499 probable UDP-glucose,sterol glucosyltransferas...   223   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AP003286_1827267 Oryza sativa (japonica cultivar-group) genom...   189   4e-47   
gb:A92378_1451222 Sequence 3 from Patent WO9817789.>gb:ASSGT_154...   171   1e-41   
gb:AP003745_1832762 Oryza sativa (japonica cultivar-group) genom...   165   1e-39   
gb:OSJN00215_1696871 Oryza sativa genomic DNA, chromosome 4, BAC...   164   1e-39   
gb:OSJN00215_1696870 Oryza sativa genomic DNA, chromosome 4, BAC...   164   2e-39   
gb:AB071962_1522973 Panax ginseng PGGT-2 gene for UDP-glucose:st...   160   3e-38   
gb:AB071961_1522972 Panax ginseng PGGT-1 gene for UDP-glucose:st...   156   3e-37   
gb:AY057496_1563915 Arabidopsis thaliana AT3g07020/F17A9_17 mRNA...   142   9e-33   
gb:ATAC016827_1543627 Arabidopsis thaliana chromosome III BAC F1...   142   9e-33   
gb:A92394_1451223 Sequence 19 from Patent WO9817789.>gb:ATSGT_15...   142   9e-33   
gb:AF001285_1760529 Glomerella cingulata CHIP6 (chip6) mRNA, par...   122   7e-27   
gb:AB078723_1523755 Aspergillus oryzae gstA gene for UDP-glucose...   110   4e-23   
gb:CVPME131_119790 C.viguieri phS gene, gene encoding putative N...   100   4e-20   
gb:BA000045_742495 Gloeobacter violaceus PCC 7421 DNA, complete ...    96   9e-19   
gb:BX294152_771073 Pirellula sp. strain 1 complete genome; segme...    94   3e-18   
gb:AF098916_1240862 Dictyostelium discoideum sterol glucosyltran...    85   1e-15   
gb:AE012041_278829 Xanthomonas axonopodis pv. citri str. 306, se...    78   2e-13   
gb:AP006840_569600 Symbiobacterium thermophilum DNA, complete ge...    76   6e-13   
gb:AF254745_1781147 Ustilago maydis UDP-glucose:sterol glucosylt...    75   1e-12   
gb:BA000045_742542 Gloeobacter violaceus PCC 7421 DNA, complete ...    75   1e-12   
gb:AP008231_581756 Synechococcus elongatus PCC 6301 DNA, complet...    74   2e-12   
gb:CR382123_1655550 Kluyveromyces lactis strain NRRL Y-1140 chro...    73   5e-12   
gb:AF091397_1767437 Pichia pastoris UDP-glucose:sterol glucosylt...    73   7e-12   
gb:AE012507_283086 Xanthomonas campestris pv. campestris str. AT...    72   1e-11   
gb:BX640438_813133 Bordetella bronchiseptica strain RB50, comple...    71   2e-11   
gb:BX640424_808733 Bordetella parapertussis strain 12822, comple...    71   2e-11   
gb:BA000030_705072 Streptomyces avermitilis MA-4680 genomic DNA,...    71   2e-11   
gb:CR555306_105663 Azoarcus sp. EbN1 complete genome.                  71   2e-11   
gb:AB070944_9284 Streptomyces avermitilis polyketide-4 biosynthe...    71   2e-11   
gb:CR382137_1670607 Debaryomyces hansenii chromosome E of strain...    69   1e-10   
gb:CR382130_1663067 Yarrowia lipolytica chromosome D of strain C...    67   3e-10   
gb:AP006840_569604 Symbiobacterium thermophilum DNA, complete ge...    66   8e-10   
pir|S51434|S51434 hypothetical protein YLR189c - yeast (Saccharo...    66   8e-10   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017347_1757966 Cryptococcus neoformans var. neoformans JEC2...    64   3e-09   
gb:AF091398_1767438 Candida albicans UDP-glucose:sterol glucosyl...    62   1e-08   
gb:AF522873_1808072 Leptosphaeria maculans aspartyl proteinase, ...    62   1e-08   
gb:AF254744_1781146 Ustilago maydis UDP-glucose:sterol glucosylt...    61   2e-08   
gb:AE016819_1749517 Ashbya gossypii (= Eremothecium gossypii) AT...    59   1e-07   
gb:NSP561198_156200 Actinomadura sp. ATCC 39727 gene cluster for...    57   4e-07   
gb:AJ605139_526655 Actinoplanes teichomyceticus gene cluster for...    57   5e-07   
gb:AJ605139_526640 Actinoplanes teichomyceticus gene cluster for...    55   1e-06   
gb:AE017343_1755692 Cryptococcus neoformans var. neoformans JEC2...    54   2e-06   
gb:AF394943_507061 Nocardia brasiliensis rifampin glycosyltransf...    54   2e-06   
gb:AY376382_614441 Mycobacterium intracellulare strain 5509-Bors...    54   4e-06   
gb:AY509120_623770 Streptomyces bikiniensis strain NRRL 2737 cha...    53   7e-06   
gb:AME16952_553205 Amycolatopsis balhimycina biosynthetic gene c...    53   7e-06   
gb:AME16952_553206 Amycolatopsis balhimycina biosynthetic gene c...    52   2e-05   
pir|T30585|T30585 transferase homolog - Amycolatopsis orientalis...    52   2e-05   Amycolatopsis orientalis
gb:AE017237_413576 Mycobacterium avium subsp. paratuberculosis s...    51   2e-05   
gb:ATT4C12_1555947 Arabidopsis thaliana DNA chromosome 5, BAC cl...    51   3e-05   
gb:AF351622_503980 Amycolatopsis orientalis glycosyltransferase ...    51   3e-05   
gb:AB089954_11978 Micromonospora griseorubida gene cluster for t...    51   3e-05   
gb:AY376381_614439 Mycobacterium avium strain Sparrow 185 rhamno...    50   5e-05   
gb:AY376370_614417 Mycobacterium avium strain 6195 rhamnosyltran...    50   5e-05   
gb:AY376369_614415 Mycobacterium avium strain 724 rhamnosyltrans...    50   5e-05   
gb:AF060183_474522 Mycobacterium avium putative glycosyltransfer...    50   5e-05   
pir|T44860|T44860 glycosyltransferase GtfE [imported] - Amycolat...    49   8e-05   Amycolatopsis orientalis
gb:AY376380_614437 Mycobacterium avium strain A5 rhamnosyltransf...    49   1e-04   
gb:AY376374_614425 Mycobacterium avium strain 101 rhamnosyltrans...    49   1e-04   
gb:AY130970_591124 Mycobacterium avium strain A5 glycopeptidolip...    49   1e-04   
gb:AF351621_503979 Amycolatopsis orientalis glycosyltransferase ...    49   1e-04   
gb:SFAJ5397_182670 Streptomyces fradiae tylN gene.>gb:AF055922_4...    47   3e-04   
pir|T44859|T44859 glycosyltransferase GtfD [imported] - Amycolat...    47   4e-04   Amycolatopsis orientalis
gb:AY138899_591657 Mycobacterium smegmatis glycopeptidolipid loc...    44   0.004   
pir|T30584|T30584 transferase homolog - Amycolatopsis orientalis...    43   0.006   Amycolatopsis orientalis
pir|T30586|T30586 glycosyltransferase homolog - Amycolatopsis or...    43   0.006   Amycolatopsis orientalis
gb:AY138899_591664 Mycobacterium smegmatis glycopeptidolipid loc...    42   0.016   
gb:AF060183_474521 Mycobacterium avium putative glycosyltransfer...    41   0.027   
sp|Q50583|YF24_MYCTU|YF24_MYCTU Hypothetical protein Rv1524/MT1575/Mb1551.>...    40   0.047   Mycobacterium tuberculosis
gb:AY130970_591123 Mycobacterium avium strain A5 glycopeptidolip...    40   0.061   
gb:AE017240_414467 Mycobacterium avium subsp. paratuberculosis s...    39   0.080   
gb:AF370013_1792010 Magnaporthe grisea UDP-glucose:sterol glucos...    39   0.10    
gb:AY138899_591661 Mycobacterium smegmatis glycopeptidolipid loc...    38   0.18    
sp|Q49929|YF24_MYCLE|YF24_MYCLE Hypothetical protein ML2348.>pir|S73010|S73...    36   0.88    Mycobacterium leprae
pir|B53652|B53652 rhamnosyltransferase 1 chain B - Pseudomonas a...    35   1.5     Pseudomonas aeruginosa
pir|C83212|C83212 rhamnosyltransferase chain B PA3478 [imported]...    35   1.5     Pseudomonas aeruginosa
gb:AB008677_1407693 Bos taurus mRNA for UDP-glucuronosyltransfer...    33   5.7     
gb:HSU89508_2027086 Human UDP-glucuronosyltransferase 1A10 mRNA,...    33   7.5     
gb:BC019861_1976915 Homo sapiens UDP glycosyltransferase 1 famil...    33   7.5     
gb:AY029169_1934457 Macaca mulatta UDP-glucuronosyltransferase U...    33   7.5     
gb:AF462267_1903375 Homo sapiens UDP-glucuronosyltransferase UGT...    33   7.5     
gb:AF360121_1898898 Macaca mulatta UDP-glucuronosyltransferase U...    33   7.5     
gb:AF297093_1895570 Homo sapiens UGT1 gene locus, complete seque...    33   7.5     
gb:AF104339_1883908 Macaca fascicularis UDP-glucuronosyltransfer...    33   7.5     
gb:AF104338_1883907 Macaca fascicularis UDP-glucuronosyltransfer...    33   7.5     
gb:AF104337_1883906 Macaca fascicularis UDP-glucuronosyltransfer...    33   7.5     
gb:AF104336_1883905 Macaca fascicularis UDP-glucuronosyltransfer...    33   7.5     
gb:AF030310_1877645 Homo sapiens UDP-glucuronosyltransferase 1A8...    33   7.5     
gb:AY376368_614414 Mycobacterium avium strain 17584-286 glycosyl...    33   7.5     
gb:AY376366_614412 Mycobacterium avium strain B-92 glycosyltrans...    33   7.5     
gb:AY376365_614411 Mycobacterium avium strain 724 glycosyltransf...    33   7.5     
gb:AY376364_614410 Mycobacterium avium strain A5 glycosyltransfe...    33   7.5     
gb:AY376356_614402 Mycobacterium avium strain 34540-Wales glycos...    33   7.5     
gb:AY130970_591128 Mycobacterium avium strain A5 glycopeptidolip...    33   7.5     
gb:AF125999_481248 Mycobacterium avium glycopeptidolipid biosynt...    33   7.5     
gb:CP000026_75788 Salmonella enterica subsp. enterica serovar Pa...    33   7.5     
pir|S40710|S40710 hypothetical protein C07A9.6 - Caenorhabditis ...    33   7.5     Caenorhabditis elegans [roundworm]
pir|A31340|A31340 glucuronosyltransferase (EC 2.4.1.17) UGT1A1 p...    33   7.5     Homo sapiens [man]
pir|JC5656|JC5656 UDP glucuronosyltransferase (EC 2.4.1.-) 1A10 ...    33   7.5     Homo sapiens [man]
sp|P34317|YKT6_CAEEL|YKT6_CAEEL Hypothetical protein C07A9.6 in chromosome ...    33   7.5     Caenorhabditis elegans [roundworm]
sp|Q9HAW8|UD1A_HUMAN|UD1A_HUMAN UDP-glucuronosyltransferase 1-10 precursor,...    33   7.5     Homo sapiens [man]
sp|O60656|UD19_HUMAN|UD19_HUMAN UDP-glucuronosyltransferase 1-9 precursor, ...    33   7.5     Homo sapiens [man]
sp|Q9HAW9|UD18_HUMAN|UD18_HUMAN UDP-glucuronosyltransferase 1-8 precursor, ...    33   7.5     Homo sapiens [man]
sp|Q9HAW7|UD17_HUMAN|UD17_HUMAN UDP-glucuronosyltransferase 1-7 precursor, ...    33   7.5     Homo sapiens [man]
sp|P19224|UD16_HUMAN|UD16_HUMAN UDP-glucuronosyltransferase 1-6 precursor, ...    33   7.5     Homo sapiens [man]
sp|P35504|UD15_HUMAN|UD15_HUMAN UDP-glucuronosyltransferase 1-5 precursor, ...    33   7.5     Homo sapiens [man]
sp|P22310|UD14_HUMAN|UD14_HUMAN UDP-glucuronosyltransferase 1-4 precursor, ...    33   7.5     Homo sapiens [man]
sp|P35503|UD13_HUMAN|UD13_HUMAN UDP-glucuronosyltransferase 1-3 precursor, ...    33   7.5     Homo sapiens [man]
sp|P36509|UD12_HUMAN|UD12_HUMAN UDP-glucuronosyltransferase 1-2 precursor, ...    33   7.5     Homo sapiens [man]
sp|P22309|UD11_HUMAN|UD11_HUMAN UDP-glucuronosyltransferase 1-1 precursor, ...    33   7.5     Homo sapiens [man]
gb:AF499596_2266679 Phthorimaea operculella granulovirus, comple...    32   9.7     
gb:AY376358_614404 Mycobacterium avium strain 101 glycosyltransf...    32   9.7     
gb:AF143772_482914 Mycobacterium avium strain 2151 glycopeptidol...    32   9.7     
pir|S17512|S17512 glucuronosyltransferase (EC 2.4.1.17) - human        32   9.7     Homo sapiens [man]


