BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8215
         (797 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AE005172_891598 Arabidopsis thaliana chromosome 1, top arm co...   243   2e-63   
gb:AB026644_1517155 Arabidopsis thaliana genomic DNA, chromosome...   218   1e-55   
pir|E96722|E96722 hypothetical protein F20P5.27 [imported] - Ara...   206   5e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AC108875_1738611 Oryza sativa (japonica cultivar-group) chrom...   186   3e-46   
gb:OSJN00139_1695533 Oryza sativa genomic DNA, chromosome 4, BAC...   186   6e-46   
gb:AF083807_1767037 Arabidopsis thaliana clone sps952 unknown mRNA.   168   9e-41   
gb:AY074386_1567540 Arabidopsis thaliana putative receptor prote...   168   9e-41   
gb:AY062559_1565215 Arabidopsis thaliana receptor-like protein k...   168   9e-41   
gb:AB020745_1514593 Arabidopsis thaliana genomic DNA, chromosome...   168   9e-41   
gb:AP005457_1852174 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AY714496_1624027 Oryza sativa (indica cultivar-group) clone O...   117   2e-25   
gb:AP007224_1863291 Oryza sativa (japonica cultivar-group) genom...   116   6e-25   
gb:AY756174_1627017 Oryza rufipogon putative leucine-rich repeat...   116   6e-25   
gb:AY714497_1624028 Oryza sativa (japonica cultivar-group) clone...   116   6e-25   
gb:AP005896_1859825 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP004342_1840507 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AY756174_1627012 Oryza rufipogon putative leucine-rich repeat...   115   1e-24   
gb:AP005896_1859828 Oryza sativa (japonica cultivar-group) genom...   114   2e-24   
gb:AP005457_1852180 Oryza sativa (japonica cultivar-group) genom...   114   2e-24   
gb:AY756174_1627016 Oryza rufipogon putative leucine-rich repeat...   114   3e-24   
gb:AY714492_1624023 Oryza sativa (indica cultivar-group) clone O...   114   3e-24   
gb:AP007224_1863292 Oryza sativa (japonica cultivar-group) genom...   113   4e-24   
gb:AP007224_1863294 Oryza sativa (japonica cultivar-group) genom...   113   5e-24   
gb:AP005896_1859826 Oryza sativa (japonica cultivar-group) genom...   113   5e-24   
gb:AY756174_1627014 Oryza rufipogon putative leucine-rich repeat...   113   5e-24   
gb:AY756174_1627011 Oryza rufipogon putative leucine-rich repeat...   113   5e-24   
gb:AY714491_1624022 Oryza sativa (indica cultivar-group) clone O...   113   5e-24   
gb:AY730046_1625387 Oryza sativa (indica cultivar-group) putativ...   112   6e-24   
gb:AP005457_1852183 Oryza sativa (japonica cultivar-group) genom...   112   8e-24   
gb:AP003770_1833317 Oryza sativa (japonica cultivar-group) genom...   112   8e-24   
gb:AY756174_1627010 Oryza rufipogon putative leucine-rich repeat...   112   8e-24   
gb:OSJN00095_1694822 Oryza sativa genomic DNA, chromosome 4, BAC...   111   2e-23   
gb:AY756174_1627013 Oryza rufipogon putative leucine-rich repeat...   111   2e-23   
gb:AY714495_1624026 Oryza sativa (indica cultivar-group) clone O...   110   2e-23   
gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genom...   110   3e-23   
gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat...   110   3e-23   
gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone O...   110   3e-23   
gb:AY714493_1624024 Oryza sativa (indica cultivar-group) clone O...   110   3e-23   
gb:AB104529_1526474 Pisum sativum LKA mRNA for brassinosteroid r...   110   3e-23   
pir|F96598|F96598 protein F20N2.4 [imported] - Arabidopsis thali...   110   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP006168_1861232 Oryza sativa (japonica cultivar-group) genom...   110   4e-23   
gb:AP005457_1852178 Oryza sativa (japonica cultivar-group) genom...   110   4e-23   
sp|Q8L899|BRI1_LYCPE|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1...   109   5e-23   Solanum peruvianum [Peruvian tomato]
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...   109   5e-23   Solanum lycopersicum
gb:AB007644_1510128 Arabidopsis thaliana genomic DNA, chromosome...   109   7e-23   
gb:AP006156_1861014 Oryza sativa (japonica cultivar-group) genom...   108   9e-23   
gb:AP004553_1841478 Oryza sativa (japonica cultivar-group) genom...   108   9e-23   
gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genom...   107   3e-22   
gb:CRU303349_1673665 Capsella rubella ORF1, ORF2, ORF3, ORF4, OR...   107   3e-22   
gb:AC005936_1533211 Arabidopsis thaliana chromosome 2 clone F5O4...   107   3e-22   
pir|G96746|G96746 hypothetical protein T9N14.20 [imported] - Ara...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZVR7|PSKR_ARATH|PSKR_ARATH Putative phytosulfokine receptor precursor ...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
sp|O22476|BRI1_ARATH|BRI1_ARATH BRASSINOSTEROID INSENSITIVE 1 precursor (EC...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
pir|G86227|G86227 hypothetical protein [imported] - Arabidopsis ...   106   6e-22   Arabidopsis thaliana [mouse-ear cress]
sp|Q8LPB4|PSKR_DAUCA|PSKR_DAUCA Phytosulfokine receptor precursor (EC 2.7.1...   105   8e-22   Daucus carota [carrots]
sp|Q9LYN8|EXS_ARATH|EXS_ARATH Leucine-rich repeat receptor protein kinase ...   105   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AK118356_1816339 Arabidopsis thaliana At5g62710 mRNA for puta...   105   1e-21   
gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporoge...   105   1e-21   
gb:AB009053_1510681 Arabidopsis thaliana genomic DNA, chromosome...   105   1e-21   
pir|H84770|H84770 probable receptor-like protein kinase [importe...   105   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AP003453_1829707 Oryza sativa (japonica cultivar-group) genom...   103   3e-21   
gb:AP005659_1855662 Oryza sativa (japonica cultivar-group) genom...   103   4e-21   
gb:AP004121_1837906 Oryza sativa (japonica cultivar-group) genom...   103   4e-21   
gb:AY128280_1580582 Arabidopsis thaliana AT3g13380/MRP15_1 mRNA,...   103   4e-21   
gb:AE016959_1020675 Oryza sativa (japonica cultivar-group) chrom...   103   4e-21   
gb:AC119796_1739716 Oryza sativa (japonica cultivar-group) chrom...   103   5e-21   
gb:AP002865_1823339 Oryza sativa (japonica cultivar-group) genom...   102   6e-21   
gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis r...   102   6e-21   
gb:AC007789_1536200 Oryza sativa BAC OSJNBa0049B20 genomic seque...   102   6e-21   
gb:AX120065_1461712 Sequence 48 from Patent WO0129240.                102   6e-21   
pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis...   102   6e-21   Arabidopsis thaliana [mouse-ear cress]
sp|Q94F62|BAK1_ARATH|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re...   102   6e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 ...   102   8e-21   
gb:AY056243_1563564 Arabidopsis thaliana unknown protein (At2g13...   102   1e-20   
gb:AX120071_1461715 Sequence 54 from Patent WO0129240.                102   1e-20   
gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.             102   1e-20   
pir|G84510|G84510 probable receptor-like protein kinase [importe...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AX138085_1462208 Sequence 31 from Patent EP1094113.                101   1e-20   
gb:CQ768545_1451790 Sequence 40 from Patent WO2004007712.>gb:AY0...   101   1e-20   
pir|T14354|T14354 probable somatic embryogenesis receptor-like k...   101   1e-20   Daucus carota [carrots]
pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5....   101   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis r...   101   2e-20   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...   100   2e-20   
gb:BT008322_1639539 Arabidopsis thaliana At1g56720 gene, complet...   100   2e-20   
gb:AY094412_1575714 Arabidopsis thaliana At2g13800/F13J11.15 mRN...   100   2e-20   
gb:AY087491_1572522 Arabidopsis thaliana clone 36000 mRNA, compl...   100   2e-20   
gb:AX120069_1461714 Sequence 52 from Patent WO0129240.                100   2e-20   
gb:CQ768565_1451800 Sequence 60 from Patent WO2004007712.             100   2e-20   
pir|T47793|T47793 receptor-like protein kinase - Arabidopsis tha...   100   2e-20   Arabidopsis thaliana [mouse-ear cress]
pir|B96609|B96609 probable protein kinase F25P12.84 [imported] -...   100   2e-20   Arabidopsis thaliana [mouse-ear cress]
pir|H84510|H84510 probable receptor-like protein kinase [importe...   100   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC009755_1543036 Arabidopsis thaliana chromosome III BAC F1...   100   3e-20   
pir|G96813|G96813 hypothetical protein T30F21.14 [imported] - Ar...   100   3e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP003453_1829708 Oryza sativa (japonica cultivar-group) genom...   100   4e-20   
gb:AC008262_1536615 Genomic sequence for Arabidopsis thaliana BA...   100   4e-20   
pir|G96716|G96716 hypothetical protein F23O10.15 [imported] - Ar...   100   4e-20   Arabidopsis thaliana [mouse-ear cress]
pir|D84860|D84860 probable protein kinase [imported] - Arabidops...    99   7e-20   Arabidopsis thaliana [mouse-ear cress]
pir|B86440|B86440 probable protein kinase [imported] - Arabidops...    99   7e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AB109215_1526831 Hordeum vulgare BRI1 gene for putative brass...    99   9e-20   
gb:AB088206_1524763 Hordeum vulgare BRI1 mRNA for putative brass...    99   9e-20   
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...    99   9e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
pir|T49010|T49010 hypothetical protein F25L23.280 - Arabidopsis ...    98   2e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP005533_1853634 Oryza sativa (japonica cultivar-group) genom...    97   3e-19   
gb:AB057787_1521711 Oryza sativa OsCR4 gene, complete cds.>gb:AC...    97   3e-19   
gb:AP000382_1819890 Arabidopsis thaliana genomic DNA, chromosome...    97   3e-19   
gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,...    97   5e-19   
gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding ...    97   5e-19   
gb:AB073628_1523190 Nicotiana tabacum mRNA for receptor-like pro...    97   5e-19   
pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis tha...    97   5e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY463361_1607685 Oryza sativa (indica cultivar-group) benzoth...    96   6e-19   
gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSER...    96   6e-19   
gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRN...    96   8e-19   
gb:AC073556_1541104 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...    96   8e-19   
gb:AB178084_1528917 Daucus carota LRR-S/T-RLK mRNA for putative ...    96   8e-19   
gb:A67827_1450282 Sequence 32 from Patent WO9743427.>gb:CQ768543...    96   8e-19   
pir|H96740|H96740 hypothetical protein F14O23.21 [imported] - Ar...    96   8e-19   Arabidopsis thaliana [mouse-ear cress]
pir|B84431|B84431 probable receptor protein kinase [imported] - ...    96   8e-19   Arabidopsis thaliana [mouse-ear cress]
pir|C96641|C96641 hypothetical protein T25B24.6 [imported] - Ara...    96   8e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP005807_1858200 Oryza sativa (japonica cultivar-group) genom...    96   1e-18   
gb:LES303345_1684557 Lycopersicon esculentum lateral suppressor ...    96   1e-18   
gb:AE016959_1023261 Oryza sativa (japonica cultivar-group) chrom...    96   1e-18   
sp|O24585|CRI4_MAIZE|CRI4_MAIZE Putative receptor protein kinase CRINKLY4 p...    96   1e-18   Zea mays [maize]
gb:AC120509_1739833 Oryza sativa chromosome 3 BAC OSJNBb0081K01 ...    95   1e-18   
gb:AP003768_1833267 Oryza sativa (japonica cultivar-group) genom...    95   2e-18   
gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA...    95   2e-18   
pir|T01502|T01502 probable serine/threonine-specific protein kin...    95   2e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryoge...    94   2e-18   
pir|T49152|T49152 serine/threonine-specific protein kinase-like ...    94   2e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete sequ...    94   3e-18   
gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete sequ...    94   3e-18   
gb:AE005173_892850 Arabidopsis thaliana chromosome 1, bottom arm...    94   3e-18   
pir|D96711|D96711 hypothetical protein F24J5.8 [imported] - Arab...    94   3e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    94   4e-18   
gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenes...    94   4e-18   
gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.                  94   4e-18   
pir|T10659|T10659 probable serine/threonine-specific protein kin...    94   4e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AC133334_1741357 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    93   5e-18   
gb:AC133334_1741356 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    93   5e-18   
pir|T01711|T01711 probable serine/threonine-specific protein kin...    93   5e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP003278_1827097 Oryza sativa (japonica cultivar-group) genom...    93   7e-18   
gb:AY162176_1585779 Medicago truncatula somatic embryogenesis re...    93   7e-18   
gb:AE016959_1022408 Oryza sativa (japonica cultivar-group) chrom...    93   7e-18   
gb:AC104473_1737654 Oryza sativa (japonica cultivar-group) chrom...    92   9e-18   
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...    92   9e-18   
gb:BT006463_1639350 Arabidopsis thaliana At1g24030 gene, complet...    92   9e-18   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...    92   9e-18   
gb:AY059844_1564688 Arabidopsis thaliana receptor-like protein k...    92   9e-18   
gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome...    92   9e-18   
gb:AB013395_1512172 Arabidopsis thaliana genomic DNA, chromosome...    92   9e-18   
gb:AX138087_1462209 Sequence 33 from Patent EP1094113.                 92   9e-18   
gb:AX120053_1461706 Sequence 36 from Patent WO0129240.                 92   9e-18   
gb:CQ768547_1451791 Sequence 42 from Patent WO2004007712.              92   9e-18   
pir|A86374|A86374 protein T23E23.18 [imported] - Arabidopsis tha...    92   9e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP002972_1824065 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AF503433_1806732 Sorghum bicolor BAC 170F8, complete sequence.      92   1e-17   
gb:CQ768555_1451795 Sequence 50 from Patent WO2004007712.>gb:AX1...    92   1e-17   
gb:AE016959_1022791 Oryza sativa (japonica cultivar-group) chrom...    92   1e-17   
gb:AE005172_889761 Arabidopsis thaliana chromosome 1, top arm co...    92   1e-17   
pir|T50817|T50817 protein serine/threonine kinase-like protein -...    92   1e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AP000366_1819745 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AK117450_1815484 Arabidopsis thaliana At3g58690 mRNA for puta...    92   1e-17   
gb:OSJN00189_1696455 Oryza sativa genomic DNA, chromosome 4, BAC...    92   1e-17   
gb:AY093029_1574983 Arabidopsis thaliana protein serine/threonin...    92   1e-17   
gb:AB188249_1529360 Oryza sativa (japonica cultivar-group) OsSER...    92   1e-17   
gb:AB188248_1529359 Oryza sativa (japonica cultivar-group) OsSER...    92   1e-17   
gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome...    92   1e-17   
gb:AX138094_1462211 Sequence 40 from Patent EP1094113.                 92   1e-17   
gb:AX120059_1461709 Sequence 42 from Patent WO0129240.                 92   1e-17   
gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.              92   1e-17   
gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genom...    91   2e-17   
gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19...    91   2e-17   
gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich r...    91   2e-17   
gb:AB125885_1528227 Ipomoea batatas SRF6 mRNA for putative serin...    91   2e-17   
gb:AE016959_1022495 Oryza sativa (japonica cultivar-group) chrom...    91   2e-17   
pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis ...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genom...    91   2e-17   
gb:AK117442_1815476 Arabidopsis thaliana At3g02130 mRNA for puta...    91   2e-17   
gb:AY484589_1608333 Musa acuminata clone MuH9, genomic sequence.       91   2e-17   
gb:AY062680_1565336 Arabidopsis thaliana Unknown protein (At1g09...    91   2e-17   
gb:AP003247_1826197 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219 ge...    91   3e-17   
gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-...    91   3e-17   
gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic embryog...    90   4e-17   
gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threoni...    90   4e-17   
gb:AY182167_1587875 Elaeis guineensis clone Rlk-OPsc receptor-li...    90   4e-17   
gb:AY078961_1568114 Arabidopsis thaliana At1g79670/F20B17_27 mRN...    90   4e-17   
pir|G96827|G96827 protein F20B17.10 [imported] - Arabidopsis tha...    90   4e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genom...    90   6e-17   
gb:AF244888_1780445 Glycine max receptor-like protein kinase 1 (...    90   6e-17   
gb:AF131222_1770837 Lophopyrum elongatum protein serine/threonin...    90   6e-17   
gb:OSJN00129_1695385 Oryza sativa genomic DNA, chromosome 4, BAC...    90   6e-17   
gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complet...    90   6e-17   
gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, compl...    90   6e-17   
gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene ...    90   6e-17   
gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome...    90   6e-17   
gb:AP003282_1827220 Oryza sativa (japonica cultivar-group) genom...    89   7e-17   
gb:AP003247_1826195 Oryza sativa (japonica cultivar-group) genom...    89   7e-17   
gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genom...    89   7e-17   
gb:BT011239_1640989 Arabidopsis thaliana At4g34500 gene, complet...    89   7e-17   
gb:AB026654_1517312 Arabidopsis thaliana genomic DNA, chromosome...    89   7e-17   
pir|T05270|T05270 probable serine/threonine-specific protein kin...    89   7e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T47694|T47694 probable serine/threonine-specific protein kin...    89   7e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic embryog...    89   9e-17   
gb:AC104473_1737662 Oryza sativa (japonica cultivar-group) chrom...    89   9e-17   
gb:OSJN00112_1695130 Oryza sativa genomic DNA, chromosome 4, BAC...    89   9e-17   
gb:AY091071_1574298 Arabidopsis thaliana putative protein kinase...    89   9e-17   
gb:AB016888_1513168 Arabidopsis thaliana genomic DNA, chromosome...    89   9e-17   
gb:AX088876_1461047 Sequence 1 from Patent WO0114563.>gb:AX82570...    89   9e-17   
pir|T00546|T00546 serine/threonine-specific protein kinase homol...    89   9e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T05898|T05898 hypothetical protein F6H11.170 - Arabidopsis t...    89   9e-17   Arabidopsis thaliana [mouse-ear cress]
pir|H86295|H86295 hypothetical protein T24D18.20 [imported] - Ar...    89   9e-17   Arabidopsis thaliana [mouse-ear cress]
pir|E84587|E84587 probable protein kinase [imported] - Arabidops...    89   9e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP005637_1855222 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:AP003614_1831401 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:AF244889_1780446 Glycine max receptor-like protein kinase 2 (...    89   1e-16   
gb:AC137001_1743353 Oryza sativa (japonica cultivar-group) chrom...    89   1e-16   
gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isola...    89   1e-16   
pir|B86289|B86289 probable serine/threonine-specific protein kin...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T46033|T46033 receptor protein kinase-like protein - Arabido...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AC104280_1737456 Oryza sativa (japonica cultivar-group) chrom...    88   2e-16   
gb:OSJN00259_1697523 Oryza sativa genomic DNA, chromosome 4, BAC...    88   2e-16   
gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like ...    88   2e-16   
pir|T50850|T50850 receptor protein kinase homolog [imported] - s...    88   2e-16   Glycine max [soybeans]
pir|A86327|A86327 protein F18O14.11 [imported] - Arabidopsis tha...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
pir|C84813|C84813 probable protein kinase [imported] - Arabidops...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein ...    88   2e-16   
gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complet...    88   2e-16   
gb:ATF8D20_1551119 Arabidopsis thaliana DNA chromosome 4, BAC cl...    88   2e-16   
gb:AB025639_1516690 Arabidopsis thaliana genomic DNA, chromosome...    88   2e-16   
gb:AX120057_1461708 Sequence 40 from Patent WO0129240.                 88   2e-16   
gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.              88   2e-16   
pir|T08973|T08973 probable serine/threonine-specific protein kin...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
pir|G84630|G84630 probable LRR receptor protein kinase [imported...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T04665|T04665 probable serine/threonine-specific protein kin...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
pir|C85420|C85420 protein kinase-like protein [imported] - Arabi...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
sp|P27450|CX32_ARATH|CX32_ARATH Probable serine/threonine-protein kinase Cx...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP004685_1843366 Oryza sativa (japonica cultivar-group) genom...    87   3e-16   
gb:AP003282_1827213 Oryza sativa (japonica cultivar-group) genom...    87   3e-16   
gb:BT004631_1637665 Arabidopsis thaliana At2g39110 gene, complet...    87   3e-16   
gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specif...    87   3e-16   
gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specif...    87   3e-16   
gb:AB120627_1527973 Populus nigra PnLRK1 mRNA for leucine-rich r...    87   3e-16   
gb:AB090881_1524972 Aster tripolium mRNA for serine/threonine pr...    87   3e-16   
gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome...    87   3e-16   
pir|D96728|D96728 hypothetical protein F24J13.3 [imported] - Ara...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
pir|B84742|B84742 probable receptor-like protein kinase [importe...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
pir|E86345|E86345 hypothetical protein F16F4.9 - Arabidopsis tha...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
pir|C86314|C86314 hypothetical protein F2H15.13 - Arabidopsis th...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T47684|T47684 serine/threonine-specific protein kinase-like ...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
pir|B84712|B84712 probable protein kinase [imported] - Arabidops...    87   3e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP004791_1845157 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AP003255_1826437 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AY054639_1563293 Arabidopsis thaliana protein kinase-like pro...    87   4e-16   
gb:AE016959_1023603 Oryza sativa (japonica cultivar-group) chrom...    87   4e-16   
pir|T49003|T49003 protein kinase-like protein - Arabidopsis thal...    87   4e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP005299_1850138 Oryza sativa (japonica cultivar-group) genom...    87   5e-16   
gb:AP004084_1837460 Oryza sativa (japonica cultivar-group) genom...    87   5e-16   
gb:AP003991_1836031 Oryza sativa (japonica cultivar-group) genom...    87   5e-16   
gb:AP003864_1834495 Oryza sativa (japonica cultivar-group) genom...    87   5e-16   
gb:AC119292_1739707 Oryza sativa (japonica cultivar-group) chrom...    87   5e-16   
gb:AC118284_1739500 Oryza sativa (japonica cultivar-group) chrom...    87   5e-16   
gb:ZMA400870_1731518 Zea mays partial mRNA for somatic embryogen...    87   5e-16   
gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC...    87   5e-16   
gb:AY283519_1594738 Brassica napus CLV1-like receptor kinase (CL...    87   5e-16   
gb:AY075617_1567762 Arabidopsis thaliana AT3g25560/MWL2_18 mRNA,...    87   5e-16   
gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinas...    87   5e-16   
gb:ATAC015985_1543577 Arabidopsis thaliana chromosome III BAC F8...    87   5e-16   
gb:AB025639_1516701 Arabidopsis thaliana genomic DNA, chromosome...    87   5e-16   
gb:AX120073_1461716 Sequence 56 from Patent WO0129240.                 87   5e-16   
gb:AX120067_1461713 Sequence 50 from Patent WO0129240.                 87   5e-16   
gb:CQ768569_1451802 Sequence 64 from Patent WO2004007712.              87   5e-16   
gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.              87   5e-16   
pir|T01086|T01086 probable serine/threonine-specific protein kin...    87   5e-16   Arabidopsis thaliana [mouse-ear cress]
pir|A85357|A85357 receptor-like kinase homolog [imported] - Arab...    87   5e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T10665|T10665 hypothetical protein F6E21.30 - Arabidopsis th...    87   5e-16   
pir|E86297|E86297 F3O9.6 protein - Arabidopsis thaliana>gb:AE005...    87   5e-16   
pir|C86296|C86296 hypothetical protein T24D18.23 [imported] - Ar...    87   5e-16   
pir|B86296|B86296 hypothetical protein T24D18.22 - Arabidopsis t...    87   5e-16   
gb:AP003227_1825640 Oryza sativa (japonica cultivar-group) genom...    86   6e-16   
gb:AC099732_1737183 Oryza sativa (japonica cultivar-group) chrom...    86   6e-16   
gb:BT005955_1638877 Arabidopsis thaliana At4g34440 gene, complet...    86   6e-16   
gb:AY050535_1562263 Arabidopsis thaliana leucine-rich repeat rec...    86   6e-16   
gb:AE016959_1020597 Oryza sativa (japonica cultivar-group) chrom...    86   6e-16   
pir|F84564|F84564 probable protein kinase [imported] - Arabidops...    86   6e-16   
gb:AF244890_1780447 Glycine max receptor-like protein kinase 3 (...    86   8e-16   
gb:OSJN00129_1695387 Oryza sativa genomic DNA, chromosome 4, BAC...    86   8e-16   
gb:OSJN00129_1695386 Oryza sativa genomic DNA, chromosome 4, BAC...    86   8e-16   
gb:OSJN00089_1694690 Oryza sativa genomic DNA, chromosome 4, BAC...    86   8e-16   
gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09 (R2...    86   8e-16   
gb:AY088040_1573064 Arabidopsis thaliana clone 40594 mRNA, compl...    86   8e-16   
pir|T51383|T51383 receptor protein kinase-like protein - Arabido...    86   8e-16   
pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis t...    86   8e-16   
pir|T07699|T07699 hypothetical protein F17N18.80 - Arabidopsis t...    86   8e-16   
gb:AP003952_1835675 Oryza sativa (japonica cultivar-group) genom...    86   1e-15   
gb:AP003260_1826565 Oryza sativa (japonica cultivar-group) genom...    86   1e-15   
gb:OSJN00129_1695383 Oryza sativa genomic DNA, chromosome 4, BAC...    86   1e-15   
gb:AY730335_1625407 Solanum tuberosum strain P6/210 clone BAC BA...    86   1e-15   
gb:AC004450_1531709 Arabidopsis thaliana chromosome 2 clone F14B...    86   1e-15   
pir|F84863|F84863 probable protein kinase [imported] - Arabidops...    86   1e-15   
pir|T49986|T49986 lectin-like protein kinase-like - Arabidopsis ...    86   1e-15   
pir|E96787|E96787 protein T4O12.5 [imported] - Arabidopsis thali...    86   1e-15   
pir|D86296|D86296 hypothetical protein T24D18.24 - Arabidopsis t...    86   1e-15   
pir|E71446|E71446 probable protein kinase - Arabidopsis thaliana...    86   1e-15   
sp|Q9SYQ8|CLV1_ARATH|CLV1_ARATH Receptor protein kinase CLAVATA1 precursor ...    86   1e-15   
gb:AP005593_1854663 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AP003962_1835750 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AP003418_1829222 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AP001551_1821319 Oryza sativa (japonica cultivar-group) genom...    85   1e-15   
gb:AC108906_1738699 Oryza sativa chromosome 3 BAC OSJNBa0087C10 ...    85   1e-15   
gb:AC092852_1735770 Oryza sativa chromosome 3 BAC OSJNBa0032G11 ...    85   1e-15   
gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threon...    85   1e-15   
gb:BT004634_1637668 Arabidopsis thaliana At3g53810 gene, complet...    85   1e-15   
gb:BT004627_1637661 Arabidopsis thaliana At3g07070 gene, complet...    85   1e-15   
gb:ATAC012395_1543484 Arabidopsis thaliana chromosome III BAC T1...    85   1e-15   
pir|T45921|T45921 serine/threonine-specific kinase like protein ...    85   1e-15   
pir|C96772|C96772 probable receptor protein kinase F1M20.4 [impo...    85   1e-15   
pir|F86345|F86345 F16F4.8 protein - Arabidopsis thaliana>gb:AE00...    85   1e-15   
gb:AP003990_1836012 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AP002901_1823734 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AP002901_1823733 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AP002537_1822501 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AC125472_1740503 Oryza sativa (japonica cultivar-group) chrom...    85   2e-15   
gb:OSJN00259_1697526 Oryza sativa genomic DNA, chromosome 4, BAC...    85   2e-15   
gb:ATH9695_1552959 Arabidopsis thaliana wak4 gene.                     85   2e-15   
gb:AE005172_891079 Arabidopsis thaliana chromosome 1, top arm co...    85   2e-15   
pir|T48228|T48228 probable protein kinase - Arabidopsis thaliana...    85   2e-15   
pir|D86345|D86345 hypothetical protein F16F4.10 [imported] - Ara...    85   2e-15   
gb:AP003770_1833323 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:AP003518_1830289 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:AP003334_1828124 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:AP003247_1826193 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:OSJN00236_1697175 Oryza sativa genomic DNA, chromosome 4, BAC...    84   2e-15   
gb:AB110953_1527050 Nicotiana tabacum NtPERK1 mRNA for PERK1-lik...    84   2e-15   
gb:AE016959_1020714 Oryza sativa (japonica cultivar-group) chrom...    84   2e-15   
pir|C84922|C84922 probable protein kinase [imported] - Arabidops...    84   2e-15   
gb:AP004030_1836608 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AP003866_1834552 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AC091494_1734784 Oryza sativa chromosome 3 BAC OSJNBa0070N04 ...    84   3e-15   
gb:BT008569_1639786 Arabidopsis thaliana clone U51269 putative W...    84   3e-15   
gb:AY085132_1570213 Arabidopsis thaliana clone 13257 mRNA, compl...    84   3e-15   
pir|T10587|T10587 serine/threonine-specific protein kinase (EC 2...    84   3e-15   
pir|F85343|F85343 hypothetical protein AT4g29450 [imported] - Ar...    84   3e-15   
pir|T10664|T10664 serine/threonine-specific protein kinase homol...    84   3e-15   
pir|A86296|A86296 hypothetical protein T24D18.21 - Arabidopsis t...    84   3e-15   
gb:AP006452_1861891 Oryza sativa (japonica cultivar-group) genom...    84   4e-15   
gb:AP005903_1859842 Oryza sativa (japonica cultivar-group) genom...    84   4e-15   
gb:AP005650_1855480 Oryza sativa (japonica cultivar-group) genom...    84   4e-15   
gb:AF049870_1764105 Arabidopsis thaliana beta tubulin 1, thaumat...    84   4e-15   
gb:OSJN00068_1694248 Oryza sativa genomic DNA, chromosome 4, BAC...    84   4e-15   
gb:AY536850_1612404 Arabidopsis thaliana putative protein kinase...    84   4e-15   
gb:AY220481_1590515 Nicotiana tabacum Avr9/Cf-9 induced kinase 1...    84   4e-15   
gb:AC007127_1535275 Arabidopsis thaliana chromosome 2 clone T23A...    84   4e-15   
gb:AE016959_1021252 Oryza sativa (japonica cultivar-group) chrom...    84   4e-15   
pir|E84549|E84549 probable protein kinase [imported] - Arabidops...    84   4e-15   
pir|T52400|T52400 receptor-like protein kinase [imported] - Arab...    84   4e-15   
pir|E86308|E86308 hypothetical protein F20D23.7 - Arabidopsis th...    84   4e-15   
gb:AP005495_1852859 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP004764_1844639 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP004764_1844638 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP004314_1840053 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP003761_1833082 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP003224_1825581 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AY150374_1584939 Arabidopsis thaliana putative kinase interac...    83   5e-15   
gb:AY072320_1567137 Arabidopsis thaliana wall-associated kinase ...    83   5e-15   
gb:AC007592_1535979 Genomic sequence for Arabidopsis thaliana BA...    83   5e-15   
gb:AB022216_1515058 Arabidopsis thaliana genomic DNA, chromosome...    83   5e-15   
gb:AE005173_894394 Arabidopsis thaliana chromosome 1, bottom arm...    83   5e-15   
pir|F86201|F86201 probable protein kinase [imported] - Arabidops...    83   5e-15   
pir|A84712|A84712 probable protein kinase [imported] - Arabidops...    83   5e-15   
pir|C96728|C96728 hypothetical protein F24J13.2 [imported] - Ara...    83   5e-15   
gb:AP005394_1851023 Oryza sativa (japonica cultivar-group) genom...    83   7e-15   
gb:AP004991_1846842 Oryza sativa (japonica cultivar-group) genom...    83   7e-15   
gb:AF370260_1792145 Arabidopsis thaliana putative protein kinase...    83   7e-15   
gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC...    83   7e-15   
gb:AY708048_1623886 Zea mays salt-inducible putative protein ser...    83   7e-15   
gb:AB012242_1511712 Arabidopsis thaliana genomic DNA, chromosome...    83   7e-15   
pir|A86211|A86211 hypothetical protein [imported] - Arabidopsis ...    83   7e-15   
gb:AP004140_1838185 Oryza sativa (japonica cultivar-group) genom...    82   9e-15   
gb:AP003622_1831610 Oryza sativa (japonica cultivar-group) genom...    82   9e-15   
gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for puta...    82   9e-15   
gb:OSJN00135_1695468 Oryza sativa genomic DNA, chromosome 4, BAC...    82   9e-15   
gb:AY263347_1593758 Glycine max protein kinase Pti1 (Pti1) mRNA,...    82   9e-15   
gb:AY086096_1571154 Arabidopsis thaliana clone 21250 mRNA, compl...    82   9e-15   
gb:ATF7J8_1550981 Arabidopsis thaliana DNA chromosome 5, BAC clo...    82   9e-15   
gb:AB016892_1513231 Arabidopsis thaliana genomic DNA, chromosome...    82   9e-15   
gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome...    82   9e-15   
gb:AE005172_891084 Arabidopsis thaliana chromosome 1, top arm co...    82   9e-15   
pir|A96529|A96529 hypothetical protein F13F21.28 [imported] - Ar...    82   9e-15   
pir|T45924|T45924 protein kinase-like protein - Arabidopsis thal...    82   9e-15   
pir|T45699|T45699 hypothetical protein F18L15.140 - Arabidopsis ...    82   9e-15   
pir|T50851|T50851 receptor protein kinase homolog [imported] - s...    82   9e-15   
pir|C84726|C84726 probable receptor-like protein kinase [importe...    82   9e-15   
pir|A96566|A96566 hypothetical protein F6D8.24 [imported] - Arab...    82   9e-15   
pir|T52285|T52285 serine/threonine-specific protein kinase APK2a...    82   9e-15   
gb:AP006756_1862889 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP006523_1862133 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP005849_1859071 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP004868_1846287 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003981_1835888 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003863_1834472 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003854_1834320 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003300_1827660 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003210_1825238 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AC087552_1734100 Oryza sativa (japonica cultivar-group) chrom...    82   1e-14   
gb:AC084405_1733594 Oryza sativa chromosome 3 BAC OSJNBa0044H10 ...    82   1e-14   
gb:AC079288_1732515 Arabidopsis thaliana chromosome 1 BAC T3M22 ...    82   1e-14   
gb:OSJN00202_1696640 Oryza sativa genomic DNA, chromosome 4, BAC...    82   1e-14   
gb:BT015737_1642355 Arabidopsis thaliana At1g69790 mRNA, complet...    82   1e-14   
gb:AY224476_1590678 Oryza sativa (japonica cultivar-group) isola...    82   1e-14   
gb:AY091785_1574743 Arabidopsis thaliana AT5g38990/K15E6_170 mRN...    82   1e-14   
gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR receptor-...    82   1e-14   
gb:AP008246_1541863 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AX093394_1461117 Sequence 13 from Patent WO0118061.                 82   1e-14   
pir|T05264|T05264 probable serine/threonine-specific protein kin...    82   1e-14   
pir|G86420|G86420 probable receptor-like serine/threonine kinase...    82   1e-14   
pir|T51453|T51453 serine/threonine specific protein kinase-like ...    82   1e-14   
pir|T00574|T00574 probable protein kinase [imported] - Arabidops...    82   1e-14   
pir|A96720|A96720 hypothetical protein T6C23.1 [imported] - Arab...    82   1e-14   
gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AP004048_1836910 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AP004014_1836383 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AP003915_1835150 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AP000410_1820018 Arabidopsis thaliana genomic DNA, chromosome...    82   2e-14   
gb:AC132492_1741212 Oryza sativa (japonica cultivar-group) chrom...    82   2e-14   
gb:AC109596_1738731 Oryza sativa (japonica cultivar-group) chrom...    82   2e-14   
gb:AC109596_1738727 Oryza sativa (japonica cultivar-group) chrom...    82   2e-14   
gb:OSJN00200_1696604 Oryza sativa genomic DNA, chromosome 4, BAC...    82   2e-14   
gb:AY316956_1598465 Capsicum annuum clone CaMaoPto4 Pto-like ser...    82   2e-14   
gb:AY113170_1578244 Arabidopsis thaliana At1g29720/T3M22_6 mRNA,...    82   2e-14   
gb:AY058153_1564291 Arabidopsis thaliana At2g31880/F20M17.8 mRNA...    82   2e-14   
gb:AC025294_1539379 Arabidopsis thaliana chromosome 1 BAC F19C24...    82   2e-14   
gb:AC008030_1536482 Arabidopsis thaliana chromosome I BAC F1N18 ...    82   2e-14   
gb:AB025609_1516337 Arabidopsis thaliana genomic DNA, chromosome...    82   2e-14   
gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome...    82   2e-14   
gb:AB009056_1510760 Arabidopsis thaliana genomic DNA, chromosome...    82   2e-14   
gb:AE016959_1022785 Oryza sativa (japonica cultivar-group) chrom...    82   2e-14   
pir|T10060|T10060 receptor-like protein kinase (EC 2.7.1.-) prec...    82   2e-14   
pir|F86420|F86420 probable receptor-like serine/threonine kinase...    82   2e-14   
pir|T45690|T45690 receptor-like protein kinase homolog - Arabido...    82   2e-14   
pir|F96557|F96557 probable protein kinase [imported] - Arabidops...    82   2e-14   
gb:AP006172_1861328 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP005092_1847661 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP004301_1839822 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP003736_1832653 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP003233_1825851 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP002909_1823824 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AF249317_1780696 Glycine max Pti1 kinase-like protein (Pti1a)...    81   2e-14   
gb:AC104487_1737663 Oryza sativa chromosome 3 BAC OSJNBa0042I09 ...    81   2e-14   
gb:AC096856_1736382 Oryza sativa chromosome 3 BAC OSJNBa0075M12 ...    81   2e-14   
gb:AY332474_1600056 Oryza sativa (japonica cultivar-group) trans...    81   2e-14   
gb:AY316961_1598470 Capsicum chinense clone CchiPto4 Pto-like se...    81   2e-14   
gb:AY087034_1572070 Arabidopsis thaliana clone 30775 mRNA, compl...    81   2e-14   
gb:AY060554_1564862 Arabidopsis thaliana AT5g63710/MBK5_19 mRNA,...    81   2e-14   
gb:ATAC008261_1542788 Arabidopsis thaliana chromosome III BAC T4...    81   2e-14   
gb:AC079022_1541726 Oryza sativa chromosome 5 clone P0574H01, co...    81   2e-14   
gb:AB099698_1526154 Arabidopsis thaliana CDG1 mRNA for protein k...    81   2e-14   
gb:AB026649_1517226 Arabidopsis thaliana genomic DNA, chromosome...    81   2e-14   
gb:AX138089_1462210 Sequence 35 from Patent EP1094113.                 81   2e-14   
gb:CQ768549_1451792 Sequence 44 from Patent WO2004007712.>gb:AX1...    81   2e-14   
pir|T04455|T04455 hypothetical protein F4D11.90 - Arabidopsis th...    81   2e-14   
pir|B86369|B86369 hypothetical protein F5O8.10 - Arabidopsis tha...    81   2e-14   
pir|T47532|T47532 protein kinase-like - Arabidopsis thaliana>gb:...    81   2e-14   
pir|A96724|A96724 hypothetical protein F20P5.15 [imported] - Ara...    81   2e-14   
pir|T45692|T45692 receptor-like protein kinase homolog - Arabido...    81   2e-14   
pir|G96749|G96749 hypothetical protein F28P22.27 [imported] - Ar...    81   2e-14   
sp|P47735|RLK5_ARATH|RLK5_ARATH Receptor-like protein kinase 5 precursor (E...    81   2e-14   
sp|Q9FE20|PBS1_ARATH|PBS1_ARATH Serine/threonine-protein kinase PBS1 (EC 2....    81   2e-14   
gb:AP006172_1861338 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AP006162_1861144 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AP005786_1857838 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AP005534_1853651 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AP004301_1839832 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AP003277_1827082 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AF288545_1783476 Solanum berthaultii berS1 putative Pto-like ...    81   3e-14   
gb:AF249318_1780697 Glycine max Pti1 kinase-like protein (Pti1b)...    81   3e-14   
gb:ATHPRKINA_1553318 Arabidopsis thaliana Columbia protein kinas...    81   3e-14   
gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome...    81   3e-14   
gb:AB015471_1512521 Arabidopsis thaliana genomic DNA, chromosome...    81   3e-14   
gb:AE016959_1023612 Oryza sativa (japonica cultivar-group) chrom...    81   3e-14   
gb:AE016959_1021261 Oryza sativa (japonica cultivar-group) chrom...    81   3e-14   
pir|D85065|D85065 receptor protein kinase-like protein [imported...    81   3e-14   
pir|T02729|T02729 serine/threonine-specific protein kinase (EC 2...    81   3e-14   
pir|C96639|C96639 protein T1F9.14 [imported] - Arabidopsis thali...    81   3e-14   
pir|T52588|T52588 wall-associated serine/threonine kinase (EC 2....    81   3e-14   
pir|T48353|T48353 protein kinase-like - Arabidopsis thaliana>gb:...    81   3e-14   
pir|T01477|T01477 protein kinase homolog F17O7.1 - Arabidopsis t...    81   3e-14   
pir|T07412|T07412 serine/threonine protein kinase (EC 2.7.1.-) p...    81   3e-14   
gb:AP006172_1861335 Oryza sativa (japonica cultivar-group) genom...    80   3e-14   
gb:AP004301_1839828 Oryza sativa (japonica cultivar-group) genom...    80   3e-14   
gb:AK117389_1815427 Arabidopsis thaliana At2g02800 mRNA for puta...    80   3e-14   
gb:AF492655_1804962 Lotus japonicus receptor-like kinase SYMRK m...    80   3e-14   