>pir|D96499|D96499 probable UDP-glucose,sterol glucosyltransferase
           [imported] - Arabidopsis thaliana>gb:AE005173_892552
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007203_1535555 Arabidopsis thaliana
           chromosome I BAC T10P12 genomic sequence, complete
           sequence.>gb:BT005834_1638756 Arabidopsis thaliana
           At1g43620 gene, complete cds.
          Length = 615

 Score =  223 bits (569), Expect = 2e-57
 Identities = 110/186 (59%), Positives = 129/186 (69%), Gaps = 2/186 (1%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLP-EIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           DIILE LK T QRGI+D+GWGGLG L  E+PE V+ + DCPHDWLF QCS          
Sbjct: 428 DIILETLKDTEQRGIVDRGWGGLGNLATEVPENVFLVEDCPHDWLFPQCSAVVHHGGAGT 487

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+AGCPTTIVP FGDQFFWGDR+ +KGLGP PIPI+QL+VE L  +IRFMLQPEVK
Sbjct: 488 TATGLKAGCPTTIVPFFGDQFFWGDRIYEKGLGPAPIPIAQLSVENLSSSIRFMLQPEVK 547

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPTELPLP-AGPPSVEETESPNPLPWLFIKIGSL 226
           S+VMELA++            AFHRHLP ELPLP +     +E + P+ L W FI+IG  
Sbjct: 548 SQVMELAKVLENEDGVAAAVDAFHRHLPPELPLPESSSEKKDEDDRPDLLQWFFIQIGKK 607

Query: 225 CSLACG 208
           C L CG
Sbjct: 608 CCLPCG 613



>gb:AP003286_1827267 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0677H08.
          Length = 620

 Score =  189 bits (481), Expect = 4e-47
 Identities = 91/164 (55%), Positives = 109/164 (66%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T +IL+AL+ TGQRGII +GWG LG+  E+P  V+ L DCPHDWLF +C+          
Sbjct: 437 TSVILDALRETGQRGIISRGWGDLGSFSEVPVDVFILEDCPHDWLFPRCAAVVHHGGAGT 496

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL AGCPTTIVP FGDQFFWG+R+  +G+GP PIPI++LTVE L  AIRFML PEVK
Sbjct: 497 TAAGLVAGCPTTIVPFFGDQFFWGERIHAQGVGPAPIPIAELTVEALSNAIRFMLDPEVK 556

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPTELPLPAGPPSVEETE 271
           SR MELA              +FHRHLP ELPL   P  V+E +
Sbjct: 557 SRTMELAIAIGNEDGVAAAVDSFHRHLPAELPLAPPPTDVKEEQ 600



>gb:A92378_1451222 Sequence 3 from Patent
           WO9817789.>gb:ASSGT_1542517 Avena sativa mRNA for
           UDP-glucose:sterol glucosyltransferase.
          Length = 608

 Score =  171 bits (433), Expect = 1e-41
 Identities = 82/175 (46%), Positives = 112/175 (64%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T+ I++AL++TGQRGII++GWGGLGTL E  +++Y L +CPHDWLFLQC           
Sbjct: 431 TETIIQALEMTGQRGIINKGWGGLGTLAEPKDSIYVLDNCPHDWLFLQCKAVVHHGGAGT 490

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWGDR+  +G+GP PIP+ Q  ++ L +A++FML+PEVK
Sbjct: 491 TAAGLKAACPTTIVPFFGDQQFWGDRVHARGVGPVPIPVEQFNLQKLVDAMKFMLEPEVK 550

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPTELPLPAGPPSVEETESPNPLPWLFIK 238
            + +ELA+             AF +HLP+         S E+  SP P P  F++
Sbjct: 551 EKAVELAKAMESEDGVTGAVRAFLKHLPS---------SKEDENSPPPTPHGFLE 596



>gb:AP003745_1832762 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1123_B01.
          Length = 617

 Score =  165 bits (417), Expect = 1e-39
 Identities = 81/163 (49%), Positives = 102/163 (62%), Gaps = 4/163 (2%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T II+EAL++TGQRGII++GWGGLG L E  E VY + + PHDWLFLQC           
Sbjct: 437 TRIIVEALEITGQRGIINKGWGGLGNLEEPKEFVYVIDNIPHDWLFLQCKAVVHHGGAGT 496

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
               L+A CPTTIVP FGDQFFWG+ +  +GLG PP+P+ QL +  L +AI+FM+ P+VK
Sbjct: 497 TAASLKAACPTTIVPFFGDQFFWGNMVHARGLGAPPVPVEQLQLHLLVDAIKFMMDPKVK 556

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLP----TELPLPAGPPS 286
            R +ELA+             AF +HLP     E P PA P S
Sbjct: 557 ERAVELAKAIESEDGVDGAVKAFLKHLPQPRSLEKPQPAPPSS 599



>gb:OSJN00215_1696871 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0080H08, complete sequence.
          Length = 609

 Score =  164 bits (416), Expect = 1e-39
 Identities = 76/149 (51%), Positives = 101/149 (67%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T++I++AL++TGQRGII++GWGGLGTL E  + VY L +CPHDWLFLQC           
Sbjct: 434 TEVIVKALEITGQRGIINKGWGGLGTLAEPKDFVYLLDNCPHDWLFLQCKAVVHHGGAGT 493

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWGDR+  +G+GP PIP+ Q +++ L +AI FM++P+VK
Sbjct: 494 TAAGLKAACPTTIVPFFGDQPFWGDRVHARGVGPLPIPVDQFSLQKLVDAINFMMEPKVK 553

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPT 316
              +ELA+             AF RHLP+
Sbjct: 554 DNAVELAKAMESEDGVSGAVRAFLRHLPS 582



>gb:OSJN00215_1696870 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0080H08, complete sequence.
          Length = 307

 Score =  164 bits (414), Expect = 2e-39
 Identities = 76/148 (51%), Positives = 100/148 (67%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T++I++AL++TGQRGII++GWGGLGTL E  + VY L +CPHDWLFLQC           
Sbjct: 132 TEVIVKALEITGQRGIINKGWGGLGTLAEPKDFVYLLDNCPHDWLFLQCKAVVHHGGAGT 191

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWGDR+  +G+GP PIP+ Q ++  L +AI FM++P+VK
Sbjct: 192 TAAGLKAACPTTIVPFFGDQPFWGDRVHARGVGPLPIPVDQFSLRKLVDAINFMMEPKVK 251

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLP 319
            + +ELA+             AF RHLP
Sbjct: 252 EKAVELAKAMESEDGVSGVVRAFLRHLP 279



>gb:AB071962_1522973 Panax ginseng PGGT-2 gene for
           UDP-glucose:sterol 3-O-glucosyltransferase, comolete
           cds.
          Length = 602

 Score =  160 bits (404), Expect = 3e-38
 Identities = 76/162 (46%), Positives = 105/162 (64%), Gaps = 6/162 (3%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T +I+EAL++TGQRGII++GWGGLG L E  +T+Y+L + PHDWLFLQC+          
Sbjct: 431 TKVIVEALEITGQRGIINKGWGGLGNLAEPKDTIYSLDNVPHDWLFLQCAAVVHHGGAGT 490

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWG+R+  +G+GP PIPI + ++  L +AI+FML+P+VK
Sbjct: 491 TAAGLKAACPTTIVPFFGDQPFWGERVHARGVGPAPIPIDEFSLPKLVDAIKFMLEPKVK 550

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPTE------LPLPAG 295
              ++LA+             AF +HLP         P+P+G
Sbjct: 551 ESAIQLAKAMEDEDGVAGAVKAFFKHLPCRKTEAEPTPVPSG 592



>gb:AB071961_1522972 Panax ginseng PGGT-1 gene for
           UDP-glucose:sterol 3-O-glucosyltransferase, comolete
           cds.
          Length = 609

 Score =  156 bits (395), Expect = 3e-37
 Identities = 75/158 (47%), Positives = 99/158 (62%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T +I+EAL++TGQRGII++GWGGLG L E  + +Y+L + PHDWLFLQC+          
Sbjct: 438 TKVIVEALEITGQRGIINKGWGGLGNLAEPKDAIYSLDNVPHDWLFLQCAAVVHHGGAGT 497

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWG+R+  +G+GP PIPI + ++  L +AIRFML P+VK
Sbjct: 498 TAAGLKAACPTTIVPFFGDQPFWGERVHARGVGPVPIPIDEFSLPKLVDAIRFMLDPKVK 557

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPTELPLPAGPP 289
              + LA+             AF +HLP     P   P
Sbjct: 558 ESAVRLAKDMEDEDGVAGAVRAFFKHLPFRKTAPEPEP 595



>gb:AY057496_1563915 Arabidopsis thaliana AT3g07020/F17A9_17 mRNA,
           complete cds.>gb:AY079032_1568145 Arabidopsis thaliana
           AT3g07020/F17A9_17 mRNA, complete cds.
          Length = 555

 Score =  142 bits (357), Expect = 9e-33
 Identities = 73/163 (44%), Positives = 97/163 (59%), Gaps = 7/163 (4%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T+II+EAL+ T QRGII++GWGGLG L E  + VY L + PHDWLF +C           
Sbjct: 382 TEIIVEALQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVVHHGGAGT 441

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWG+R+  +G+GP PIP+ + ++  L +AI FML  +VK
Sbjct: 442 TAAGLKASCPTTIVPFFGDQPFWGERVHARGVGPSPIPVDEFSLHKLEDAINFMLDDKVK 501

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPT-------ELPLPAG 295
           S    LA+             AF +HLP+        +P P+G
Sbjct: 502 SSAETLAKAMKDEDGVAGAVKAFFKHLPSAKQNISDPIPEPSG 544



>gb:ATAC016827_1543627 Arabidopsis thaliana chromosome III BAC F17A9
           genomic sequence, complete sequence.
          Length = 637

 Score =  142 bits (357), Expect = 9e-33
 Identities = 73/163 (44%), Positives = 97/163 (59%), Gaps = 7/163 (4%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T+II+EAL+ T QRGII++GWGGLG L E  + VY L + PHDWLF +C           
Sbjct: 464 TEIIVEALQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVVHHGGAGT 523

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWG+R+  +G+GP PIP+ + ++  L +AI FML  +VK
Sbjct: 524 TAAGLKASCPTTIVPFFGDQPFWGERVHARGVGPSPIPVDEFSLHKLEDAINFMLDDKVK 583

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPT-------ELPLPAG 295
           S    LA+             AF +HLP+        +P P+G
Sbjct: 584 SSAETLAKAMKDEDGVAGAVKAFFKHLPSAKQNISDPIPEPSG 626



>gb:A92394_1451223 Sequence 19 from Patent
           WO9817789.>gb:ATSGT_1554155 Arabidopsis thaliana mRNA
           for UDP-glucose:sterol glucosyltransferase.
          Length = 637

 Score =  142 bits (357), Expect = 9e-33
 Identities = 73/163 (44%), Positives = 97/163 (59%), Gaps = 7/163 (4%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T+II+EAL+ T QRGII++GWGGLG L E  + VY L + PHDWLF +C           
Sbjct: 464 TEIIVEALQRTKQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVVHHGGAGT 523

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              GL+A CPTTIVP FGDQ FWG+R+  +G+GP PIP+ + ++  L +AI FML  +VK
Sbjct: 524 TAAGLKASCPTTIVPFFGDQPFWGERVHARGVGPSPIPVDEFSLHKLEDAINFMLDDKVK 583

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPT-------ELPLPAG 295
           S    LA+             AF +HLP+        +P P+G
Sbjct: 584 SSAETLAKAMKDEDGVAGAVKAFFKHLPSAKQNISDPIPEPSG 626



>gb:AF001285_1760529 Glomerella cingulata CHIP6 (chip6) mRNA,
           partial cds.
          Length = 914

 Score =  122 bits (306), Expect = 7e-27
 Identities = 53/127 (41%), Positives = 77/127 (60%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T +I +A+K+ G R I+ +GWGG+G    +PE +Y + +CPHDWLF + S          
Sbjct: 389 TQLIFDAVKIAGVRAIVSKGWGGVGGGDNVPENIYLIGNCPHDWLFKRVSAVVHHGGAGT 448