>gb:AE005172_891598 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC000348_1530077 Genomic sequence
           for Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.>gb:BT015801_1642419 Arabidopsis
           thaliana At1g27190 gene, complete cds.
          Length = 601

 Score =  243 bits (621), Expect = 2e-63
 Identities = 114/177 (64%), Positives = 143/177 (80%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           HQ  SS+ ILLD+DFDARI D+GLA+L+   D++++SF  GDLGE GYVAPEYSSTM+ S
Sbjct: 424 HQFISSNVILLDDDFDARITDYGLAKLVGSRDSNDSSFNNGDLGELGYVAPEYSSTMVAS 483

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            KGD Y FG+VLLEL TGQKPL +    EGFKG+LVDWV+Q+ G+GR KD ID+SIC +G
Sbjct: 484 LKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQYLGTGRSKDAIDRSICDKG 543

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQD 248
           HDE+I+QFL+IAC+CVVSR KER +M Q YE+L  MA + G+SE YDEFPL+F +Q+
Sbjct: 544 HDEEILQFLKIACSCVVSRPKERPTMIQVYESLKNMADKHGVSEHYDEFPLVFNKQE 600



>gb:AB026644_1517155 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MFJ20.>gb:AK117357_1815396 Arabidopsis
           thaliana At3g28450 mRNA for putative receptor kinase,
           complete cds, clone: RAFL16-92-N06.
          Length = 605

 Score =  218 bits (555), Expect = 1e-55
 Identities = 111/179 (62%), Positives = 133/179 (74%), Gaps = 2/179 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           HQN  S  IL+DEDFDARI+D GLARLM P D +E+SF+ GDLGEFGYVAPEYS+TM+ S
Sbjct: 427 HQNICSSVILIDEDFDARIIDSGLARLMVPSDNNESSFMTGDLGEFGYVAPEYSTTMLAS 486

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            KGD Y  GVVLLELATG K        EGFKG+LVDWV Q   SGRI +  D++I G+G
Sbjct: 487 LKGDVYGLGVVLLELATGLK----AVGGEGFKGSLVDWVKQLESSGRIAETFDENIRGKG 542

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG--ISEPYDEFPLIFTEQD 248
           HDE+I +F+ IA NCV SR KERWSM+QAY++L  +A +QG   SE  D+FPLIF  Q+
Sbjct: 543 HDEEISKFVEIALNCVSSRPKERWSMFQAYQSLKAIAEKQGYSFSEQDDDFPLIFDTQE 601



>pir|E96722|E96722 hypothetical protein F20P5.27 [imported] -
           Arabidopsis thaliana>gb:AE005173_894583 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F20P5_1677781 Sequence of BAC F20P5 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 574

 Score =  206 bits (523), Expect = 5e-52
 Identities = 101/178 (56%), Positives = 133/178 (74%), Gaps = 1/178 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           HQ  SS+ ILLDEDFDAR++D+GL +L++  D+ ++SF  G   +FGYVAPEYSSTM+ S
Sbjct: 397 HQYISSNVILLDEDFDARVIDYGLGKLVSSQDSKDSSFSNG---KFGYVAPEYSSTMVAS 453

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             GD Y FG+VLLE+ TGQKP+ +   EEGFK +LV+WV++H  +GR KD ID+ I G+G
Sbjct: 454 LSGDVYGFGIVLLEIVTGQKPVLINNGEEGFKESLVEWVSKHLSNGRSKDAIDRRIFGKG 513

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQG-ISEPYDEFPLIFTEQD 248
           +D++I+Q LRIAC+CVVSR KER  M Q YE+L  +  Q G  SE  DEFPLIF +Q+
Sbjct: 514 YDDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQHGFFSEYSDEFPLIFNKQE 571



>gb:AC108875_1738611 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1123_C08, complete
           sequence.>gb:AC130607_1740855 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0017D10, complete
           sequence.
          Length = 607

 Score =  186 bits (473), Expect = 3e-46
 Identities = 88/187 (47%), Positives = 130/187 (69%), Gaps = 4/187 (2%)
 Frame = -2

Query: 793 TANPS--HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY 620
           T NP   H+N SS  ILLDED++ +I DFGLARLM P D H ++FV G+ G+ GYVAPEY
Sbjct: 413 TCNPRVLHRNISSKCILLDEDYEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEY 472

Query: 619 SSTMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID 440
           + T++ + KGD YSFGVVLLEL TG++P  ++TA E F+G+LV+W+N  S +  ++D +D
Sbjct: 473 ARTLVATPKGDVYSFGVVLLELITGERPTHVSTAPENFRGSLVEWINYLSNNALLQDAVD 532

Query: 439 KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD--EFPL 266
           KS+ G+G D +++QFL++AC+C +S  KER +M++ Y+ L  +  +   S   D    P 
Sbjct: 533 KSLIGKGSDGELMQFLKVACSCTISTPKERPTMFEVYQLLRAIGEKYHFSAEDDLMMLPP 592

Query: 265 IFTEQDT 245
           + T+ +T
Sbjct: 593 LSTDGET 599



>gb:OSJN00139_1695533 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ991113_30, complete sequence.
          Length = 622

 Score =  186 bits (471), Expect = 6e-46
 Identities = 92/185 (49%), Positives = 128/185 (69%), Gaps = 5/185 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARL--MAPPDAHETS-FVKGDLGEFGYVAPEYSSTM 608
           HQN SS A+LLDED++AR  D GL RL  MAP +  +TS F+ GD GE+GYVAPE +S  
Sbjct: 437 HQNLSSSAVLLDEDYEARFTDVGLTRLVRMAPGEGGDTSPFLNGDFGEYGYVAPECASNP 496

Query: 607 IPSTKGDAYSFGVVLLELATGQKPLELT--TAEEGFKGNLVDWVNQHSGSGRIKDVIDKS 434
           + + KGD Y+FGV+LLEL +GQ+   +T   A EGFKG LVDWVNQ   SGRI D + KS
Sbjct: 497 VATMKGDVYAFGVILLELVSGQEAATVTGDAAGEGFKGTLVDWVNQLKASGRIGDAVHKS 556

Query: 433 ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE 254
           + G GHD +I +F++IA  C++   +ER+SMY+ Y +L  +   + +SE +DEFPL + +
Sbjct: 557 LRGNGHDSEIDEFVKIAFACIMVHPRERFSMYRVYHSLKSIGQGRDVSEQFDEFPLAYNK 616

Query: 253 QDTSS 239
            ++ +
Sbjct: 617 DESDT 621



>gb:AF083807_1767037 Arabidopsis thaliana clone sps952 unknown mRNA.
          Length = 620

 Score =  168 bits (426), Expect = 9e-41
 Identities = 81/160 (50%), Positives = 113/160 (70%), Gaps = 7/160 (4%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEYS TM+ +
Sbjct: 427 HRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEYSRTMVAT 486

Query: 598 TKGDAYSFGVVLLELATGQKPLELT------TAEEGFKGNLVDWVNQHSGSGRIKDVIDK 437
            KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   ++++ ID+
Sbjct: 487 PKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESKLQEAIDR 546

Query: 436 SICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEAL 320
           S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L
Sbjct: 547 SLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL 586



>gb:AY074386_1567540 Arabidopsis thaliana putative receptor protein
           kinase (At5g48380) mRNA, complete
           cds.>gb:AF367312_1791764 Arabidopsis thaliana
           AT5g48380/MJE7_1 mRNA, complete cds.
          Length = 620

 Score =  168 bits (426), Expect = 9e-41
 Identities = 81/160 (50%), Positives = 113/160 (70%), Gaps = 7/160 (4%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEYS TM+ +
Sbjct: 427 HRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEYSRTMVAT 486

Query: 598 TKGDAYSFGVVLLELATGQKPLELT------TAEEGFKGNLVDWVNQHSGSGRIKDVIDK 437
            KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   ++++ ID+
Sbjct: 487 PKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESKLQEAIDR 546

Query: 436 SICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEAL 320
           S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L
Sbjct: 547 SLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL 586



>gb:AY062559_1565215 Arabidopsis thaliana receptor-like protein
           kinase (At5g48380; MJE7.1) mRNA, complete cds.
          Length = 620

 Score =  168 bits (426), Expect = 9e-41
 Identities = 81/160 (50%), Positives = 113/160 (70%), Gaps = 7/160 (4%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEYS TM+ +
Sbjct: 427 HRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEYSRTMVAT 486

Query: 598 TKGDAYSFGVVLLELATGQKPLELT------TAEEGFKGNLVDWVNQHSGSGRIKDVIDK 437
            KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   ++++ ID+
Sbjct: 487 PKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESKLQEAIDR 546

Query: 436 SICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEAL 320
           S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L
Sbjct: 547 SLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL 586



>gb:AB020745_1514593 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJE7.
          Length = 618

 Score =  168 bits (426), Expect = 9e-41
 Identities = 81/160 (50%), Positives = 113/160 (70%), Gaps = 7/160 (4%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H+N SS  ILL  +F+ +I DFGLARLM P D H ++FV G+ G+FGYVAPEYS TM+ +
Sbjct: 425 HRNISSKCILLTAEFEPKISDFGLARLMNPIDTHLSTFVNGEFGDFGYVAPEYSRTMVAT 484

Query: 598 TKGDAYSFGVVLLELATGQKPLELT------TAEEGFKGNLVDWVNQHSGSGRIKDVIDK 437
            KGD YSFGVVLLEL TGQK   +T        EE FKGNLV+W+ + S   ++++ ID+
Sbjct: 485 PKGDVYSFGVVLLELVTGQKATSVTKVSEEKAEEENFKGNLVEWITKLSSESKLQEAIDR 544

Query: 436 SICGRGHDEQIVQFLRIACNCVVSR-SKERWSMYQAYEAL 320
           S+ G G D++I + L++ACNCV+   +K+R +M++ Y+ L
Sbjct: 545 SLLGNGVDDEIFKVLKVACNCVLPEIAKQRPTMFEVYQLL 584



>gb:AP005457_1852174 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0532H03.
          Length = 1066

 Score =  121 bits (303), Expect = 2e-26
 Identities = 60/158 (37%), Positives = 97/158 (61%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD +F A + DFGLARL+ P D H T+ +   +G  GY+ PEYS   + +
Sbjct: 910  HRDIKSSNILLDREFRACVADFGLARLILPYDTHVTTEL---IGTLGYIPPEYSQAWVAT 966

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+++ +  +     LV W  +    G+  +V+D ++ GRG
Sbjct: 967  LRGDIYSFGVVLLELLTGKRPVQVLSKSK----ELVQWTREMRSHGKDTEVLDPALRGRG 1022

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA 305
            H+EQ+++ L +AC C+     +R ++ +    L+ + A
Sbjct: 1023 HEEQMLKVLDVACKCISHNPCKRPTIQEVVSCLDNVDA 1060



>gb:AY714496_1624027 Oryza sativa (indica cultivar-group) clone
            OsInlk8 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625390 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1051

 Score =  117 bits (294), Expect = 2e-25
 Identities = 61/167 (36%), Positives = 99/167 (59%)
 Frame = -2

Query: 787  NPSHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTM 608
            N  H++  S  ILLD++F A + DFGL+RL+ P   H T+ + G LG   YV PEY    
Sbjct: 890  NIVHRDIKSSNILLDKEFKAYVADFGLSRLILPNKTHVTTELVGTLG---YVPPEYGQRW 946

Query: 607  IPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC 428
            + + +GD YSFGVVLLEL TG++P+ + +A +     L++WV +    G+  +V+D ++ 
Sbjct: 947  VATLRGDMYSFGVVLLELLTGRRPIPVLSASK----ELIEWVQEMRSKGKQIEVLDPTLR 1002

Query: 427  GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
            G GH+EQ+++ L +AC CV      R ++ +    L+ +  +   +E
Sbjct: 1003 GTGHEEQMLKVLEVACQCVNHNPGMRLTIREVVSCLDIIGTELQTTE 1049



>gb:AP007224_1863291 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1047

 Score =  116 bits (290), Expect = 6e-25
 Identities = 58/139 (41%), Positives = 89/139 (64%)
 Frame = -2

Query: 787  NPSHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTM 608
            N  H++  S  ILLD++F A + DFGL+RL+ P   H T+ + G LG   YV PEY    
Sbjct: 886  NIVHRDIKSSNILLDKEFKAYVADFGLSRLILPNKTHVTTELVGTLG---YVPPEYGQGW 942

Query: 607  IPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC 428
            + + +GD YSFGVVLLEL TG++P+ + +A +     L++WV +    G+  +V+D ++ 
Sbjct: 943  MATLRGDMYSFGVVLLELLTGRRPIPVLSASK----ELIEWVQEMRSKGKQIEVLDPTLR 998

Query: 427  GRGHDEQIVQFLRIACNCV 371
            G GH+EQ+++ L +AC CV
Sbjct: 999  GTGHEEQMLKVLEVACQCV 1017



>gb:AY756174_1627017 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1051

 Score =  116 bits (290), Expect = 6e-25
 Identities = 58/139 (41%), Positives = 89/139 (64%)
 Frame = -2

Query: 787  NPSHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTM 608
            N  H++  S  ILLD++F A + DFGL+RL+ P   H T+ + G LG   YV PEY    
Sbjct: 890  NIVHRDIKSSNILLDKEFKAYVADFGLSRLILPNKTHVTTELVGTLG---YVPPEYGQGW 946

Query: 607  IPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC 428
            + + +GD YSFGVVLLEL TG++P+ + +A +     L++WV +    G+  +V+D ++ 
Sbjct: 947  MATLRGDMYSFGVVLLELLTGRRPIPVLSASK----ELIEWVQEMRSKGKQIEVLDPTLR 1002

Query: 427  GRGHDEQIVQFLRIACNCV 371
            G GH+EQ+++ L +AC CV
Sbjct: 1003 GTGHEEQMLKVLEVACQCV 1021



>gb:AY714497_1624028 Oryza sativa (japonica cultivar-group) clone
            OsJalk8 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.
          Length = 1051

 Score =  116 bits (290), Expect = 6e-25
 Identities = 58/139 (41%), Positives = 89/139 (64%)
 Frame = -2

Query: 787  NPSHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTM 608
            N  H++  S  ILLD++F A + DFGL+RL+ P   H T+ + G LG   YV PEY    
Sbjct: 890  NIVHRDIKSSNILLDKEFKAYVADFGLSRLILPNKTHVTTELVGTLG---YVPPEYGQGW 946

Query: 607  IPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC 428
            + + +GD YSFGVVLLEL TG++P+ + +A +     L++WV +    G+  +V+D ++ 
Sbjct: 947  MATLRGDMYSFGVVLLELLTGRRPIPVLSASK----ELIEWVQEMRSKGKQIEVLDPTLR 1002

Query: 427  GRGHDEQIVQFLRIACNCV 371
            G GH+EQ+++ L +AC CV
Sbjct: 1003 GTGHEEQMLKVLEVACQCV 1021



>gb:AP005896_1859825 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OSJNBb0032C09.>gb:AP007224_1863298 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0463E12.
          Length = 1051

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/160 (38%), Positives = 96/160 (60%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H T+ + G LG   Y+ PEY  + I +
Sbjct: 897  HRDIKSSNILLDKEFKAYIADFGLSRLILPSKTHVTTELVGTLG---YIPPEYGQSWIAT 953

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+ L +  +     LV WV +    G+  +V+D ++ G G
Sbjct: 954  LRGDIYSFGVVLLELLTGRRPVPLLSTSK----ELVPWVQEMRSVGKQIEVLDPTVRGMG 1009

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ 299
            +DEQ+++ L  AC CV      R ++ +   +L+ + A +
Sbjct: 1010 YDEQMLKVLETACKCVNYNPLMRPTIMEVVASLDSIDADR 1049



>gb:AP004342_1840507 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0585H11.
          Length = 1010

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/159 (38%), Positives = 98/159 (61%)
 Frame = -2

Query: 787  NPSHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTM 608
            N  H++  S  ILL+E+F+A + DFGLARL+ P D H T+ + G LG   Y+ PEYS ++
Sbjct: 857  NIIHRDVKSSNILLNENFEAHLADFGLARLIQPYDTHVTTDLVGTLG---YIPPEYSQSV 913

Query: 607  IPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC 428
            I + KGD YSFGVVLLEL TG++P++++ A+     +LV +V Q     + + + D  I 
Sbjct: 914  IATPKGDVYSFGVVLLELLTGRRPMDVSKAKG--SRDLVSYVLQMKSEKKEEQIFDTLIW 971

Query: 427  GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
             + H++Q+   L  AC C+ +  ++R S+ Q    L+ +
Sbjct: 972  SKTHEKQLFSVLEAACRCISTDPRQRPSIEQVVAWLDSV 1010



>gb:AY756174_1627012 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1051

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/160 (38%), Positives = 96/160 (60%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H T+ + G LG   Y+ PEY  + I +
Sbjct: 897  HRDIKSSNILLDKEFKAYIADFGLSRLILPSKTHVTTELVGTLG---YIPPEYGQSWIAT 953

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+ L +  +     LV WV +    G+  +V+D ++ G G
Sbjct: 954  LRGDIYSFGVVLLELLTGRRPVPLLSTSK----ELVPWVQEMRSVGKQIEVLDPTVRGMG 1009

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ 299
            +DEQ+++ L  AC CV      R ++ +   +L+ + A +
Sbjct: 1010 YDEQMLKVLETACKCVNYNPLMRPTIMEVVASLDSIDADR 1049



>gb:AP005896_1859828 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OSJNBb0032C09.>gb:AP007224_1863301 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0463E12.
          Length = 1049

 Score =  114 bits (286), Expect = 2e-24
 Identities = 64/157 (40%), Positives = 97/157 (61%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H T+ + G LG   Y+ PEY+   + +
Sbjct: 895  HRDIKSSNILLDKEFKAYIADFGLSRLILPNKTHVTTELVGTLG---YIPPEYAQAWVAT 951

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             KGD YSFGVVLLEL TG++P+  L+T++E     LV WV +   +G+  +V+D +  G 
Sbjct: 952  LKGDVYSFGVVLLELLTGRRPVPILSTSKE-----LVPWVQEMVSNGKQIEVLDLTFQGT 1006

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            G +EQ+++ L IAC CV      R +M +   +L+ +
Sbjct: 1007 GCEEQMLKVLEIACKCVKGDPLRRPTMIEVVASLHSI 1043



>gb:AP005457_1852180 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0532H03.
          Length = 1076

 Score =  114 bits (286), Expect = 2e-24
 Identities = 60/138 (43%), Positives = 84/138 (60%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE  +AR+ DFGLARL+ P   H T+ +   +G  GY+ PEY    + +
Sbjct: 916  HRDIKSSNILLDEAGEARVADFGLARLILPDRTHVTTEL---VGTPGYIPPEYGQAWVAT 972

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+E     +G +  LV WV Q    GR  +V+D  + G G
Sbjct: 973  LRGDIYSFGVVLLELLTGRRPVETLPPPQGQQWELVRWVMQMRSQGRHAEVLDPRLRGNG 1032

Query: 418  HDEQIVQFLRIACNCVVS 365
             + Q++  L +AC CV S
Sbjct: 1033 DEAQMLNMLDLACLCVDS 1050



>gb:AY756174_1627016 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1050

 Score =  114 bits (284), Expect = 3e-24
 Identities = 55/136 (40%), Positives = 88/136 (64%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD++F A I DFGL+RL+ P   H T+ +   +G FGY+ PEY    + +
Sbjct: 892  HRDIKCSNILLDKEFKAHIADFGLSRLILPNRTHVTTEL---VGTFGYIPPEYGQGWVAT 948

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+ + ++ +     LV+WV +    G+  +V+D ++ G G
Sbjct: 949  LRGDMYSFGVVLLELLTGRRPVPILSSSK----QLVEWVQEMISEGKYIEVLDPTLRGTG 1004

Query: 418  HDEQIVQFLRIACNCV 371
            +++Q+V+ L +AC CV
Sbjct: 1005 YEKQMVKVLEVACQCV 1020



>gb:AY714492_1624023 Oryza sativa (indica cultivar-group) clone
            OsInlk3 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625385 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1051

 Score =  114 bits (284), Expect = 3e-24
 Identities = 62/160 (38%), Positives = 95/160 (59%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H T+ + G LG   Y+ PEY  + I +
Sbjct: 897  HRDIKSSNILLDKEFKAYIADFGLSRLILPSKTHVTTELVGTLG---YIPPEYGQSWIAT 953

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+ L +  +     LV WV +    G+   V+D ++ G G
Sbjct: 954  LRGDIYSFGVVLLELLTGRRPVPLLSTSK----ELVPWVQEMRSVGKQIKVLDPTVRGMG 1009

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ 299
            +DEQ+++ L  AC CV      R ++ +   +L+ + A +
Sbjct: 1010 YDEQMLKVLETACKCVNYNPLMRPTIMEVVASLDSIDADR 1049



>gb:AP007224_1863292 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1030

 Score =  113 bits (283), Expect = 4e-24
 Identities = 54/136 (39%), Positives = 88/136 (64%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     +LLD++F A I DFGL+RL+ P   H T+ +   +G FGY+ PEY    + +
Sbjct: 872  HRDIKCSNVLLDKEFKAHIADFGLSRLILPNRTHVTTEL---VGTFGYIPPEYGQGWVAT 928

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+ + ++ +     LV+WV +    G+  +V+D ++ G G
Sbjct: 929  LRGDMYSFGVVLLELLTGRRPVPILSSSK----QLVEWVQEMISEGKYIEVLDPTLRGTG 984

Query: 418  HDEQIVQFLRIACNCV 371
            +++Q+V+ L +AC CV
Sbjct: 985  YEKQMVKVLEVACQCV 1000



>gb:AP007224_1863294 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1049

 Score =  113 bits (282), Expect = 5e-24
 Identities = 63/157 (40%), Positives = 95/157 (60%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 894  HRDIKSSNILLDKEFKAYIADFGLSRLILPNKTHVTTELVGTLG---YIPPEYGQAWVAT 950

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             KGD YSFGVVLLEL TG++P+  L+T++E     LV WV +    G+  +V+D ++ G 
Sbjct: 951  LKGDVYSFGVVLLELLTGRRPVPILSTSKE-----LVPWVQEMISEGKQIEVLDSTLQGT 1005

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            G +EQ+++ L  AC CV      R +M +   +L+ +
Sbjct: 1006 GCEEQMLKVLETACKCVDGNPLMRPTMMEVVASLDSI 1042



>gb:AP005896_1859826 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OSJNBb0032C09.>gb:AP007224_1863299 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0463E12.
          Length = 1046

 Score =  113 bits (282), Expect = 5e-24
 Identities = 59/137 (43%), Positives = 89/137 (64%), Gaps = 1/137 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A + DFGL+RL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 895  HRDIKSSNILLDKEFKAYVADFGLSRLILPNKNHITTELVGTLG---YIPPEYGQGWVAT 951

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             +GD YSFGVVLLEL TG++P+  L+T+EE     LV WV +    G + +V+D ++ G 
Sbjct: 952  LRGDVYSFGVVLLELLTGRRPVSILSTSEE-----LVPWVLEMKSKGNMLEVLDPTLQGT 1006

Query: 421  GHDEQIVQFLRIACNCV 371
            G++EQ+++ L +AC CV
Sbjct: 1007 GNEEQMLKVLEVACKCV 1023



>gb:AY756174_1627014 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1049

 Score =  113 bits (282), Expect = 5e-24
 Identities = 63/157 (40%), Positives = 95/157 (60%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 894  HRDIKSSNILLDKEFKAYIADFGLSRLILPNKTHVTTELVGTLG---YIPPEYGQAWVAT 950

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             KGD YSFGVVLLEL TG++P+  L+T++E     LV WV +    G+  +V+D ++ G 
Sbjct: 951  LKGDVYSFGVVLLELLTGRRPVPILSTSKE-----LVPWVQEMISEGKQIEVLDSTLQGT 1005

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            G +EQ+++ L  AC CV      R +M +   +L+ +
Sbjct: 1006 GCEEQMLKVLETACKCVDGNPLMRPTMMEVVASLDSI 1042



>gb:AY756174_1627011 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1046

 Score =  113 bits (282), Expect = 5e-24
 Identities = 59/137 (43%), Positives = 89/137 (64%), Gaps = 1/137 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A + DFGL+RL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 895  HRDIKSSNILLDKEFKAYVADFGLSRLILPNKNHITTELVGTLG---YIPPEYGQGWVAT 951

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             +GD YSFGVVLLEL TG++P+  L+T+EE     LV WV +    G + +V+D ++ G 
Sbjct: 952  LRGDVYSFGVVLLELLTGRRPVSILSTSEE-----LVPWVLEMKSKGNMLEVLDPTLQGT 1006

Query: 421  GHDEQIVQFLRIACNCV 371
            G++EQ+++ L +AC CV
Sbjct: 1007 GNEEQMLKVLEVACKCV 1023



>gb:AY714491_1624022 Oryza sativa (indica cultivar-group) clone
            OsInlk2 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625384 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1046

 Score =  113 bits (282), Expect = 5e-24
 Identities = 58/137 (42%), Positives = 89/137 (64%), Gaps = 1/137 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A + DFGL+RL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 895  HRDIKSSNILLDKEFKAYVADFGLSRLILPNKNHVTTELVGTLG---YIPPEYGQAWVAT 951

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             +GD YSFGVVLLEL TG++P+  L+T++E     LV WV +    G + +V+D ++ G 
Sbjct: 952  LRGDVYSFGVVLLELLTGRRPVSILSTSKE-----LVPWVLEMRSKGNLLEVLDPTLHGT 1006

Query: 421  GHDEQIVQFLRIACNCV 371
            G++EQ+++ L +AC CV
Sbjct: 1007 GYEEQMLKVLEVACKCV 1023



>gb:AY730046_1625387 Oryza sativa (indica cultivar-group) putative
            leucine-rich repeat receptor-like kinase genes, complete
            cds.
          Length = 1049

 Score =  112 bits (281), Expect = 6e-24
 Identities = 63/157 (40%), Positives = 95/157 (60%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 894  HRDIKSSNILLDKEFKAYIADFGLSRLILPNKTHVTTELVGTLG---YIPPEYGQAWVAT 950

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             KGD YSFGVVLLEL TG++P+  L+T++E     LV WV +    G+  +V+D ++ G 
Sbjct: 951  LKGDVYSFGVVLLELLTGRRPVPILSTSKE-----LVPWVQEMISEGKQIEVLDPTLQGT 1005

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            G +EQ+++ L  AC CV      R +M +   +L+ +
Sbjct: 1006 GCEEQMLKVLETACKCVDGNPLMRPTMMEVVTSLDSI 1042



>gb:AP005457_1852183 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0532H03.
          Length = 1063

 Score =  112 bits (280), Expect = 8e-24
 Identities = 62/143 (43%), Positives = 85/143 (59%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE  +AR+ DFGLARL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 909  HRDIKSSNILLDEAGEARVADFGLARLILPDRTHVTTELVGTLG---YIPPEYGQAWVAT 965

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P E+     G +  LV WV Q    GR  +V+D+ + G G
Sbjct: 966  RRGDVYSFGVVLLELLTGRRPFEV--LRHGQQLELVQWVLQMRSQGRHGEVLDQRLRGNG 1023

Query: 418  HDEQIVQFLRIACNCVVSRSKER 350
             + Q++  L +AC CV S    R
Sbjct: 1024 DEAQMLYVLDLACLCVDSTPLSR 1046



>gb:AP003770_1833317 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0550B04.>gb:AP005457_1852184 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0532H03.
          Length = 1066

 Score =  112 bits (280), Expect = 8e-24
 Identities = 62/143 (43%), Positives = 86/143 (60%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE  +AR+ DFGLARL+ P   H T+ + G LG   Y+ PEY   +  +
Sbjct: 912  HRDIKSSNILLDEAGEARVADFGLARLILPDRTHVTTELVGTLG---YIPPEYGQALAAT 968

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+E      G +  LV WV Q    GR  +V+D+ + G+G
Sbjct: 969  LRGDVYSFGVVLLELLTGRRPVE--ALPHGQQRELVRWVLQMRSQGRHGEVLDQRLRGKG 1026

Query: 418  HDEQIVQFLRIACNCVVSRSKER 350
             + Q++  L +AC CV S    R
Sbjct: 1027 DEAQMLYVLDLACLCVDSTPLSR 1049



>gb:AY756174_1627010 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1049

 Score =  112 bits (280), Expect = 8e-24
 Identities = 63/157 (40%), Positives = 96/157 (61%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A I DFGL+RL+ P   H  + + G LG   Y+ PEY+   + +
Sbjct: 895  HRDIKSSNILLDKEFKAYIADFGLSRLILPNKTHVPTELVGTLG---YIPPEYAQAWVAT 951

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             KGD YSFGVVLLEL TG++P+  L+T++E     LV WV +   +G+  +V+D +  G 
Sbjct: 952  LKGDVYSFGVVLLELLTGRRPVPILSTSKE-----LVPWVQEMVSNGKQIEVLDLTFQGT 1006

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            G +EQ+++ L IAC CV      R +M +   +L+ +
Sbjct: 1007 GCEEQMLKVLEIACKCVKGDPLRRPTMIEVVASLHSI 1043



>gb:OSJN00095_1694822 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0004A17, complete sequence.
          Length = 1012

 Score =  111 bits (277), Expect = 2e-23
 Identities = 61/157 (38%), Positives = 94/157 (59%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE+F+A + DFGLARL+   + H T+ V G LG   Y+ PEY  + + +
Sbjct: 859  HRDIKSSNILLDENFEAHLADFGLARLICAYETHVTTDVVGTLG---YIPPEYGQSPVAT 915

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFG+VLLEL TG++P+++   +     ++V WV Q     R  +V D +I  + 
Sbjct: 916  YKGDVYSFGIVLLELLTGRRPVDMCRPKG--SRDVVSWVLQMKKEDRETEVFDPTIYDKE 973

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMA 308
            ++ Q+++ L IA  CV +  K R +  Q  E L+ +A
Sbjct: 974  NESQLIRILEIALLCVTAAPKSRPTSQQLVEWLDHIA 1010



>gb:AY756174_1627013 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete
            cds.>gb:AP005896_1859822 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBb0032C09.>gb:AP007224_1863295 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0463E12.
          Length = 1047

 Score =  111 bits (277), Expect = 2e-23
 Identities = 61/160 (38%), Positives = 98/160 (61%), Gaps = 1/160 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F + I DFGL+RL+ P   H T+ + G LG   Y+ PEY  + + +
Sbjct: 893  HRDIKSSNILLDKEFKSYIADFGLSRLVLPNITHVTTELVGTLG---YIPPEYGQSWVAT 949

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             +GD YSFGVVLLEL TG++P+  L+T+EE     LV WV++    G+  +V+D ++ G 
Sbjct: 950  LRGDMYSFGVVLLELLTGRRPVPILSTSEE-----LVPWVHKMRSEGKQIEVLDPTLRGT 1004

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            G +EQ+++ L  AC CV     +R ++ +    L+ +  +
Sbjct: 1005 GCEEQMLKVLETACKCVDCNPLKRPTIMEVVTCLDSIGTE 1044



>gb:AY714495_1624026 Oryza sativa (indica cultivar-group) clone
            OsInlk7 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625389 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1051

 Score =  110 bits (276), Expect = 2e-23
 Identities = 54/136 (39%), Positives = 87/136 (63%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD++F A I DFGL+RL+     H T+ +   +G FGY+ PEY    + +
Sbjct: 893  HRDIKCSNILLDKEFKAHIADFGLSRLILSNRTHVTTEL---VGTFGYIPPEYGQGWVAT 949

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+ + ++ +     LV+WV +    G+  +V+D ++ G G
Sbjct: 950  LRGDMYSFGVVLLELLTGRRPVPILSSSK----QLVEWVQEMISEGKYIEVLDPTLRGTG 1005

Query: 418  HDEQIVQFLRIACNCV 371
            +++Q+V+ L +AC CV
Sbjct: 1006 YEKQMVKVLEVACQCV 1021



>gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1063

 Score =  110 bits (275), Expect = 3e-23
 Identities = 60/159 (37%), Positives = 92/159 (57%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A + DFGLARL+     H T+ + G LG   Y+ PEY    + +
Sbjct: 903  HRDIKSSNILLDKEFKAYVADFGLARLILANKTHVTTELVGTLG---YIPPEYGQGWVAT 959

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFGVVLLEL TG++P+ + ++ +     LV WV +    G   +V+D  + G G
Sbjct: 960  LKGDIYSFGVVLLELLTGRRPVHILSSSK----ELVKWVQEMKSEGNQIEVLDPILRGTG 1015

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            +DEQ+++ L  AC CV      R ++ +    L+ + A+
Sbjct: 1016 YDEQMLKVLETACKCVNCNPCMRPTIKEVVSCLDSIDAK 1054



>gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1063

 Score =  110 bits (275), Expect = 3e-23
 Identities = 60/159 (37%), Positives = 92/159 (57%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A + DFGLARL+     H T+ + G LG   Y+ PEY    + +
Sbjct: 903  HRDIKSSNILLDKEFKAYVADFGLARLILANKTHVTTELVGTLG---YIPPEYGQGWVAT 959

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFGVVLLEL TG++P+ + ++ +     LV WV +    G   +V+D  + G G
Sbjct: 960  LKGDIYSFGVVLLELLTGRRPVHILSSSK----ELVKWVQEMKSEGNQIEVLDPILRGTG 1015

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            +DEQ+++ L  AC CV      R ++ +    L+ + A+
Sbjct: 1016 YDEQMLKVLETACKCVNCNPCMRPTIKEVVSCLDSIDAK 1054



>gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone
            OsInlk6 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625388 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1065

 Score =  110 bits (275), Expect = 3e-23
 Identities = 60/159 (37%), Positives = 92/159 (57%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F A + DFGLARL+     H T+ + G LG   Y+ PEY    + +
Sbjct: 905  HRDIKSSNILLDKEFKAYVADFGLARLILANKTHVTTELVGTLG---YIPPEYGQGWVAT 961

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFGVVLLEL TG++P+ + ++ +     LV WV +    G   +V+D  + G G
Sbjct: 962  LKGDIYSFGVVLLELLTGRRPVHILSSSK----ELVKWVQEMKSEGNQIEVLDPILRGTG 1017

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            +DEQ+++ L  AC CV      R ++ +    L+ + A+
Sbjct: 1018 YDEQMLKVLETACKCVNCNPCMRPTIKEVVSCLDSIDAK 1056



>gb:AY714493_1624024 Oryza sativa (indica cultivar-group) clone
            OsInlk4 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625386 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1047

 Score =  110 bits (275), Expect = 3e-23
 Identities = 61/160 (38%), Positives = 97/160 (60%), Gaps = 1/160 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD++F + I DFGL+RL+ P   H T+ + G LG   Y+ PEY  + + +
Sbjct: 893  HRDIKSSNILLDKEFKSYIADFGLSRLVLPNITHVTTELVGTLG---YIPPEYGQSWVAT 949

Query: 598  TKGDAYSFGVVLLELATGQKPLE-LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             +GD YSFGVVLLEL TG++P+  L+T+EE     LV WV++    G+  +V+D +  G 
Sbjct: 950  LRGDMYSFGVVLLELLTGRRPVPILSTSEE-----LVPWVHKMRSEGKQIEVLDPTFRGT 1004

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            G +EQ+++ L  AC CV     +R ++ +    L+ +  +
Sbjct: 1005 GCEEQMLKVLETACKCVDCNPLKRPTIMEVVTCLDSIGTE 1044



>gb:AB104529_1526474 Pisum sativum LKA mRNA for brassinosteroid
            receptor, complete cds.
          Length = 1188

 Score =  110 bits (275), Expect = 3e-23
 Identities = 67/164 (40%), Positives = 95/164 (57%), Gaps = 2/164 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDE+ +AR+ DFG+ARLM+  D H +  V    G  GYV PEY  +   S
Sbjct: 999  HRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLS--VSTLAGTPGYVPPEYYQSFRCS 1056

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TKGD YS+GVVLLEL TG++P   T + +    NLV WV QH+   +I DV DK +    
Sbjct: 1057 TKGDVYSYGVVLLELLTGKRP---TDSADFGDNNLVGWVKQHA-KLKISDVFDKELMKED 1112

Query: 418  HDEQI--VQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI 293
             + +I  +Q L++AC C+  R   R +M Q      ++ A  G+
Sbjct: 1113 PNLEIELLQHLKVACACLDDRPWRRPTMIQVMAKFKEIQAGSGM 1156



>pir|F96598|F96598 protein F20N2.4 [imported] - Arabidopsis
            thaliana>gb:AE005173_893444 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC002328_1530234 Genomic sequence for
            Arabidopsis thaliana BAC F20N2 from chromosome I,
            complete sequence.
          Length = 1166

 Score =  110 bits (275), Expect = 3e-23
 Identities = 65/172 (37%), Positives = 96/172 (55%), Gaps = 1/172 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDEDF+AR+ DFG+ARL++  D H +  V    G  GYV PEY  +   +
Sbjct: 985  HRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1042

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID-KSICGR 422
             KGD YS+GV+LLEL +G+KP++    E G   NLV W  Q     R  +++D + +  +
Sbjct: 1043 AKGDVYSYGVILLELLSGKKPID--PGEFGEDNNLVGWAKQLYREKRGAEILDPELVTDK 1100

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL 266
              D ++  +L+IA  C+  R  +R +M Q      +M A     E  DEF L
Sbjct: 1101 SGDVELFHYLKIASQCLDDRPFKRPTMIQLMAMFKEMKADTEEDESLDEFSL 1152



>gb:AP006168_1861232 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1469H02.
          Length = 1047

 Score =  110 bits (274), Expect = 4e-23
 Identities = 58/143 (40%), Positives = 86/143 (60%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDEDF+A + DFGLARL+ P D H T+ + G LG   Y+ PEY  + + +
Sbjct: 889  HRDIKSSNILLDEDFEAHLADFGLARLICPYDTHVTTDLVGTLG---YIPPEYGQSSVAN 945

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFG+VLLEL TG++P+++   +      LV WV          +V+D+++  + 
Sbjct: 946  FKGDVYSFGIVLLELLTGKRPVDMCKPKGA--RELVSWVLHMKEKNCEAEVLDRAMYDKK 1003

Query: 418  HDEQIVQFLRIACNCVVSRSKER 350
             + Q+VQ + IAC C+    K R
Sbjct: 1004 FEMQMVQMIDIACLCISESPKLR 1026



>gb:AP005457_1852178 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0532H03.
          Length = 776

 Score =  110 bits (274), Expect = 4e-23
 Identities = 62/156 (39%), Positives = 92/156 (58%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE  +AR+ DFGLARL+ P   H T+ +   +G  GY+ PEY    + +
Sbjct: 619  HRDIKSSNILLDEAGEARVADFGLARLILPDRTHVTTEL---VGTPGYIPPEYGQAWVAT 675

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVVLLEL TG++P+E  +   G +  LV WV Q    GR  +V+D  + G G
Sbjct: 676  RRGDVYSFGVVLLELLTGRRPVEAASPPHGQQRELVRWVLQMRLQGRQAEVLDTRLSG-G 734

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            ++ Q++  L +AC CV S    R ++ +    L+ +
Sbjct: 735  NEAQMLYVLDLACLCVDSTPFSRPAIQEVVSWLDNV 770



>sp|Q8L899|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1.37)
            (Brassinosteroid LRR receptor
            kinase).>gb:AY112661_1578149 Lycopersicon peruvianum
            systemin receptor SR160 mRNA, complete cds.
          Length = 1207

 Score =  109 bits (273), Expect = 5e-23
 Identities = 65/164 (39%), Positives = 96/164 (58%), Gaps = 2/164 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDE+ +AR+ DFG+ARLM+  D H +  V    G  GYV PEY  +   S
Sbjct: 1012 HRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLS--VSTLAGTPGYVPPEYYQSFRCS 1069

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC--G 425
            TKGD YS+GVVLLEL TG++P   T + +    NLV WV  H+  G+I DV D+ +    
Sbjct: 1070 TKGDVYSYGVVLLELLTGKQP---TDSADFGDNNLVGWVKLHA-KGKITDVFDRELLKED 1125

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI 293
               + +++Q L++AC C+  R  +R +M Q      ++ A  G+
Sbjct: 1126 ASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQAGSGM 1169



>sp|Q8GUQ5|BRI1_LYCES Brassinosteroid LRR receptor kinase precursor
            (EC 2.7.1.37) (tBRI1) (Altered brassinolide sensitivity
            1) (Systemin receptor SR160).>gb:AY179606_1587457
            Lycopersicon esculentum BRI1 protein (CURL3) gene,
            complete cds.
          Length = 1207

 Score =  109 bits (273), Expect = 5e-23
 Identities = 65/164 (39%), Positives = 96/164 (58%), Gaps = 2/164 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDE+ +AR+ DFG+ARLM+  D H +  V    G  GYV PEY  +   S
Sbjct: 1012 HRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLS--VSTLAGTPGYVPPEYYQSFRCS 1069

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC--G 425
            TKGD YS+GVVLLEL TG++P   T + +    NLV WV  H+  G+I DV D+ +    
Sbjct: 1070 TKGDVYSYGVVLLELLTGKQP---TDSADFGDNNLVGWVKLHA-KGKITDVFDRELLKED 1125

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI 293
               + +++Q L++AC C+  R  +R +M Q      ++ A  G+
Sbjct: 1126 ASIEIELLQHLKVACACLDDRHWKRPTMIQVMAMFKEIQAGSGM 1169



>gb:AB007644_1510128 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K19P17.>gb:AY064019_1565958 Arabidopsis
            thaliana putative receptor protein kinase (At5g53890)
            mRNA, complete cds.>gb:AY091180_1574390 Arabidopsis
            thaliana putative receptor protein kinase (At5g53890)
            mRNA, complete cds.
          Length = 1036

 Score =  109 bits (272), Expect = 7e-23
 Identities = 60/146 (41%), Positives = 88/146 (60%)
 Frame = -2

Query: 787  NPSHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTM 608
            N  H++  S  ILLDE F+A + DFGLARL+ P D H T+ + G LG   Y+ PEYS ++
Sbjct: 875  NVIHRDVKSSNILLDEKFEAHLADFGLARLLRPYDTHVTTDLVGTLG---YIPPEYSQSL 931

Query: 607  IPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSIC 428
            I + +GD YSFGVVLLEL TG++P+E+   +     +LV  V Q     R  ++ID +I 
Sbjct: 932  IATCRGDVYSFGVVLLELVTGRRPVEVCKGKS--CRDLVSRVFQMKAEKREAELIDTTIR 989

Query: 427  GRGHDEQIVQFLRIACNCVVSRSKER 350
               ++  +++ L IAC C+    + R
Sbjct: 990  ENVNERTVLEMLEIACKCIDHEPRRR 1015



>gb:AP006156_1861014 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:B1043F11.
          Length = 1214

 Score =  108 bits (271), Expect = 9e-23
 Identities = 63/149 (42%), Positives = 87/149 (58%), Gaps = 1/149 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLD + DAR+ DFG+ARLM   D H +  V    G  GYV PEY  +   +
Sbjct: 1036 HRDMKSSNVLLDNNLDARVSDFGMARLMNALDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1093

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TKGD YS+GVVLLEL +G+KP++ T   E    NLV WV Q     R  ++ D ++  R 
Sbjct: 1094 TKGDVYSYGVVLLELLSGKKPIDPT---EFGDNNLVGWVKQMVKENRSSEIFDPTLTDRK 1150

Query: 418  HDE-QIVQFLRIACNCVVSRSKERWSMYQ 335
              E ++ Q+L+IAC C+  R   R +M Q
Sbjct: 1151 SGEAELYQYLKIACECLDDRPNRRPTMIQ 1179



>gb:AP004553_1841478 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1790_D02.
          Length = 1214

 Score =  108 bits (271), Expect = 9e-23
 Identities = 70/181 (38%), Positives = 97/181 (53%), Gaps = 1/181 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLD +FDA + DFG+ARLM   D+H T  +    G  GYV PEY      +
Sbjct: 1037 HRDMKSSNVLLDGNFDAYVSDFGMARLMNALDSHLTVSMLS--GTPGYVPPEYCQDFRCT 1094

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TKGD YS+GVVLLEL TG+KP++ T   E    NLV WV Q     R  ++ D ++    
Sbjct: 1095 TKGDVYSYGVVLLELLTGKKPIDPT---EFGDSNLVGWVKQ-MVEDRCSEIYDPTLMATT 1150

Query: 418  HDE-QIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTS 242
              E ++ Q+L+IAC C+  +   R +M Q      +     G S   D+F L  T  + S
Sbjct: 1151 SSELELYQYLKIACRCLDDQPNRRPTMIQVMTMFKEFQVDSG-SNFLDDFSLNSTNMEES 1209

Query: 241  S 239
            S
Sbjct: 1210 S 1210



>gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0426D06.
          Length = 516

 Score =  107 bits (267), Expect = 3e-22
 Identities = 62/153 (40%), Positives = 90/153 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL+D+DFDA++ DFGLA+L+    +H T+ V   +G FGYVAPEY++T + +
Sbjct: 317 HRDIKSSNILIDDDFDAKVSDFGLAKLLGAGKSHVTTRV---MGTFGYVAPEYANTGLLN 373

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVLLE  TG+ P++        + NLVDW+     S R ++V+D +I  R 
Sbjct: 374 EKSDIYSFGVVLLEAITGRDPVDY--GRPANEVNLVDWLKMMVASRRSEEVVDPTIETRP 431

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L  A  CV   S++R  M Q    L
Sbjct: 432 STRALKRALLTALRCVDPDSEKRPKMGQVVRML 464



>gb:CRU303349_1673665 Capsella rubella ORF1, ORF2, ORF3, ORF4, ORF5
            and ORF6 (partial).
          Length = 1166

 Score =  107 bits (267), Expect = 3e-22
 Identities = 63/172 (36%), Positives = 95/172 (55%), Gaps = 1/172 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDEDF+AR+ DFG+ARL++  D H +  V    G  GYV PEY  +   +
Sbjct: 985  HRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1042

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID-KSICGR 422
             KGD YS+GV+LLEL +G+KP++    E G   NLV W  Q        +++D + +  +
Sbjct: 1043 AKGDVYSYGVILLELLSGKKPID--PGEFGEDNNLVGWAKQLYREKSGTEILDPELVTEK 1100

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL 266
              D ++  +L+IA  C+  R  +R +M Q      ++ A     E  DEF L
Sbjct: 1101 SGDAELFHYLKIASQCLDDRPFKRPTMIQVMAMFKELKADTEEDESLDEFSL 1152



>gb:AC005936_1533211 Arabidopsis thaliana chromosome 2 clone F5O4
           map CIC11A04, complete sequence.
          Length = 719

 Score =  107 bits (266), Expect = 3e-22
 Identities = 56/143 (39%), Positives = 89/143 (62%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLDE+F++ + DFGLARLM+P + H ++ + G LG   Y+ PEY    + +
Sbjct: 569 HRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLVGTLG---YIPPEYGQASVAT 625

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            KGD YSFGVVLLEL T ++P+++    +G + +L+ WV +     R  +V D  I  + 
Sbjct: 626 YKGDVYSFGVVLLELLTDKRPVDM-CKPKGCR-DLISWVVKMKHESRASEVFDPLIYSKE 683

Query: 418 HDEQIVQFLRIACNCVVSRSKER 350
           +D+++ + L IAC C+    K+R
Sbjct: 684 NDKEMFRVLEIACLCLSENPKQR 706



>pir|G96746|G96746 hypothetical protein T9N14.20 [imported] -
            Arabidopsis thaliana>gb:AE005173_894777 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC067754_1540329 Arabidopsis thaliana
            chromosome 1 BAC T9N14 genomic sequence, complete
            sequence.>gb:AY080797_1568497 Arabidopsis thaliana
            putative leucine-rich receptor protein kinase (At1g72300)
            mRNA, complete cds.>gb:AY133783_1581603 Arabidopsis
            thaliana clone U10901 putative leucine-rich receptor
            protein kinase (At1g72300) mRNA, complete cds.
          Length = 1095

 Score =  107 bits (266), Expect = 3e-22
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 3/171 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLD +F A + DFGL+RL+ P   H T+ + G LG   Y+ PEY    + +
Sbjct: 927  HRDIKSSNILLDGNFKAYVADFGLSRLILPYRTHVTTELVGTLG---YIPPEYGQAWVAT 983

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             +GD YSFGVV+LEL TG++P+E+   +      LV WV+     G+ ++V D  +   G
Sbjct: 984  LRGDVYSFGVVMLELLTGKRPMEVFRPK--MSRELVAWVHTMKRDGKPEEVFDTLLRESG 1041

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA---QQGISEPYDE 275
            ++E +++ L IAC CV     +R ++ Q  + L  + A   Q    EP +E
Sbjct: 1042 NEEAMLRVLDIACMCVNQNPMKRPNIQQVVDWLKNIEAEKNQNNREEPEEE 1092



>sp|Q9ZVR7|PSKR_ARATH Putative phytosulfokine receptor precursor (EC
            2.7.1.37) (Phytosulfokine LRR receptor
            kinase).>pir|D84434|D84434 probable receptor-like protein
            kinase [imported] - Arabidopsis thaliana
          Length = 1008

 Score =  107 bits (266), Expect = 3e-22
 Identities = 56/143 (39%), Positives = 89/143 (62%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE+F++ + DFGLARLM+P + H ++ + G LG   Y+ PEY    + +
Sbjct: 858  HRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLVGTLG---YIPPEYGQASVAT 914

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFGVVLLEL T ++P+++    +G + +L+ WV +     R  +V D  I  + 
Sbjct: 915  YKGDVYSFGVVLLELLTDKRPVDM-CKPKGCR-DLISWVVKMKHESRASEVFDPLIYSKE 972

Query: 418  HDEQIVQFLRIACNCVVSRSKER 350
            +D+++ + L IAC C+    K+R
Sbjct: 973  NDKEMFRVLEIACLCLSENPKQR 995



>sp|O22476|BRI1_ARATH BRASSINOSTEROID INSENSITIVE 1 precursor (EC
            2.7.1.37) (AtBRI1) (Brassinosteroid LRR receptor
            kinase).>pir|T09356|T09356 brassinosteroid-insensitive
            protein BRI1 - Arabidopsis thaliana>gb:ATCHRIV91_1547924
            Arabidopsis thaliana DNA chromosome 4, contig fragment
            No. 91.>gb:ATF23K16_1549765 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F23K16 (ESSA
            project).>gb:AF017056_1761527 Arabidopsis thaliana
            brassinosteroid insensitive 1 (BRI1) gene, complete cds.
          Length = 1196

 Score =  107 bits (266), Expect = 3e-22
 Identities = 66/164 (40%), Positives = 94/164 (57%), Gaps = 2/164 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDE+ +AR+ DFG+ARLM+  D H +  V    G  GYV PEY  +   S
Sbjct: 1007 HRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLS--VSTLAGTPGYVPPEYYQSFRCS 1064

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR- 422
            TKGD YS+GVVLLEL TG++P   T + +    NLV WV QH+   RI DV D  +    
Sbjct: 1065 TKGDVYSYGVVLLELLTGKRP---TDSPDFGDNNLVGWVKQHA-KLRISDVFDPELMKED 1120

Query: 421  -GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI 293
               + +++Q L++A  C+  R+  R +M Q      ++ A  GI
Sbjct: 1121 PALEIELLQHLKVAVACLDDRAWRRPTMVQVMAMFKEIQAGSGI 1164



>pir|G86227|G86227 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889950 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC003970_1531226 Arabidopsis thaliana
           chromosome I BAC F14J9 genomic sequence contains phyA
           marker, complete sequence.
          Length = 482

 Score =  106 bits (264), Expect = 6e-22
 Identities = 60/153 (39%), Positives = 92/153 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL+D+ F+A+I DFGLA+L+    +H T+ V   +G FGYVAPEY++T + +
Sbjct: 281 HRDIKSSNILIDDRFNAKISDFGLAKLLGDGKSHVTTRV---MGTFGYVAPEYANTGLLN 337

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV++LE  TG+ P++   A    + NLV+W+    GS R+++VID +I  R 
Sbjct: 338 EKSDVYSFGVLVLEAITGRDPVDY--ARPANEVNLVEWLKMMVGSKRLEEVIDPNIAVRP 395

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L  A  C+   S++R  M Q    L
Sbjct: 396 ATRALKRVLLTALRCIDPDSEKRPKMSQVVRML 428



>sp|Q8LPB4|PSKR_DAUCA Phytosulfokine receptor precursor (EC 2.7.1.37)
            (Phytosulfokine LRR receptor kinase).>gb:AB060167_1521814
            Daucus carota pskr mRNA for phytosulfokine receptor,
            complete cds.
          Length = 1021

 Score =  105 bits (263), Expect = 8e-22
 Identities = 57/143 (39%), Positives = 82/143 (57%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILL + F A + DFGLARL+ P D H T+ + G LG   Y+ PEY    + +
Sbjct: 867  HRDIKSSNILLSDTFVAHLADFGLARLILPYDTHVTTDLVGTLG---YIPPEYGQASVAT 923

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFGVVLLEL TG++P+++   +     +L+ WV Q     R  ++ D  I  + 
Sbjct: 924  YKGDVYSFGVVLLELLTGRRPMDV--CKPRGSRDLISWVLQMKTEKRESEIFDPFIYDKD 981

Query: 418  HDEQIVQFLRIACNCVVSRSKER 350
            H E+++  L IAC C+    K R
Sbjct: 982  HAEEMLLVLEIACRCLGENPKTR 1004



>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
            precursor (EC 2.7.1.37) (Extra sporogenous cells protein)
            (EXCESS MICROSPOROCYTES1 protein).>pir|T48499|T48499
            receptor-like protein kinase-like protein - Arabidopsis
            thaliana>gb:ATH488154_1552685 Arabidopsis thaliana mRNA
            for receptor-like protein kinase-like protein (ems1
            gene).>gb:ATT28J14_1555609 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 1192

 Score =  105 bits (262), Expect = 1e-21
 Identities = 58/156 (37%), Positives = 89/156 (57%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLD DF+ ++ DFGLARL++  ++H ++ + G    FGY+ PEY  +   +
Sbjct: 1041 HRDIKASNILLDGDFEPKVADFGLARLISACESHVSTVIAGT---FGYIPPEYGQSARAT 1097

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TKGD YSFGV+LLEL TG++P      +E   GNLV W  Q    G+  DVID  +    
Sbjct: 1098 TKGDVYSFGVILLELVTGKEPTG-PDFKESEGGNLVGWAIQKINQGKAVDVIDPLLVSVA 1156

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
                 ++ L+IA  C+     +R +M    +AL ++
Sbjct: 1157 LKNSQLRLLQIAMLCLAETPAKRPNMLDVLKALKEI 1192



>gb:AK118356_1816339 Arabidopsis thaliana At5g62710 mRNA for
           putative receptor like protein kinase, complete cds,
           clone: RAFL19-62-H10.
          Length = 604

 Score =  105 bits (261), Expect = 1e-21
 Identities = 65/170 (38%), Positives = 95/170 (55%), Gaps = 2/170 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILL++  + R+ DFGLA+L+   DAH T+ V G    FGY+APEY      +
Sbjct: 436 HRDIKSSNILLNDKLEPRVSDFGLAKLLVDEDAHVTTVVAGT---FGYLAPEYLQNGRAT 492

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV+LLEL TG++P +    + G   N+V W+N      R++DVIDK  C   
Sbjct: 493 EKSDVYSFGVLLLELVTGKRPTDPIFVKRGL--NVVGWMNTVLKENRLEDVIDKR-CTDV 549

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK--MAAQQGISEPYDE 275
            +E +   L IA  C  +  + R +M Q  + L +  M+   GI + YD+
Sbjct: 550 DEESVEALLEIAERCTDANPENRPAMNQVAQLLEQEVMSPSSGI-DYYDD 598



>gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporogenous
            cells (ESP gene).
          Length = 1192

 Score =  105 bits (261), Expect = 1e-21
 Identities = 58/156 (37%), Positives = 89/156 (57%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLD DF+ ++ DFGLARL++  ++H ++ + G    FGY+ PEY  +   +
Sbjct: 1041 HRDIKASNILLDGDFEPKVADFGLARLISACESHISTVIAGT---FGYIPPEYGQSARAT 1097

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TKGD YSFGV+LLEL TG++P      +E   GNLV W  Q    G+  DVID  +    
Sbjct: 1098 TKGDVYSFGVILLELVTGKEPTG-PDFKESEGGNLVGWAIQKINQGKAVDVIDPLLVSVA 1156

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
                 ++ L+IA  C+     +R +M    +AL ++
Sbjct: 1157 LKNSQLRLLQIAMLCLAETPAKRPNMLDVLKALKEI 1192



>gb:AB009053_1510681 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQB2.
          Length = 580

 Score =  105 bits (261), Expect = 1e-21
 Identities = 65/170 (38%), Positives = 95/170 (55%), Gaps = 2/170 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILL++  + R+ DFGLA+L+   DAH T+ V G    FGY+APEY      +
Sbjct: 412 HRDIKSSNILLNDKLEPRVSDFGLAKLLVDEDAHVTTVVAGT---FGYLAPEYLQNGRAT 468