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
              G+ AG PT +VP FGDQ FWG  + + G GP P+P  ++T E L  +I F L+PEV+
Sbjct: 449 SAAGIAAGRPTVVVPFFGDQPFWGQMIARAGAGPVPVPFKEMTAETLAASISFALKPEVQ 508

Query: 402 SRVMELA 382
             V ++A
Sbjct: 509 VAVQQMA 515



>gb:AB078723_1523755 Aspergillus oryzae gstA gene for
           UDP-glucose,sterol transferase, complete cds.
          Length = 834

 Score =  110 bits (274), Expect = 4e-23
 Identities = 56/150 (37%), Positives = 74/150 (49%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T I+ EA++  G R II +GW  LG      + +  + DCPH+WLF   S          
Sbjct: 366 TSILEEAVRAVGVRAIISRGWSKLGGSSS--KDILYIGDCPHEWLFQNVSAVVHHGGAGT 423

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
               LR G PT IVP FGDQ FWG  +   G GP PIP   LT E L EAI++ L P+ K
Sbjct: 424 TACSLRFGKPTAIVPFFGDQPFWGKMIAASGAGPEPIPQKSLTAENLAEAIQYCLTPQAK 483

Query: 402 SRVMELARLXXXXXXXXXXXXAFHRHLPTE 313
               +++              +FHR+LP +
Sbjct: 484 EAAKDISNKMQYEAGVKAAVESFHRNLPLD 513



>gb:CVPME131_119790 C.viguieri phS gene, gene encoding putative NADH
           dehydrogenase and two genes encoding unknown proteins.
          Length = 305

 Score =  100 bits (248), Expect = 4e-20
 Identities = 49/111 (44%), Positives = 66/111 (59%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           +++LEAL  T QR I+  GW GL +   +P TVY +   PH WLF + +           
Sbjct: 152 NLVLEALAKTQQRAILLSGWSGLKS-DNLPNTVYLIDSVPHSWLFPRVAAVVHHGGAGTT 210

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIR 427
             G+RAG P+ I+P FGDQFFWG R+ + G+G  PIP  QLT E L +AI+
Sbjct: 211 AAGMRAGVPSIIIPFFGDQFFWGQRVAKLGVGTEPIPRKQLTAERLAQAIQ 261



>gb:BA000045_742495 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 439

 Score = 95.5 bits (236), Expect = 9e-19
 Identities = 48/127 (37%), Positives = 70/127 (55%), Gaps = 1/127 (0%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T  +LEA++++GQR ++ +GWGGL +   +P+  + +   PHDWLF + S          
Sbjct: 290 TQKVLEAIRLSGQRAVLLRGWGGLQS-GRMPDGCFQIDAVPHDWLFPRVSGVVTHGGAGT 348

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFML-QPEV 406
               LRAG P   VPL GDQFFWG RL + G GP P+P+  L    L  A++ +     +
Sbjct: 349 VAAALRAGVPALAVPLLGDQFFWGRRLAELGAGPRPLPLKDLQATPLAVALKALAGDSSM 408

Query: 405 KSRVMEL 385
           + R  EL
Sbjct: 409 RRRAAEL 415



>gb:BX294152_771073 Pirellula sp. strain 1 complete genome; segment
           20/24.
          Length = 428

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 52/127 (40%), Positives = 74/127 (58%), Gaps = 2/127 (1%)
 Frame = -3

Query: 753 ILEALKVTGQRGIIDQGWGGLGTLP-EIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           ++EA++++GQR I+  GWGG+     + PET+ ++   PHDWLF Q S            
Sbjct: 282 VIEAVRLSGQRAILAPGWGGMDLREFDFPETMLSIDAVPHDWLFPQVSAVVHHGGCGTTA 341

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQP-EVKS 400
            GLRAG  T I P FGDQ FWG  + + G+GP PIP  +LT E L +AI   +   E++S
Sbjct: 342 AGLRAGRRTIICPFFGDQPFWGRVVHELGVGPKPIPQRRLTPERLAKAISETIDDCEMES 401

Query: 399 RVMELAR 379
           R  +L +
Sbjct: 402 RAEQLGK 408



>gb:AF098916_1240862 Dictyostelium discoideum sterol
            glucosyltransferase (ugt52) mRNA, complete cds.
          Length = 1023

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 59/195 (30%), Positives = 88/195 (45%), Gaps = 31/195 (15%)
 Frame = -3

Query: 756  IILEALKVTGQRGIIDQGWGGL-----------------GTLPEIPET------VYTLSD 646
            +++EA+K++G+R II QGWGGL                 G   +  ++      +Y L  
Sbjct: 767  LLIEAIKLSGKRAIISQGWGGLSIDEHNNNNNNNNNNNNGENSDSNKSSLQSNRIYLLKK 826

Query: 645  -CPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIP 469
               H WLF + S              L A  PT +VP FGDQFFWG+R+ Q G+G   IP
Sbjct: 827  PVDHSWLFEKVSLVISHGGAGTVAASLLAAKPTIVVPFFGDQFFWGERIKQTGIG-TSIP 885

Query: 468  ISQLTVEGLFEAIRFML-QPEVKSRVMELARLXXXXXXXXXXXXAFHRHL------PTEL 310
               LT + L   I  +L +P V+++V +++ L              HR+L      P E+
Sbjct: 886  FDILTAKSLSSHIISILNEPSVRAKVNKMSHLLKREDGVKTAIDFIHRYLPFSFIPPREI 945

Query: 309  PLPAGPPSVEETESP 265
            P  + P S    + P
Sbjct: 946  PFSSAPNSCMGCKQP 960



>gb:AE012041_278829 Xanthomonas axonopodis pv. citri str. 306,
           section 419 of 469 of the complete
           genome.>gb:AE008923_920604 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 443

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 42/132 (31%), Positives = 62/132 (46%), Gaps = 4/132 (3%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGT----LPEIPETVYTLSDCPHDWLFLQCSXXXXXX 595
           T  +  A+++TGQR ++  GWGGLG       +  E  + L   PHDWLF + S      
Sbjct: 272 TATVKAAVRLTGQRALLASGWGGLGAGDTAAADDAERFFHLEQAPHDWLFPRVSVAVHHG 331

Query: 594 XXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQ 415
                   L AG P+ ++P   DQ FW   L Q+G+ PP +  + L  E L  AI     
Sbjct: 332 GAGTSGAALAAGIPSVVLPFGYDQSFWAHCLAQRGVAPPALARAGLQPEALAAAIHQAST 391

Query: 414 PEVKSRVMELAR 379
           P +++    L +
Sbjct: 392 PAMRAAARALGQ 403



>gb:AP006840_569600 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 417

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 50/127 (39%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T + LEAL   G RGI+  G G    L  +   V  + + PHDWLF + +          
Sbjct: 267 TRMALEALSQAGVRGILATGSGDGPRL--LSPDVLAIPEAPHDWLFPRVAAVVHHGGAGT 324

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFML-QPEV 406
              GL AG PT + P   DQ FWG  + Q G+GP PIP  QLT E L EA+R     PE+
Sbjct: 325 VAPGLAAGKPTLVCPATTDQPFWGRVVHQLGVGPAPIPRRQLTAERLAEAVRAATGDPEM 384

Query: 405 KSRVMEL 385
           + R   L
Sbjct: 385 QRRAAAL 391



>gb:AF254745_1781147 Ustilago maydis UDP-glucose:sterol
           glucosyltransferase Ugt51D1 (UGT51D1) gene, partial cds.
          Length = 679

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 43/118 (36%), Positives = 60/118 (50%), Gaps = 7/118 (5%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGG-LGTLPEIP------ETVYTLSDCPHDWLFLQCSXXX 604
           T  +L+A+K +G   I+ +GW   L + P  P        V+ +S  PHDWLF Q     
Sbjct: 446 TRCVLQAVKKSGVCAILSKGWSDRLSSDPSTPIDASISADVFQVSSVPHDWLFPQIDAAC 505

Query: 603 XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAI 430
                      LRAG PT + P FGDQFFWG ++   G+G     + QLTV+ L +A+
Sbjct: 506 HHGGAGTLGASLRAGLPTVVKPYFGDQFFWGQQIESLGVGS---CVRQLTVDSLAKAL 560



>gb:BA000045_742542 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 461

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 59/112 (52%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T ++L A++  G R ++  GWGGL +L    + V+     P+DWLF + +          
Sbjct: 264 TALVLGAVRKAGVRAVLLCGWGGLASLG-CADDVFFADALPNDWLFPRVTAVVHHGGAGT 322

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIR 427
               LRAG P  +VP   DQ FWG R+   G GP PI  ++LT E L ++IR
Sbjct: 323 TGAALRAGVPALVVPFTMDQPFWGARVAALGAGPTPIARARLTQERLADSIR 374



>gb:AP008231_581756 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 371

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 44/127 (34%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T I +EAL+ + QRGI+  GW  +    ++P+TV+ L   P   LF + +          
Sbjct: 219 TAIAVEALQKSNQRGILLAGWSRIDR-SQLPDTVFPLESAPFGLLFPRLAAAVHHGGCGT 277

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAI-RFMLQPEV 406
               L+AG PT I     DQ FWG R+ + G GP PI    LT E L  AI + +  P++
Sbjct: 278 TAASLQAGLPTIITAYGNDQAFWGKRVAELGAGPSPITREGLTAETLATAIAQAVSDPQM 337

Query: 405 KSRVMEL 385
           +SR   +
Sbjct: 338 RSRAQAI 344



>gb:CR382123_1655550 Kluyveromyces lactis strain NRRL Y-1140
            chromosome C of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1209

 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 42/135 (31%), Positives = 65/135 (48%), Gaps = 7/135 (5%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGGLGTLP-------EIPETVYTLSDCPHDWLFLQCSXXX 604
            TD I+EA++  G   ++++GW      P       E+P  +Y   D PHDWLF +     
Sbjct: 1002 TDTIIEAVRDAGVYCVLNKGWSNRFGDPLAKKIDKELPSYIYNSGDVPHDWLFTKIDATV 1061

Query: 603  XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRF 424
                       LRAG PT I P FGDQFF+  R+   G G   + + +L    L +A++ 
Sbjct: 1062 HHGGSGTTGASLRAGLPTIIKPFFGDQFFYASRVEDIGAG---VALKKLNRSSLAKALK- 1117

Query: 423  MLQPEVKSRVMELAR 379
              +    +R+++ AR
Sbjct: 1118 --EVTTNTRIIQKAR 1130



>gb:AF091397_1767437 Pichia pastoris UDP-glucose:sterol
            glucosyltransferase (UGT51B1) gene, complete cds.
          Length = 1211

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 42/133 (31%), Positives = 68/133 (51%), Gaps = 5/133 (3%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGG-----LGTLPEIPETVYTLSDCPHDWLFLQCSXXXXX 598
            T+ +++A+     R I+++GW        G   E+PE +Y   + PHDWLF +       
Sbjct: 1029 TEAVIDAVLSADVRCILNKGWSDRLGKQTGVEVELPEEIYNSGNVPHDWLFGKIDASVHH 1088

Query: 597  XXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFML 418
                     LRAG PT I P FGDQFF+ +R+   G+G   I + +L  + L +AI+   
Sbjct: 1089 GGSGTTGATLRAGIPTIIKPFFGDQFFYANRVEDIGVG---IGLRKLNSKSLSKAIK--- 1142

Query: 417  QPEVKSRVMELAR 379
            +    +R++E A+
Sbjct: 1143 EVTTNTRIIEKAK 1155



>gb:AE012507_283086 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 415 of 460 of the complete
           genome.>gb:AE008922_916368 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 444

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 3/131 (2%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETV---YTLSDCPHDWLFLQCSXXXXXXX 592
           T  +  A+++TGQR ++  GWGGL    +  +     + L   PHDWLF + +       
Sbjct: 275 TATVKAAVRLTGQRALLASGWGGLAAGEDADDDATRFFHLEQAPHDWLFPRVAVAVHHGG 334

Query: 591 XXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQP 412
                  L AG P+ ++P   DQ FW   L Q+G+ PP +  + L  + L +AI     P
Sbjct: 335 AGTTGAALTAGIPSVVLPFGYDQPFWAHCLAQRGVAPPALSRNGLLPQALADAIDQASTP 394

Query: 411 EVKSRVMELAR 379
            +++    L +
Sbjct: 395 TMRAAAAALGQ 405



>gb:BX640438_813133 Bordetella bronchiseptica strain RB50, complete
           genome; segment 2/16.
          Length = 414

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 36/117 (30%), Positives = 54/117 (46%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +   GW GL  +  +P+    + + PH WL  + S               RAG P+
Sbjct: 269 GERILFHPGWSGLPDV-RLPQDCLVIGNTPHGWLLPRTSLAMHHGGSGTAHSACRAGVPS 327

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELAR 379
            ++P  GDQFFW  +L + G+   PI   QL    +  A+RF   P  +S    LA+
Sbjct: 328 VVLPFAGDQFFWARQLARLGVADAPISTRQLDAGAIKAAVRFARLPATRSSAAALAQ 384



>gb:BX640424_808733 Bordetella parapertussis strain 12822, complete
           genome; segment 2/14.
          Length = 383

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 36/117 (30%), Positives = 54/117 (46%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +   GW GL  +  +P+    + + PH WL  + S               RAG P+
Sbjct: 246 GERILFHPGWSGLPDV-RLPQDCLVIGNTPHGWLLPRTSLAMHHGGSGTAHSACRAGVPS 304

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELAR 379
            ++P  GDQFFW  +L + G+   PI   QL    +  A+RF   P  +S    LA+
Sbjct: 305 VVLPFAGDQFFWARQLARLGVADAPISTRQLDAGAIKAAVRFARLPATRSSAAALAQ 361



>gb:BA000030_705072 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 427

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 37/93 (39%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGL-GTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           D+I+ A + TG R ++  GW  L G   E+P+TV  +    HDWLF +C           
Sbjct: 279 DLIVRAAERTGLRLLVGAGWSDLSGLTGELPDTVRLIGAIDHDWLFPRCRAVVHHGGAGT 338

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG 484
              GL AG PT I  +F DQ FWGDR+ + G G
Sbjct: 339 TAAGLTAGLPTWIYTVFSDQPFWGDRVARLGAG 371



>gb:CR555306_105663 Azoarcus sp. EbN1 complete genome.
          Length = 410

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 35/117 (29%), Positives = 58/117 (49%)
 Frame = -3

Query: 735 VTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGC 556
           + G+R +   GW G+  +  +P+ +  +   PHDWL  + S               RAG 
Sbjct: 264 LAGRRALFYPGWSGMDDVG-LPDNILRIGTTPHDWLLPRTSAVIHHGGSGTTHSATRAGK 322

Query: 555 PTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMEL 385
           P+ ++P  GDQ FW +RL + G+ PP +  ++L    L +AI F+    V+ R  +L
Sbjct: 323 PSVVIPFAGDQAFWAERLNRLGVAPPALDAAKLEAGLLGKAIGFVEGEGVQKRAAQL 379



>gb:AB070944_9284 Streptomyces avermitilis polyketide-4 biosynthetic
           gene cluster.
          Length = 423

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 37/93 (39%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGL-GTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           D+I+ A + TG R ++  GW  L G   E+P+TV  +    HDWLF +C           
Sbjct: 275 DLIVRAAERTGLRLLVGAGWSDLSGLTGELPDTVRLIGAIDHDWLFPRCRAVVHHGGAGT 334

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG 484
              GL AG PT I  +F DQ FWGDR+ + G G
Sbjct: 335 TAAGLTAGLPTWIYTVFSDQPFWGDRVARLGAG 367



>gb:CR382137_1670607 Debaryomyces hansenii chromosome E of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1574

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 39/121 (32%), Positives = 55/121 (45%), Gaps = 9/121 (7%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGGLGTLP---------EIPETVYTLSDCPHDWLFLQCSX 610
            T  I+EA+     R I+++GW    + P         E+PE +Y     PHDWLF +   
Sbjct: 1316 TKAIVEAVLNADVRCILNKGWSDRNSSPAKDNAEPEVELPEEIYNSGSIPHDWLFPKIDA 1375

Query: 609  XXXXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAI 430
                         +RAG PT I P FGDQFF+  R+   G G   I + +L    L  A+
Sbjct: 1376 AVHHGGSGTTGATMRAGIPTIIKPFFGDQFFYSSRIEDIGAG---IGLKKLNARSLCTAL 1432

Query: 429  R 427
            +
Sbjct: 1433 K 1433



>gb:CR382130_1663067 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1307

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 44/118 (37%), Positives = 61/118 (51%), Gaps = 7/118 (5%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGG-LGTL----PEIP--ETVYTLSDCPHDWLFLQCSXXX 604
            T  ++E++     R I+++GW   LG      PEIP  E V  +++CPHDWLF Q     
Sbjct: 1113 TKSVVESVLKADVRCILNKGWSDRLGKKDAKEPEIPLPEEVLQITNCPHDWLFPQIDACV 1172

Query: 603  XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAI 430
                      GLRAG PT I P FGDQFF+ +R+   G G   I + +L V    +A+
Sbjct: 1173 HHGGSGTTGAGLRAGLPTIIKPFFGDQFFYANRVEDLGAG---IHLRKLNVSQFSKAL 1227



>gb:AP006840_569604 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 413

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 41/111 (36%), Positives = 53/111 (47%)
 Frame = -3

Query: 762 TDIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXX 583
           T +  EAL   G RG+I    G       + +TV  +   PHDWLF + +          
Sbjct: 267 TRMAAEALARAGVRGVIATETGDAPV--RLSDTVLAIPGAPHDWLFPRMAAVVHHGGAGT 324

Query: 582 XXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAI 430
              GL AG PT + P   DQ FWG  + + G+GP PIP  +LT E L  AI
Sbjct: 325 VAAGLAAGKPTLVCPATTDQPFWGRVVHRLGVGPAPIPRRRLTAERLAAAI 375



>pir|S51434|S51434 hypothetical protein YLR189c - yeast (Saccharomyces
            cerevisiae)>gb:YSCL9470_1729707 Saccharomyces cerevisiae
            chromosome XII cosmid 9470.
          Length = 1198

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 7/119 (5%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGG-LG------TLPEIPETVYTLSDCPHDWLFLQCSXXX 604
            T+ ++EA+       I+++GW   LG      T  ++P  +  + + PHDWLF Q     
Sbjct: 1008 TEALVEAVMEADVYCILNKGWSERLGDKAAKKTEVDLPRNILNIGNVPHDWLFPQVDAAV 1067

Query: 603  XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIR 427
                       LRAG PT I P FGDQFF+  R+   G+G   I + +L  + L +A++
Sbjct: 1068 HHGGSGTTGASLRAGLPTVIKPFFGDQFFYAGRVEDIGVG---IALKKLNAQTLADALK 1123



>gb:AE017347_1757966 Cryptococcus neoformans var. neoformans JEC21
            chromosome 7, complete sequence.
          Length = 1220

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 44/136 (32%), Positives = 58/136 (42%), Gaps = 8/136 (5%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGGLGTLPE-------IPETVYTLSDCPHDWLFLQCSXXX 604
            T  I++A++      II +GW   G  P         PE+ Y +   PH WLF +     
Sbjct: 1058 TRSIIKAVEKANVCAIIAKGWSSRGGDPAKEGQNITFPESCYGIDKIPHAWLFPRVRAAL 1117

Query: 603  XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG-PPPIPISQLTVEGLFEAIR 427
                       LRAG PT I P FGDQFFW  R+ + G+G   P   S      L +A  
Sbjct: 1118 HHGGAGTVGASLRAGIPTLIKPWFGDQFFWSIRVSKLGVGLKVPSLRSDDVASALIKATS 1177

Query: 426  FMLQPEVKSRVMELAR 379
              L  E  +R+ E  R
Sbjct: 1178 DRLMIEKAARIGERIR 1193



>gb:AF091398_1767438 Candida albicans UDP-glucose:sterol
            glucosyltransferase (UGT51C1) gene, complete cds.
          Length = 1516

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 36/118 (30%), Positives = 54/118 (45%), Gaps = 7/118 (5%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGGLGTLP-------EIPETVYTLSDCPHDWLFLQCSXXX 604
            T  ++ A++    R I+++GW              E+P  +Y     PHDWLF +     
Sbjct: 1284 TKAVVSAVRRADVRCILNKGWSDRLDNKDKNEIEIELPPEIYNSGTIPHDWLFPRIDAAV 1343

Query: 603  XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAI 430
                       +RAG PT I P FGDQFF+  R+   G G   I + +LT + L +A+
Sbjct: 1344 HHGGSGTTGATMRAGIPTIIKPFFGDQFFYATRIEDLGAG---IALKKLTAKTLGDAL 1398



>gb:AF522873_1808072 Leptosphaeria maculans aspartyl proteinase,
            UDP-glucose:sterol glycosyltransferase (ugt51), and RNA
            polymerase II C-terminal domain phosphatase component
            genes, complete cds.
          Length = 1456

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 7/100 (7%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGGL-----GTLPEIP--ETVYTLSDCPHDWLFLQCSXXX 604
            T  +++++     R ++ +GW         + PEIP    ++ +   PHDWLF Q     
Sbjct: 1223 TKTVVDSVLKADVRCVLSKGWSDRLETKDASKPEIPLPSEIFQIQSAPHDWLFKQMDAAV 1282

Query: 603  XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG 484
                       LRAG PT I P FGDQ+F+  R+   G+G
Sbjct: 1283 HHGGSGTTGASLRAGIPTIIKPFFGDQYFFAQRVEDMGVG 1322



>gb:AF254744_1781146 Ustilago maydis UDP-glucose:sterol
            glucosyltransferase Ugt53A1 (UGT53A1) gene, complete cds.
          Length = 1510

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 30/83 (36%), Positives = 43/83 (51%)
 Frame = -3

Query: 675  IPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQ 496
            IP+ V+ +   PHDWLF Q                LRAG  T I P FGDQFFW +R+ +
Sbjct: 1171 IPDDVFVVESVPHDWLFPQIDIAMHHGGAGTTGASLRAGLVTLIKPFFGDQFFWANRVQK 1230

Query: 495  KGLGPPPIPISQLTVEGLFEAIR 427
             G G     ++ L+V  + +A++
Sbjct: 1231 LGAG---ARVNGLSVSDISDALK 1250



>gb:AE016819_1749517 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 1227

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 7/100 (7%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGW----GGLGTLP---EIPETVYTLSDCPHDWLFLQCSXXX 604
            T  ++EA+       I+++GW    GG        ++P  VY   + PHDWLF +     
Sbjct: 1043 TMAVVEAVVKADVYCILNKGWSARLGGQSQKSIEVQLPNCVYDAGNVPHDWLFPRVDAAV 1102

Query: 603  XXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG 484
                       +RAG PT I P FGDQ+F+ +R+   G G
Sbjct: 1103 HHGGSGTTGATMRAGVPTVIKPFFGDQYFYANRIEDIGAG 1142



>gb:NSP561198_156200 Actinomadura sp. ATCC 39727 gene cluster for
           biosynthesis of glycopeptide antibiotic A40926, strain
           ATCC 39727.
          Length = 408

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G R I+ +GW GL   P+      T+ +  H  LF + +            
Sbjct: 258 VAIEAIRAHGHRVIVSRGWAGLAP-PDDRSDCLTVGEVNHQVLFGRVAAVVHAGSAGITT 316

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  +VP   DQ +   R+ + G+G      +P    TVE L  A+   L PE 
Sbjct: 317 AVTRAGAPQVVVPQMTDQPYHAGRVAELGIGVAHDGRVP----TVESLSAALTTALAPET 372

Query: 405 KSRVMELA 382
           ++R +++A
Sbjct: 373 RARAIDVA 380



>gb:AJ605139_526655 Actinoplanes teichomyceticus gene cluster for
           biosynthesis of glycopeptide antibiotic
           teicoplanin.>gb:AJ632270_528901 Actinoplanes
           teichomyceticus teicoplanin gene cluster.
          Length = 408

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G+R ++  GW GLG + E  +    + +  H  LF + +            
Sbjct: 258 VAIEAVRAQGRRVVLSSGWAGLGRIDE-GDDCLVVGEVNHQVLFGRVAAVVHAGSAGTTT 316

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  +VP   DQ ++  R+   G+G     P P    TVE L  A+   L P +
Sbjct: 317 AVTRAGAPQVVVPQMTDQPYYAGRVADLGVGVAHDGPTP----TVESLSAALATALTPGI 372

Query: 405 KSRVMELA 382
           ++R   +A
Sbjct: 373 RARAAAVA 380



>gb:AJ605139_526640 Actinoplanes teichomyceticus gene cluster for
           biosynthesis of glycopeptide antibiotic
           teicoplanin.>gb:AJ632270_528887 Actinoplanes
           teichomyceticus teicoplanin gene cluster.
          Length = 393

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G+R ++  GW GLG + E  +    + +  H  LF + +            
Sbjct: 243 VAIEAVRAQGRRVVLSSGWAGLGRIDE-GDDCLVVGEVNHQVLFGRVAAVVHHGGAGTTT 301

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  +VP   DQ ++  R+   G+G     P P    TVE L  A+   L P +
Sbjct: 302 AVTRAGAPQVVVPQKADQPYYAGRVADLGVGVAHDGPTP----TVESLSAALATALTPGI 357

Query: 405 KSRVMELA 382
           ++R   +A
Sbjct: 358 RARAAAVA 365



>gb:AE017343_1755692 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 1581

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 34/124 (27%), Positives = 51/124 (41%), Gaps = 13/124 (10%)
 Frame = -3