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV+LLEL TG++P +    + G   N+V W+N      R++DVIDK  C   
Sbjct: 469 EKSDVYSFGVLLLELVTGKRPTDPIFVKRGL--NVVGWMNTVLKENRLEDVIDKR-CTDV 525

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK--MAAQQGISEPYDE 275
            +E +   L IA  C  +  + R +M Q  + L +  M+   GI + YD+
Sbjct: 526 DEESVEALLEIAERCTDANPENRPAMNQVAQLLEQEVMSPSSGI-DYYDD 574



>pir|H84770|H84770 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006068_1533368 Arabidopsis
           thaliana chromosome 2 clone T20F21 map ve016, complete
           sequence.
          Length = 567

 Score =  105 bits (261), Expect = 1e-21
 Identities = 62/167 (37%), Positives = 94/167 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD + +AR+ DFGLA+L+   ++H T+ V G    FGY+APEY  +   +
Sbjct: 403 HRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGT---FGYLAPEYMQSGRAT 459

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV++LE+ +G+ P + +  E+GF  N+V W+N      R K+++D S C   
Sbjct: 460 EKTDVYSFGVLVLEVLSGKLPTDASFIEKGF--NIVGWLNFLISENRAKEIVDLS-CEGV 516

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
             E +   L IA  CV S   ER +M++  + L         S+ YD
Sbjct: 517 ERESLDALLSIATKCVSSSPDERPTMHRVVQLLESEVMTPCPSDFYD 563



>gb:AP003453_1829707 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0480C01.
          Length = 1121

 Score =  103 bits (258), Expect = 3e-21
 Identities = 62/160 (38%), Positives = 92/160 (57%), Gaps = 2/160 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +L+DE  +AR+ DFG+ARLM+  D H +  V    G  GYV PEY  +   +
Sbjct: 931  HRDMKSSNVLIDEQLEARVSDFGMARLMSVVDTHLS--VSTLAGTPGYVPPEYYQSFRCT 988

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR- 422
            TKGD YS+GVVLLEL TG+ P +  +A+ G   NLV WV QH+   +I DV D  +    
Sbjct: 989  TKGDVYSYGVVLLELLTGKPPTD--SADFGEDNNLVGWVKQHT-KLKITDVFDPELLKED 1045

Query: 421  -GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA 305
               + ++++ L+IAC C+  R   R +M +      ++ A
Sbjct: 1046 PSVELELLEHLKIACACLDDRPSRRPTMLKVMAMFKEIQA 1085



>gb:AP005659_1855662 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0649C11.>gb:AP006584_1862452 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:B1197G05.
          Length = 509

 Score =  103 bits (257), Expect = 4e-21
 Identities = 62/147 (42%), Positives = 80/147 (54%), Gaps = 4/147 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++     ILLD+D +ARI DFGLA+ M  PDAH         G  GY+APEY  T+  +
Sbjct: 350 HRDLKPANILLDDDMEARIADFGLAKAM--PDAHTHMTTSNVAGTLGYIAPEYHQTLKFT 407

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKG-NLVDW---VNQHSGSGRIKDVIDKSI 431
            K D YSFGV+L  L TG++P +   A++      +V W   V Q         VID +I
Sbjct: 408 AKCDVYSFGVILAVLGTGKEPTDKFFAQQVVDDVGIVRWLRRVMQEGDPAAQAGVIDAAI 467

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKER 350
            G GHDEQI+  LRIA  C     K+R
Sbjct: 468 AGAGHDEQILLVLRIAVFCTADDPKDR 494



>gb:AP004121_1837906 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1442_E05.
          Length = 1060

 Score =  103 bits (257), Expect = 4e-21
 Identities = 59/159 (37%), Positives = 90/159 (56%), Gaps = 1/159 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDL-GEFGYVAPEYSSTMIP 602
            H++  S  ILLD   + R+ DFGLARL+    AH+ + V  DL G  GY+ PEY  + + 
Sbjct: 902  HRDIKSSNILLDARLEPRLADFGLARLVR---AHDDTHVTTDLVGTLGYIPPEYGHSSVA 958

Query: 601  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
            + +GD YS GVVLLEL TG++P+++     G + ++  W  +     R  +V+D S+  R
Sbjct: 959  TYRGDVYSLGVVLLELVTGRRPVDMARPAGGGR-DVTSWALRMRREARGDEVVDASVGER 1017

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA 305
             H ++  + L +AC CV    K R +  Q  E L+ +AA
Sbjct: 1018 RHRDEACRVLDVACACVSDNPKSRPTAQQLVEWLDAIAA 1056



>gb:AY128280_1580582 Arabidopsis thaliana AT3g13380/MRP15_1 mRNA,
            complete cds.>gb:AP000603_1820392 Arabidopsis thaliana
            genomic DNA, chromosome 3, P1 clone: MRP15.
          Length = 1164

 Score =  103 bits (257), Expect = 4e-21
 Identities = 61/172 (35%), Positives = 96/172 (55%), Gaps = 1/172 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLD+DF AR+ DFG+ARL++  D H +  V    G  GYV PEY  +   +
Sbjct: 983  HRDMKSSNVLLDQDFVARVSDFGMARLVSALDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1040

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID-KSICGR 422
             KGD YS+GV+LLEL +G+KP++    E G   NLV W  Q     R  +++D + +  +
Sbjct: 1041 AKGDVYSYGVILLELLSGKKPID--PEEFGEDNNLVGWAKQLYREKRGAEILDPELVTDK 1098

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL 266
              D +++ +L+IA  C+  R  +R +M Q      ++      ++  DEF L
Sbjct: 1099 SGDVELLHYLKIASQCLDDRPFKRPTMIQVMTMFKELVQVDTENDSLDEFLL 1150



>gb:AE016959_1020675 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC078891_1541546 Oryza sativa
            chromosome 10 clone OSJNBa0092N12, complete
            sequence.>gb:AC098694_1736838 Oryza sativa (japonica
            cultivar-group) chromosome 10 clone OJ1014H12, complete
            sequence.>gb:AE017050_1750494 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 4 of 77 of the
            complete sequence.
          Length = 1110

 Score =  103 bits (257), Expect = 4e-21
 Identities = 62/159 (38%), Positives = 90/159 (56%), Gaps = 1/159 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLD D +AR+ DFG+ARL++  D H +  V    G  GYV PEY  +   +
Sbjct: 950  HRDMKSSNVLLDGDMEARVADFGMARLISALDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1007

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YSFGVVLLEL TG++P   T  ++    NLV WV    G G  K+V+D  +   G
Sbjct: 1008 VKGDVYSFGVVLLELLTGRRP---TDKDDFGDTNLVGWVKMKVGDGAGKEVLDPELVVEG 1064

Query: 418  HD-EQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA 305
             D +++ +F+ +A  CV     +R +M Q    L ++ A
Sbjct: 1065 ADADEMARFMDMALQCVDDFPSKRPNMLQVVAMLRELDA 1103



>gb:AC119796_1739716 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1172F09, complete sequence.
          Length = 1030

 Score =  103 bits (256), Expect = 5e-21
 Identities = 61/149 (40%), Positives = 91/149 (61%), Gaps = 3/149 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLD++ DA+I DFGLAR+MA   AHET  V    G +GY+APEY  T+   
Sbjct: 847  HRDVKSSNVLLDDNMDAKIADFGLARVMAR--AHETVSVVA--GSYGYIAPEYGYTLKVD 902

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
             K D YSFGVVL+EL TG++P+E    E G   ++V W+ +   S   +++++D S+ GR
Sbjct: 903  QKSDIYSFGVVLMELLTGRRPIE---PEYGESQDIVGWIRERLRSNTGVEELLDASVGGR 959

Query: 421  GHD--EQIVQFLRIACNCVVSRSKERWSM 341
                 E+++  LR+A  C     K+R +M
Sbjct: 960  VDHVREEMLLVLRVAVLCTAKSPKDRPTM 988



>gb:AP002865_1823339 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0034C11.>gb:AP003074_1824596 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0004G10.
          Length = 346

 Score =  102 bits (255), Expect = 6e-21
 Identities = 59/155 (38%), Positives = 87/155 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD + +AR+ DFGLA LM P  +H T+ V G    FGY+APEY  T   +
Sbjct: 191 HRDIKSSNILLDHNMEARVSDFGLATLMKPNHSHVTTVVAGT---FGYLAPEYFETGRAT 247

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
           TKGD YS+GVVLLEL TG +P + +  E G +  LV WV +     R +  +D ++    
Sbjct: 248 TKGDVYSYGVVLLELLTGMRPTDESFLENGTR--LVTWVKETMEEKREEHAVDSALESSF 305

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
             E++    ++A  C+ S    R +M +  + L +
Sbjct: 306 PAEEVKLVFKVADKCLESEPCNRPTMAEVVKLLEQ 340



>gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis
           receptor-like kinase 3 (SERK3) mRNA, complete cds.
          Length = 615

 Score =  102 bits (255), Expect = 6e-21
 Identities = 59/169 (34%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 414 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 470

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQ+  +L          L+DWV       +++ ++D  + G  
Sbjct: 471 EKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNY 530

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            DE++ Q +++A  C  S   ER  M +      +M    G++E ++E+
Sbjct: 531 KDEEVEQLIQVALLCTQSSPMERPKMSEVV----RMLEGDGLAERWEEW 575



>gb:AC007789_1536200 Oryza sativa BAC OSJNBa0049B20 genomic
           sequence, complete sequence.
          Length = 303

 Score =  102 bits (255), Expect = 6e-21
 Identities = 59/155 (38%), Positives = 87/155 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD + +AR+ DFGLA LM P  +H T+ V G    FGY+APEY  T   +
Sbjct: 148 HRDIKSSNILLDHNMEARVSDFGLATLMKPNHSHVTTVVAGT---FGYLAPEYFETGRAT 204

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
           TKGD YS+GVVLLEL TG +P + +  E G +  LV WV +     R +  +D ++    
Sbjct: 205 TKGDVYSYGVVLLELLTGMRPTDESFLENGTR--LVTWVKETMEEKREEHAVDSALESSF 262

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
             E++    ++A  C+ S    R +M +  + L +
Sbjct: 263 PAEEVKLVFKVADKCLESEPCNRPTMAEVVKLLEQ 297



>gb:AX120065_1461712 Sequence 48 from Patent WO0129240.
          Length = 591

 Score =  102 bits (255), Expect = 6e-21
 Identities = 59/169 (34%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 390 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 446

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQ+  +L          L+DWV       +++ ++D  + G  
Sbjct: 447 EKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNY 506

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            DE++ Q +++A  C  S   ER  M +      +M    G++E ++E+
Sbjct: 507 KDEEVEQLIQVALLCTQSSPMERPKMSEVV----RMLEGDGLAERWEEW 551



>pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis
           thaliana>gb:ATCHRIV79_1547263 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 79.>gb:ATF17M5_1549022
           Arabidopsis thaliana DNA chromosome 4, BAC clone F17M5
           (ESSA project).
          Length = 523

 Score =  102 bits (255), Expect = 6e-21
 Identities = 59/169 (34%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 322 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 378

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQ+  +L          L+DWV       +++ ++D  + G  
Sbjct: 379 EKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNY 438

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            DE++ Q +++A  C  S   ER  M +      +M    G++E ++E+
Sbjct: 439 KDEEVEQLIQVALLCTQSSPMERPKMSEVV----RMLEGDGLAERWEEW 483



>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated
           receptor kinase 1 precursor (EC 2.7.1.37)
           (BRI1-associated receptor kinase 1) (Somatic
           embryogenesis receptor-like kinase
           3).>gb:CQ768561_1451798 Sequence 56 from Patent
           WO2004007712.
          Length = 615

 Score =  102 bits (255), Expect = 6e-21
 Identities = 59/169 (34%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 414 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 470

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQ+  +L          L+DWV       +++ ++D  + G  
Sbjct: 471 EKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNY 530

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            DE++ Q +++A  C  S   ER  M +      +M    G++E ++E+
Sbjct: 531 KDEEVEQLIQVALLCTQSSPMERPKMSEVV----RMLEGDGLAERWEEW 575



>gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 mRNA
            for putative leucin-rich repeat protein kinase, complete
            cds.>gb:AP003451_1829652 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0413C03.
          Length = 1294

 Score =  102 bits (254), Expect = 8e-21
 Identities = 59/154 (38%), Positives = 87/154 (56%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE+F+ R+ DFGLAR+++  + H ++ + G    FGY+ PEY  TM  +
Sbjct: 1127 HRDMKSSNILLDENFEPRVSDFGLARIISACETHVSTDIAGT---FGYIPPEYGLTMKST 1183

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSI-CGR 422
            TKGD YSFGVV+LEL TG+ P      + G  GNLV WV      G+  ++ D  +    
Sbjct: 1184 TKGDVYSFGVVMLELLTGRPPTGQEEVQGG--GNLVGWVRWMIARGKQNELFDPCLPVSS 1241

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               EQ+ + L IA +C      +R +M +  + L
Sbjct: 1242 VWREQMARVLAIARDCTADEPFKRPTMLEVVKGL 1275



>gb:AY056243_1563564 Arabidopsis thaliana unknown protein
           (At2g13780) mRNA, complete cds.
          Length = 620

 Score =  102 bits (253), Expect = 1e-20
 Identities = 58/169 (34%), Positives = 98/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 419 HRDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 475

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 476 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 535

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 536 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 580



>gb:AX120071_1461715 Sequence 54 from Patent WO0129240.
          Length = 596

 Score =  102 bits (253), Expect = 1e-20
 Identities = 58/169 (34%), Positives = 98/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 395 HRDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 451

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 452 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 511

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 512 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 556



>gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.
          Length = 615

 Score =  102 bits (253), Expect = 1e-20
 Identities = 58/169 (34%), Positives = 98/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 414 HRDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 470

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 471 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 530

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 531 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 575



>pir|G84510|G84510 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006436_1534245 Arabidopsis
           thaliana chromosome 2 clone F13J11 map mi398, complete
           sequence.
          Length = 520

 Score =  102 bits (253), Expect = 1e-20
 Identities = 58/169 (34%), Positives = 98/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 319 HRDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 375

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 376 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 435

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 436 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 480



>gb:AX138085_1462208 Sequence 31 from Patent EP1094113.
          Length = 597

 Score =  101 bits (252), Expect = 1e-20
 Identities = 59/167 (35%), Positives = 97/167 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 391 HRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVTTAVRGTVG---HIAPEYLSTGQSS 447

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TGQK L+   +    KG ++DWV +    G++K +IDK +  + 
Sbjct: 448 EKTDVFGFGILLLELITGQKALDFGRSAHQ-KGVMLDWVKKLHQEGKLKQLIDKDLNDKF 506

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
              ++ + +++A  C       R  M +    + KM    G++E ++
Sbjct: 507 DRVELEEIVQVALLCTQFNPSHRPKMSE----VMKMLEGDGLAERWE 549



>gb:CQ768545_1451790 Sequence 40 from Patent
           WO2004007712.>gb:AY056294_1563607 Arabidopsis thaliana
           putative receptor kinase (At1g60800) mRNA, complete
           cds.>gb:AY150495_1585060 Arabidopsis thaliana putative
           receptor kinase (At1g60800) mRNA, complete cds.
          Length = 632

 Score =  101 bits (252), Expect = 1e-20
 Identities = 59/167 (35%), Positives = 97/167 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 426 HRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVTTAVRGTVG---HIAPEYLSTGQSS 482

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TGQK L+   +    KG ++DWV +    G++K +IDK +  + 
Sbjct: 483 EKTDVFGFGILLLELITGQKALDFGRSAHQ-KGVMLDWVKKLHQEGKLKQLIDKDLNDKF 541

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
              ++ + +++A  C       R  M +    + KM    G++E ++
Sbjct: 542 DRVELEEIVQVALLCTQFNPSHRPKMSE----VMKMLEGDGLAERWE 584



>pir|T14354|T14354 probable somatic embryogenesis receptor-like
           kinase - carrot>gb:A67797_1450276 Sequence 2 from Patent
           WO9743427.>gb:DCU93048_1675787 Daucus carota somatic
           embryogenesis receptor-like kinase mRNA, complete cds.
          Length = 553

 Score =  101 bits (252), Expect = 1e-20
 Identities = 59/169 (34%), Positives = 92/169 (54%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLARLM   D H T+ V+G LG   Y+APEY ST   S
Sbjct: 355 HRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTLG---YIAPEYLSTGKSS 411

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 412 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKSLLKEKKLEMLVDPDLENNY 471

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            D ++ Q +++A  C      ER  M +      +M    G++E +DE+
Sbjct: 472 IDTEVEQLIQVALLCTQGSPMERPKMSEVV----RMLEGDGLAEKWDEW 516



>pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5.31
           [imported] - Arabidopsis thaliana>gb:AE005173_893755
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AX120051_1461705 Sequence 34 from Patent
           WO0129240.>gb:AC002292_1530159 Arabidopsis thaliana BAC
           F8A5, complete sequence.
          Length = 588

 Score =  101 bits (252), Expect = 1e-20
 Identities = 59/167 (35%), Positives = 97/167 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 382 HRDVKAANILLDEDFEAVVGDFGLAKLLDHRDSHVTTAVRGTVG---HIAPEYLSTGQSS 438

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TGQK L+   +    KG ++DWV +    G++K +IDK +  + 
Sbjct: 439 EKTDVFGFGILLLELITGQKALDFGRSAHQ-KGVMLDWVKKLHQEGKLKQLIDKDLNDKF 497

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
              ++ + +++A  C       R  M +    + KM    G++E ++
Sbjct: 498 DRVELEEIVQVALLCTQFNPSHRPKMSE----VMKMLEGDGLAERWE 540



>gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis
           receptor-like kinase 2 (SERK2) mRNA, complete cds.
          Length = 628

 Score =  101 bits (251), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 94/169 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLARLM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 430 HRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 486

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  + G  
Sbjct: 487 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQGNY 546

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S   ER  M +      +M    G++E +DE+
Sbjct: 547 TEAEVEQLIQVALLCTQSSPMERPKMSEVV----RMLEGDGLAEKWDEW 591



>gb:ZMA277702_1731487 Zea mays mRNA for SERK1
           protein.>gb:ZMA400868_1731516 Zea mays serk1 gene for
           somatic embryogenesis receptor-like kinase 1, exons
           1-11.
          Length = 622

 Score =  100 bits (250), Expect = 2e-20
 Identities = 56/169 (33%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 425 HRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 481

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  + GR 
Sbjct: 482 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKALLKEKKLEQLVDPDLQGRY 541

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            D+++   +++A  C      ER  M +    + +M    G++E ++++
Sbjct: 542 VDQEVESLIQVALLCTQGSPMERPKMSE----VARMLEGDGLAERWEQW 586



>gb:BT008322_1639539 Arabidopsis thaliana At1g56720 gene, complete
           cds.
          Length = 492

 Score =  100 bits (250), Expect = 2e-20
 Identities = 57/153 (37%), Positives = 90/153 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL++++F+A++ DFGLA+L+    +H T+ V   +G FGYVAPEY+++ + +
Sbjct: 303 HRDIKSSNILINDEFNAKVSDFGLAKLLGAGKSHVTTRV---MGTFGYVAPEYANSGLLN 359

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVLLE  TG+ P++        + NLVDW+    G+ R ++V+D +I  + 
Sbjct: 360 EKSDVYSFGVVLLEAITGRDPVDY--GRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKP 417

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L  A  CV   S +R  M Q    L
Sbjct: 418 PTRSLKRALLTALRCVDPDSDKRPKMSQVVRML 450



>gb:AY094412_1575714 Arabidopsis thaliana At2g13800/F13J11.15 mRNA,
           complete cds.>gb:BT001116_1635371 Arabidopsis thaliana
           At2g13800/F13J11.15 mRNA, complete cds.
          Length = 484

 Score =  100 bits (250), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 97/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H +  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 283 HLDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 339

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 340 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 399

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 400 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 444



>gb:AY087491_1572522 Arabidopsis thaliana clone 36000 mRNA, complete
           sequence.
          Length = 492

 Score =  100 bits (250), Expect = 2e-20
 Identities = 57/153 (37%), Positives = 90/153 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL++++F+A++ DFGLA+L+    +H T+ V   +G FGYVAPEY+++ + +
Sbjct: 303 HRDIKSSNILINDEFNAKVSDFGLAKLLGAGKSHVTTRV---MGTFGYVAPEYANSGLLN 359

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVLLE  TG+ P++        + NLVDW+    G+ R ++V+D +I  + 
Sbjct: 360 EKSDVYSFGVVLLEAITGRDPVDY--GRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKP 417

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L  A  CV   S +R  M Q    L
Sbjct: 418 PTRSLKRALLTALRCVDPDSDKRPKMSQVVRML 450



>gb:AX120069_1461714 Sequence 52 from Patent WO0129240.
          Length = 577

 Score =  100 bits (250), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 97/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H +  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 376 HLDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 432

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 433 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 492

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 493 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 537



>gb:CQ768565_1451800 Sequence 60 from Patent WO2004007712.
          Length = 601

 Score =  100 bits (250), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 97/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H +  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 400 HLDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 456

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 457 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 516

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 517 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 561



>pir|T47793|T47793 receptor-like protein kinase - Arabidopsis
           thaliana>gb:ATF17J16_1548972 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F17J16.
          Length = 512

 Score =  100 bits (250), Expect = 2e-20
 Identities = 56/153 (36%), Positives = 91/153 (59%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  IL+D+DF+A++ DFGLA+L+   ++H T+ V   +G FGYVAPEY++T + +
Sbjct: 314 HRDIKASNILIDDDFNAKLSDFGLAKLLDSGESHITTRV---MGTFGYVAPEYANTGLLN 370

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV+LLE  TG+ P++        + NLV+W+    G+ R ++V+D  I    
Sbjct: 371 EKSDIYSFGVLLLETITGRDPVDYERPAN--EVNLVEWLKMMVGTRRAEEVVDSRIEPPP 428

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L +A  CV   +++R  M Q    L
Sbjct: 429 ATRALKRALLVALRCVDPEAQKRPKMSQVVRML 461



>pir|B96609|B96609 probable protein kinase F25P12.84 [imported] -
           Arabidopsis thaliana>gb:AE005173_893547 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC009323_1536713 Arabidopsis thaliana
           chromosome I BAC F25P12 genomic sequence, complete
           sequence.
          Length = 495

 Score =  100 bits (250), Expect = 2e-20
 Identities = 57/153 (37%), Positives = 90/153 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL++++F+A++ DFGLA+L+    +H T+ V   +G FGYVAPEY+++ + +
Sbjct: 306 HRDIKSSNILINDEFNAKVSDFGLAKLLGAGKSHVTTRV---MGTFGYVAPEYANSGLLN 362

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVLLE  TG+ P++        + NLVDW+    G+ R ++V+D +I  + 
Sbjct: 363 EKSDVYSFGVVLLEAITGRDPVDY--GRPAHEVNLVDWLKMMVGTRRSEEVVDPNIEVKP 420

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L  A  CV   S +R  M Q    L
Sbjct: 421 PTRSLKRALLTALRCVDPDSDKRPKMSQVVRML 453



>pir|H84510|H84510 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006436_1534246 Arabidopsis
           thaliana chromosome 2 clone F13J11 map mi398, complete
           sequence.
          Length = 524

 Score =  100 bits (250), Expect = 2e-20
 Identities = 58/169 (34%), Positives = 97/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H +  +  ILLDE+F+A + DFGLA+LM   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 323 HLDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIG---HIAPEYLSTGKSS 379

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +GV+LLEL TGQK  +L          L+DWV +     +++ ++D  + G+ 
Sbjct: 380 EKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKY 439

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S + ER  M +      +M    G++E ++E+
Sbjct: 440 VETEVEQLIQMALLCTQSSAMERPKMSEVV----RMLEGDGLAERWEEW 484



>gb:ATAC009755_1543036 Arabidopsis thaliana chromosome III BAC F14P3
            genomic sequence, complete
            sequence.>gb:ATAC011664_1543339 Arabidopsis thaliana
            chromosome III BAC F1C9 genomic sequence, complete
            sequence.
          Length = 1151

 Score =  100 bits (249), Expect = 3e-20
 Identities = 58/156 (37%), Positives = 82/156 (52%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD+D +A + DFGLARL+   + H T+   G  G FGYVAPEY+ T   S
Sbjct: 994  HRDVKPSNILLDDDCNAYLSDFGLARLLGTSETHATT---GVAGTFGYVAPEYAMTCRVS 1050

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YS+GVVLLEL + +K L+ +    G   N+V W       GR K+     +   G
Sbjct: 1051 DKADVYSYGVVLLELLSDKKALDPSFVSYGNGFNIVQWACMLLRQGRAKEFFTAGLWDAG 1110

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              + +V+ L +A  C V     R +M Q    L ++
Sbjct: 1111 PHDDLVEVLHLAVVCTVDSLSTRPTMKQVVRRLKQL 1146



>pir|G96813|G96813 hypothetical protein T30F21.14 [imported] -
           Arabidopsis thaliana>gb:AE005173_895371 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007260_1535711 Arabidopsis thaliana
           chromosome I BAC T30F21 genomic sequence, complete
           sequence.
          Length = 355

 Score =  100 bits (249), Expect = 3e-20
 Identities = 65/155 (41%), Positives = 85/155 (54%), Gaps = 2/155 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD + +AR+ DFGLA LM P   H ++FV G    FGY+APEY  T   +
Sbjct: 195 HRDIKSSNILLDHNMEARVSDFGLATLMEPDKTHVSTFVAGT---FGYLAPEYFDTGKAT 251

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            KGD YSFGVVLLEL TG+KP +    EEG K  LV WV       R + VID  + G  
Sbjct: 252 MKGDVYSFGVVLLELLTGRKPTDDEFFEEGTK--LVTWVKGVVRDQREEVVIDNRLRGSS 309

Query: 418 --HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
              +E++     IA  C+      R +M +  + L
Sbjct: 310 VQENEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLL 344



>gb:AP003453_1829708 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0480C01.
          Length = 188

 Score =  100 bits (248), Expect = 4e-20
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
 Frame = -2

Query: 763 SHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPSTKGDA 584
           S  +L+DE  +AR+ DFG+ARLM+  D H +  V    G  GYV PEY  +   +TKGD 
Sbjct: 3   SSNVLIDEQLEARVSDFGMARLMSVVDTHLS--VSTLAGTPGYVPPEYYQSFRCTTKGDV 60

Query: 583 YSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR--GHDE 410
           YS+GVVLLEL TG+ P +  +A+ G   NLV WV QH+   +I DV D  +       + 
Sbjct: 61  YSYGVVLLELLTGKPPTD--SADFGEDNNLVGWVKQHT-KLKITDVFDPELLKEDPSVEL 117

Query: 409 QIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA 305
           ++++ L+IAC C+  R   R +M +      ++ A
Sbjct: 118 ELLEHLKIACACLDDRPSRRPTMLKVMAMFKEIQA 152



>gb:AC008262_1536615 Genomic sequence for Arabidopsis thaliana BAC
            F4N2 from chromosome I, complete sequence.
          Length = 857

 Score =  100 bits (248), Expect = 4e-20
 Identities = 56/158 (35%), Positives = 88/158 (55%), Gaps = 2/158 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD +++A + DFGL++L+    +H T+   G  G FGYVAPEY+ T   S
Sbjct: 700  HRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTT---GVAGTFGYVAPEYAMTCRVS 756

Query: 598  TKGDAYSFGVVLLELATGQKPLE--LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICG 425
             K D YS+G+VLLEL + ++ L+   ++ E GF  N+V W +     G+ K+V    +  
Sbjct: 757  EKADVYSYGIVLLELISDKRALDPSFSSHENGF--NIVSWAHMMLSQGKAKEVFTTGLWE 814

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
             G  + +V+ L +A  C V     R +M QA   L ++
Sbjct: 815  TGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRI 852



>pir|G96716|G96716 hypothetical protein F23O10.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_894537 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC018364_1538336 Arabidopsis thaliana
           chromosome 1 BAC F23O10 genomic sequence, complete
           sequence.>gb:ATU55875_1557092 Arabidopsis thaliana
           protein kinase (RPK1) mRNA, complete
           cds.>gb:AY099858_1576883 Arabidopsis thaliana receptor
           protein kinase, putative (At1g69270) mRNA, complete
           cds.>gb:BT008896_1640092 Arabidopsis thaliana At1g69270
           mRNA, complete cds.
          Length = 540

 Score =  100 bits (248), Expect = 4e-20
 Identities = 56/158 (35%), Positives = 88/158 (55%), Gaps = 2/158 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++     ILLD +++A + DFGL++L+    +H T+   G  G FGYVAPEY+ T   S
Sbjct: 383 HRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTT---GVAGTFGYVAPEYAMTCRVS 439

Query: 598 TKGDAYSFGVVLLELATGQKPLE--LTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICG 425
            K D YS+G+VLLEL + ++ L+   ++ E GF  N+V W +     G+ K+V    +  
Sbjct: 440 EKADVYSYGIVLLELISDKRALDPSFSSHENGF--NIVSWAHMMLSQGKAKEVFTTGLWE 497

Query: 424 RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            G  + +V+ L +A  C V     R +M QA   L ++
Sbjct: 498 TGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRI 535



>pir|D84860|D84860 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006580_1534489 Arabidopsis thaliana
           chromosome 2 clone F23E6 map m551, complete
           sequence.>gb:AC006931_1534812 Arabidopsis thaliana
           chromosome 2 clone F7D19 map m551, complete sequence.
          Length = 494

 Score = 99.4 bits (246), Expect = 7e-20
 Identities = 54/153 (35%), Positives = 92/153 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  IL+D++F+A++ DFGLA+L+   ++H T+ V   +G FGYVAPEY++T + +
Sbjct: 307 HRDIKASNILIDDEFNAKLSDFGLAKLLDSGESHITTRV---MGTFGYVAPEYANTGLLN 363

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV+LLE  TG+ P++        + NLV+W+    G+ R ++V+D  +  R 
Sbjct: 364 EKSDIYSFGVLLLEAITGRDPVDY--GRPANEVNLVEWLKMMVGTRRAEEVVDPRLEPRP 421

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L ++  CV   +++R  M Q    L
Sbjct: 422 SKSALKRALLVSLRCVDPEAEKRPRMSQVARML 454



>pir|B86440|B86440 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AE005172_892007 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC027135_1539879 Arabidopsis thaliana
           chromosome 1 BAC T8E3 genomic sequence, complete
           sequence.
          Length = 590

 Score = 99.4 bits (246), Expect = 7e-20
 Identities = 59/167 (35%), Positives = 93/167 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD + +AR+ DFGLA+L+   ++H T+ V G    FGY+APEY  +   +
Sbjct: 426 HRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHITTIVAGT---FGYLAPEYMQSGRAT 482

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV++LE+ +G++P + +  E+G   N+V W+       R +D++D + C   
Sbjct: 483 EKTDVYSFGVLVLEVLSGKRPTDASFIEKGL--NVVGWLKFLISEKRPRDIVDPN-CEGM 539

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
             E +   L IA  CV    +ER +M++  + L         SE YD
Sbjct: 540 QMESLDALLSIATQCVSPSPEERPTMHRVVQLLESEVMTPCPSEFYD 586



>gb:AB109215_1526831 Hordeum vulgare BRI1 gene for putative
            brassinosteroid-insensitive 1, complete cds,
            cultivar:Akashinriki.
          Length = 1118

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 60/160 (37%), Positives = 91/160 (56%), Gaps = 2/160 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +L+DE+ +AR+ DFG+AR+M+  D H +  V    G  GYV PEY  +   +
Sbjct: 928  HRDMKSSNVLVDENLEARVSDFGMARMMSVVDTHLS--VSTLAGTPGYVPPEYYQSFRCT 985

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TKGD YS+GVVLLEL TG+ P + T  + G   NLV WV  H+   +I DV D  +    
Sbjct: 986  TKGDVYSYGVVLLELLTGKPPTDST--DFGEDHNLVGWVKMHT-KLKITDVFDPELLKDD 1042

Query: 418  H--DEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA 305
               + ++++ L+IAC C+  R   R +M +      ++ A
Sbjct: 1043 PTLELELLEHLKIACACLDDRPSRRPTMLKVMTMFKEIQA 1082



>gb:AB088206_1524763 Hordeum vulgare BRI1 mRNA for putative
            brassinosteroid-insensitive protein 1, complete
            cds.>gb:AB109213_1526829 Hordeum vulgare BRI1 gene for
            putative brassinosteroid-insensitive 1, complete cds,
            cultivar:Haruna Nijo.>gb:AB109214_1526830 Hordeum vulgare
            subsp. spontaneum BRI1 gene for putative
            brassinosteroid-insensitive 1, complete cds, strain:H602.
          Length = 1118

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 60/160 (37%), Positives = 91/160 (56%), Gaps = 2/160 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +L+DE+ +AR+ DFG+AR+M+  D H +  V    G  GYV PEY  +   +
Sbjct: 928  HRDMKSSNVLVDENLEARVSDFGMARMMSVVDTHLS--VSTLAGTPGYVPPEYYQSFRCT 985

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TKGD YS+GVVLLEL TG+ P + T  + G   NLV WV  H+   +I DV D  +    
Sbjct: 986  TKGDVYSYGVVLLELLTGKPPTDST--DFGEDHNLVGWVKMHT-KLKITDVFDPELLKDD 1042

Query: 418  H--DEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAA 305
               + ++++ L+IAC C+  R   R +M +      ++ A
Sbjct: 1043 PTLELELLEHLKIACACLDDRPSRRPTMLKVMTMFKEIQA 1082



>pir|D86466|D86466 69.4K hypothetical protein F23M19.11 -
           Arabidopsis thaliana>gb:AE005172_892224 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:CQ768559_1451797 Sequence 54 from Patent
           WO2004007712.>gb:AX120063_1461711 Sequence 46 from
           Patent WO0129240.>gb:F23M19_1677952 Arabidopsis thaliana
           chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 628

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 57/169 (33%), Positives = 93/169 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLARLM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 430 HRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 486

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 487 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNY 546

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C  S   ER  M +      +M    G++E +DE+
Sbjct: 547 TEAEVEQLIQVALLCTQSSPMERPKMSEVV----RMLEGDGLAEKWDEW 591



>gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1080A02.
          Length = 652

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 53/143 (37%), Positives = 81/143 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++     ILLD  F+ R+ DFGLARL  P  +  ++   G +G   Y+APEY      +
Sbjct: 453 HRDIKCSNILLDSHFNPRLGDFGLARLKDPNTSPRSTLAAGTVG---YLAPEYLQMGKAT 509

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YS+GVVLLE+ TG++P+E    +     N+VDWV      G++ D +D ++ G  
Sbjct: 510 EKSDVYSYGVVLLEICTGRRPIESAAPDSMNMVNVVDWVWNLHSKGKVLDAVDPTLNGEY 569

Query: 418 HDEQIVQFLRIACNCVVSRSKER 350
              Q+++FL +  +CV   S+ER
Sbjct: 570 DAGQMMRFLLVGLSCVNPFSEER 592



>pir|T49010|T49010 hypothetical protein F25L23.280 - Arabidopsis
            thaliana>gb:AB074762_1523267 Arabidopsis thaliana mRNA
            for putative receptor protein kinase ACR4, complete
            cds.>gb:ATF25L23_1550067 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F25L23.
          Length = 895

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 61/175 (34%), Positives = 97/175 (55%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  IL+DE+ +AR+ DFGL+ L+ P D+  +   +   G  GY+ PEY      +
Sbjct: 639  HRDIKSSNILIDEEHNARVADFGLS-LLGPVDSG-SPLAELPAGTLGYLDPEYYRLHYLT 696

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TK D YSFGV+LLE+ +G+K +++   E    GN+V+W      +G I  ++D  +    
Sbjct: 697  TKSDVYSFGVLLLEILSGRKAIDMHYEE----GNIVEWAVPLIKAGDINALLDPVLKHPS 752

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE 254
              E + + + +AC CV  R K+R SM +   AL +  AQ  +  P  E P++ TE
Sbjct: 753  EIEALKRIVSVACKCVRMRGKDRPSMDKVTTALERALAQL-MGNPSSEQPILPTE 806



>gb:AP005533_1853634 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0018M09.
          Length = 607

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 54/169 (31%), Positives = 97/169 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+  + DFGLA+L+   D  +TS      G  G++APEY ST   S
Sbjct: 409 HRDVKAANVLLDEDFEPVVGDFGLAKLV---DVQKTSVTTQVRGTMGHIAPEYLSTGKSS 465

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            + D + +G++LLEL TGQ+ ++ +  EE     L+D V +    G++  ++D+++    
Sbjct: 466 ERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLQREGQLGSIVDRNLNQNY 525

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            DE++   ++IA  C  S  ++R SM +      +M   +G++E ++E+
Sbjct: 526 DDEEVEMMIQIALLCTQSSPEDRPSMSEVV----RMLEGEGLAERWEEW 570



>gb:AB057787_1521711 Oryza sativa OsCR4 gene, complete
            cds.>gb:AC120505_1739753 Oryza sativa chromosome 3 BAC
            OSJNBa0066H15 genomic sequence, complete sequence.
          Length = 901

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 62/175 (35%), Positives = 96/175 (54%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  IL+DED +AR+ DFGL+ ++ P D+  T   +   G  GY+ PEY      +
Sbjct: 631  HRDIKSSNILIDEDHNARVADFGLS-ILGPADSG-TPLSELPAGTLGYLDPEYYRLHYLT 688

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TK D YSFGVVLLE+ +G+K +++   E    GN+V+W      +G I  ++D  +    
Sbjct: 689  TKSDVYSFGVVLLEILSGRKAIDMQFEE----GNIVEWAVPLIKAGDISALLDPVLSPPS 744

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE 254
              E + +   +AC CV  R+K+R SM +   AL +  A   +  P  E P++ TE
Sbjct: 745  DLEALKKIAAVACKCVRMRAKDRPSMDKVTTALERALALL-MGSPCIEQPILPTE 798



>gb:AP000382_1819890 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K7M2.
          Length = 458

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 56/157 (35%), Positives = 90/157 (57%), Gaps = 4/157 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  IL+D  F+A++ DFGLA++ +  + H ++ V   +G FGY+APEY+S+   +
Sbjct: 217 HRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVSTRV---MGTFGYLAPEYASSGKLT 273

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW----VNQHSGSGRIKDVIDKSI 431
            K D +SFGVVLLEL TG++P+++         +LVDW    +NQ S  G  + V+DK +
Sbjct: 274 EKSDVFSFGVVLLELITGRRPIDVNNVHA--DNSLVDWARPLLNQVSELGNFEVVVDKKL 331

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
                 E++ + +  A  CV S +  R  M Q    L
Sbjct: 332 NNEYDKEEMARMVACAAACVRSTAPRRPRMDQVARVL 368



>gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,
           complete cds.>gb:AF367265_1791718 Arabidopsis thaliana
           At1g01540/F22L4_6 mRNA, complete cds.
          Length = 479

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 51/146 (34%), Positives = 88/146 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD  ++A++ DFGLA+L+    ++ T+ V   +G FGYVAPEY+ T + +
Sbjct: 278 HRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRV---MGTFGYVAPEYACTGMLN 334

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFG++++E+ TG+ P++ +  +   + NLVDW+    G+ R ++V+D  I    
Sbjct: 335 EKSDIYSFGILIMEIITGRNPVDYSRPQG--ETNLVDWLKSMVGNRRSEEVVDPKIPEPP 392

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSM 341
             + + + L +A  CV   + +R  M
Sbjct: 393 SSKALKRVLLVALRCVDPDANKRPKM 418



>gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding
           ACS1 locus.>gb:AF332429_1787241 Arabidopsis thaliana
           clone C00102 (h) putative protein serine/threonine
           kinase (At1g01540) mRNA, complete cds.
          Length = 472

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 51/146 (34%), Positives = 88/146 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD  ++A++ DFGLA+L+    ++ T+ V   +G FGYVAPEY+ T + +
Sbjct: 278 HRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRV---MGTFGYVAPEYACTGMLN 334

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFG++++E+ TG+ P++ +  +   + NLVDW+    G+ R ++V+D  I    
Sbjct: 335 EKSDIYSFGILIMEIITGRNPVDYSRPQG--ETNLVDWLKSMVGNRRSEEVVDPKIPEPP 392

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSM 341
             + + + L +A  CV   + +R  M
Sbjct: 393 SSKALKRVLLVALRCVDPDANKRPKM 418



>gb:AB073628_1523190 Nicotiana tabacum mRNA for receptor-like
           protein kinase, complete cds.
          Length = 633

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 59/147 (40%), Positives = 80/147 (54%), Gaps = 4/147 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++     +LLD+D +ARI DFGLA+  A PDAH         G  GY+APEY  T+  +
Sbjct: 479 HRDLKPANVLLDDDMEARIADFGLAK--AVPDAHTHVTTSNVAGTVGYIAPEYHQTLKFT 536

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKG----NLVDWVNQHSGSGRIKDVIDKSI 431
            K D YSFGVVL  L  G+ P     ++E F+     +LV W+     S   K  ID  +
Sbjct: 537 DKCDIYSFGVVLAVLVIGKLP-----SDEFFQHTPEMSLVKWLRNVMTSEDPKRAIDPKL 591

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKER 350
            G G +EQ++  L+IAC C +   KER
Sbjct: 592 IGSGFEEQMLLVLKIACFCTLENPKER 618



>pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis
           thaliana>gb:AE005172_889202 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F22L4_1677883 Sequence of BAC F22L4 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 497

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 51/146 (34%), Positives = 88/146 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD  ++A++ DFGLA+L+    ++ T+ V   +G FGYVAPEY+ T + +
Sbjct: 303 HRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTRV---MGTFGYVAPEYACTGMLN 359

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFG++++E+ TG+ P++ +  +   + NLVDW+    G+ R ++V+D  I    
Sbjct: 360 EKSDIYSFGILIMEIITGRNPVDYSRPQG--ETNLVDWLKSMVGNRRSEEVVDPKIPEPP 417

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSM 341
             + + + L +A  CV   + +R  M
Sbjct: 418 SSKALKRVLLVALRCVDPDANKRPKM 443



>gb:AY463361_1607685 Oryza sativa (indica cultivar-group)
           benzothiadiazole-induced somatic embryogenesis receptor
           kinase 1 (BISERK1) mRNA, complete cds.
          Length = 624

 Score = 96.3 bits (238), Expect = 6e-19
 Identities = 57/172 (33%), Positives = 92/172 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 426 HRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 482

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       R++ ++D  +    
Sbjct: 483 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKRLEMLVDPDLQSNY 542

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI 263
            D ++   +++A  C      ER  M +      +M    G++E ++E+  I
Sbjct: 543 IDVEVESLIQVALLCTQGSPTERPKMAEVV----RMLEGDGLAERWEEWQKI 590



>gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSERK1
           mRNA for SERK-family receptor-like protein kinase,
           complete cds.>gb:AP005164_1848543 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0054L03.
          Length = 624

 Score = 96.3 bits (238), Expect = 6e-19
 Identities = 57/172 (33%), Positives = 92/172 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 426 HRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 482

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       R++ ++D  +    
Sbjct: 483 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKRLEMLVDPDLQSNY 542

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI 263
            D ++   +++A  C      ER  M +      +M    G++E ++E+  I
Sbjct: 543 IDVEVESLIQVALLCTQGSPTERPKMAEVV----RMLEGDGLAERWEEWQKI 590



>gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRNA,
           complete cds.>gb:BT002217_1635820 Arabidopsis thaliana
           At1g71830/F14O23_24 mRNA, complete cds.
          Length = 625

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 55/169 (32%), Positives = 92/169 (54%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 427 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 483

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 484 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNY 543

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C      ER  M +      +M    G++E +DE+
Sbjct: 544 EERELEQVIQVALLCTQGSPMERPKMSEVV----RMLEGDGLAEKWDEW 588



>gb:AC073556_1541104 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 422

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 58/157 (36%), Positives = 88/157 (56%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILLD +F++++ DFGLA+  A P   +T      +G  GY APEY +T   S
Sbjct: 218 YRDFKASNILLDSEFNSKLSDFGLAK--AGPTGDKTHVSTQVMGTHGYAAPEYIATGRLS 275

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSG-SGRIKDVIDKSICGR 422
            K D YSFGVVLLEL TG++ L+   ++ G + NLVDW   H G   R+  V+D  + G+
Sbjct: 276 AKADVYSFGVVLLELLTGRRALD--KSKPGIEQNLVDWAKPHLGDKRRLYRVMDTKLGGQ 333

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              +       IA  C+ + +K R  M +  E L ++
Sbjct: 334 YPKKGAHAIANIALQCICNDAKMRPRMSEVLEELEQL 370



>gb:AB178084_1528917 Daucus carota LRR-S/T-RLK mRNA for putative
            leucine rich repeat-type serine/threonine receptor-like
            kinase, complete cds.
          Length = 1212

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 55/149 (36%), Positives = 87/149 (58%), Gaps = 1/149 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDE+F+AR+ DFG+ARL+   D H +  V    G  GYV PEY  +   +
Sbjct: 1037 HRDMKSSNVLLDENFEARVSDFGMARLVNAFDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1094

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKS-ICGR 422
             KGD YS+GVVLLEL +G++P++   A+ G   NLV W  Q     R  +++D   +  +
Sbjct: 1095 AKGDVYSYGVVLLELLSGKRPID--PAQFGDDNNLVGWAKQLHKEKRDLEILDSELLLHQ 1152

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQ 335
              + ++  +L+IA  C+  ++  R +M Q
Sbjct: 1153 SSEAELYHYLQIAFECLDEKAYRRPTMIQ 1181



>gb:A67827_1450282 Sequence 32 from Patent
           WO9743427.>gb:CQ768543_1451789 Sequence 38 from Patent
           WO2004007712.>gb:AX120037_1461704 Sequence 20 from
           Patent WO0129240.>gb:AX138071_1462207 Sequence 17 from
           Patent EP1094113.
          Length = 625

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 55/169 (32%), Positives = 92/169 (54%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 427 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 483

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 484 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNY 543

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C      ER  M +      +M    G++E +DE+
Sbjct: 544 EERELEQVIQVALLCTQGSPMERPKMSEVV----RMLEGDGLAEKWDEW 588



>pir|H96740|H96740 hypothetical protein F14O23.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_894730 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F14O23_1677509 Arabidopsis thaliana
           chromosome 1 BAC F14O23 sequence, complete sequence.
          Length = 601

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 55/169 (32%), Positives = 92/169 (54%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 403 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 459

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 460 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNY 519

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C      ER  M +      +M    G++E +DE+
Sbjct: 520 EERELEQVIQVALLCTQGSPMERPKMSEVV----RMLEGDGLAEKWDEW 564



>pir|B84431|B84431 probable receptor protein kinase [imported] -
            Arabidopsis thaliana>gb:AC006532_1534365 Arabidopsis
            thaliana chromosome 2 clone F14H20 map CIC11A04, complete
            sequence.>gb:AY074313_1567471 Arabidopsis thaliana
            putative receptor protein kinase (At2g01950) mRNA,
            complete cds.
          Length = 1143

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 59/181 (32%), Positives = 93/181 (51%), Gaps = 15/181 (8%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLD+D +AR+ DFG+ARL++  D H +  V    G  GYV PEY  +   +
Sbjct: 964  HRDMKSSNVLLDQDMEARVSDFGMARLISALDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1021

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             KGD YS GVV+LE+ +G++P   T  EE    NLV W    +  G+  +VID+ +   G
Sbjct: 1022 AKGDVYSIGVVMLEILSGKRP---TDKEEFGDTNLVGWSKMKAREGKHMEVIDEDLLKEG 1078

Query: 418  HDE---------------QIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEP 284
              E               +++++L IA  CV     +R +M Q   +L ++   +  S  
Sbjct: 1079 SSESLNEKEGFEGGVIVKEMLRYLEIALRCVDDFPSKRPNMLQVVASLRELRGSENNSHS 1138

Query: 283  Y 281
            +
Sbjct: 1139 H 1139



>pir|C96641|C96641 hypothetical protein T25B24.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_893829 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005850_1533094 Arabidopsis thaliana
           chromosome I BAC T25B24 genomic sequence, complete
           sequence.>gb:AY064142_1566023 Arabidopsis thaliana
           At1g61590/T25B24_6 mRNA, complete
           cds.>gb:AY097413_1576408 Arabidopsis thaliana
           At1g61590/T25B24_6 mRNA, complete cds.
          Length = 424

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 57/172 (33%), Positives = 94/172 (54%), Gaps = 1/172 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILLD DF A++ DFGLA++   P+  ++      +G +GY APEY ST   +
Sbjct: 227 YRDFKTSNILLDSDFTAKLSDFGLAKM--GPEGSKSHVTTRVMGTYGYAAPEYVSTGHLT 284

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQH-SGSGRIKDVIDKSICGR 422
           TK D YS+GVVLLEL TG++  E +  +   + N++DW   + + S R++ V+D  + G+
Sbjct: 285 TKSDVYSYGVVLLELLTGRRATEKSRPKN--QQNIIDWSKPYLTSSRRLRCVMDPRLAGQ 342

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL 266
              +       +A  CV    K+R  M    EAL  +   + ++     +PL
Sbjct: 343 YSVKAAKDTALLALQCVSPNPKDRPKMLAVVEALESLIHYKDMAVSSGHWPL 394



>gb:AP005807_1858200 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OSJNBb0018H10.>gb:AP005809_1858233 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBb0039M16.
          Length = 1084

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 55/156 (35%), Positives = 84/156 (53%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD +++A + DFGLARL+   + H T+   G  G FGYVAPEY+ T   S
Sbjct: 924  HRDVKPSNILLDTEYNAYLSDFGLARLLGNSETHATT---GVAGTFGYVAPEYAMTCRVS 980

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YS+GVVL+EL + +K L+ + +  G   N+V W       GR ++     +   G
Sbjct: 981  DKADVYSYGVVLMELISDKKALDPSFSPYGNGFNIVAWACMLLRQGRAREFFIDGLWDVG 1040

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              + +V+ L +A  C V     R +M Q  + L ++
Sbjct: 1041 PHDDLVETLHLAVMCTVDSLSVRPTMKQVVQRLKQL 1076



>gb:LES303345_1684557 Lycopersicon esculentum lateral suppressor gene,
            ORF1 and ORF2.
          Length = 1192

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 54/149 (36%), Positives = 86/149 (57%), Gaps = 1/149 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LLDE+F+AR+ DFG+ARL+   D H +  V    G  GYV PEY  +   +
Sbjct: 1013 HRDMKSSNVLLDENFEARVSDFGMARLVNALDTHLS--VSTLAGTPGYVPPEYYQSFRCT 1070

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID-KSICGR 422
             KGD YS+GV+LLEL +G++P++      G   NLV W  Q     +  +++D + I   
Sbjct: 1071 AKGDVYSYGVILLELLSGKRPIDPRVF--GDDNNLVGWAKQLHNDKQSHEILDPELITNL 1128

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQ 335
              D ++  +L++A  C+  +S +R +M Q
Sbjct: 1129 SGDAELYHYLKVAFECLDEKSYKRPTMIQ 1157



>gb:AE016959_1023261 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068923_1540502
           Oryza sativa chromosome 10 BAC OSJNBa0017E08 genomic
           sequence, complete sequence.>gb:AE017109_1753080 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           63 of 77 of the complete sequence.
          Length = 520

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 52/146 (35%), Positives = 89/146 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL+DE+F+ ++ DFGLA+++    +H T+ V   +G FGYVAPEY++T + +
Sbjct: 313 HRDIKSSNILIDEEFNGKLSDFGLAKMLGAGKSHITTRV---MGTFGYVAPEYANTGLLN 369

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV+LLE  TG+ P++        + +LV+W+    G+ R ++V+D  +  + 
Sbjct: 370 EKSDVYSFGVLLLEAVTGRDPVDY--GRPANEVHLVEWLKMMVGTRRSEEVVDPDMEVKP 427

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSM 341
               + + L +A  CV   S++R +M
Sbjct: 428 TIRALKRALLVALRCVDPDSEKRPTM 453



>sp|O24585|CRI4_MAIZE Putative receptor protein kinase CRINKLY4
            precursor (EC 2.7.1.-).>pir|T04108|T04108 receptor kinase
            homolog CRINKLY4 - maize>gb:ZMU67422_1732215 Zea mays
            CRINKLY4 precursor (cr4) mRNA, complete cds.
          Length = 901

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 62/175 (35%), Positives = 94/175 (53%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  IL+DED +AR+ DFGL+ ++ P D+  T   +   G  GY+ PEY      +
Sbjct: 632  HRDIKSSNILIDEDHNARVADFGLS-ILGPADSG-TPLSELPAGTLGYLDPEYYRLHYLT 689

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TK D YSFGVVLLE+ +G+K +++   E    GN+V+W      +G I  ++D  +    
Sbjct: 690  TKSDVYSFGVVLLEILSGRKAIDMQFEE----GNIVEWAVPLIKAGDIFAILDPVLSPPS 745

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE 254
              E + +   +AC CV  R K+R SM +   AL    A   +  P  E P++ TE
Sbjct: 746  DLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALL-MGSPCIEQPILPTE 799



>gb:AC120509_1739833 Oryza sativa chromosome 3 BAC OSJNBb0081K01
            genomic sequence, complete sequence.
          Length = 1049

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 54/156 (34%), Positives = 82/156 (52%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD +++A + DFGLARL+   + H T+   G  G FGYVAPEY+ T   S
Sbjct: 892  HRDVKPSNILLDNEYNAYLSDFGLARLLGNSETHATT---GVAGTFGYVAPEYAMTCRVS 948

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YS+GVVLLEL + +K L+ + +  G   N+V W       GR ++   + +    
Sbjct: 949  DKADVYSYGVVLLELISDKKALDPSFSPYGNGFNIVAWACMLLQKGRAREFFIEGLWDVA 1008

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              + +V+ L +   C V     R +M Q    L ++
Sbjct: 1009 PHDDLVEILHLGIKCTVDSLSSRPTMKQVVRRLKEL 1044



>gb:AP003768_1833267 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0439E07.
          Length = 1066

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 63/184 (34%), Positives = 90/184 (48%), Gaps = 8/184 (4%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLD +F A++ DFGLAR++A     +T  V    G FGY+APE   T    
Sbjct: 863  HRDVKTSNILLDSEFRAKVADFGLARMLAQAGTPDT--VSAVAGSFGYMAPECGYTRKVD 920

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
             K D YSFGVVLLEL TG+        + G  G+L DW   H  SG  I D  D+ I   
Sbjct: 921  EKVDVYSFGVVLLELTTGK-----AANDGGEHGSLADWARHHYQSGESIPDATDQCIRYA 975

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ-------QGISEPYDEFPLI 263
            G+ ++I    R+   C  +    R +M    + L K + Q       +   E Y+  PL+
Sbjct: 976  GYSDEIEVVFRLGVMCTGATPASRPTMKDVLQILVKCSEQTHQKCKAESGQEEYEVAPLL 1035

Query: 262  FTEQ 251
              ++
Sbjct: 1036 LPQR 1039



>gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA,
           complete cds.>gb:BT009694_1640155 Arabidopsis thaliana
           At4g02010/T10M13_2 gene, complete cds.
          Length = 725

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 53/154 (34%), Positives = 88/154 (57%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++F +  ILL+ +F+A++ DFGLA+    P+          +G FGYVAPEY+ T    
Sbjct: 506 HRDFKASNILLENNFNAKVADFGLAK--QAPEGRGNHLSTRVMGTFGYVAPEYAMTGHLL 563

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQ-HSGSGRIKDVIDKSICGR 422
            K D YS+GVVLLEL TG+KP+++  ++   + NLV W         R+++++D  + G+
Sbjct: 564 VKSDVYSYGVVLLELLTGRKPVDM--SQPSGQENLVTWTRPVLRDKDRLEELVDSRLEGK 621

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
              E  ++   IA  CV   + +R +M +  ++L
Sbjct: 622 YPKEDFIRVCTIAAACVAPEASQRPTMGEVVQSL 655



>pir|T01502|T01502 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T10M13.2 - Arabidopsis
           thaliana>gb:ATAF001308_1543828 Arabidopsis thaliana BAC
           T10M13 from chromosome IV, from 10.8 cM to 11.6 cM,
           complete sequence.>gb:ATCHRIV5_1545724 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 5.
          Length = 707

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 53/154 (34%), Positives = 88/154 (57%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++F +  ILL+ +F+A++ DFGLA+    P+          +G FGYVAPEY+ T    
Sbjct: 488 HRDFKASNILLENNFNAKVADFGLAK--QAPEGRGNHLSTRVMGTFGYVAPEYAMTGHLL 545

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQ-HSGSGRIKDVIDKSICGR 422
            K D YS+GVVLLEL TG+KP+++  ++   + NLV W         R+++++D  + G+
Sbjct: 546 VKSDVYSYGVVLLELLTGRKPVDM--SQPSGQENLVTWTRPVLRDKDRLEELVDSRLEGK 603

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
              E  ++   IA  CV   + +R +M +  ++L
Sbjct: 604 YPKEDFIRVCTIAAACVAPEASQRPTMGEVVQSL 637



>gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic
           embryogenesis receptor kinase 1, complete cds.
          Length = 621

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 54/169 (31%), Positives = 92/169 (54%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 423 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 479

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 480 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQNNY 539

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C      +R  M +      +M    G++E +DE+
Sbjct: 540 VEAEVEQLIQVALLCTQGSPMDRPKMSEVV----RMLEGDGLAERWDEW 584



>pir|T49152|T49152 serine/threonine-specific protein kinase-like
           protein - Arabidopsis thaliana>gb:ATT20N10_1555052
           Arabidopsis thaliana DNA chromosome 3, BAC clone T20N10.
          Length = 386

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 59/155 (38%), Positives = 94/155 (60%), Gaps = 2/155 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPP-DAHETSFVKGDLGEFGYVAPEYSSTMIP 602
           H++F S  ILLD +F+A++ DFGLA++ +     H ++ V   LG  GYVAPEY+ T   
Sbjct: 200 HRDFKSSNILLDRNFNAKVSDFGLAKVGSDKAGGHVSTRV---LGTQGYVAPEYALTGHL 256

Query: 601 STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW-VNQHSGSGRIKDVIDKSICG 425
           +TK D YS+GVVLLEL TG+ P+++  A    +G LV W + Q +   ++ D++D ++ G
Sbjct: 257 TTKSDVYSYGVVLLELLTGRVPVDMKRATG--EGVLVSWALPQLADRDKVVDIMDPTLEG 314

Query: 424 RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           +   +++VQ   IA  CV + +  R  M    ++L
Sbjct: 315 QYSTKEVVQVAAIAAMCVQAEADYRPLMADVVQSL 349



>gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete
           sequence.
          Length = 618

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 57/165 (34%), Positives = 90/165 (54%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 421 HRDVKAANILLDESFEAVVGDFGLAKLLDKRDSHVTTAVRGTVG---HIAPEYLSTGQSS 477

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TGQK L+    +   KG ++DWV       R++ ++D+ + G  
Sbjct: 478 EKTDVFGFGILLLELITGQKTLDAGNGQVQ-KGMILDWVRTLHEERRLEVLVDRDLQGCF 536

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEP 284
              ++     +A  C   +   R  M +  + L  +  Q G  EP
Sbjct: 537 DTIELETVTELALQCTRPQPHLRPKMSEVLKVLEGL-VQSGTEEP 580



>gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete
           sequence.
          Length = 618

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 57/165 (34%), Positives = 90/165 (54%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 421 HRDVKAANILLDESFEAVVGDFGLAKLLDKRDSHVTTAVRGTVG---HIAPEYLSTGQSS 477

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TGQK L+    +   KG ++DWV       R++ ++D+ + G  
Sbjct: 478 EKTDVFGFGILLLELITGQKTLDAGNGQVQ-KGMILDWVRTLHEERRLEVLVDRDLQGCF 536

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEP 284
              ++     +A  C   +   R  M +  + L  +  Q G  EP
Sbjct: 537 DTIELETVTELALQCTRPQPHLRPKMSEVLKVLEGL-VQSGTDEP 580



>gb:AE005173_892850 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC016041_1538076 Genomic sequence
            for Arabidopsis thaliana BAC F27J15 from chromosome I,
            complete sequence.
          Length = 896

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 55/156 (35%), Positives = 87/156 (55%), Gaps = 1/156 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLAR-LMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIP 602
            H++  +  ILLDE F A++ DFGL+R  +   ++H ++ V G +G   Y+ PEY  T   
Sbjct: 712  HRDVKTANILLDEHFQAKLADFGLSRSFLNEGESHVSTVVAGTIG---YLDPEYYRTNWL 768

Query: 601  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
            + K D YSFGVVLLE+ T Q+ +E T      K ++ +WVN     G I+ ++D ++ G 
Sbjct: 769  TEKSDVYSFGVVLLEIITNQRVIERTRE----KPHIAEWVNLMITKGDIRKIVDPNLKGD 824

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
             H + + +F+ +A  CV   S  R +M Q    L +
Sbjct: 825  YHSDSVWKFVELAMTCVNDSSATRPTMTQVVTELTE 860



>pir|D96711|D96711 hypothetical protein F24J5.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_894489 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY035076_1559848 Arabidopsis thaliana
           putative protein kinase (At1g68690) mRNA, complete
           cds.>gb:AY113877_1578288 Arabidopsis thaliana putative
           protein kinase (At1g68690) mRNA, complete
           cds.>gb:F24J5_1677998 Arabidopsis thaliana chromosome 1
           BAC F24J5 sequence, complete sequence.
          Length = 708

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 58/163 (35%), Positives = 93/163 (57%), Gaps = 4/163 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILL+++FDAR+ DFGLARL    + H T+ V   +G FGY+APEY+S+   +
Sbjct: 498 HRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRV---IGTFGYMAPEYASSGKLT 554

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW----VNQHSGSGRIKDVIDKSI 431
            K D +SFGVVLLEL TG+KP++  T++     +LV+W    ++    +     + D  +
Sbjct: 555 EKSDVFSFGVVLLELITGRKPVD--TSQPLGDESLVEWARPLISHAIETEEFDSLADPKL 612

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            G   + ++ + +  A  CV   + +R  M Q   A   +AA+
Sbjct: 613 GGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESLAAE 655



>gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03
            genomic sequence, complete sequence.
          Length = 1029

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 62/176 (35%), Positives = 96/176 (54%), Gaps = 7/176 (3%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD DF+A + DFGLA+ +    A E   +    G +GY+APEY+ T+   
Sbjct: 820  HRDVKSNNILLDSDFEAHVADFGLAKFLQDTGASEC--MSAIAGSYGYIAPEYAYTLKVD 877

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR--IKDVIDKSICG 425
             K D YSFGVVLLEL TG+KP+     E G   ++V WV   + S +  +  V+D  +  
Sbjct: 878  EKSDVYSFGVVLLELVTGRKPV----GEFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLST 933

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALN---KMAAQQG--ISEPYDEF 272
                E ++    +A  C+  +S +R +M +  + L+   K+A +QG  +S   D F
Sbjct: 934  VPLHE-VMHVFYVALLCIEEQSVQRPTMREVVQILSELPKLAPRQGEVLSHAVDGF 988



>gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenesis
           receptor-like kinase 2, exons 1-11.
          Length = 626

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 54/169 (31%), Positives = 91/169 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 429 HRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 485

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 486 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQKAY 545

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++   +++A  C      +R  M +      +M    G++E +DE+
Sbjct: 546 EEVEVESLIQVALLCTQGSPLDRPKMSEVV----RMLEGDGLAERWDEW 590



>gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.
          Length = 626

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 54/169 (31%), Positives = 91/169 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 429 HRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 485

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 486 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQKAY 545

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++   +++A  C      +R  M +      +M    G++E +DE+
Sbjct: 546 EEVEVESLIQVALLCTQGSPLDRPKMSEVV----RMLEGDGLAERWDEW 590



>pir|T10659|T10659 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) T5F17.100 - Arabidopsis
            thaliana>gb:ATCHRIV69_1546745 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 69.
          Length = 1013

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 60/157 (38%), Positives = 88/157 (56%), Gaps = 2/157 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD + DARI DFGLAR+MA     +   V    G +GY+APEY  T+   
Sbjct: 829  HRDIKSNNILLDANLDARIADFGLARMMA----RKKETVSMVAGSYGYIAPEYGYTLKVD 884

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSG-RIKDVIDKSICG- 425
             K D YS+GVVLLEL TG++PLE    E G   ++V+WV +       +++ +D ++   
Sbjct: 885  EKIDIYSYGVVLLELLTGRRPLE---PEFGESVDIVEWVRRKIRDNISLEEALDPNVGNC 941

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
            R   E+++  L+IA  C     K+R SM      L +
Sbjct: 942  RYVQEEMLLVLQIALLCTTKLPKDRPSMRDVISMLGE 978



>gb:AC133334_1741357 Oryza sativa chromosome 3 BAC OSJNBa0004L11
           genomic sequence, complete sequence.
          Length = 543

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 51/169 (30%), Positives = 96/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+  + DFGLA+L+   D  +TS      G  G++APEY ST   S
Sbjct: 345 HRDVKAANVLLDEDFEPVVGDFGLAKLV---DVQKTSVTTQVRGTMGHIAPEYLSTGKSS 401

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            + D + +G++LLEL TGQ+ ++ +  EE     L+D V +    G++  ++D+++    
Sbjct: 402 ERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLQREGQLGAIVDRNLSSNY 461

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             +++   ++IA  C  +  ++R SM +      +M   +G++E ++E+
Sbjct: 462 DGQEVEMMIQIALLCTQASPEDRPSMSEVV----RMLEGEGLAERWEEW 506



>gb:AC133334_1741356 Oryza sativa chromosome 3 BAC OSJNBa0004L11
           genomic sequence, complete sequence.
          Length = 605