Query: 762  TDIILEALKVTGQRGIIDQGWGGLGTLP-------------EIPETVYTLSDCPHDWLFL 622
            T  ++EA+  +G   I+ +GW   G+               + P  ++ +    H WLF 
Sbjct: 1302 TRCVVEAVVNSGVCAILSKGWSDRGSKKGEPKGDSEGADGVKYPPEIFAIDSIDHGWLFP 1361

Query: 621  QCSXXXXXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGL 442
            +                LRAG PT I P FGDQ FW +R+    +G     I +LT   L
Sbjct: 1362 RIDAACHHGGAGTTGASLRAGIPTIIKPFFGDQAFWAERVESLNVGS---SIRRLTSHQL 1418

Query: 441  FEAI 430
              A+
Sbjct: 1419 ASAL 1422



>gb:AF394943_507061 Nocardia brasiliensis rifampin
           glycosyltransferase (rgt) and putative oxygenase genes,
           complete cds.
          Length = 406

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 34/126 (26%), Positives = 57/126 (45%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G+R ++ +GW  L  + +  +  + + D     LF + +            
Sbjct: 260 VAIEAVRAQGRRVLLGRGWAQLAPIDDDADC-FVVGDVNQQALFPRVAAVVHHGGAGTTT 318

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSR 397
              RAG P  IVP   DQ FW  R+ + G+G      S  TV+ L  A+   L  + +SR
Sbjct: 319 TAARAGAPQVIVPHIADQPFWAARIAELGIGAAH-QGSTPTVDSLSAALATALTSDTRSR 377

Query: 396 VMELAR 379
              +AR
Sbjct: 378 AESVAR 383



>gb:AY376382_614441 Mycobacterium intracellulare strain 5509-Borstel
           rhamnosyltransferase A (rtfA) and methyltransferase C
           (mtfC) genes, partial cds.
          Length = 419

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 37/116 (31%), Positives = 52/116 (44%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  GW     +P++ E V  +    +  +F  C              GLRAG P+
Sbjct: 270 GERALICSGWSDFSDVPQL-EHVKVVGVVNYTKIFPACRAVVHHGGSGTTAAGLRAGIPS 328

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
            I+   GDQ  WG R+ Q  +G      S  T E L   +R +L PE  +R  ELA
Sbjct: 329 LILWTAGDQPMWGSRVKQLKVGTSR-RFSSATPETLIADLRTILAPEYTTRARELA 383



>gb:AY509120_623770 Streptomyces bikiniensis strain NRRL 2737
           chalcomycin biosynthetic gene cluster, partial sequence.
          Length = 418

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 30/108 (27%), Positives = 52/108 (48%)
 Frame = -3

Query: 750 LEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXG 571
           L+A++  G+R ++  G        ++P+ V  L    +  LF + +              
Sbjct: 273 LDAVRGVGRRLVMVDGPDS-----DLPDDVLRLHQVDYATLFPRMAAVIHHGGAGTTAEV 327

Query: 570 LRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIR 427
           LRAG P  IVP+F D  FW  RL + G+   P+P ++ + E L +++R
Sbjct: 328 LRAGVPQVIVPVFADHPFWAARLSRTGVAARPVPFARFSREALAQSVR 375



>gb:AME16952_553205 Amycolatopsis balhimycina biosynthetic gene
           cluster for balhimycin, strain DSM 5908.
          Length = 409

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 3/129 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + ++A++  G+R I+ +GW  L  LP+  E  +   +     LF + +            
Sbjct: 259 VSIDAIRAQGRRVILSRGWADL-VLPDDREDCFATGEVNQQVLFGRVAAVIHHGGAGTTH 317

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
             ++AG P  +VP   DQ ++  R+ + G+G     P+P    T + L  A+   L PE 
Sbjct: 318 VAMQAGAPQVLVPQMADQPYYAGRVAELGIGVAHDGPVP----TFDSLSAALVTALAPET 373

Query: 405 KSRVMELAR 379
           ++R   +AR
Sbjct: 374 RARAEAVAR 382



>gb:AME16952_553206 Amycolatopsis balhimycina biosynthetic gene
           cluster for balhimycin, strain DSM 5908.
          Length = 409

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 36/156 (23%), Positives = 63/156 (40%), Gaps = 3/156 (1%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G+R I+ +GW  L  LP+  E  + + +     LF Q +            
Sbjct: 259 VAIEAIRALGRRAILSRGWADL-VLPDDREDCFAVDEANLQVLFEQSAAVVHHGSAGTEH 317

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P   +P   DQ ++  R+ + G+G     P+P    +   +   +   L PE 
Sbjct: 318 LATRAGVPQIAIPRHTDQAYYAGRVAELGVGVALEGPVP----SFAAMSAELATALAPET 373

Query: 405 KSRVMELARLXXXXXXXXXXXXAFHRHLPTELPLPA 298
           ++R  E+A               F      +L +PA
Sbjct: 374 RARAAEVAGTVRTDGTTMAAELLFQAAEQGKLTVPA 409



>pir|T30585|T30585 transferase homolog - Amycolatopsis
           orientalis>gb:AOPCZA361_553708 Amycolatopsis orientalis
           cosmid PCZA361.>gb:AOU84349_553749 Amycolatopsis
           orientalis hypothetical hydroxylases a and b genes,
           partial cds, glycosyltransferases GtfA (gtfA), GtfB
           (gtfB) and GtfC (gtfC) genes, complete cds.
          Length = 407

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 33/128 (25%), Positives = 58/128 (45%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + ++A++  G+R I+ +GW  L  LP+     + + +  H  LF + +            
Sbjct: 257 VAIDAIRAHGRRVILSRGWADL-VLPDDGADCFAIGEVNHQVLFGRVAAVIHHGGAGTTH 315

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  ++P   DQ ++  R+ + G+G     PIP    T + L  A+   L PE 
Sbjct: 316 VAARAGAPQILLPQMADQPYYAGRVAELGVGVAHDGPIP----TFDSLSAALATALTPET 371

Query: 405 KSRVMELA 382
            +R   +A
Sbjct: 372 HARATAVA 379



>gb:AE017237_413576 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 11 of 16 of the complete
           genome.>gb:AE016958_1056980 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 405

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 33/128 (25%), Positives = 56/128 (43%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++   +R ++ +GW GLG + +  E    + +  H  LF + +            
Sbjct: 262 VAIEAVRAQRRRAVVSRGWAGLGPIDD-GEDCLVVGEVNHQALFGRVAAVVHHGGVGTLT 320

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPP---PIPISQLTVEGLFEAIRFMLQPEV 406
               AG P  +VP   DQ +W  R+ + G+G     P P    TVE L  A+   L    
Sbjct: 321 AAALAGAPQVVVPQGADQPYWAARVAELGIGAAHDGPAP----TVESLSAALGTALTERT 376

Query: 405 KSRVMELA 382
           ++R   +A
Sbjct: 377 RARAGAVA 384



>gb:ATT4C12_1555947 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T4C12 (ESSA project).
          Length = 517

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 13/102 (12%)
 Frame = -3

Query: 642 PHDWLFLQCSXXXXXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPIS 463
           P++W+F  C+              L+AG P  I P   DQF+W +++   G+ P P+  +
Sbjct: 365 PYNWMFRTCAAAIHHGGSGSVAAALQAGIPQIICPFMLDQFYWAEKMSWLGVAPQPLKRN 424

Query: 462 QLTVEG-------------LFEAIRFMLQPEVKSRVMELARL 376
            L +E              + +AI   L  + ++R ME+A +
Sbjct: 425 HLLLEDSNDEKNITEAAQVVAKAIYDALSAKTRARAMEIAEI 466



>gb:AF351622_503980 Amycolatopsis orientalis glycosyltransferase
           GtfE (gtfE) gene, complete cds.
          Length = 409

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G+R I+ +GW  L  LP+  +  +   +     LF + +            
Sbjct: 259 VAIEAIRAHGRRVILSRGWADL-VLPDDRDDCFATGEVNQQVLFRRVAAVIHHGGAGTTH 317

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  +VP   DQ ++  R+ + G+G     P P    T E L  A+   L PE 
Sbjct: 318 VATRAGAPQILVPQIADQPYYAGRVAELGIGVAHDGPTP----TFESLSAALTTALAPET 373

Query: 405 KSRVMELA 382
           + R   +A
Sbjct: 374 RVRAEAVA 381



>gb:AB089954_11978 Micromonospora griseorubida gene cluster for the
           polyketide macrolide mycinamicin, partial and comeplete
           cds.
          Length = 420

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 2/105 (1%)
 Frame = -3

Query: 750 LEALKVTGQRGIIDQGWGGLGTLPEIP--ETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + A +  G+R ++  G       P++P  + V  L D  + WLF + +            
Sbjct: 273 IAAARAAGRRIVVVDG-------PDVPPSDDVLRLHDVDYRWLFPRTAAVVHHGGFGTTA 325

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGL 442
             +RAG P  +VP+F D  FW  RL + G+  P +    LT E L
Sbjct: 326 EVVRAGRPHVVVPVFADHPFWARRLTEIGVAAPAVDFRTLTREAL 370



>gb:AY376381_614439 Mycobacterium avium strain Sparrow 185
           rhamnosyltransferase A (rtfA) and methyltransferase C
           (mtfC) genes, partial cds.
          Length = 419

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 37/126 (29%), Positives = 54/126 (42%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           ++I  A    G+R +I  GW     +P  P+ V  +    +  +F  C            
Sbjct: 260 EMIGAACAELGERALICSGWSDFSNVPH-PDHVKVVGVVNYTKIFPACRAVVHHGGSGTT 318

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
             GLRAG P+ I+   GDQ  WG  + Q  +G      S  T E L   +R +L PE  +
Sbjct: 319 AAGLRAGIPSLILWTAGDQPLWGSHIKQLKVGTSR-RFSATTPETLVADLRKILAPEYLT 377

Query: 399 RVMELA 382
           R  EL+
Sbjct: 378 RARELS 383



>gb:AY376370_614417 Mycobacterium avium strain 6195
           rhamnosyltransferase A (rtfA) and methyltransferase C
           (mtfC) genes, partial cds.>gb:AY376371_614419
           Mycobacterium avium strain B-92 rhamnosyltransferase A
           (rtfA) and methyltransferase C (mtfC) genes, partial
           cds.>gb:AY376373_614423 Mycobacterium avium strain
           17584-286 rhamnosyltransferase A (rtfA) and
           methyltransferase C (mtfC) genes, partial cds.
          Length = 419

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 38/126 (30%), Positives = 54/126 (42%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           +II  A    G+R +I  GW     +P   + V  +    +  +F  C            
Sbjct: 260 EIIGTACAELGERALICSGWSDFSNVPHA-DHVKVVGVVNYTKIFPACRAVVHHGGSGTT 318

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
             GLRAG P+ I+   GDQ  WG R+ Q  +G      S  T E L   +R +L PE  +
Sbjct: 319 AAGLRAGIPSLILWTAGDQPLWGSRIKQLKVGTSR-RFSATTPETLVADLRKILAPEYLT 377

Query: 399 RVMELA 382
           R  EL+
Sbjct: 378 RARELS 383



>gb:AY376369_614415 Mycobacterium avium strain 724
           rhamnosyltransferase A (rtfA) and methyltransferase C
           (mtfC) genes, partial cds.>gb:AY376372_614421
           Mycobacterium avium strain 2151 rhamnosyltransferase A
           (rtfA) and methyltransferase C (mtfC) genes, partial
           cds.
          Length = 419

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 38/126 (30%), Positives = 54/126 (42%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           +II  A    G+R +I  GW     +P   + V  +    +  +F  C            
Sbjct: 260 EIIGTACAELGERALICSGWSDFSNVPHA-DHVKVVGVVNYTKIFPACRAVVHHGGSGTT 318

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
             GLRAG P+ I+   GDQ  WG R+ Q  +G      S  T E L   +R +L PE  +
Sbjct: 319 AAGLRAGIPSLILWTAGDQPLWGSRIKQLKVGTSR-RFSATTPETLVADLRKILAPEYLT 377

Query: 399 RVMELA 382
           R  EL+
Sbjct: 378 RARELS 383



>gb:AF060183_474522 Mycobacterium avium putative
           glycosyltransferase, rhamnosyltransferase (rtfA), and
           putative methyltransferase genes, complete
           cds.>gb:AF125999_481244 Mycobacterium avium
           glycopeptidolipid biosynthesis and daunorubicin
           resistance gene clusters, complete sequence; and
           transport membrane protein gene, partial
           cds.>gb:AF143772_482910 Mycobacterium avium strain 2151
           glycopeptidolipid biosynthesis and daunorubicin
           resistance gene clusters and insertion sequences IS1601,
           IS1245 and IS1348, complete sequence.
          Length = 428