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 51/169 (30%), Positives = 96/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+  + DFGLA+L+   D  +TS      G  G++APEY ST   S
Sbjct: 407 HRDVKAANVLLDEDFEPVVGDFGLAKLV---DVQKTSVTTQVRGTMGHIAPEYLSTGKSS 463

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            + D + +G++LLEL TGQ+ ++ +  EE     L+D V +    G++  ++D+++    
Sbjct: 464 ERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLQREGQLGAIVDRNLSSNY 523

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             +++   ++IA  C  +  ++R SM +      +M   +G++E ++E+
Sbjct: 524 DGQEVEMMIQIALLCTQASPEDRPSMSEVV----RMLEGEGLAERWEEW 568



>pir|T01711|T01711 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) A_IG002N01.22 - Arabidopsis
           thaliana>gb:ATCHRIV3_1544819 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 3.>gb:IG002N01_1683033
           Arabidopsis thaliana BAC IG002N01.
          Length = 450

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 50/146 (34%), Positives = 88/146 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD  ++A++ DFGLA+L+    ++ T+ V   +G FGYVAPEY+ T + +
Sbjct: 284 HRDIKSSNILLDRQWNAKVSDFGLAKLLFSESSYVTTRV---MGTFGYVAPEYACTGMLT 340

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFG++++E+ TG+ P++ +  +   + NLV+W+    G+ R ++V+D  I    
Sbjct: 341 EKSDIYSFGILIMEIITGRNPVDYSRPQG--EVNLVEWLKTMVGNRRSEEVVDPKIPEPP 398

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSM 341
             + + + L +A  CV   + +R  M
Sbjct: 399 TSKALKRVLLVALRCVDPDANKRPKM 424



>gb:AP003278_1827097 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0518F01.
          Length = 245

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 51/146 (34%), Positives = 88/146 (60%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL+D+DF  ++ DFGL++L+    +H T+ V   +G FGYVAPEY++T   +
Sbjct: 55  HRDIKSSNILIDKDFTGKLSDFGLSKLLRAGKSHITTRV---MGTFGYVAPEYANTGQLN 111

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGV+LLE  TG+ P+      +  + +L++W+   + S R ++V+D ++  + 
Sbjct: 112 EKSDVYSFGVLLLEAVTGRDPVNYGRPTD--EVHLLEWIKLMASSRRAEEVVDPAMEAKP 169

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSM 341
              Q+ + L  A  CV  ++ +R +M
Sbjct: 170 TKRQLRRALVAALKCVDPKADKRPTM 195



>gb:AY162176_1585779 Medicago truncatula somatic embryogenesis
           receptor kinase 1 (SERK1) mRNA, complete
           cds.>gb:AY162177_1585780 Medicago truncatula somatic
           embryogenesis receptor kinase 1 (SERK1) gene, complete
           cds.
          Length = 627

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 54/169 (31%), Positives = 91/169 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+F+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 429 HRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 485

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 486 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLKTNY 545

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++ Q +++A  C      +R  M        +M    G++E +DE+
Sbjct: 546 IEAEVEQLIQVALLCTQGSPMDRPKMSDVV----RMLEGDGLAERWDEW 590



>gb:AE016959_1022408 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092388_1735318
           Oryza sativa chromosome 10 BAC OSJNBa0011L09 genomic
           sequence, complete sequence.>gb:AC122144_1740242 Oryza
           sativa (japonica cultivar-group) chromosome 10 clone
           OSJNAa0011L09, complete sequence.>gb:AE017090_1752227
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 44 of 77 of the complete sequence.
          Length = 389

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 63/168 (37%), Positives = 89/168 (52%), Gaps = 2/168 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILL+ D++A++ DFGLA+    P   ET      +G  GY APEY  T   +
Sbjct: 217 YRDFKTSNILLNSDYEAKLSDFGLAK--DGPQEDETHVSTRVMGTQGYAAPEYIMTGHLT 274

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQ-HSGSGRIKDVIDKSICGR 422
           TK D YS+GVVLLEL TG+K ++        + NLV+W       S R+  VIDKS+ G+
Sbjct: 275 TKSDVYSYGVVLLELLTGRKAVDKKRPPR--EQNLVEWARPCLHDSRRLNRVIDKSLNGQ 332

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK-MAAQQGISEPY 281
                + +   IA  C+    K R  M    EAL   +A   GI EP+
Sbjct: 333 YSTRAVQKAAAIAYQCLSVSPKSRPRMSAVVEALEPLLAMDDGIVEPF 380



>gb:AC104473_1737654 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1626B05, complete sequence.
          Length = 1761

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 59/169 (34%), Positives = 93/169 (55%), Gaps = 5/169 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLDE+FDA++ DFGLA+L    + H ++ V   +G FGY+APEY+S+   +
Sbjct: 1538 HRDIKAANILLDENFDAKVADFGLAKLTTDTNTHVSTRV---MGTFGYLAPEYASSGKLT 1594

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW-----VNQHSGSGRIKDVIDKS 434
             K D +SFGV+LLEL TG++P++ T   E    +LVDW         S  G   ++ID+ 
Sbjct: 1595 DKSDVFSFGVMLLELITGRRPVDPTNYME---DSLVDWARPLLARALSEDGSFDELIDQR 1651

Query: 433  ICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
            +  +    ++ +    A   V   +K R  M Q   AL   A+   ++E
Sbjct: 1652 LENKFDRLEMERMAACAAAAVRHSAKRRPKMKQIVRALEGDASLDDLNE 1700



>gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0036B21, complete sequence.
          Length = 628

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 53/169 (31%), Positives = 91/169 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 431 HRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 487

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 488 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQSGF 547

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++   +++A  C      +R  M +      +M    G++E ++E+
Sbjct: 548 VEHEVESLIQVALLCTQGSPMDRPKMSEVV----RMLEGDGLAERWEEW 592



>gb:BT006463_1639350 Arabidopsis thaliana At1g24030 gene, complete
           cds.
          Length = 375

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 60/155 (38%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++F S  +LLD +++A+I DFGLA+LM  P+  +T      LG FGY  PEY+ST   +
Sbjct: 203 HRDFKSTNVLLDSNYNAKISDFGLAKLM--PEGKDTCVTARVLGTFGYFDPEYTSTGKLT 260

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWV-NQHSGSGRIKDVIDKSICGR 422
            + D Y+FGVVLLEL TG++ ++LT      + NLV  V N  +   +++ VID  +   
Sbjct: 261 LQSDIYAFGVVLLELLTGRRAVDLTQGPN--EQNLVLQVRNILNDRKKLRKVIDVELPRN 318

Query: 421 GHD-EQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
            +  E I  F  +A  C+   SKER S+    + L
Sbjct: 319 SYSMEAITMFADLASRCIRIESKERPSVMDCVKEL 353



>gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somatic
           embryogenesis protein kinase 1 mRNA, complete cds.
          Length = 628

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 53/169 (31%), Positives = 91/169 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+LM   D H T+ V+G +G   ++APEY ST   S
Sbjct: 431 HRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIG---HIAPEYLSTGKSS 487

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+  +L          L+DWV       +++ ++D  +    
Sbjct: 488 EKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQSGF 547

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
            + ++   +++A  C      +R  M +      +M    G++E ++E+
Sbjct: 548 VEHEVESLIQVALLCTQGSPMDRPKMSEVV----RMLEGDGLAERWEEW 592



>gb:AY059844_1564688 Arabidopsis thaliana receptor-like protein
           kinase (At5g65240; MQN23.19) mRNA, complete
           cds.>gb:BT006309_1639201 Arabidopsis thaliana At5g65240
           mRNA, complete cds.
          Length = 276

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 53/169 (31%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APE  ST   S
Sbjct: 78  HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPECISTGKSS 134

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R++D++DK +    
Sbjct: 135 EKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKKLDEDY 194

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C  +  +ER +M +      +M   +G++E ++E+
Sbjct: 195 IKEEVEMMIQVALLCTQAAPEERPAMSEVV----RMLEGEGLAERWEEW 239



>gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MTO12.>gb:AY065430_1566536 Arabidopsis thaliana
           putative serine/threonine protein kinase (At3g17420)
           mRNA, complete cds.>gb:AY096380_1575926 Arabidopsis
           thaliana putative serine/threonine protein kinase
           (At3g17420) mRNA, complete cds.
          Length = 467

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 55/176 (31%), Positives = 98/176 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL+D++FDA++ DFGLA+L+     + ++ V   +G FGYVAPEY+++ + +
Sbjct: 278 HRDIKSSNILMDDNFDAKLSDFGLAKLLGADSNYVSTRV---MGTFGYVAPEYANSGLLN 334

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YS+GVVLLE  TG+ P++    +E  + ++V+W+       + ++V+DK +  + 
Sbjct: 335 EKSDVYSYGVVLLEAITGRYPVDYARPKE--EVHMVEWLKLMVQQKQFEEVVDKELEIKP 392

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ 251
              ++ + L  A  CV   + +R  M Q    L             DE+P++  E+
Sbjct: 393 TTSELKRALLTALRCVDPDADKRPKMSQVARMLES-----------DEYPVMPREE 437



>gb:AB013395_1512172 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQN23.
          Length = 617

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 53/169 (31%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APE  ST   S
Sbjct: 419 HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPECISTGKSS 475

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R++D++DK +    
Sbjct: 476 EKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKKLDEDY 535

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C  +  +ER +M +      +M   +G++E ++E+
Sbjct: 536 IKEEVEMMIQVALLCTQAAPEERPAMSEVV----RMLEGEGLAERWEEW 580



>gb:AX138087_1462209 Sequence 33 from Patent EP1094113.
          Length = 579

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 53/169 (31%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APE  ST   S
Sbjct: 381 HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPECISTGKSS 437

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R++D++DK +    
Sbjct: 438 EKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKKLDEDY 497

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C  +  +ER +M +      +M   +G++E ++E+
Sbjct: 498 IKEEVEMMIQVALLCTQAAPEERPAMSEVV----RMLEGEGLAERWEEW 542



>gb:AX120053_1461706 Sequence 36 from Patent WO0129240.
          Length = 571

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 53/169 (31%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APE  ST   S
Sbjct: 373 HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPECISTGKSS 429

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R++D++DK +    
Sbjct: 430 EKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKKLDEDY 489

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C  +  +ER +M +      +M   +G++E ++E+
Sbjct: 490 IKEEVEMMIQVALLCTQAAPEERPAMSEVV----RMLEGEGLAERWEEW 534



>gb:CQ768547_1451791 Sequence 42 from Patent WO2004007712.
          Length = 618

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 53/169 (31%), Positives = 95/169 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APE  ST   S
Sbjct: 420 HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPECISTGKSS 476

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R++D++DK +    
Sbjct: 477 EKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKKLDEDY 536

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C  +  +ER +M +      +M   +G++E ++E+
Sbjct: 537 IKEEVEMMIQVALLCTQAAPEERPAMSEVV----RMLEGEGLAERWEEW 581



>pir|A86374|A86374 protein T23E23.18 [imported] - Arabidopsis
           thaliana>gb:AE005172_891354 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC002423_1530735 Genomic sequence for
           Arabidopsis thaliana BAC T23E23, complete sequence.
          Length = 307

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 60/155 (38%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++F S  +LLD +++A+I DFGLA+LM  P+  +T      LG FGY  PEY+ST   +
Sbjct: 135 HRDFKSTNVLLDSNYNAKISDFGLAKLM--PEGKDTCVTARVLGTFGYFDPEYTSTGKLT 192

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWV-NQHSGSGRIKDVIDKSICGR 422
            + D Y+FGVVLLEL TG++ ++LT      + NLV  V N  +   +++ VID  +   
Sbjct: 193 LQSDIYAFGVVLLELLTGRRAVDLTQGPN--EQNLVLQVRNILNDRKKLRKVIDVELPRN 250

Query: 421 GHD-EQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
            +  E I  F  +A  C+   SKER S+    + L
Sbjct: 251 SYSMEAITMFADLASRCIRIESKERPSVMDCVKEL 285



>gb:AP002972_1824065 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0638D12.>gb:AP003218_1825440 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBb0021A09.
          Length = 671

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 59/164 (35%), Positives = 91/164 (55%), Gaps = 7/164 (4%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD++F+A++ DFGLARL A  + H T+ V   +G FGY+APEY+ +   +
Sbjct: 464 HRDIKSSNILLDDNFEAQVSDFGLARLAADSNTHVTTRV---MGTFGYLAPEYALSGKLT 520

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-------QHSGSGRIKDVID 440
            K D YSFGVVLLEL TG+KP++   ++     +LV+W         +H   G   D+ D
Sbjct: 521 AKSDVYSFGVVLLELITGRKPVD--ASQPLGDESLVEWARPLLLKAIEHREFG---DLPD 575

Query: 439 KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMA 308
             +  R  + ++   +  A  C+   +  R  M Q   AL+ +A
Sbjct: 576 PRMENRFDENEMYHMIGAAAACIRHSAAMRPRMGQVVRALDSLA 619



>gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439B06.
          Length = 698

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 54/161 (33%), Positives = 92/161 (57%), Gaps = 4/161 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD +F+A++ DFGLARL      H T+ V   +G FGY+APEY+S+   +
Sbjct: 482 HRDIKSSNILLDNNFEAQVADFGLARLAMDAVTHVTTRV---MGTFGYLAPEYASSGKLT 538

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW----VNQHSGSGRIKDVIDKSI 431
            + D +SFGVVLLEL TG+KP++   ++     +LV+W    + +   +G + ++ID  +
Sbjct: 539 ERSDVFSFGVVLLELITGRKPVD--ASKPLGDESLVEWARPLLTEAIETGNVGELIDSRL 596

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMA 308
               ++ ++ + +  A  C+   +  R  M Q    L+ +A
Sbjct: 597 DKNFNEAEMFRMIEAAAACIRHSASRRPRMSQVVRVLDSLA 637



>gb:AF503433_1806732 Sorghum bicolor BAC 170F8, complete sequence.
          Length = 1053

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 54/148 (36%), Positives = 77/148 (52%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD D  A + DFGLARL+   + H T+   G  G FGYVAPEY+ T   S
Sbjct: 776  HRDVKPSNILLDNDHTAYLSDFGLARLLGNSETHATT---GVAGTFGYVAPEYAMTCRVS 832

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YS+GVVLLEL + +K L+ + +  G   N+V W       GR ++   + +    
Sbjct: 833  DKADVYSYGVVLLELISDKKALDPSFSPYGNGFNIVAWACMLLQKGRSREFFIEGLWDVA 892

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQ 335
              + +V+ L +   C V     R +M Q
Sbjct: 893  PHDDLVEILHLGIKCTVESLSSRPTMKQ 920



>gb:CQ768555_1451795 Sequence 50 from Patent
           WO2004007712.>gb:AX120061_1461710 Sequence 44 from
           Patent WO0129240.
          Length = 613

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 52/169 (30%), Positives = 94/169 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APEY ST   S
Sbjct: 415 HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPEYLSTGKSS 471

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            + D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R+  ++DK++ G  
Sbjct: 472 ERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLGAIVDKNLDGEY 531

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C     ++R  M +      +M   +G++E ++E+
Sbjct: 532 IKEEVEMMIQVALLCTQGSPEDRPVMSEVV----RMLEGEGLAERWEEW 576



>gb:AE016959_1022791 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017099_1752610
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 53 of 77 of the complete sequence.
          Length = 445

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 56/165 (33%), Positives = 94/165 (56%), Gaps = 1/165 (0%)
 Frame = -2

Query: 754 ILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPSTKGDAYSF 575
           IL+DE+++A++ DFGLARL++   +H ++ V   +G  GY APEY  T   S+K D +S+
Sbjct: 241 ILIDENWNAKLSDFGLARLVSQDGSHVSTAV---VGTIGYAAPEYIHTGRLSSKNDIWSY 297

Query: 574 GVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHS-GSGRIKDVIDKSICGRGHDEQIVQ 398
           GVVL EL TG++PL+        + NL++WV  +S  S +++ ++D  + G    +   +
Sbjct: 298 GVVLYELLTGRRPLDRNRPRG--EQNLIEWVKPYSTDSKKLEIIMDPRLEGSYSLKSAAK 355

Query: 397 FLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI 263
              +A  C+V  ++ R  M +  E + K+     +  P  E PLI
Sbjct: 356 LASVANKCLVRHARHRPKMSEVLEMVQKIVDSTDLGTP--EHPLI 398



>gb:AE005172_889761 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC022464_1538998 Genomic sequence
            for Arabidopsis thaliana BAC F22G5 from chromosome I,
            complete sequence.
          Length = 945

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 55/155 (35%), Positives = 86/155 (55%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILL E+F+A+I DFGL+R     +  + + V G    FGY+ PEY  T + S
Sbjct: 701  HRDVKSTNILLSEEFEAKIADFGLSRSFLIGNEAQPTVVAGT---FGYLDPEYHKTSLLS 757

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFGVVLLE+ +GQ  ++L+        N+V+W +    +G I+ ++D ++    
Sbjct: 758  MKSDVYSFGVVLLEIISGQDVIDLSRE----NCNIVEWTSFILENGDIESIVDPNLHQDY 813

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
                  + + +A +CV   SKER +M Q    LN+
Sbjct: 814  DTSSAWKVVELAMSCVNRTSKERPNMSQVVHVLNE 848



>pir|T50817|T50817 protein serine/threonine kinase-like protein -
           Arabidopsis thaliana>gb:ATF18D22_1549106 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F18D22 (ESSA
           project).
          Length = 605

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 52/169 (30%), Positives = 94/169 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APEY ST   S
Sbjct: 407 HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPEYLSTGKSS 463

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            + D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R+  ++DK++ G  
Sbjct: 464 ERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLGAIVDKNLDGEY 523

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C     ++R  M +      +M   +G++E ++E+
Sbjct: 524 IKEEVEMMIQVALLCTQGSPEDRPVMSEVV----RMLEGEGLAERWEEW 568



>gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0501G04.
          Length = 1040

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 59/149 (39%), Positives = 84/149 (56%), Gaps = 3/149 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD + +ARI DFGLAR +    A E+  V    G +GY+APEY  TM   
Sbjct: 844  HRDIKSNNILLDANMEARIADFGLARALGR--AGESVSVVA--GSYGYIAPEYGYTMKVD 899

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YS+GVVL+EL TG++ +E   A  G   ++V WV     S  ++D +D  + G G
Sbjct: 900  QKSDTYSYGVVLMELITGRRAVE---AAFGEGQDIVGWVRNKIRSNTVEDHLDGQLVGAG 956

Query: 418  HD---EQIVQFLRIACNCVVSRSKERWSM 341
                 E+++  LRIA  C     ++R SM
Sbjct: 957  CPHVREEMLLVLRIAVLCTARLPRDRPSM 985



>gb:AP000366_1819745 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0437H03.
          Length = 1413

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 58/168 (34%), Positives = 89/168 (52%), Gaps = 8/168 (4%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  +LL E    R+ DFGLAR+++  + H ++ + G LG   Y+ PEY+  M  +
Sbjct: 1232 HRDVKSSNVLLGEGLQPRVSDFGLARIISACETHVSTVLAGTLG---YIPPEYALAMRCT 1288

Query: 598  TKGDAYSFGVVLLELATGQKP----LELTTA---EEGFKGNLVDWVNQHSGSGRIKDVID 440
             KGD YSFGVV+LEL TG+ P     E+T     E G  G+LV WV   +  GR  +V D
Sbjct: 1289 AKGDVYSFGVVMLELLTGRPPTWSSAEVTAEGDDERGGGGSLVGWVRWMAARGRGGEVFD 1348

Query: 439  KSICGRGHD-EQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ 299
              +   G + EQ+ + L +A +C       R +M +    +  + A +
Sbjct: 1349 ACLPVSGAEREQMARVLDVARDCTADEPWRRPTMAEVARRVGAIEAME 1396



>gb:AK117450_1815484 Arabidopsis thaliana At3g58690 mRNA for
           putative serine/threonine-specific protein kinase,
           complete cds, clone: RAFL17-05-P15.
          Length = 271

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 58/155 (37%), Positives = 93/155 (60%), Gaps = 2/155 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPP-DAHETSFVKGDLGEFGYVAPEYSSTMIP 602
           H++F S  ILL  +F+A++ DFGLA++ +     H ++ V   LG  GYVAPEY+ T   
Sbjct: 85  HRDFKSSNILLGRNFNAKVSDFGLAKVGSDKAGGHVSTRV---LGTQGYVAPEYALTGHL 141

Query: 601 STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW-VNQHSGSGRIKDVIDKSICG 425
           +TK D YS+GVVLLEL TG+ P+++  A    +G LV W + Q +   ++ D++D ++ G
Sbjct: 142 TTKSDVYSYGVVLLELLTGRVPVDMKRATG--EGVLVSWALPQLADRDKVVDIMDPTLEG 199

Query: 424 RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           +   +++VQ   IA  CV + +  R  M    ++L
Sbjct: 200 QYSTKEVVQVAAIAAMCVQAEADYRPLMADVVQSL 234



>gb:OSJN00189_1696455 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0095H06, complete sequence.
          Length = 1135

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 55/158 (34%), Positives = 91/158 (57%), Gaps = 2/158 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  ++ IL+  DF+A I DFGLA+L+   D   +S      G +GY+APEY   M  +
Sbjct: 923  HRDIKANNILIGLDFEAYIADFGLAKLVDDGDFGRSSNTVA--GSYGYIAPEYGYMMKIT 980

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YS+GVV+LE+ TG++P++ T  +     ++VDWV +  G+    DV+D ++ GR 
Sbjct: 981  EKSDVYSYGVVVLEVLTGKQPIDPTIPD---GQHVVDWVRRRKGAA---DVLDPALRGRS 1034

Query: 418  HDE--QIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              E  +++Q + +A  CV     +R +M      LN++
Sbjct: 1035 DAEVDEMLQVMGVALLCVAPSPDDRPAMKDVAAMLNEI 1072



>gb:AY093029_1574983 Arabidopsis thaliana protein serine/threonine
           kinase-like protein (At5g10290) mRNA, complete cds.
          Length = 613

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 52/169 (30%), Positives = 94/169 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDEDF+A + DFGLA+L+   D   T+      G  G++APEY ST   S
Sbjct: 415 HRDVKAANVLLDEDFEAVVGDFGLAKLV---DVRRTNVTTQVRGTMGHIAPEYLSTGKSS 471

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            + D + +G++LLEL TGQ+ ++ +  EE     L+D V +     R+  ++DK++ G  
Sbjct: 472 ERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLGAIVDKNLDGEY 531

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEF 272
             E++   +++A  C     ++R  M +      +M   +G++E ++E+
Sbjct: 532 IKEEVGMMIQVALLCTQGSPEDRPVMSEVV----RMLEGEGLAERWEEW 576



>gb:AB188249_1529360 Oryza sativa (japonica cultivar-group) OsSERK2
            gene for SERK family receptor-like protein kinase,
            partial cds.
          Length = 744

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 58/178 (32%), Positives = 94/178 (52%), Gaps = 1/178 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLDEDF+A   DFGLA+ M   D H T+ V G +G   ++APEY ST I S
Sbjct: 546  HRDVKAANILLDEDFEAVFGDFGLAKPMDYKDTHVTTAVHGTIG---HIAPEYLSTGILS 602

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D + +G++LLEL TG++  +L     G     +DWV +     +++ +ID  +  + 
Sbjct: 603  EKTDVFGYGIMLLELITGKRAFDLALLARGEGVMPLDWVKRLIKEEKLEKLIDPDLQNKY 662

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI-FTEQD 248
             D ++   +++A  C      ER  M      L++     G++E + E+  I   +QD
Sbjct: 663  IDAEVESLIQVALLCTQGSPLERPKMAAVVRMLDE---GDGLAERWKEWQKIEIVQQD 717



 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 44/153 (28%), Positives = 77/153 (50%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  I L+EDF+A + +F LA+L    D  + + V+G +G   ++APEY S  I S
Sbjct: 144 HRDIRAVNIFLNEDFEALVGNFCLAKLEDDMDTDDRTAVRGVVG---HIAPEYLSAGILS 200

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D Y +G++LLEL TG++ L            L+DWV +     ++K ++D  +    
Sbjct: 201 EKTDVYGYGIMLLELITGKRALYHDGRARDEDIFLLDWVKRLLKEKKLKMLVDPDLRNNY 260

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
              ++   +++A  C      +R  M +    L
Sbjct: 261 IHVEVKSLIKVALICTQVSPVKRPKMVEVVRML 293



>gb:AB188248_1529359 Oryza sativa (japonica cultivar-group) OsSERK2
           mRNA for SERK family receptor-like protein kinase,
           partial cds.
          Length = 307

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 58/178 (32%), Positives = 94/178 (52%), Gaps = 1/178 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A   DFGLA+ M   D H T+ V G +G   ++APEY ST I S
Sbjct: 109 HRDVKAANILLDEDFEAVFGDFGLAKPMDYKDTHVTTAVHGTIG---HIAPEYLSTGILS 165

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + +G++LLEL TG++  +L     G     +DWV +     +++ +ID  +  + 
Sbjct: 166 EKTDVFGYGIMLLELITGKRAFDLALLARGEGVMPLDWVKRLIKEEKLEKLIDPDLQNKY 225

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI-FTEQD 248
            D ++   +++A  C      ER  M      L++     G++E + E+  I   +QD
Sbjct: 226 IDAEVESLIQVALLCTQGSPLERPKMAAVVRMLDE---GDGLAERWKEWQKIEIVQQD 280



>gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRA19.
          Length = 570

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 53/159 (33%), Positives = 85/159 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 380 HRDVKAANILLDESFEAIVGDFGLAKLLDQRDSHVTTAVRGTIG---HIAPEYLSTGQSS 436

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FGV++LEL TG K ++    +   KG ++ WV       R  +++D+ + G  
Sbjct: 437 EKTDVFGFGVLILELITGHKMIDQGNGQVR-KGMILSWVRTLKAEKRFAEMVDRDLKGEF 495

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            D  + + + +A  C       R  M Q  + L  +  Q
Sbjct: 496 DDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQ 534



>gb:AX138094_1462211 Sequence 40 from Patent EP1094113.
          Length = 541

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 53/159 (33%), Positives = 85/159 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 351 HRDVKAANILLDESFEAIVGDFGLAKLLDQRDSHVTTAVRGTIG---HIAPEYLSTGQSS 407

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FGV++LEL TG K ++    +   KG ++ WV       R  +++D+ + G  
Sbjct: 408 EKTDVFGFGVLILELITGHKMIDQGNGQVR-KGMILSWVRTLKAEKRFAEMVDRDLKGEF 466

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            D  + + + +A  C       R  M Q  + L  +  Q
Sbjct: 467 DDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQ 505



>gb:AX120059_1461709 Sequence 42 from Patent WO0129240.
          Length = 532

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 53/159 (33%), Positives = 85/159 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 342 HRDVKAANILLDESFEAIVGDFGLAKLLDQRDSHVTTAVRGTIG---HIAPEYLSTGQSS 398

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FGV++LEL TG K ++    +   KG ++ WV       R  +++D+ + G  
Sbjct: 399 EKTDVFGFGVLILELITGHKMIDQGNGQVR-KGMILSWVRTLKAEKRFAEMVDRDLKGEF 457

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            D  + + + +A  C       R  M Q  + L  +  Q
Sbjct: 458 DDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQ 496



>gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.
          Length = 603

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 53/159 (33%), Positives = 85/159 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 413 HRDVKAANILLDESFEAIVGDFGLAKLLDQRDSHVTTAVRGTIG---HIAPEYLSTGQSS 469

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FGV++LEL TG K ++    +   KG ++ WV       R  +++D+ + G  
Sbjct: 470 EKTDVFGFGVLILELITGHKMIDQGNGQVR-KGMILSWVRTLKAEKRFAEMVDRDLKGEF 528

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQ 302
            D  + + + +A  C       R  M Q  + L  +  Q
Sbjct: 529 DDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQ 567



>gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:B1364A02.
          Length = 1109

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 68/184 (36%), Positives = 97/184 (52%), Gaps = 5/184 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLDE  +A + DFGLA+L+   D   +  +    G +GY+APEY+ TM  +
Sbjct: 933  HRDIKSNNILLDEMMEAHVGDFGLAKLI---DISNSRTMSAIAGSYGYIAPEYAFTMKVT 989

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKS---IC 428
             K D YSFGVVLLEL TGQ P++    E+G  G+LV+ V + + S      I  S   + 
Sbjct: 990  EKCDIYSFGVVLLELVTGQSPIQ--PLEQG--GDLVNLVRRMTNSSTTNSEIFDSRLNLN 1045

Query: 427  GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL--NKMAAQQGISEPYDEFPLIFTE 254
             R   E+I   L+IA  C      +R SM +    L   + +A    S P  E P+   E
Sbjct: 1046 SRRVLEEISLVLKIALFCTSESPLDRPSMREVISMLMDARASAYDSFSSPASEAPI---E 1102

Query: 253  QDTS 242
             D+S
Sbjct: 1103 DDSS 1106



>gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19
           genomic sequence, complete sequence.
          Length = 420

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 55/165 (33%), Positives = 92/165 (55%), Gaps = 1/165 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILLD +F++++ DFGLA+  A P    T      +G  GY APEY +T   +
Sbjct: 216 YRDFKASNILLDAEFNSKLSDFGLAK--AGPTGDRTHVSTQVMGTQGYAAPEYVATGRLT 273

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            K D YSFGVVLLEL +G++ ++   A+ G + NLVDW   + G  R +  ++D  + G+
Sbjct: 274 AKSDVYSFGVVLLELLSGRRAVD--NAKVGIEQNLVDWAKPYLGDKRKLFRIMDTKLEGQ 331

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
              +       +A  C+ +  K R  M +   AL ++ + +G+S+
Sbjct: 332 YPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQSPKGVSK 376



>gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich
           repeat receptor-like kinase, complete cds.
          Length = 627

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 53/167 (31%), Positives = 92/167 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+L+   ++H ++ V+G +G   ++APEY ST   S
Sbjct: 429 HRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVSTAVRGTVG---HIAPEYLSTGQSS 485

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TGQK ++        KG ++DWV      G++  ++DK +    
Sbjct: 486 EKTDVFGFGILLLELITGQKAVDFGRGANQ-KGVILDWVKTLHQEGKLNLMVDKDLKNNF 544

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
              ++ + +++A  C       R  M +      +M    G++E ++
Sbjct: 545 DRVELEEMVQVALLCTQFNPSHRPKMSEVL----RMLEGDGLAEKWE 587



>gb:AB125885_1528227 Ipomoea batatas SRF6 mRNA for putative
           serine/threonine protein kinase, partial cds.
          Length = 232

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 53/167 (31%), Positives = 92/167 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDEDF+A + DFGLA+L+   ++H ++ V+G +G   ++APEY ST   S
Sbjct: 34  HRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVSTAVRGTVG---HIAPEYLSTGQSS 90

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TGQK ++        KG ++DWV      G++  ++DK +    
Sbjct: 91  EKTDVFGFGILLLELITGQKAVDFGRGANQ-KGVILDWVKTLHQEGKLNLMVDKDLKNNF 149

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
              ++ + +++A  C       R  M +      +M    G++E ++
Sbjct: 150 DRVELEEMVQVALLCTQFNPSHRPKMSEVL----RMLEGDGLAEKWE 192



>gb:AE016959_1022495 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021893_1538815
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0060A14, from chromosome 10, complete
           sequence.>gb:AC090487_1734358 Genomic Sequence for Oryza
           sativa, Nipponbare strain, clone OSJNBb0044I14, from
           Chromosome 10, complete sequence.>gb:AE017092_1752314
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 46 of 77 of the complete sequence.
          Length = 428

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 57/157 (36%), Positives = 86/157 (54%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILLD +F+A++ DFGLA+  A P    T      +G  GY APEY +T   S
Sbjct: 216 YRDFKASNILLDSEFNAKLSDFGLAK--AGPTGDRTHVSTQVMGTRGYAAPEYVATGRLS 273

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSG-SGRIKDVIDKSICGR 422
            K D YSFGVVLLEL TG++ L+   ++   + NLVDW   + G   R+  ++D  + G+
Sbjct: 274 VKADVYSFGVVLLELLTGRRALD--KSKPASEQNLVDWTRPYLGDKRRLYRIMDMKLGGQ 331

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              +       IA  C+ S +K R  M +  E L ++
Sbjct: 332 YPKKGAHAIATIALQCIRSEAKMRPQMSEVLEKLQQL 368



>pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis
            thaliana>gb:AE005172_889864 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC003981_1531272 Genomic sequence for
            Arabidopsis thaliana BAC F22O13 from chromosome I,
            complete sequence.
          Length = 1029

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 3/149 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD + +ARI DFGLA++M     H+   V    G +GY+APEY  T+   
Sbjct: 852  HRDIKSNNILLDSNLEARIADFGLAKMML----HKNETVSMVAGSYGYIAPEYGYTLKID 907

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQH-SGSGRIKDVIDKSICG- 425
             K D YS GVVLLEL TG+ P++  + E+    ++V+W+ +    +  +++VID SI G 
Sbjct: 908  EKSDIYSLGVVLLELVTGKMPID-PSFEDSI--DVVEWIRRKVKKNESLEEVIDASIAGD 964

Query: 424  -RGHDEQIVQFLRIACNCVVSRSKERWSM 341
             +   E+++  LRIA  C     K+R S+
Sbjct: 965  CKHVIEEMLLALRIALLCTAKLPKDRPSI 993



>gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1118_D07.>gb:AP004338_1840410 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0507H12.
          Length = 1023

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 58/173 (33%), Positives = 94/173 (54%), Gaps = 5/173 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD DF+A + DFGLA+ +   D+  +  +    G +GY+APEY+ T+   
Sbjct: 819  HRDVKSNNILLDSDFEAHVADFGLAKFLQ--DSGTSECMSAIAGSYGYIAPEYAYTLKVD 876

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR--IKDVIDKSICG 425
             K D YSFGVVLLEL TG+KP+     E G   ++V WV   + S +  +  ++D  +  
Sbjct: 877  EKSDVYSFGVVLLELITGKKPV----GEFGDGVDIVQWVKTMTDSNKEHVIKILDPRL-S 931

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALN---KMAAQQGISEPYDE 275
                 +++    +A  CV  +S +R +M +  + L+   K  ++QG   P  E
Sbjct: 932  TVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKPTSKQGEEPPSGE 984



>gb:AK117442_1815476 Arabidopsis thaliana At3g02130 mRNA for putative
            protein kinase, complete cds, clone: RAFL17-04-I18.
          Length = 946

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 51/119 (42%), Positives = 67/119 (56%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++     ILLD+D +A + DFGLARL+   + H T+   G  G FGYVAPEY+ T   S
Sbjct: 828  HRDVKPSNILLDDDCNAYLSDFGLARLLGTSETHATT---GVAGTFGYVAPEYAMTCRVS 884

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGR 422
             K D YS+GVVLLEL + +K L+ +    G   N+V W       GR K+     I GR
Sbjct: 885  DKADVYSYGVVLLELLSDKKALDPSFVSYGNGFNIVQWACMLLRQGRAKEFFHSGIVGR 943



>gb:AY484589_1608333 Musa acuminata clone MuH9, genomic sequence.
          Length = 894

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 58/175 (33%), Positives = 94/175 (53%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  IL+DE+ +AR+ DFGL+ L+ P D+  +   +   G  GY+ PEY      +
Sbjct: 627  HRDIKSSNILIDEEHNARVADFGLS-LLGPVDS-SSPLSEPPAGTLGYLDPEYYRLHYLT 684

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            TK D YSFGV+LLE+ +G+K +++   E    GN+V+W      +G I  ++D  +    
Sbjct: 685  TKSDVYSFGVLLLEILSGRKAIDMQFEE----GNIVEWAVPLIKAGDISAILDPVLKPPA 740

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTE 254
              E + +   +A  CV  R K+R SM +    L +  A   +  P +E P++ TE
Sbjct: 741  DLEALKKIAAMASKCVRMRGKDRLSMDKVTTTLERALALL-MGSPCNEQPILPTE 794



>gb:AY062680_1565336 Arabidopsis thaliana Unknown protein (At1g09970;
            F21M12.36) mRNA, complete cds.
          Length = 976

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 2/137 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLM-APPDAHETSFVKGDLGEFGYVAPEYSSTMIP 602
            H++  S  ILLDE    RI DFGLA+++ A     E++ V    G +GY+APEY      
Sbjct: 803  HRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVA--GTYGYIAPEYGYASKV 860

Query: 601  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWV-NQHSGSGRIKDVIDKSICG 425
            + K D YSFGVVL+EL TG+KP+E   AE G   ++V+WV N       + +++DK I G
Sbjct: 861  TEKCDVYSFGVVLMELVTGKKPIE---AEFGESKDIVNWVSNNLKSKESVMEIVDKKI-G 916

Query: 424  RGHDEQIVQFLRIACNC 374
              + E  V+ LRIA  C
Sbjct: 917  EMYREDAVKMLRIAIIC 933



>gb:AP003247_1826197 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0425G02.>gb:AP003260_1826570 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0468B07.
          Length = 860

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 54/153 (35%), Positives = 82/153 (53%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLD++  A+I DFGL+R       H ++ V G LG   Y+ PEY +T   +
Sbjct: 646  HRDVKTPNILLDKNLVAKISDFGLSRAFNAAHTHISTVVAGTLG---YLDPEYHATFQLT 702

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFG+VLLE+ TGQ P+ +         +L +WV Q    G I DV+DK +  + 
Sbjct: 703  VKTDVYSFGIVLLEIVTGQPPVFMDPQTV----HLPNWVRQKIDKGSIHDVVDKKLLDQY 758

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
                +   + +A NC+ + S +R SM +    L
Sbjct: 759  DATHLQTVIDLAMNCLENTSIDRPSMTEVVSVL 791



>gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219
           genomic sequence, complete sequence.
          Length = 420

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 55/165 (33%), Positives = 92/165 (55%), Gaps = 1/165 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILLD +F++++ DFGLA+  A P    T      +G  GY APEY +T   +
Sbjct: 216 YRDFKASNILLDAEFNSKLSDFGLAK--AGPTGDRTHVSTQVMGTQGYAAPEYVATGRLT 273

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            K D YSFGVVLLEL +G++ ++ T  + G + NLVDW   + G  R +  ++D  + G+
Sbjct: 274 AKSDVYSFGVVLLELLSGRRAVDNT--KVGIEQNLVDWAKPYLGDKRKLFRIMDTKLEGQ 331

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
              +       +A  C+ +  K R  M +   AL ++ + +G+S+
Sbjct: 332 YPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQSPKGVSK 376



>gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-like
            kinase 2 (rch2 gene).
          Length = 1120

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 59/162 (36%), Positives = 92/162 (56%), Gaps = 2/162 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  ++ IL+  DF+  I DFGLA+L+   D    S      G +GY+APEY  +M  +
Sbjct: 917  HRDIKANNILIGLDFEPYIADFGLAKLVDEGDIGRCSNTVA--GSYGYIAPEYGYSMKIT 974

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YS+GVV+LE+ TG++P++  T  EG   +LVDWV Q+ GS    +V+D ++  R 
Sbjct: 975  EKSDVYSYGVVVLEVLTGKQPID-PTVPEGI--HLVDWVRQNRGS---LEVLDSTLRSRT 1028

Query: 418  HDE--QIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ 299
              E  +++Q L  A  CV S   ER +M      L ++  ++
Sbjct: 1029 EAEADEMMQVLGTALLCVNSSPDERPTMKDVAAMLKEIKQER 1070



>gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic
           embryogenesis receptor-like kinase 1, exons 1-11, allele
           1.
          Length = 629

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 56/172 (32%), Positives = 92/172 (53%), Gaps = 2/172 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 431 HRDVKAANILLDEGFEAVVGDFGLAKLLDRQDSHVTTAVRGTIG---HIAPEYLSTGQSS 487

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D Y FG++LLEL TG K L      +  KG ++DWV +     ++  ++D+ +    
Sbjct: 488 EKTDVYGFGILLLELITGPKTLS-NGHGQSQKGMILDWVRELKEEKKLDKLVDRDLKDLF 546

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL--NKMAAQQGISEPYDEFP 269
              ++   + +   C ++    R  M +  +AL  N M A+ G+    +  P
Sbjct: 547 DIAELECSVDVIIQCTLTSPILRPKMSEVLQALESNVMLAENGVDLNREALP 598



>gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threonine
            protein kinase, exons 1-2.
          Length = 976

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 58/160 (36%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD DF+A + DFGLA+ +  P A ++  +    G +GY+APEY+ T+   
Sbjct: 809  HRDVKSNNILLDADFEAHVADFGLAKFLYDPGASQS--MSSIAGSYGYIAPEYAYTLKVD 866

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-------QHSGSGRIKDVID 440
             K D YSFGVVLLEL  G+KP+     E G   ++V W+N       Q S    +  V+D
Sbjct: 867  EKSDVYSFGVVLLELIIGRKPV----GEFGDGVDIVGWINKTELELYQPSDKALVSAVVD 922

Query: 439  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
              + G      I  F  IA  CV      R +M +    L
Sbjct: 923  PRLTGYPMASVIYMF-NIAMMCVKEMGPARPTMREVVHML 961



>gb:AY182167_1587875 Elaeis guineensis clone Rlk-OPsc receptor-like
           protein kinase mRNA, partial cds.
          Length = 481

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 60/170 (35%), Positives = 94/170 (55%), Gaps = 5/170 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S+ ILLD DF+A + DFGLA+ +   D+  +  +    G +GY+APEY++  +  
Sbjct: 290 HRDVKSNNILLDSDFEAHVADFGLAKFLQ--DSGTSECISAIAGSYGYIAPEYATLKVDE 347

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR--IKDVIDKSICG 425
            K D YSFGVVLLEL TG+KP+     E G   ++V WV + + + +  I  +ID  +  
Sbjct: 348 -KSDVYSFGVVLLELVTGRKPV----GEFGDGVDIVQWVRKVTDTNKEGILKIIDPRLSS 402

Query: 424 RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM---AAQQGISEP 284
               E +  F  +A  CV  +S ER +M +  + L ++    A+QG   P
Sbjct: 403 VPLHEAMHVFY-VAMLCVEEQSVERPTMREVVQILTELPGTPAKQGEDPP 451



>gb:AY078961_1568114 Arabidopsis thaliana At1g79670/F20B17_27 mRNA,
           complete cds.
          Length = 751

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 54/156 (34%), Positives = 83/156 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE + A++ DFG +R +     H T+ V G    FGY+ PEY  T   +
Sbjct: 544 HRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGT---FGYLDPEYFQTSQFT 600

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVL+EL TG+KP  +   EE     LV   N+     R+ D++D  I    
Sbjct: 601 DKSDVYSFGVVLVELITGEKPFSVMRPEE--NRGLVSHFNEAMKQNRVLDIVDSRIKEGC 658

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
             EQ++   ++A  C+  + K+R +M +    L ++
Sbjct: 659 TLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERI 694



>pir|G96827|G96827 protein F20B17.10 [imported] - Arabidopsis
            thaliana>gb:AE005173_895488 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC010793_1537066 Genomic sequence for
            Arabidopsis thaliana BAC F20B17 from chromosome I,
            complete sequence.
          Length = 1487

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 54/156 (34%), Positives = 83/156 (53%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLDE + A++ DFG +R +     H T+ V G    FGY+ PEY  T   +
Sbjct: 1280 HRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGT---FGYLDPEYFQTSQFT 1336

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFGVVL+EL TG+KP  +   EE     LV   N+     R+ D++D  I    
Sbjct: 1337 DKSDVYSFGVVLVELITGEKPFSVMRPEE--NRGLVSHFNEAMKQNRVLDIVDSRIKEGC 1394

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              EQ++   ++A  C+  + K+R +M +    L ++
Sbjct: 1395 TLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERI 1430



 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 53/167 (31%), Positives = 82/167 (49%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  I+LDE   A++ DFG +R +     H T+ V G +G   Y+ PEY  +   +
Sbjct: 557  HRDIKSTNIMLDEKHRAKVSDFGTSRTVTVDHTHLTTVVSGTVG---YMDPEYFQSSQFT 613

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFGVVL EL TG+K +    ++E     L  +        R+ D+ID  I    
Sbjct: 614  DKSDVYSFGVVLAELITGEKSVSFLRSQE--YRTLATYFTLAMKENRLSDIIDARIRDGC 671

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
               Q+    +IA  C+  + ++R SM Q    L K+ +     +PY+
Sbjct: 672  KLNQVTAAAKIARKCLNMKGRKRPSMRQVSMELEKIRSYSEDMQPYE 718



>gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0452F10.
          Length = 597

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 54/168 (32%), Positives = 91/168 (54%), Gaps = 4/168 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD  F+A++ DFGLA+L +  + H ++ V   +G FGY+APEY+S+   +
Sbjct: 345 HRDIKSANILLDARFEAKVADFGLAKLTSDNNTHVSTRV---MGTFGYLAPEYASSGQLT 401

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN----QHSGSGRIKDVIDKSI 431
            K D +SFGV+LLEL TG++P+    ++     +LVDW      + S  G    ++D  +
Sbjct: 402 EKSDVFSFGVMLLELITGRRPVRSNQSQ--MDDSLVDWARPLMMRASDDGNYDALVDPRL 459

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
               +  ++ + +  A  CV   ++ R  M Q   AL    +   ++E
Sbjct: 460 GQEYNGNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLDDLNE 507



>gb:AF244888_1780445 Glycine max receptor-like protein kinase 1 (RLK1)
            mRNA, complete cds.
          Length = 1008

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 55/158 (34%), Positives = 88/158 (55%), Gaps = 2/158 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD +F+A + DFGLA+ +    A E   +    G +GY+APEY+ T+   
Sbjct: 810  HRDVKSNNILLDSNFEAHVADFGLAKFLQDSGASEC--MSAIAGSYGYIAPEYAYTLKVD 867

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR--IKDVIDKSICG 425
             K D YSFGVVLLEL TG+KP+     E G   ++V WV + + S +  +  V+D  +  
Sbjct: 868  EKSDVYSFGVVLLELVTGRKPV----GEFGDGVDIVQWVRKMTDSNKEGVLKVLDSRLPS 923

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
                E ++    +A  CV  ++ ER +M +  + L ++
Sbjct: 924  VPLHE-VMHVFYVAMLCVEEQAVERPTMREVVQILTEL 960



>gb:AF131222_1770837 Lophopyrum elongatum protein serine/threonine
           kinase (ESI47) mRNA, complete cds.>gb:AF339747_1787776
           Lophopyrum elongatum protein kinase (ESI47) gene,
           complete cds.
          Length = 433

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 57/165 (34%), Positives = 92/165 (55%), Gaps = 1/165 (0%)
 Frame = -2

Query: 754 ILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPSTKGDAYSF 575
           ILLDE+++A++ DFGLARL     +H ++ V   +G  GY APEY  T   S+K D +S+
Sbjct: 230 ILLDENWNAKLSDFGLARLGPQEGSHVSTAV---VGTIGYAAPEYIHTGRLSSKNDIWSY 286

Query: 574 GVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSG-SGRIKDVIDKSICGRGHDEQIVQ 398
           GVVL EL TG++PL+        + NLV+WV  +S  + + + ++D  + G  + +   +
Sbjct: 287 GVVLYELLTGRRPLDRNRPRG--EQNLVEWVKPYSSDTKKFETIMDPRLEGNYNLKSAAR 344

Query: 397 FLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLI 263
              +A  C+V  ++ R  M +  E + K+     +  P  E PLI
Sbjct: 345 IASLANKCLVRHARYRPKMSEVLEMVQKIVDSSDLGTP--ERPLI 387



>gb:OSJN00129_1695385 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNba0093F12, complete sequence.
          Length = 773

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 58/176 (32%), Positives = 91/176 (51%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE+F A+I DFG +R +     H T+ ++G +G   Y+ PEY  T   +
Sbjct: 563  HRDIKSSNILLDENFVAKIADFGASRSVPSDHTHVTTLIQGTIG---YLDPEYFQTSQLT 619

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFGVVL EL T QKP+ +   EE    NL  ++       R+   I+  I    
Sbjct: 620  EKSDVYSFGVVLAELLTRQKPISVGRPEESC--NLAMYIVILLNERRLLQEIEPQILVEA 677

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQ 251
             +EQI    +++  C+  + +ER  M +    L+      G+ E +DE  +I +++
Sbjct: 678  GEEQIYAVAQLSARCLNVKGEERPVMREVASVLH------GLRESFDEEQIIRSDE 727



>gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complete
           cds.>gb:AF370509_1792294 Arabidopsis thaliana protein
           kinase-like protein (MOB24.13) mRNA, complete cds.
          Length = 652

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 53/168 (31%), Positives = 92/168 (54%), Gaps = 4/168 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  IL+D  F+A++ DFGLA++ +  + H ++ V   +G FGY+APEY+++   +
Sbjct: 402 HRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVSTRV---MGTFGYLAPEYAASGKLT 458

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW----VNQHSGSGRIKDVIDKSI 431
            K D +SFGVVLLEL TG++P++          +LVDW    +N+ S  G  + + D  +
Sbjct: 459 EKSDVFSFGVVLLELITGRRPVDANNVY--VDDSLVDWARPLLNRASEEGDFEGLADSKM 516

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
                 E++ + +  A  CV   ++ R  M Q   AL    +   ++E
Sbjct: 517 GNEYDREEMARMVACAAACVRHSARRRPRMSQIVRALEGNVSLSDLNE 564



>gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, complete
           sequence.
          Length = 484

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 54/153 (35%), Positives = 88/153 (57%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL+D+ F+++I DFGLA+L+    +  T+ V   +G FGYVAPEY+++ + +
Sbjct: 290 HRDIKSSNILIDDKFNSKISDFGLAKLLGADKSFITTRV---MGTFGYVAPEYANSGLLN 346

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVLLE  TG+ P++   A    + +LV+W+       R ++V+D ++  + 
Sbjct: 347 EKSDVYSFGVVLLEAITGRYPVDY--ARPPPEVHLVEWLKMMVQQRRSEEVVDPNLETKP 404

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L  A  CV   S++R  M Q    L
Sbjct: 405 STSALKRTLLTALRCVDPMSEKRPRMSQVARML 437



>gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene for
            LRR receptor-like kinase, hypothetical proteins, complete
            and partial cds, clone:BAC259.12D-2.>gb:AB092810_1525115
            Lotus corniculatus var. japonicus HAR1 mRNA for LRR
            receptor-like kinase, complete cds.>gb:LCO580824_1684036
            Lotus corniculatus var. japonicus har1 gene and genes for
            transcription factor homolog BTF3-like protein,
            S-receptor kinase-like protein 1, S-receptor kinase-like
            protein 2, S-receptor kinase-like protein 3 and SAR
            DNA-binding protein-like protein.>gb:LJA495843_1684981
            Lotus japonicus har1 gene for hypernodulation aberrant
            root formation protein, exons 1-2.>gb:LJA495844_1684982
            Lotus japonicus mRNA for hypernodulation aberrant root
            formation protein, (har1 gene).
          Length = 986

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 57/160 (35%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD DF+A + DFGLA+ +  P A ++  +    G +GY+APEY+ T+   
Sbjct: 818  HRDVKSNNILLDADFEAHVADFGLAKFLYDPGASQS--MSSIAGSYGYIAPEYAYTLKVD 875

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-------QHSGSGRIKDVID 440
             K D YSFGVVLLEL  G+KP+     E G   ++V WVN       Q S +  +  V+D
Sbjct: 876  EKSDVYSFGVVLLELIIGRKPV----GEFGDGVDIVGWVNKTMSELSQPSDTALVLAVVD 931

Query: 439  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
              + G      ++    IA  CV      R +M +    L
Sbjct: 932  PRLSGYPL-TSVIHMFNIAMMCVKEMGPARPTMREVVHML 970



>gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MOB24.>gb:AY056788_1563837 Arabidopsis
           thaliana AT3g24550/MOB24_8 mRNA, complete
           cds.>gb:AY059901_1564745 Arabidopsis thaliana protein
           kinase-like protein (MOB24.13) mRNA, complete
           cds.>gb:AY093065_1575019 Arabidopsis thaliana unknown
           protein (At3g24550) mRNA, complete
           cds.>gb:AY128792_1580872 Arabidopsis thaliana protein
           kinase-like protein mRNA, complete
           cds.>gb:BT008400_1639617 Arabidopsis thaliana At3g24550
           gene, complete cds.
          Length = 652

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 53/168 (31%), Positives = 92/168 (54%), Gaps = 4/168 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  IL+D  F+A++ DFGLA++ +  + H ++ V   +G FGY+APEY+++   +
Sbjct: 402 HRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVSTRV---MGTFGYLAPEYAASGKLT 458

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW----VNQHSGSGRIKDVIDKSI 431
            K D +SFGVVLLEL TG++P++          +LVDW    +N+ S  G  + + D  +
Sbjct: 459 EKSDVFSFGVVLLELITGRRPVDANNVY--VDDSLVDWARPLLNRASEEGDFEGLADSKM 516

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
                 E++ + +  A  CV   ++ R  M Q   AL    +   ++E
Sbjct: 517 GNEYDREEMARMVACAAACVRHSARRRPRMSQIVRALEGNVSLSDLNE 564



>gb:AP003282_1827220 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0583G08.
          Length = 628

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 55/182 (30%), Positives = 97/182 (53%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDE F+A + DFGLA+L+   ++H T+ V+G +G   ++APEY ST   S
Sbjct: 429 HRDVKASNVLLDEYFEAIVGDFGLAKLLDHRESHVTTAVRGTVG---HIAPEYLSTGQSS 485

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FGV+L+EL TGQK L+        KG ++DWV +     ++  ++DK +    
Sbjct: 486 EKTDVFGFGVLLVELITGQKALDFGRLANQ-KGGVLDWVKKLHQEKQLSMMVDKDLGSNY 544

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTSS 239
              ++ + +++A  C       R  M +      +M    G++E ++    + T +  SS
Sbjct: 545 DRVELEEMVQVALLCTQYYPSHRPRMSEVI----RMLEGDGLAEKWEASQNVDTPKSVSS 600

Query: 238 PM 233
            +
Sbjct: 601 EL 602



>gb:AP003247_1826195 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0425G02.>gb:AP003260_1826568 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0468B07.
          Length = 898

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 52/153 (33%), Positives = 82/153 (53%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLD++  A+I DFGL+R       H ++   G LG   Y+ PEY +T   +
Sbjct: 688  HRDVKTPNILLDKNLVAKISDFGLSRAFNAAHTHISTVAAGTLG---YLDPEYHATFQLT 744

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFG+VLLE+ TGQ P+ +         +L +WV Q   +G + DV+DK +  + 
Sbjct: 745  VKTDVYSFGIVLLEIVTGQPPVFMDPQTV----HLPNWVRQKIANGSVHDVVDKKLLDQY 800

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
                +   + +A NC+ + S +R SM +    L
Sbjct: 801  DATHLQTVIDLAMNCLENASIDRPSMTEVVSVL 833



>gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0503G09.
          Length = 708

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 55/165 (33%), Positives = 90/165 (54%), Gaps = 1/165 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++F +  ILL++DF A++ DFGLA+    P+          +G FGYVAPEY+ T    
Sbjct: 493 HRDFKASNILLEDDFHAKVSDFGLAK--QAPEGCTNYLSTRVMGTFGYVAPEYAMTGHLL 550

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQ-HSGSGRIKDVIDKSICGR 422
            K D YS+GVVLLEL TG++P+++  ++   + NLV W          ++++ D  + G+
Sbjct: 551 VKSDVYSYGVVLLELLTGRRPVDM--SQPSGQENLVTWARPILRDKDTLEELADPKLGGQ 608

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
              +  V+   IA  CV   + +R +M +  ++L KM  +    E
Sbjct: 609 YPKDDFVRVCTIAAACVSPEASQRPTMGEVVQSL-KMVQRSEFQE 652



>gb:BT011239_1640989 Arabidopsis thaliana At4g34500 gene, complete
           cds.>gb:BT012544_1641614 Arabidopsis thaliana At4g34500
           gene, complete cds.
          Length = 437

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 54/153 (35%), Positives = 86/153 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD+ ++A++ DFGLA+L+    ++ T+ V   +G FGYV+PEY+ST + +
Sbjct: 271 HRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRV---MGTFGYVSPEYASTGMLN 327

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
              D YSFGV+L+E+ TG+ P++ +      + NLVDW      S R ++VID  I    
Sbjct: 328 ECSDVYSFGVLLMEIITGRSPVDYSRPPG--EMNLVDWFKGMVASRRGEEVIDPKIKTSP 385

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L +   C+   S +R  M Q    L
Sbjct: 386 PPRALKRALLVCLRCIDLDSSKRPKMGQIIHML 418



>gb:AB026654_1517312 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MVE11.
          Length = 714

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 57/179 (31%), Positives = 91/179 (50%), Gaps = 15/179 (8%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFG------YVAPEYS 617
           H++  +  ILLDE F+A++ DFGLA+L      H ++ + G  G         Y+APEY+
Sbjct: 459 HRDIKASNILLDESFEAKVADFGLAKLSQDNVTHVSTRIMGTFGISNCESNDRYLAPEYA 518

Query: 616 STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQH---------SGS 464
           S+   + + D +SFGV+LLEL TG++P++LT   E    +LVDWV  H         +  
Sbjct: 519 SSGKLTDRSDVFSFGVMLLELVTGRRPVDLTGEME---DSLVDWVRNHMARPICLNAAQD 575

Query: 463 GRIKDVIDKSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
           G   +++D  +  +    ++ Q +  A   V   ++ R  M Q   AL   A    +SE
Sbjct: 576 GDYSELVDPRLENQYEPHEMAQMVACAAAAVRHSARRRPKMSQIVRALEGDATLDDLSE 634



>pir|T05270|T05270 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T4L20.80 - Arabidopsis
           thaliana>gb:ATCHRIV81_1547411 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 81.>gb:ATT4L20_1556054
           Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20
           (ESSA project).
          Length = 481

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 54/153 (35%), Positives = 86/153 (56%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD+ ++A++ DFGLA+L+    ++ T+ V   +G FGYV+PEY+ST + +
Sbjct: 271 HRDVKSSNILLDKKWNAKVSDFGLAKLLGSETSYVTTRV---MGTFGYVSPEYASTGMLN 327

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
              D YSFGV+L+E+ TG+ P++ +      + NLVDW      S R ++VID  I    
Sbjct: 328 ECSDVYSFGVLLMEIITGRSPVDYSRPPG--EMNLVDWFKGMVASRRGEEVIDPKIKTSP 385

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L +   C+   S +R  M Q    L
Sbjct: 386 PPRALKRALLVCLRCIDLDSSKRPKMGQIIHML 418



>pir|T47694|T47694 probable serine/threonine-specific protein kinase
           - Arabidopsis thaliana>gb:ATT22E16_1555259 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T22E16.
          Length = 684

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 52/155 (33%), Positives = 86/155 (55%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLD + + R+ DFGLA+L         + V   +G FGY+APE + +   +
Sbjct: 470 HRDIKAANVLLDSEMNGRVGDFGLAKLYEHGSDPGATRV---VGTFGYLAPELTKSGKLT 526

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
           T  D Y+FG VLLE+A G++P+E +   E     +VDWV     SG I+DV+D+ + G  
Sbjct: 527 TSTDVYAFGAVLLEVACGRRPIETSALPEELV--MVDWVWSRWQSGDIRDVVDRRLNGEF 584

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
            +E++V  +++   C  +  + R +M Q    L K
Sbjct: 585 DEEEVVMVIKLGLLCSNNSPEVRPTMRQVVMYLEK 619



>gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic
           embryogenesis receptor-like kinase 2, exons 1-11, allele
           1.
          Length = 629

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 56/172 (32%), Positives = 91/172 (52%), Gaps = 2/172 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 431 HRDVKAANILLDESFEAVVGDFGLAKLLDRQDSHVTTAVRGTIG---HIAPEYLSTGQSS 487

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D Y FG++LLEL TG K L      +  KG ++DWV +     ++  ++D+ +    
Sbjct: 488 EKTDVYGFGILLLELITGPKTLS-NGHGQSQKGMILDWVRELKEEKKLDKLVDRDLKDLF 546

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL--NKMAAQQGISEPYDEFP 269
              ++   + +   C ++    R  M +  +AL  N   A+ GI    +  P
Sbjct: 547 DIAELECSVDVIIQCTLTNPILRPKMSEVLQALESNVTLAENGIDLNREALP 598



>gb:AC104473_1737662 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1626B05, complete sequence.
          Length = 467

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 50/153 (32%), Positives = 89/153 (58%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD+ ++ ++ DFG+A+++    ++ T+ V   +G FGYVAPEY+ST + +
Sbjct: 287 HRDIKSSNILLDKKWNPKVSDFGMAKVLGSGSSYVTTRV---MGTFGYVAPEYASTGMLN 343

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
              D YSFGV+L+EL +G++P++ + +    + NLV+W     GS R++ ++D  I    
Sbjct: 344 ESSDIYSFGVLLMELISGKRPVDYSKSVG--EVNLVEWFKGMVGSRRVEQLVDPRIEDPP 401

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + + L +   C+ S + +R  M Q    L
Sbjct: 402 GARALNRVLLVCLRCIDSDAHKRPKMGQIVHML 434



>gb:OSJN00112_1695130 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0103I08, complete sequence.
          Length = 458

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 56/183 (30%), Positives = 97/183 (53%), Gaps = 2/183 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  +LLD++F  ++ DFGLAR    P   +T      +G +GY AP+Y  T   +
Sbjct: 231 YRDFKAANVLLDDEFRPKLSDFGLAR--EGPSEGQTHVSTAVMGTYGYAAPDYVRTGHLT 288

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQH-SGSGRIKDVIDKSICGR 422
           TK D +SFGVVL E+  G++ ++ +  ++  K  L++WV +H +GS R   ++D  + GR
Sbjct: 289 TKSDVWSFGVVLYEILAGRRSIDKSRPKDEQK--LLEWVRRHPAGSPRFGRIMDGRLQGR 346

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGI-SEPYDEFPLIFTEQDT 245
                  +   +A  C+    K+R +M +  E L +      +  E YD+      E+ +
Sbjct: 347 YSVRAAREVAELAAGCLAKHGKDRPAMAEVVERLRRATRHAELDGEVYDD----AGEESS 402

Query: 244 SSP 236
           SSP
Sbjct: 403 SSP 405



>gb:AY091071_1574298 Arabidopsis thaliana putative protein kinase
           (At2g20300) mRNA, complete cds.>gb:AY133858_1581678
           Arabidopsis thaliana clone U19358 putative protein
           kinase (At2g20300) mRNA, complete cds.
          Length = 744

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 52/154 (33%), Positives = 86/154 (55%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++F +  +LL++DF  ++ DFGLAR       H ++ V   +G FGYVAPEY+ T    
Sbjct: 468 HRDFKASNVLLEDDFTPKVSDFGLAREATEGSQHISTRV---MGTFGYVAPEYAMTGHLL 524

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            K D YS+GVVLLEL TG++P+++  ++   + NLV W      +   ++ ++D ++ G 
Sbjct: 525 VKSDVYSYGVVLLELLTGRRPVDM--SQPSGEENLVTWARPLLANREGLEQLVDPALAGT 582

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
            + + + +   IA  CV      R  M +  +AL
Sbjct: 583 YNFDDMAKVAAIASMCVHQEVSHRPFMGEVVQAL 616



>gb:AB016888_1513168 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDH9.>gb:BT011003_1640949 Arabidopsis thaliana
           At5g42440 gene, complete cds.
          Length = 359

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 55/158 (34%), Positives = 86/158 (54%), Gaps = 2/158 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEY-SSTMIP 602
           H++  S  +LLD DF A I DFGLAR +    +H ++ V G +   GY+ PEY       
Sbjct: 204 HRDIKSSNVLLDSDFVAHIADFGLARRIDASRSHVSTQVAGTM---GYMPPEYWEGNTAA 260

Query: 601 STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID-KSICG 425
           + K D YSFGV++LELAT ++P  LT   +  +  L  W        R  +++D   +C 
Sbjct: 261 TVKADVYSFGVLMLELATRRRP-NLTVVVDEKEVGLAQWAVIMVEQNRCYEMLDFGGVC- 318

Query: 424 RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            G ++ + ++ RIAC C+   ++ER +M Q  E L ++
Sbjct: 319 -GSEKGVEEYFRIACLCIKESTRERPTMVQVVELLEEL 355



>gb:AX088876_1461047 Sequence 1 from Patent
           WO0114563.>gb:AX825703_1475974 Sequence 1 from Patent
           WO03072763.>gb:AY028699_1559159 Brassica napus receptor
           protein kinase PERK1 mRNA, complete cds.
          Length = 647

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 55/169 (32%), Positives = 95/169 (56%), Gaps = 5/169 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  IL+D  F+A++ DFGLA++ +  + H ++ V   +G FGY+APEY+++   +
Sbjct: 397 HRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVSTRV---MGTFGYLAPEYAASGKLT 453

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW----VNQHSGSGRIKDVIDKSI 431
            K D +SFGVVLLEL TG++P++          +LVDW    +N+ S  G  + + D  +
Sbjct: 454 EKSDVFSFGVVLLELITGRRPVDANNVY--VDDSLVDWARPLLNRASEQGDFEGLADAKM 511

Query: 430 CGRGHD-EQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
              G+D E++ + +  A  CV   ++ R  M Q   AL    +   ++E
Sbjct: 512 -NNGYDREEMARMVACAAACVRHSARRRPRMSQIVRALEGNVSLSDLNE 559



>pir|T00546|T00546 serine/threonine-specific protein kinase homolog
            F12L6.2 - Arabidopsis thaliana>gb:AC004218_1531520
            Arabidopsis thaliana chromosome 2 clone F12L6 map
            CIC10A06, complete sequence.>gb:AF325084_1786538
            Arabidopsis thaliana putative protein kinase (At2g39360)
            mRNA, complete cds.
          Length = 815