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 38/126 (30%), Positives = 54/126 (42%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           +II  A    G+R +I  GW     +P   + V  +    +  +F  C            
Sbjct: 269 EIIGTACAELGERALICSGWSDFSNVPHA-DHVKVVGVVNYTKIFPACRAVVHHGGSGTT 327

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
             GLRAG P+ I+   GDQ  WG R+ Q  +G      S  T E L   +R +L PE  +
Sbjct: 328 AAGLRAGIPSLILWTAGDQPLWGSRIKQLKVGTSR-RFSATTPETLVADLRKILAPEYLT 386

Query: 399 RVMELA 382
           R  EL+
Sbjct: 387 RARELS 392



>pir|T44860|T44860 glycosyltransferase GtfE [imported] -
           Amycolatopsis orientalis>gb:AOU84350_553755
           Amycolatopsis orientalis hypothetical hydroxylases d and
           b genes, partial cds, hypothetical hydroxylase a,
           glycosyltransferases GtfD (gtfD) and GtfE (gtfE) genes,
           complete cds.
          Length = 408

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G R I+ +GW  L  LP+  E  + + +     LF + +            
Sbjct: 258 VAIEAIRAHGHRVILSRGWADL-VLPDDREDCFAIGEVNQQVLFRRVAAVIHHGGAGTTH 316

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  +VP   DQ ++  R+ + G+G     P P    T + L  A+   L PE 
Sbjct: 317 VATRAGVPQILVPQIADQPYYAARVAELGVGVAHDGPTP----TFDTLSAALTKALAPET 372

Query: 405 KSRVMELA 382
           + R   +A
Sbjct: 373 RVRAEAVA 380



>gb:AY376380_614437 Mycobacterium avium strain A5
           rhamnosyltransferase A (rtfA) and methyltransferase C
           (mtfC) genes, partial cds.
          Length = 419

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 36/126 (28%), Positives = 54/126 (42%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           ++I  A    G+R +I  GW     +P  P+ V  +    +  +F  C            
Sbjct: 260 EMIGAACAELGERALICSGWSDFSNVPH-PDHVKVVGVVNYTKIFPACRAVVHHGGSGTT 318

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
             GLRAG P+ I+   GDQ  WG  + +  +G      S  T E L   +R +L PE  +
Sbjct: 319 AAGLRAGIPSLILWTAGDQPLWGSHIKRLKVGTSR-RFSATTPETLVADLRKILAPEYLT 377

Query: 399 RVMELA 382
           R  EL+
Sbjct: 378 RARELS 383



>gb:AY376374_614425 Mycobacterium avium strain 101
           rhamnosyltransferase A (rtfA) and methyltransferase C
           (mtfC) genes, partial cds.>gb:AY376375_614427
           Mycobacterium avium strain 2993 rhamnosyltransferase A
           (rtfA) and methyltransferase C (mtfC) genes, partial
           cds.>gb:AY376376_614429 Mycobacterium avium strain 104
           rhamnosyltransferase A (rtfA) and methyltransferase C
           (mtfC) genes, partial cds.>gb:AY376377_614431
           Mycobacterium avium strain SJB2 rhamnosyltransferase A
           (rtfA) and methyltransferase C (mtfC) genes, partial
           cds.>gb:AY376378_614433 Mycobacterium avium strain
           13528-1079 rhamnosyltransferase A (rtfA) and
           methyltransferase C (mtfC) genes, partial
           cds.>gb:AY376379_614435 Mycobacterium avium strain
           34540-Wales rhamnosyltransferase A (rtfA) and
           methyltransferase C (mtfC) genes, partial cds.
          Length = 419

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 36/126 (28%), Positives = 54/126 (42%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           ++I  A    G+R +I  GW     +P  P+ V  +    +  +F  C            
Sbjct: 260 EMIGAACAELGERALICSGWSDFSNVPH-PDHVKVVGVVNYTKIFPACRAVVHHGGSGTT 318

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
             GLRAG P+ I+   GDQ  WG  + +  +G      S  T E L   +R +L PE  +
Sbjct: 319 AAGLRAGIPSLILWTAGDQPLWGSHIKRLKVGTSR-RFSATTPETLVADLRKILAPEYLT 377

Query: 399 RVMELA 382
           R  EL+
Sbjct: 378 RARELS 383



>gb:AY130970_591124 Mycobacterium avium strain A5 glycopeptidolipid
           biosynthesis gene cluster, partial sequence.
          Length = 428

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 36/126 (28%), Positives = 54/126 (42%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           ++I  A    G+R +I  GW     +P  P+ V  +    +  +F  C            
Sbjct: 269 EMIGAACAELGERALICSGWSDFSNVPH-PDHVKVVGVVNYTKIFPACRAVVHHGGSGTT 327

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
             GLRAG P+ I+   GDQ  WG  + +  +G      S  T E L   +R +L PE  +
Sbjct: 328 AAGLRAGIPSLILWTAGDQPLWGSHIKRLKVGTSR-RFSATTPETLVADLRKILAPEYLT 386

Query: 399 RVMELA 382
           R  EL+
Sbjct: 387 RARELS 392



>gb:AF351621_503979 Amycolatopsis orientalis glycosyltransferase
           GtfD (gtfD) gene, complete cds.
          Length = 408

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/128 (25%), Positives = 58/128 (45%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G+R I+ +GW  L  LP+  +  + + +     LF + +            
Sbjct: 258 VAVEAIRAQGRRVILSRGWTEL-VLPDDRDDCFAIDEVNFQALFRRVAAVIHHGSAGTEH 316

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  ++P   DQ ++  R+   G+G     P P    T E L  A+  +L PE 
Sbjct: 317 VATRAGVPQLVIPRNTDQPYFAGRVAALGIGVAHDGPTP----TFESLSAALTTVLAPET 372

Query: 405 KSRVMELA 382
           ++R   +A
Sbjct: 373 RARAEAVA 380



>gb:SFAJ5397_182670 Streptomyces fradiae tylN
           gene.>gb:AF055922_474070 Streptomyces fradiae dipeptidil
           carboxypeptidase (ddcA), tylosin resistance protein
           (tlrB), glycosyltransferase (tylN), methyltransferase
           (tylE), 4-ketoreductase (tylD), ferredoxin (tylH2),
           cytochrome P450 (tylH1), macrocin O-methyltransferase
           (tylF), epimerase (tylJ), acyl-CoA oxydase (tylP), and
           butyrolactone receptor (tylQ) genes, complete cds.
          Length = 422

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 21/83 (25%), Positives = 37/83 (44%)
 Frame = -3

Query: 675 IPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPTTIVPLFGDQFFWGDRLLQ 496
           +P     +    + WL  + +              +RAG P  +VP+F D  FW  RL +
Sbjct: 294 LPGDALRVPSADYSWLMPRTAAVVHHGGFGTTADAVRAGVPQVLVPVFADHPFWAARLRR 353

Query: 495 KGLGPPPIPISQLTVEGLFEAIR 427
            G    P+P++++  E L  ++R
Sbjct: 354 MGTAARPVPLARMNREALAASVR 376



>pir|T44859|T44859 glycosyltransferase GtfD [imported] -
           Amycolatopsis orientalis>gb:AOU84350_553754
           Amycolatopsis orientalis hypothetical hydroxylases d and
           b genes, partial cds, hypothetical hydroxylase a,
           glycosyltransferases GtfD (gtfD) and GtfE (gtfE) genes,
           complete cds.
          Length = 408

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 3/130 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           I +E  +  G+R I+ +GW  L  LP+  E  + + +     LF + +            
Sbjct: 258 IAVEVSRAHGRRVILSRGWTDL-LLPDDREDCFAIGEVNFQALFPRVAAVIHHGSAGTEH 316

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
              RAG P  ++P   DQ ++  R+   G+G     P P    T E L  A+  +L PE 
Sbjct: 317 VATRAGVPQLVIPRNTDQPYFAARVADLGIGVAHDGPTP----TFESLSAALTTVLAPET 372

Query: 405 KSRVMELARL 376
           ++R   +A +
Sbjct: 373 RARARAVAAM 382



>gb:AY138899_591657 Mycobacterium smegmatis glycopeptidolipid locus,
           complete sequence.
          Length = 422

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 35/126 (27%), Positives = 50/126 (39%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           D+I  A    G+R ++  G    G  P   E V       +  +F  C            
Sbjct: 272 DMIASACAELGERALVCAGGTDFGDSPRF-EHVKVAGTVNYATVFPVCRAVVHHGGSGTT 330

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
              LRAG PT  +   GDQ FWG +L +  +G      S  T + L   +R +L PE   
Sbjct: 331 AASLRAGVPTLTLWTAGDQPFWGAQLKKLKVGASR-RFSATTRDTLVSDLRRILSPEYAV 389

Query: 399 RVMELA 382
           +  E+A
Sbjct: 390 KAREVA 395



>pir|T30584|T30584 transferase homolog - Amycolatopsis
           orientalis>gb:AOPCZA361_553707 Amycolatopsis orientalis
           cosmid PCZA361.>gb:AOU84349_553748 Amycolatopsis
           orientalis hypothetical hydroxylases a and b genes,
           partial cds, glycosyltransferases GtfA (gtfA), GtfB
           (gtfB) and GtfC (gtfC) genes, complete cds.
          Length = 396

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/130 (23%), Positives = 60/130 (46%), Gaps = 7/130 (5%)
 Frame = -3

Query: 750 LEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXG 571
           ++A++ +G+R ++ +GW  L  LP+     + + +     LF + +              
Sbjct: 244 IKAVRASGRRIVLSRGWADL-VLPDDGADCFVVGEVNLQELFGRVAAAIHHDSAGTTLLA 302

Query: 570 LRAGCPTTIVPLFGD----QFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQP 412
           +RAG P  +V    D    Q +  DR+ + G+G     P+P    T++ L  A+   L P
Sbjct: 303 MRAGIPQIVVRRVVDNVVEQAYHADRVAELGVGVAVDGPVP----TIDSLSAALDTALAP 358

Query: 411 EVKSRVMELA 382
           E+++R   +A
Sbjct: 359 EIRARATTVA 368



>pir|T30586|T30586 glycosyltransferase homolog - Amycolatopsis
           orientalis>gb:AOPCZA361_553709 Amycolatopsis orientalis
           cosmid PCZA361.>gb:AOU84349_553750 Amycolatopsis
           orientalis hypothetical hydroxylases a and b genes,
           partial cds, glycosyltransferases GtfA (gtfA), GtfB
           (gtfB) and GtfC (gtfC) genes, complete cds.
          Length = 409

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 28/128 (21%), Positives = 56/128 (43%), Gaps = 3/128 (2%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           + +EA++  G+R ++  GW  L   P+     +++ +     LF + +            
Sbjct: 259 VAIEAIRAHGRRIVLLSGWADL-VRPDDGADCFSVDEVNLQVLFSRAAAAIHHGSAGTEH 317

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLG---PPPIPISQLTVEGLFEAIRFMLQPEV 406
               AG P  ++P   DQ ++ +R+   G+G     P+P    T + +  A+   L PE 
Sbjct: 318 LATLAGIPQIVIPRHTDQPYYAERVADLGIGVALEGPVP----TFDAMSAAVATALAPET 373

Query: 405 KSRVMELA 382
           ++R   +A
Sbjct: 374 RARATAVA 381



>gb:AY138899_591664 Mycobacterium smegmatis glycopeptidolipid locus,
           complete sequence.
          Length = 417

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 34/126 (26%), Positives = 55/126 (43%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           ++I  A    GQR ++  G   L  +P+  + V  +    +  +F  C            
Sbjct: 268 EMISHACDQLGQRALVCAGGTDLRGVPQF-DNVKMVGAVNYAAVFPLCRGIVHHGGSGTT 326

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
              LRAG PT I+    DQ +WG++L +  +G      S  + + L   +R +L+PE   
Sbjct: 327 AASLRAGVPTLILWSTADQPYWGNQLKRLKVGTSR-RFSGASRKSLVTDLRRILRPEYAV 385

Query: 399 RVMELA 382
           R  ELA
Sbjct: 386 RARELA 391



>gb:AF060183_474521 Mycobacterium avium putative
           glycosyltransferase, rhamnosyltransferase (rtfA), and
           putative methyltransferase genes, complete
           cds.>gb:AF125999_481243 Mycobacterium avium
           glycopeptidolipid biosynthesis and daunorubicin
           resistance gene clusters, complete sequence; and
           transport membrane protein gene, partial
           cds.>gb:AF143772_482909 Mycobacterium avium strain 2151
           glycopeptidolipid biosynthesis and daunorubicin
           resistance gene clusters and insertion sequences IS1601,
           IS1245 and IS1348, complete sequence.
          Length = 425

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 31/126 (24%), Positives = 52/126 (41%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           D+I  A    G+R ++  G      +P  P+ V  +    +  +F  C            
Sbjct: 272 DMIGTACAQLGERALLCAGRSDFSGVPA-PDHVKVVGPVNYATIFPACRAVVHHGGSGTT 330

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
              LRAG PT I+ +  +Q  WG +L +  +G      S    + L + +R +L P+   
Sbjct: 331 AASLRAGVPTLILSMDANQTIWGAQLKRLKVGATR-RFSATDRDSLVQDLRKILAPDYAR 389

Query: 399 RVMELA 382
           R  E+A
Sbjct: 390 RAREIA 395



>sp|Q50583|YF24_MYCTU Hypothetical protein
           Rv1524/MT1575/Mb1551.>pir|D70723|D70723 probable
           transferase - Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_21615 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248339_758907
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 6/14.>gb:BX842576_819593 Mycobacterium
           tuberculosis H37Rv complete genome; segment 5/13.
          Length = 414

 Score = 40.0 bits (92), Expect = 0.047
 Identities = 34/125 (27%), Positives = 52/125 (41%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           +I  A    G+R +I  G      +P+  + V  +    H  +F  C             
Sbjct: 267 MISAACAELGERALICSGPSDATGIPQF-DHVKVVRVVSHAAVFPTCRAVVHHGGAGTTA 325

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSR 397
            GLRAG PT I+ +  DQ  W  ++ Q  +G      S  T E L   +R +L P+  +R
Sbjct: 326 AGLRAGIPTLILWVTSDQPIWAAQIKQLKVGRGR-RFSSATKESLIADLRTILAPDYVTR 384

Query: 396 VMELA 382
             E+A
Sbjct: 385 AREIA 389



>gb:AY130970_591123 Mycobacterium avium strain A5 glycopeptidolipid
           biosynthesis gene cluster, partial sequence.
          Length = 426

 Score = 39.7 bits (91), Expect = 0.061
 Identities = 30/126 (23%), Positives = 51/126 (40%)
 Frame = -3

Query: 759 DIILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXX 580
           D+I  A    G+R ++  G         +P+ V  +    +  +F  C            
Sbjct: 272 DMIGTACAQLGERALLCAGPQVTSAGVPVPDHVKVVGPVNYATIFPACRAVVHHGGSGTT 331

Query: 579 XXGLRAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKS 400
              LRAG PT I+ +  +Q  WG +L +  +G      S    + L + +R +L P+   
Sbjct: 332 AASLRAGVPTLILSMDANQTIWGAQLKRLKVGATR-RFSATDRDSLVQDLRKILAPDYAR 390

Query: 399 RVMELA 382
           R  E+A
Sbjct: 391 RAREIA 396



>gb:AE017240_414467 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 14 of 16 of the complete
           genome.>gb:AE016958_1057871 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 408

 Score = 39.3 bits (90), Expect = 0.080
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 2/108 (1%)
 Frame = -3

Query: 696 GLGTLPEIPET--VYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPTTIVPLFGDQ 523
           G   L  +P +  V  ++   H  +F  C              G+RAG PT ++ +  +Q
Sbjct: 277 GTNDLTHVPRSGHVKIVAAMNHAAIFPACRAVVHHGGAGTTAAGMRAGVPTLVLWMRNEQ 336

Query: 522 FFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELAR 379
             WG  + Q  +G      S+ T E L   +R +L+P   +R  E+A+
Sbjct: 337 PLWGAAVKQMKVGSSQ-RFSKTTEESLATCLRSILRPHYMTRAREVAK 383



>gb:AF370013_1792010 Magnaporthe grisea UDP-glucose:sterol
           glucosyltransferase gene, partial cds.
          Length = 581

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 16/46 (34%), Positives = 20/46 (43%)
 Frame = -3

Query: 681 PEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPTTI 544
           P++P  +  +   PHDWLF Q                LRAG PT I
Sbjct: 536 PKLPPEILQIKSAPHDWLFAQVDAVAHHGGSGTTGASLRAGVPTII 581



>gb:AY138899_591661 Mycobacterium smegmatis glycopeptidolipid locus,
           complete sequence.
          Length = 422

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 27/117 (23%), Positives = 47/117 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  GW     +  + + V  +    +  +F  C               LRAG PT
Sbjct: 282 GERALICAGWSDFSDVA-LADHVKVVGAVNYATVFPGCRAVVHHGGSGTTAASLRAGLPT 340

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELAR 379
            ++ +  +Q  WG ++ +  +G      S+     L   +R +L P   +R   LAR
Sbjct: 341 LVLSMDANQALWGAQIKRLKVGTTR-RFSKTNRRTLIADLRTILDPAYAARAQALAR 396



>sp|Q49929|YF24_MYCLE Hypothetical protein ML2348.>pir|S73010|S73010
           hypothetical protein L518_C2_147 - Mycobacterium
           leprae>gb:MLCB2407_144842 Mycobacterium leprae cosmid
           B2407.>gb:MLEPRTN9_148153 Mycobacterium leprae strain TN
           complete genome; segment 9/10.>gb:U00023_199102
           Mycobacterium leprae cosmid L518.
          Length = 421

 Score = 35.8 bits (81), Expect = 0.88
 Identities = 33/127 (25%), Positives = 53/127 (41%), Gaps = 2/127 (1%)
 Frame = -3

Query: 756 IILEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXX 577
           +I  A    G+R +I      L  +P+  + V  ++   H  +F  C             
Sbjct: 266 MIAAACADLGERALISVKPKDLTQVPKF-DHVKIVTSVSHAAVFPACRAVVHHGGAGTTA 324

Query: 576 XGLRAGCPTTIVPLFGDQFFWGDRL--LQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVK 403
             LRAG PT I+ +F +Q  W  ++  L+ G G      S  T   L   +R +L P+  
Sbjct: 325 ASLRAGVPTLILWIFIEQPVWAAQIKRLKVGAGR---RFSATTQRSLAADLRTILAPQYA 381

Query: 402 SRVMELA 382
           +R  E+A
Sbjct: 382 TRAREVA 388



>pir|B53652|B53652 rhamnosyltransferase 1 chain B - Pseudomonas
           aeruginosa>gb:PSERHTR_161009 Pseudomonas aeruginosa
           rhamnosyl transferase genes and regulatory protein gene,
           complete cds.
          Length = 426

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 34/126 (26%), Positives = 51/126 (40%), Gaps = 2/126 (1%)
 Frame = -3

Query: 750 LEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXG 571
           L AL+  G RGI   G  G   L  +P  V   +  P   L   C+              
Sbjct: 273 LRALERLGARGIFLTG-AGQEPLRGLPNHVLQRAYAPLGALLPSCAGLVHPGGIGAMSLA 331

Query: 570 LRAGCPTTIVPLFGDQFFWGDRLLQKGLGPP-PIPISQLTVEG-LFEAIRFMLQPEVKSR 397
           L AG P  ++P   DQF   +RL++ G G    +P+ +  + G L+  +          R
Sbjct: 332 LAAGVPQVLLPCAHDQFDNAERLVRLGCGMRLGVPLREQELRGALWRLLEDPAMAAACRR 391

Query: 396 VMELAR 379
            MEL++
Sbjct: 392 FMELSQ 397



>pir|C83212|C83212 rhamnosyltransferase chain B PA3478 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004768_57714
           Pseudomonas aeruginosa PAO1, section 329 of 529 of the
           complete genome.>gb:AE004091_971814 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 426

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 34/126 (26%), Positives = 51/126 (40%), Gaps = 2/126 (1%)
 Frame = -3

Query: 750 LEALKVTGQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXG 571
           L AL+  G RGI   G  G   L  +P  V   +  P   L   C+              
Sbjct: 273 LRALERLGARGIFLTG-AGQEPLRGLPNHVLQRAYAPLGALLPSCAGLVHPGGIGAMSLA 331

Query: 570 LRAGCPTTIVPLFGDQFFWGDRLLQKGLGPP-PIPISQLTVEG-LFEAIRFMLQPEVKSR 397
           L AG P  ++P   DQF   +RL++ G G    +P+ +  + G L+  +          R
Sbjct: 332 LAAGVPQVLLPCAHDQFDNAERLVRLGCGMRLGVPLREQELRGALWRLLEDPAMAAACRR 391

Query: 396 VMELAR 379
            MEL++
Sbjct: 392 FMELSQ 397



>gb:AB008677_1407693 Bos taurus mRNA for
           UDP-glucuronosyltransferase, complete cds.
          Length = 529

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEV-KSRVMEL 385
           G P  ++PLFGDQ     R+  +G G   + + +++ E L +A++ ++  +  K  +M L
Sbjct: 381 GVPMVMMPLFGDQMDNAKRMETRGAG-VTLNVLEMSSEDLEKALKAVINEKTYKENIMRL 439

Query: 384 ARL 376
           +RL
Sbjct: 440 SRL 442



>gb:HSU89508_2027086 Human UDP-glucuronosyltransferase 1A10 mRNA,
           complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>gb:BC019861_1976915 Homo sapiens UDP glycosyltransferase 1 family,
           polypeptide A6, transcript variant 1, mRNA (cDNA clone
           MGC:29860 IMAGE:4454322), complete cds.
          Length = 532

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 384 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 442

Query: 384 ARL 376
           + L
Sbjct: 443 SSL 445



>gb:AY029169_1934457 Macaca mulatta UDP-glucuronosyltransferase
           UGT1A01 mRNA, complete cds.
          Length = 533

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 385 GVPMVMMPLFGDQMDNAKRMETKGAG-MTLNVLEMTSEDLENALKAVINDKSYKENIMHL 443

Query: 384 ARL 376
           + L
Sbjct: 444 SSL 446



>gb:AF462267_1903375 Homo sapiens UDP-glucuronosyltransferase
           UGT1A8*2 (UGT1A8) mRNA, UGT1A8*2 allele, complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>gb:AF360121_1898898 Macaca mulatta UDP-glucuronosyltransferase
           UGT1A01 mRNA, complete cds.
          Length = 533

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 385 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMHL 443

Query: 384 ARL 376
           + L
Sbjct: 444 SSL 446



>gb:AF297093_1895570 Homo sapiens UGT1 gene locus, complete
           sequence.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>gb:AF104339_1883908 Macaca fascicularis UDP-glucuronosyltransferase
           UGT1A01 mRNA, complete cds.
          Length = 533

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 385 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMHL 443

Query: 384 ARL 376
           + L
Sbjct: 444 SSL 446



>gb:AF104338_1883907 Macaca fascicularis UDP-glucuronosyltransferase
           UGT1A08 mRNA, complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMHL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>gb:AF104337_1883906 Macaca fascicularis UDP-glucuronosyltransferase
           UGT1A06 mRNA, complete cds.
          Length = 532

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 384 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMHL 442

Query: 384 ARL 376
           + L
Sbjct: 443 SSL 445



>gb:AF104336_1883905 Macaca fascicularis UDP-glucuronosyltransferase
           UGT1A09 mRNA, complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMHL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>gb:AF030310_1877645 Homo sapiens UDP-glucuronosyltransferase 1A8
           (UGT1A8) mRNA, complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>gb:AY376368_614414 Mycobacterium avium strain 17584-286
           glycosyltransferase B (gtfB) gene, partial cds.
          Length = 296

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 176 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 234

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 235 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLVADLRTILAPDYATRARDLA 289



>gb:AY376366_614412 Mycobacterium avium strain B-92
           glycosyltransferase B (gtfB) gene, partial
           cds.>gb:AY376367_614413 Mycobacterium avium strain 6195
           glycosyltransferase B (gtfB) gene, partial cds.
          Length = 296

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 176 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 234

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 235 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLVADLRTILAPDYATRARDLA 289



>gb:AY376365_614411 Mycobacterium avium strain 724
           glycosyltransferase B (gtfB) gene, partial cds.
          Length = 296

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 176 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 234

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 235 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLVADLRTILAPDYATRARDLA 289



>gb:AY376364_614410 Mycobacterium avium strain A5
           glycosyltransferase B (gtfB) gene, partial cds.
          Length = 296

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 176 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 234

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 235 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLVADLRTILAPDYATRARDLA 289



>gb:AY376356_614402 Mycobacterium avium strain 34540-Wales
           glycosyltransferase B (gtfB) gene, partial
           cds.>gb:AY376357_614403 Mycobacterium avium strain
           Sparrow 185 glycosyltransferase B (gtfB) gene, partial
           cds.
          Length = 296

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 176 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 234

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 235 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLVADLRTILAPDYATRARDLA 289



>gb:AY130970_591128 Mycobacterium avium strain A5 glycopeptidolipid
           biosynthesis gene cluster, partial sequence.
          Length = 418

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 278 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 336

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 337 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLVADLRTILAPDYATRARDLA 391



>gb:AF125999_481248 Mycobacterium avium glycopeptidolipid
           biosynthesis and daunorubicin resistance gene clusters,
           complete sequence; and transport membrane protein gene,
           partial cds.
          Length = 418

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 278 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 336

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 337 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLVADLRTILAPDYATRARDLA 391



>gb:CP000026_75788 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 110

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 1/72 (1%)
 Frame = -1

Query: 716 LLTKVGEVLVLYQKFLKLFIRF-RIALMTGFSCNAQLWFIMVVPEPRLQGYGLGVQQLSY 540
           LL +VG + V Y    KLFI F  I ++   SC   L+FI+  PE  +  Y L  +  S 
Sbjct: 9   LLKRVG-LPVKYTDNAKLFISFINIGIV---SCALLLFFILYEPESAIVTYSLPGELSSS 64

Query: 539 HCSEINFSGVTD 504
            C   NF G  D
Sbjct: 65  TCDAHNFIGYVD 76



>pir|S40710|S40710 hypothetical protein C07A9.6 - Caenorhabditis
           elegans
          Length = 703

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 18/64 (28%), Positives = 33/64 (51%)
 Frame = -3

Query: 567 RAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVME 388
           +AG P  ++PLF DQ     R  + G+    +    LT+  ++ AI+  L+PE  +   +
Sbjct: 583 QAGIPAVLMPLFADQKINAKRAQRYGMA-TVLDKLDLTINNVYGAIKEALKPEYSTNAKK 641

Query: 387 LARL 376
           L+ +
Sbjct: 642 LSAM 645



>pir|A31340|A31340 glucuronosyltransferase (EC 2.4.1.17) UGT1A1
           precursor - human>gb:HUMUGT1FA_2037990 Homo sapiens
           phenol UDP-glucuronosyltransferase (UDPGT) mRNA,
           complete cds.
          Length = 531

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 383 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 441

Query: 384 ARL 376
           + L
Sbjct: 442 SSL 444



>pir|JC5656|JC5656 UDP glucuronosyltransferase (EC 2.4.1.-) 1A10
           precursor - human
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>sp|P34317|YKT6_CAEEL Hypothetical protein C07A9.6 in chromosome III
           precursor.>gb:CEC07A9_1360150 Caenorhabditis elegans
           cosmid C07A9, complete sequence.
          Length = 507

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 18/64 (28%), Positives = 33/64 (51%)
 Frame = -3

Query: 567 RAGCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVME 388
           +AG P  ++PLF DQ     R  + G+    +    LT+  ++ AI+  L+PE  +   +
Sbjct: 387 QAGIPAVLMPLFADQKINAKRAQRYGMA-TVLDKLDLTINNVYGAIKEALKPEYSTNAKK 445

Query: 387 LARL 376
           L+ +
Sbjct: 446 LSAM 449



>sp|Q9HAW8|UD1A_HUMAN UDP-glucuronosyltransferase 1-10 precursor,
           microsomal (EC 2.4.1.17) (UDPGT) (UGT1*10) (UGT1-10)
           (UGT1.10) (UGT-1J) (UGT1J).>gb:AF297093_1895567 Homo
           sapiens UGT1 gene locus, complete
           sequence.>gb:AY435137_1950634 Homo sapiens UDP
           glycosyltransferase 1 family polypeptide A10 (UGT1A10)
           mRNA, complete cds.>gb:BC020971_1977317 Homo sapiens UDP
           glycosyltransferase 1 family, polypeptide A10, mRNA
           (cDNA clone MGC:9353 IMAGE:3850654), complete
           cds.>gb:BC069210_1987868 Homo sapiens UDP
           glycosyltransferase 1 family, polypeptide A10, mRNA
           (cDNA clone MGC:78613 IMAGE:4660540), complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>sp|O60656|UD19_HUMAN UDP-glucuronosyltransferase 1-9 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A9) (UDPGT) (UGT1*9) (UGT1-9) (UGT1.9) (UGT-1I)
           (UGT1I).>gb:AX286762_1465282 Sequence 1 from Patent
           WO0180896.>gb:AX286764_1465283 Sequence 3 from Patent
           WO0180896.>gb:AF056188_1879573 Homo sapiens
           UDP-glucuronosyltransferase 1A9 (UGT1A9) mRNA, complete
           cds.>gb:AF297093_1895569 Homo sapiens UGT1 gene locus,
           complete sequence.>gb:AY435144_1950641 Homo sapiens UDP
           glycosyltransferase 1 family polypeptide 9 (UGT1A9)
           mRNA, complete cds.>gb:BC058844_1985547 Homo sapiens UDP
           glycosyltransferase 1 family, polypeptide A9, mRNA (cDNA
           clone MGC:61893 IMAGE:4593613), complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>sp|Q9HAW9|UD18_HUMAN UDP-glucuronosyltransferase 1-8 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A8) (UDPGT) (UGT1*8) (UGT1-08) (UGT1.8) (UGT-1H)
           (UGT1H).>gb:AF297093_1895566 Homo sapiens UGT1 gene
           locus, complete sequence.>gb:AF462268_1903376 Homo
           sapiens UDP-glucuronosyltransferase UGT1A8*1 (UGT1A8)
           mRNA, UGT1A8*1 allele, complete cds.>gb:AY435143_1950640
           Homo sapiens UDP glycosyltransferase 1 family
           polypeptide A8 (UGT1A8) mRNA, complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>sp|Q9HAW7|UD17_HUMAN UDP-glucuronosyltransferase 1-7 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A7) (UDPGT) (UGT1*7) (UGT1-07) (UGT1.7) (UGT-1G)
           (UGT1G).>gb:AY435142_1950639 Homo sapiens UDP
           glycosyltransferase 1 family polypeptide A7 (UGT1A7)
           mRNA, complete cds.
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>sp|P19224|UD16_HUMAN UDP-glucuronosyltransferase 1-6 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A6) (UDPGT) (UGT1*6) (UGT1-06) (UGT1.6) (UGT-1F)
           (UGT1F) (Phenol-metabolizing
           UDP-glucuronosyltransferase).>gb:AF297093_1895571 Homo
           sapiens UGT1 gene locus, complete
           sequence.>gb:AY435141_1950638 Homo sapiens UDP
           glycosyltransferase 1 family polypeptide A6 (UGT1A6)
           mRNA, complete cds.
          Length = 532

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 384 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 442

Query: 384 ARL 376
           + L
Sbjct: 443 SSL 445



>sp|P35504|UD15_HUMAN UDP-glucuronosyltransferase 1-5 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A5) (UDPGT) (UGT1*5) (UGT1-05) (UGT1.5) (UGT-1E)
           (UGT1E).>gb:AF297093_1895572 Homo sapiens UGT1 gene
           locus, complete sequence.>gb:AY435140_1950637 Homo
           sapiens UDP glycosyltransferase 1 family polypeptide A5
           (UGT1A5) mRNA, complete cds.
          Length = 534

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 386 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 444

Query: 384 ARL 376
           + L
Sbjct: 445 SSL 447



>sp|P22310|UD14_HUMAN UDP-glucuronosyltransferase 1-4 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A4) (UDPGT) (UGT1*4) (UGT1-04) (UGT1.4) (UGT-1D)
           (UGT1D) (Bilirubin specific UDPGT isozyme 2)
           (HUG-BR2).>gb:AF297093_1895573 Homo sapiens UGT1 gene
           locus, complete sequence.>gb:AY435139_1950636 Homo
           sapiens UDP glycosyltransferase 1 family polypeptide A4
           (UGT1A4) mRNA, complete cds.>gb:HUMHUGBR2_2032283 Human
           bilirubin UDP-glucuronosyltransferase isozyme 2 mRNA,
           complete cds.
          Length = 534

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 386 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 444

Query: 384 ARL 376
           + L
Sbjct: 445 SSL 447



>sp|P35503|UD13_HUMAN UDP-glucuronosyltransferase 1-3 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A3) (UDPGT) (UGT1*3) (UGT1-03) (UGT1.3) (UGT-1C)
           (UGT1C).>gb:AF297093_1895574 Homo sapiens UGT1 gene
           locus, complete sequence.>gb:AY435138_1950635 Homo
           sapiens UDP glycosyltransferase 1 family polypeptide A3
           (UGT1A3) mRNA, complete cds.
          Length = 534

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 386 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 444

Query: 384 ARL 376
           + L
Sbjct: 445 SSL 447



>sp|P36509|UD12_HUMAN UDP-glucuronosyltransferase 1-2 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A2) (UDPGT) (UGT1*2) (UGT1-02) (UGT1.2) (UGT-1B)
           (UGT1B) (HLUGP4).
          Length = 530

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443



>sp|P22309|UD11_HUMAN UDP-glucuronosyltransferase 1-1 precursor,
           microsomal (EC 2.4.1.17) (UDP-glucuronosyltransferase
           1A1) (UDPGT) (UGT1*1) (UGT1-01) (UGT1.1) (UGT-1A)
           (UGT1A) (Bilirubin specific UDPGT isozyme 1)
           (HUG-BR1).>pir|A39092|A39092 glucuronosyltransferase (EC
           2.4.1.17) 1 precursor, bilirubin-specific -
           human>gb:AC006985_1875194 Homo sapiens BAC clone
           RP11-154L24 from 2, complete
           sequence.>gb:AF297093_1895576 Homo sapiens UGT1 gene
           locus, complete sequence.>gb:AY435136_1950633 Homo
           sapiens UDP glycosyltransferase 1 family polypeptide A1
           (UGT1A1) mRNA, complete cds.>gb:AY603772_1957358 Homo
           sapiens UDP glycosyltransferase 1 family, polypeptide A1
           (UGT1A1) gene, complete cds.>gb:HUMHUGBR1_2032282 Human
           bilirubin UDP-glucuronosyltransferase isozyme 1 mRNA,
           complete cds.
          Length = 533

 Score = 32.7 bits (73), Expect = 7.5
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 385 GVPMVMMPLFGDQMDNAKRMETKGAG-VTLNVLEMTSEDLENALKAVINDKSYKENIMRL 443

Query: 384 ARL 376
           + L
Sbjct: 444 SSL 446



>gb:AF499596_2266679 Phthorimaea operculella granulovirus, complete
           genome.
          Length = 434

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = -3

Query: 570 LRAGCPTTIVPLFGDQFFWGDRLLQKGL 487
           + AG P  ++PL GDQF+   RL+Q G+
Sbjct: 359 IEAGVPMLVLPLMGDQFYNAHRLVQLGV 386



>gb:AY376358_614404 Mycobacterium avium strain 101
           glycosyltransferase B (gtfB) gene, partial
           cds.>gb:AY376359_614405 Mycobacterium avium strain 2993
           glycosyltransferase B (gtfB) gene, partial
           cds.>gb:AY376360_614406 Mycobacterium avium strain
           13528-1079 glycosyltransferase B (gtfB) gene, partial
           cds.>gb:AY376361_614407 Mycobacterium avium strain 104
           glycosyltransferase B (gtfB) gene, partial
           cds.>gb:AY376362_614408 Mycobacterium avium strain 2151
           glycosyltransferase B (gtfB) gene, partial
           cds.>gb:AY376363_614409 Mycobacterium avium strain SJB2
           glycosyltransferase B (gtfB) gene, partial cds.
          Length = 296

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 176 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 234

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 235 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLAADLRTILAPDYATRARDLA 289



>gb:AF143772_482914 Mycobacterium avium strain 2151
           glycopeptidolipid biosynthesis and daunorubicin
           resistance gene clusters and insertion sequences IS1601,
           IS1245 and IS1348, complete sequence.
          Length = 418

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 28/116 (24%), Positives = 47/116 (40%)
 Frame = -3

Query: 729 GQRGIIDQGWGGLGTLPEIPETVYTLSDCPHDWLFLQCSXXXXXXXXXXXXXGLRAGCPT 550
           G+R +I  G   +  +P   + V  +    +  +F  C               LRAG PT
Sbjct: 278 GERALICFGGTDVRGVPRF-DHVKVVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPT 336

Query: 549 TIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPEVKSRVMELA 382
             +    DQ +W  ++ +  +G      S  T E L   +R +L P+  +R  +LA
Sbjct: 337 LALWSSADQPYWAAQIKRLKVGTAR-RFSATTSETLAADLRTILAPDYATRARDLA 391



>pir|S17512|S17512 glucuronosyltransferase (EC 2.4.1.17) - human
          Length = 530

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -3

Query: 561 GCPTTIVPLFGDQFFWGDRLLQKGLGPPPIPISQLTVEGLFEAIRFMLQPE-VKSRVMEL 385
           G P  ++PLFGDQ     R+  KG G   + + ++T E L  A++ ++  +  K  +M L
Sbjct: 382 GVPMVMMPLFGDQMDNAKRMETKGAG-VTMNVLEMTSEDLENALKAVINDKSYKENIMRL 440

Query: 384 ARL 376
           + L
Sbjct: 441 SSL 443


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 869,830,445
Number of Sequences: 1806583
Number of extensions: 19191004
Number of successful extensions: 57165
Number of sequences better than 10.0: 115
Number of HSP's better than 10.0 without gapping: 51915
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56997
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 47719960068
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)