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 50/152 (32%), Positives = 84/152 (55%)
 Frame = -2

Query: 796  STANPSHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYS 617
            ST    H++  S  ILLD++F A++ DFGL++    PD  +T       G FGY+ PEY 
Sbjct: 604  STRAIIHRDVKSANILLDDNFMAKVADFGLSK--TGPDLDQTHVSTAVKGSFGYLDPEYL 661

Query: 616  STMIPSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDK 437
            +    + K D YSFGVV+LE+  G+  ++ +   E  K NL++W  +    G+++D+ID 
Sbjct: 662  TRQQLTEKSDVYSFGVVMLEVVCGRPVIDPSLPRE--KVNLIEWAMKLVKKGKLEDIIDP 719

Query: 436  SICGRGHDEQIVQFLRIACNCVVSRSKERWSM 341
             + G+   E++ ++  +   C+     ER +M
Sbjct: 720  FLVGKVKLEEVKKYCEVTEKCLSQNGIERPAM 751



>pir|T05898|T05898 hypothetical protein F6H11.170 - Arabidopsis
            thaliana>gb:AX250419_1464807 Sequence 25 from Patent
            WO0168863.>gb:AB010075_1510983 Arabidopsis thaliana
            genomic DNA, chromosome 5, P1
            clone:MPA24.>gb:ATF6H11_1550860 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F6H11 (ESSAII
            project).>gb:AY099814_1576839 Arabidopsis thaliana
            receptor protein kinase-like protein (At5g65700) mRNA,
            complete cds.>gb:BT008810_1640006 Arabidopsis thaliana
            At5g65700 gene, complete cds.
          Length = 1003

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 54/158 (34%), Positives = 88/158 (55%), Gaps = 2/158 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD +F+A + DFGLA+ +   D+  +  +    G +GY+APEY+ T+   
Sbjct: 818  HRDVKSNNILLDSNFEAHVADFGLAKFLQ--DSGTSECMSAIAGSYGYIAPEYAYTLKVD 875

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR--IKDVIDKSICG 425
             K D YSFGVVLLEL TG+KP+     E G   ++V WV + + S +  +  V+D  +  
Sbjct: 876  EKSDVYSFGVVLLELVTGRKPV----GEFGDGVDIVQWVRKMTDSNKDSVLKVLDPRLSS 931

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
                E +     +A  CV  ++ ER +M +  + L ++
Sbjct: 932  IPIHE-VTHVFYVAMLCVEEQAVERPTMREVVQILTEI 968



>pir|H86295|H86295 hypothetical protein T24D18.20 [imported] -
            Arabidopsis thaliana>gb:AE005172_890596 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:T24D18_1723861 Arabidopsis thaliana
            chromosome 1 BAC T24D18 sequence, complete sequence.
          Length = 730

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 54/156 (34%), Positives = 82/156 (52%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILLDE + A++ DFG +R +     H T+ V G    FGY+ PEY  +   +
Sbjct: 552  HRDIKTTNILLDEKYRAKVSDFGTSRSVTLDQTHLTTLVAGT---FGYMDPEYFLSSQYT 608

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFGVVL+EL TG+KPL    +EEG    L     +     R+ D+ID  I    
Sbjct: 609  HKSDVYSFGVVLVELITGEKPLSRVRSEEG--RGLATHFLEAMKENRVIDIIDIRIKDES 666

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
              EQ++   ++A  C+  + K R +M +    L ++
Sbjct: 667  KLEQVMAVAKLARKCLNRKGKNRPNMKEVSNELERI 702



>pir|E84587|E84587 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006569_1534470 Arabidopsis thaliana
           chromosome 2 clone F11A3 map mi148, complete sequence.
          Length = 435

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 52/154 (33%), Positives = 86/154 (55%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++F +  +LL++DF  ++ DFGLAR       H ++ V   +G FGYVAPEY+ T    
Sbjct: 159 HRDFKASNVLLEDDFTPKVSDFGLAREATEGSQHISTRV---MGTFGYVAPEYAMTGHLL 215

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            K D YS+GVVLLEL TG++P+++  ++   + NLV W      +   ++ ++D ++ G 
Sbjct: 216 VKSDVYSYGVVLLELLTGRRPVDM--SQPSGEENLVTWARPLLANREGLEQLVDPALAGT 273

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
            + + + +   IA  CV      R  M +  +AL
Sbjct: 274 YNFDDMAKVAAIASMCVHQEVSHRPFMGEVVQAL 307



>gb:AP005637_1855222 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0711A01.
          Length = 192

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 60/156 (38%), Positives = 88/156 (56%), Gaps = 3/156 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPP-DAHETSFVKGDLGEFGYVAPEYSSTMIP 602
           H++F S  ILL E F+A+I DFGLA+LM    D + T+ V   LG FGY  PEY+ T   
Sbjct: 32  HRDFKSSNILLTEHFEAKISDFGLAKLMPQDIDLYATTRV---LGTFGYFDPEYALTGKL 88

Query: 601 STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGS-GRIKDVIDKSICG 425
           + + D Y+FGVVLLEL TG++ ++L+      + NL+  + Q SG   R++ V+D+ +  
Sbjct: 89  TLQSDVYAFGVVLLELLTGRRAIDLSQGTP--EQNLIVRMQQVSGDRKRLRKVVDRDMAR 146

Query: 424 RGH-DEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
             +  E +  F  +A  CV   S  R SM    + L
Sbjct: 147 SSYTPESVSMFAGLAARCVCFESAGRPSMADCVKEL 182



>gb:AP003614_1831401 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0481E08.
          Length = 381

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 56/157 (35%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  +LLD DF  ++ DFGLAR    P   +T      +G  GY AP+Y  T   +
Sbjct: 205 YRDFKAANVLLDADFKPKLSDFGLAR--EGPTEGKTHVSTAVVGTHGYAAPDYIETGHLT 262

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQH-SGSGRIKDVIDKSICGR 422
           TK D +SFGVVL E+ TG++ LE +   E  K  L+ WV +H   S   + ++D  + GR
Sbjct: 263 TKSDVWSFGVVLYEILTGRRSLERSRPAEEQK--LLGWVRRHPPESQSFRSIMDPRLGGR 320

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
                  Q  R+A  C+V   KER +M +  E L ++
Sbjct: 321 YPAAAARQVARLADRCLVKNPKERPAMREVVEELERV 357



>gb:AF244889_1780446 Glycine max receptor-like protein kinase 2 (RLK2)
            mRNA, complete cds.
          Length = 1012

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 60/182 (32%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD + +A + DFGLA+ +   D+  +  +    G +GY+APEY+ T+   
Sbjct: 814  HRDVKSNNILLDSNHEAHVADFGLAKFLQ--DSGTSECMSAIAGSYGYIAPEYAYTLKVD 871

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR--IKDVIDKSICG 425
             K D YSFGVVLLEL TG+KP+     E G   ++V WV + + S +  +  V+D  +  
Sbjct: 872  EKSDVYSFGVVLLELITGRKPV----GEFGDGVDIVQWVRKMTDSNKEGVLKVLDPRLPS 927

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDT 245
                E ++    +A  CV  ++ ER +M +  + L ++    G  E      L  TE   
Sbjct: 928  VPLHE-VMHVFYVAMLCVEEQAVERPTMREVVQILTELPKPPGSKEG----DLTITESSL 982

Query: 244  SS 239
            SS
Sbjct: 983  SS 984



>gb:AC137001_1743353 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0012L23, complete sequence.
          Length = 471

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 51/168 (30%), Positives = 95/168 (56%), Gaps = 4/168 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLD  F++++ DFGLA+  +  + H ++ V   +G FGY+APEY+S+   +
Sbjct: 219 HRDIKASNILLDFKFESKVADFGLAKFTSDNNTHVSTRV---MGTFGYLAPEYASSGKLT 275

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN----QHSGSGRIKDVIDKSI 431
            K D +S+GV+LLEL TG++P++  T++     +LVDW      Q   +G  ++++D  +
Sbjct: 276 EKSDVFSYGVMLLELITGRRPVD--TSQTYMDDSLVDWARPLLMQALENGNYEELVDPRL 333

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
               +  ++ + +  A  CV   ++ R  M Q   AL    + + ++E
Sbjct: 334 GKDFNPNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLEDLNE 381



>gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isolate
           20960 putative receptor protein kinase mRNA, partial
           cds.
          Length = 394

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 51/168 (30%), Positives = 95/168 (56%), Gaps = 4/168 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLD  F++++ DFGLA+  +  + H ++ V   +G FGY+APEY+S+   +
Sbjct: 142 HRDIKASNILLDFKFESKVADFGLAKFTSDNNTHVSTRV---MGTFGYLAPEYASSGKLT 198

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN----QHSGSGRIKDVIDKSI 431
            K D +S+GV+LLEL TG++P++  T++     +LVDW      Q   +G  ++++D  +
Sbjct: 199 EKSDVFSYGVMLLELITGRRPVD--TSQTYMDDSLVDWARPLLMQALENGNYEELVDPRL 256

Query: 430 CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISE 287
               +  ++ + +  A  CV   ++ R  M Q   AL    + + ++E
Sbjct: 257 GKDFNPNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLEDLNE 304



>pir|B86289|B86289 probable serine/threonine-specific protein kinase
           - Arabidopsis thaliana>gb:AE005172_890542 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC013453_1537937 Arabidopsis thaliana
           chromosome I BAC T16N11 genomic sequence, complete
           sequence.
          Length = 656

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 53/136 (38%), Positives = 76/136 (55%), Gaps = 3/136 (2%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD +   R+ DFGLA+L     A  T+ V G LG   Y+APE +S   P+
Sbjct: 483 HRDIKSSNILLDSEMRGRLGDFGLAKLYEHGGAPNTTRVVGTLG---YLAPELASASAPT 539

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVID---KSIC 428
              D YSFGVV+LE+ +G++P+E    E+     LVDWV    G GR+ D  D   +S C
Sbjct: 540 EASDVYSFGVVVLEVVSGRRPIEYAEEEDMV---LVDWVRDLYGGGRVVDAADERVRSEC 596

Query: 427 GRGHDEQIVQFLRIAC 380
               + +++  L +AC
Sbjct: 597 ETMEEVELLLKLGLAC 612



>pir|T46033|T46033 receptor protein kinase-like protein - Arabidopsis
            thaliana>gb:ATT16K5_1554580 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T16K5.>gb:BT005722_1638658
            Arabidopsis thaliana clone RAFL15-39-P09 (R50199)
            putative leucine-rich repeat transmembrane protein kinase
            (At3g49670) mRNA, complete cds.>gb:BT006113_1639007
            Arabidopsis thaliana clone U50199 putative leucine-rich
            repeat transmembrane protein kinase (At3g49670) mRNA,
            complete cds.
          Length = 1002

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 55/158 (34%), Positives = 87/158 (55%), Gaps = 2/158 (1%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD +F+A + DFGLA+ +   D+  +  +    G +GY+APEY+ T+   
Sbjct: 814  HRDVKSNNILLDSNFEAHVADFGLAKFLQ--DSGTSECMSAIAGSYGYIAPEYAYTLKVD 871

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR--IKDVIDKSICG 425
             K D YSFGVVLLEL TG+KP+     E G   ++V WV   + S +  +  VID  +  
Sbjct: 872  EKSDVYSFGVVLLELITGKKPV----GEFGDGVDIVQWVRSMTDSNKDCVLKVIDLRLSS 927

Query: 424  RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
                E +     +A  CV  ++ ER +M +  + L ++
Sbjct: 928  VPVHE-VTHVFYVALLCVEEQAVERPTMREVVQILTEI 964



>gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0003E08.
          Length = 492

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 52/182 (28%), Positives = 99/182 (54%), Gaps = 2/182 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  IL+D++F++++ DFGLA+L+    ++  + V   +G +GYVAPEY+++ + +
Sbjct: 307 HRDIKSSNILIDDEFNSKVSDFGLAKLLNSDSSYINTRV---MGTYGYVAPEYANSGMLN 363

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVLLE  T + P++ +   +  + NLV+W+     S R ++V+D ++  + 
Sbjct: 364 EKSDIYSFGVVLLESVTARDPVDYSKPAD--ETNLVEWLKMMISSKRAEEVVDPNLEIKP 421

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM--AAQQGISEPYDEFPLIFTEQDT 245
               + + + +   CV   + +R  M    + L  +  A +Q    P  +   +  E   
Sbjct: 422 PKRALKRAILVGLKCVDPDADKRPKMSHVVQMLEAVQNAYRQDQKRPSSQMGSVDVESQQ 481

Query: 244 SS 239
           S+
Sbjct: 482 SA 483



>gb:AC104280_1737456 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1430_B02, complete sequence.
          Length = 424

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAP-PDAHETSFVKGDLGEFGYVAPEYSSTMIP 602
           H++F S  ILLD+DF AR+ DFGLA+L +     H ++ V   LG  GYVAPEY+ T   
Sbjct: 256 HRDFKSSNILLDKDFRARVSDFGLAKLGSDRAGGHVSTRV---LGTQGYVAPEYALTGHL 312

Query: 601 STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDW-VNQHSGSGRIKDVIDKSICG 425
           +TK D YS+GVVLLEL TG+ P+++       +G LV+W +   +   ++  ++D ++ G
Sbjct: 313 TTKSDVYSYGVVLLELLTGRVPVDMKRPPG--EGVLVNWALPMLTDREKVVQILDPALEG 370

Query: 424 RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           +   +  VQ   IA  CV   +  R  M    ++L
Sbjct: 371 QYSLKDAVQVAAIAAMCVQQEADYRPLMADVVQSL 405



>gb:OSJN00259_1697523 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0079M09, complete sequence.
          Length = 822

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 56/184 (30%), Positives = 101/184 (54%), Gaps = 3/184 (1%)
 Frame = -2

Query: 781  SHQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIP 602
            +H +     ILLDE F+A++ DFGL++L+   D  ++  V    G  GY+APE+ ++ I 
Sbjct: 630  AHLDIKPQNILLDEKFNAKLADFGLSKLI---DRDQSKVVTVMRGTPGYLAPEWLTSQI- 685

Query: 601  STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICG- 425
            + K D YSFGVVLLE+  G+K ++++  EE  +  L++ + + +    + D+IDK     
Sbjct: 686  TEKVDVYSFGVVLLEIICGRKNIDISQPEESVQ--LINLLREKAKDNELNDIIDKKSTDM 743

Query: 424  -RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL-NKMAAQQGISEPYDEFPLIFTEQ 251
               H E++++ L++A  C+ + S  R SM    + L   ++ +  +   +     + + Q
Sbjct: 744  VSHHQEEVIKMLKLAMWCLQNESSRRPSMSMVVKVLEGAVSVENCLDYSFVNANSVISTQ 803

Query: 250  DTSS 239
            D SS
Sbjct: 804  DNSS 807



>gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like
            kinase, partial cds.
          Length = 1001

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 58/162 (35%), Positives = 84/162 (51%), Gaps = 7/162 (4%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD D +A + DFGLA+ +  P A ++  +    G +GY+APEY+ T+   
Sbjct: 833  HRDVKSNNILLDGDLEAHVADFGLAKFLYDPGASQS--MSSIAGSYGYIAPEYAYTLKVD 890

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-------QHSGSGRIKDVID 440
             K D YSFGVVLLEL  G+KP+     E G   ++V WVN       Q S +  +  V+D
Sbjct: 891  EKSDVYSFGVVLLELIIGRKPV----GEFGDGVDIVGWVNKTRLELAQPSDAALVLAVVD 946

Query: 439  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
              + G      I  F  IA  CV      R +M +    L++
Sbjct: 947  PRLSGYPLTSVIYMF-NIAMMCVKEMGPARPTMREVVHMLSE 987



>pir|T50850|T50850 receptor protein kinase homolog [imported] -
            soybean>gb:AY166655_1586208 Glycine max nodule
            autoregulation receptor-like protein kinase precursor
            (NARK) gene, complete cds.>gb:AF197947_1776385 Glycine
            max receptor protein kinase-like protein (CLV1B) mRNA,
            complete cds.
          Length = 987

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 58/162 (35%), Positives = 84/162 (51%), Gaps = 7/162 (4%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD D +A + DFGLA+ +  P A ++  +    G +GY+APEY+ T+   
Sbjct: 819  HRDVKSNNILLDGDLEAHVADFGLAKFLYDPGASQS--MSSIAGSYGYIAPEYAYTLKVD 876

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-------QHSGSGRIKDVID 440
             K D YSFGVVLLEL  G+KP+     E G   ++V WVN       Q S +  +  V+D
Sbjct: 877  EKSDVYSFGVVLLELIIGRKPV----GEFGDGVDIVGWVNKTRLELAQPSDAALVLAVVD 932

Query: 439  KSICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNK 314
              + G      I  F  IA  CV      R +M +    L++
Sbjct: 933  PRLSGYPLTSVIYMF-NIAMMCVKEMGPARPTMREVVHMLSE 973



>pir|A86327|A86327 protein F18O14.11 [imported] - Arabidopsis
            thaliana>gb:AE005172_890898 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC025808_1539558 Genomic sequence for
            Arabidopsis thaliana BAC F18O14 from chromosome I,
            complete sequence.
          Length = 804

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 53/160 (33%), Positives = 83/160 (51%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILLDE +  ++ DFG +R +     H T+ + G +G   YV PEY  +   +
Sbjct: 574  HRDIKSTNILLDEKYRTKVSDFGTSRSVTIDHTHWTTVISGTVG---YVDPEYYGSSQYT 630

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFGVVL+EL TG+KP+   +  +  +G L D         R  +++D  I    
Sbjct: 631  DKSDVYSFGVVLVELITGEKPVITVSNSQEIRG-LADHFRVAMKENRFFEIMDARIRDGC 689

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQ 299
              EQ++    +A  C+ S+ K+R  M + +  L K+ A Q
Sbjct: 690  KPEQVMAVANLARRCLNSKGKKRPCMRKVFTDLEKILASQ 729



>pir|C84813|C84813 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC005770_1533012 Arabidopsis thaliana
           chromosome 2 clone T7F6 map CIC10A06, complete sequence.
          Length = 419

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 53/165 (32%), Positives = 89/165 (53%), Gaps = 1/165 (0%)
 Frame = -2

Query: 775 QNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPST 596
           ++F S  ILLDE+++A++ DFGLAR M P D    + V   +G  GY APEY  T   + 
Sbjct: 209 RDFKSSNILLDENWNAKLSDFGLAR-MGPSDG--ITHVSTVVGTIGYAAPEYIQTGHLTA 265

Query: 595 KGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQH-SGSGRIKDVIDKSICGRG 419
           K D +S+G+ L EL TG++P +        + N+++W+  H S   + K +ID  + G  
Sbjct: 266 KSDVWSYGIFLYELITGRRPFDRNRPRN--EQNILEWIRPHLSDIKKFKMIIDPRLEGNY 323

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEP 284
           + +  ++   +A  C++ ++K R +M Q  E L ++        P
Sbjct: 324 YLKSALKLAAVANRCLMVKAKARPTMSQVSEMLERIVETSSDGAP 368



>gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0038C05.>gb:AP005813_1858325 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0676F10.
          Length = 640

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 48/136 (35%), Positives = 84/136 (61%), Gaps = 1/136 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  +LLDE  +A + DFGLA+L+   ++H T+ V+G +G   ++APEY ST   S
Sbjct: 425 HRDVKAANVLLDEACEAVVGDFGLAKLLDHRESHVTTAVRGTVG---HIAPEYLSTGQSS 481

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            + D + FG++LLEL TGQ  LE   +    KG ++DWV +     +++ ++DK + G G
Sbjct: 482 DRTDVFGFGILLLELVTGQTALEFGKS-SNHKGAMLDWVKKMQSEKKVEVLVDKGL-GGG 539

Query: 418 HDE-QIVQFLRIACNC 374
           +D  ++ + +++A  C
Sbjct: 540 YDRVEVEEMVQVALLC 555



>gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein
            kinase (upk gene).
          Length = 1145

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 57/151 (37%), Positives = 87/151 (57%), Gaps = 5/151 (3%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  ++ ILL   ++  + DFGLA+L+   D + +S      G +GY+APEY  TM  +
Sbjct: 924  HRDVKANNILLGSQYEPYLADFGLAKLVDSADFNRSSTTVA--GSYGYIAPEYGYTMKIT 981

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKD---VIDKSIC 428
             K D YSFGVVLLE+ TG++P++  T  EG   +LV+W      S ++ D   VID  + 
Sbjct: 982  QKIDVYSFGVVLLEVVTGKQPID-PTIPEGV--HLVEWARDAVQSNKLADSAEVIDPRLQ 1038

Query: 427  GRGHD--EQIVQFLRIACNCVVSRSKERWSM 341
            GR     ++++Q L +A  CV S   ER +M
Sbjct: 1039 GRPDTQIQEMLQVLGVAFLCVNSNPDERPTM 1069



>gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complete
            cds.>gb:BT002287_1635890 Arabidopsis thaliana At5g56885
            mRNA, complete cds.
          Length = 1113

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 58/154 (37%), Positives = 81/154 (52%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++F S  ILL+ DF  ++ DFGLAR  A  D          +G FGYVAPEY+ T    
Sbjct: 847  HRDFKSSNILLENDFTPKVSDFGLAR-NALDDEDNRHISTRVMGTFGYVAPEYAMTGHLL 905

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
             K D YS+GVVLLEL TG+KP+++  ++   + NLV W      S   +  +ID+S+   
Sbjct: 906  VKSDVYSYGVVLLELLTGRKPVDM--SQPPGQENLVSWTRPFLTSAEGLAAIIDQSLGPE 963

Query: 421  GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
               + I +   IA  CV      R  M +  +AL
Sbjct: 964  ISFDSIAKVAAIASMCVQPEVSHRPFMGEVVQAL 997



>gb:ATF8D20_1551119 Arabidopsis thaliana DNA chromosome 4, BAC clone
           F8D20 (ESSAII project).
          Length = 356

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 56/156 (35%), Positives = 87/156 (55%), Gaps = 3/156 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPD--AHETSFVKGDLGEFGYVAPEYSSTMI 605
           +++F +  ILLD ++DA++ DFGLA+L  P D  +H T+ +   +G +GY APEY +T  
Sbjct: 153 YRDFKASNILLDSNYDAKLSDFGLAKL-GPADEKSHVTTRI---MGTYGYAAPEYMATGH 208

Query: 604 PSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-QHSGSGRIKDVIDKSIC 428
              K D ++FGVVLLE+ TG       T     + +LVDW+  + S   R+K ++DK I 
Sbjct: 209 LYVKSDVFAFGVVLLEIMTGL--TAHNTKRPRGQESLVDWLRPELSNKHRVKQIMDKGIK 266

Query: 427 GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           G+   +   +  RI  +C+    K R  M +  E L
Sbjct: 267 GQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVL 302



>gb:AB025639_1516690 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MWL2.
          Length = 433

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 53/170 (31%), Positives = 87/170 (51%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE+  A++ DFG ++L        T+ V+G LG   Y+ PEY +T + +
Sbjct: 231 HRDIKTENILLDENLTAKVADFGASKLKPMDKEQLTTMVQGTLG---YLDPEYYTTWLLN 287

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D YSFGVVL+EL +GQK L     E     +LV +    +   R+ ++ID  +    
Sbjct: 288 EKSDVYSFGVVLMELISGQKALCFERPET--SKHLVSYFVLATKENRLHEIIDDQVLNEE 345

Query: 418 HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFP 269
           +  +I +  R+A  C   + +ER  M +    L  + A+       D++P
Sbjct: 346 NQREIHEAARVAVECTRLKGEERPRMIEVAAELETLRAKTTKHNWLDQYP 395



>gb:AX120057_1461708 Sequence 40 from Patent WO0129240.
          Length = 515

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 52/154 (33%), Positives = 90/154 (58%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 301 HRDVKAANILLDEYFEAVVGDFGLAKLLNHEDSHVTTAVRGTVG---HIAPEYLSTGQSS 357

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TG + LE   +    KG +++WV +     ++++++D+ + G  
Sbjct: 358 EKTDVFGFGILLLELITGMRALEFGKSVSQ-KGAMLEWVRKLHKEMKVEELVDREL-GTT 415

Query: 418 HDE-QIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           +D  ++ + L++A  C       R  M +  + L
Sbjct: 416 YDRIEVGEMLQVALLCTQFLPAHRPKMSEVVQML 449



>gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.
          Length = 627

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 52/154 (33%), Positives = 90/154 (58%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 413 HRDVKAANILLDEYFEAVVGDFGLAKLLNHEDSHVTTAVRGTVG---HIAPEYLSTGQSS 469

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TG + LE   +    KG +++WV +     ++++++D+ + G  
Sbjct: 470 EKTDVFGFGILLLELITGMRALEFGKSVSQ-KGAMLEWVRKLHKEMKVEELVDREL-GTT 527

Query: 418 HDE-QIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           +D  ++ + L++A  C       R  M +  + L
Sbjct: 528 YDRIEVGEMLQVALLCTQFLPAHRPKMSEVVQML 561



>pir|T08973|T08973 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) F19B15.210 - Arabidopsis
            thaliana>gb:ATCHRIV70_1546839 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 70.>gb:ATF19B15_1549291
            Arabidopsis thaliana DNA chromosome 4, BAC clone F19B15
            (ESSA project).
          Length = 892

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 55/165 (33%), Positives = 88/165 (53%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  +  ILL+++ +A+I DFGL+++   P+   +  V   +G  GYV PEY +T   +
Sbjct: 681  HRDVKTANILLNDNLEAKIADFGLSKVF--PEDDLSHVVTAVMGTPGYVDPEYYNTFKLN 738

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
             K D YSFG+VLLEL TG++ +  T  ++G K N+V +V      G I  V+D  + G  
Sbjct: 739  EKSDVYSFGIVLLELITGKRSIMKT--DDGEKMNVVHYVEPFLKMGDIDGVVDPRLHGDF 796

Query: 418  HDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEP 284
                  +F+ +A +CV  R   R +  Q    L +  A +   EP
Sbjct: 797  SSNSAWKFVEVAMSCVRDRGTNRPNTNQIVSDLKQCLAAELAREP 841



>pir|G84630|G84630 probable LRR receptor protein kinase [imported] -
           Arabidopsis thaliana>gb:AC005170_1532295 Arabidopsis
           thaliana chromosome 2 clone T29E15 map CIC06C07,
           complete sequence.
          Length = 607

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 52/154 (33%), Positives = 90/154 (58%), Gaps = 1/154 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  +  ILLDE F+A + DFGLA+L+   D+H T+ V+G +G   ++APEY ST   S
Sbjct: 393 HRDVKAANILLDEYFEAVVGDFGLAKLLNHEDSHVTTAVRGTVG---HIAPEYLSTGQSS 449

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKDVIDKSICGRG 419
            K D + FG++LLEL TG + LE   +    KG +++WV +     ++++++D+ + G  
Sbjct: 450 EKTDVFGFGILLLELITGMRALEFGKSVSQ-KGAMLEWVRKLHKEMKVEELVDREL-GTT 507

Query: 418 HDE-QIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           +D  ++ + L++A  C       R  M +  + L
Sbjct: 508 YDRIEVGEMLQVALLCTQFLPAHRPKMSEVVQML 541



>pir|T04665|T04665 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F8D20.110 - Arabidopsis thaliana (fragment)
          Length = 356

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 56/156 (35%), Positives = 87/156 (55%), Gaps = 3/156 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPD--AHETSFVKGDLGEFGYVAPEYSSTMI 605
           +++F +  ILLD ++DA++ DFGLA+L  P D  +H T+ +   +G +GY APEY +T  
Sbjct: 153 YRDFKASNILLDSNYDAKLSDFGLAKL-GPADEKSHVTTRI---MGTYGYAAPEYMATGH 208

Query: 604 PSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-QHSGSGRIKDVIDKSIC 428
              K D ++FGVVLLE+ TG       T     + +LVDW+  + S   R+K ++DK I 
Sbjct: 209 LYVKSDVFAFGVVLLEIMTGL--TAHNTKRPRGQESLVDWLRPELSNKHRVKQIMDKGIK 266

Query: 427 GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           G+   +   +  RI  +C+    K R  M +  E L
Sbjct: 267 GQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVL 302



>pir|C85420|C85420 protein kinase-like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV83_1547520 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 83.
          Length = 415

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 56/156 (35%), Positives = 87/156 (55%), Gaps = 3/156 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPD--AHETSFVKGDLGEFGYVAPEYSSTMI 605
           +++F +  ILLD ++DA++ DFGLA+L  P D  +H T+ +   +G +GY APEY +T  
Sbjct: 212 YRDFKASNILLDSNYDAKLSDFGLAKL-GPADEKSHVTTRI---MGTYGYAAPEYMATGH 267

Query: 604 PSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-QHSGSGRIKDVIDKSIC 428
              K D ++FGVVLLE+ TG       T     + +LVDW+  + S   R+K ++DK I 
Sbjct: 268 LYVKSDVFAFGVVLLEIMTGL--TAHNTKRPRGQESLVDWLRPELSNKHRVKQIMDKGIK 325

Query: 427 GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           G+   +   +  RI  +C+    K R  M +  E L
Sbjct: 326 GQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVL 361



>sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx32
           (EC 2.7.1.37).>gb:AY065403_1566514 Arabidopsis thaliana
           putative protein kinase (At4g35600) mRNA, complete
           cds.>gb:AY096501_1576043 Arabidopsis thaliana putative
           protein kinase (At4g35600) mRNA, complete cds.
          Length = 419

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 56/156 (35%), Positives = 87/156 (55%), Gaps = 3/156 (1%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPD--AHETSFVKGDLGEFGYVAPEYSSTMI 605
           +++F +  ILLD ++DA++ DFGLA+L  P D  +H T+ +   +G +GY APEY +T  
Sbjct: 216 YRDFKASNILLDSNYDAKLSDFGLAKL-GPADEKSHVTTRI---MGTYGYAAPEYMATGH 271

Query: 604 PSTKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVN-QHSGSGRIKDVIDKSIC 428
              K D ++FGVVLLE+ TG       T     + +LVDW+  + S   R+K ++DK I 
Sbjct: 272 LYVKSDVFAFGVVLLEIMTGL--TAHNTKRPRGQESLVDWLRPELSNKHRVKQIMDKGIK 329

Query: 427 GRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
           G+   +   +  RI  +C+    K R  M +  E L
Sbjct: 330 GQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVL 365



>gb:AP004685_1843366 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0017G10.
          Length = 414

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 54/157 (34%), Positives = 83/157 (52%), Gaps = 1/157 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILLD +F+A++ DFGLA+    PD   +      +G +GY APEY +T    
Sbjct: 226 YRDFKASNILLDSNFNAKLSDFGLAK--HGPDGGLSHVTTRVMGTYGYAAPEYVATGHLY 283

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            K D Y FGVVLLE+ +G + L+   +    K NLVDW        R +  ++D  + G+
Sbjct: 284 VKSDVYGFGVVLLEMLSGLRALD--PSRPSGKLNLVDWAKPLLADRRKLSQLMDSRLEGQ 341

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKM 311
            H    +Q  ++   C+    K R SM +  EAL K+
Sbjct: 342 YHSRGALQAAQLTLKCLSGDPKSRPSMKEVVEALEKI 378



>gb:AP003282_1827213 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0583G08.
          Length = 1117

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 58/149 (38%), Positives = 83/149 (55%), Gaps = 3/149 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S  ILL E ++A + DFGLAR+    D    S      G +GY+APEY      +
Sbjct: 913  HRDVKSDNILLGERYEACLADFGLARVA---DDGANSSPPPFAGSYGYIAPEYGCMTKIT 969

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            TK D YSFGVVLLE+ TG++P+E   A  G    +V WV +H    R   +VID  + GR
Sbjct: 970  TKSDVYSFGVVLLEIITGRRPIE---AAFGEGQTVVQWVREHLHRKRDPAEVIDSRLQGR 1026

Query: 421  GHD--EQIVQFLRIACNCVVSRSKERWSM 341
                 ++++Q L IA  C  +R ++R +M
Sbjct: 1027 SDTQVQEMLQALGIALLCASTRPEDRPTM 1055



>gb:BT004631_1637665 Arabidopsis thaliana At2g39110 gene, complete
           cds.
          Length = 435

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 54/167 (32%), Positives = 91/167 (54%), Gaps = 3/167 (1%)
 Frame = -2

Query: 775 QNFSSHAILLDEDFDARIMDFGLARLMAPPDA--HETSFVKGDLGEFGYVAPEYSSTMIP 602
           ++F S  ILLDE+++A++ DFGLAR M P D   H ++ V   +G  GY APEY  T   
Sbjct: 224 RDFKSSNILLDENWNAKLSDFGLAR-MGPSDGITHVSTAV---VGTIGYAAPEYIQTGHL 279

Query: 601 STKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQH-SGSGRIKDVIDKSICG 425
           + K D +S+G+ L EL TG++P +        + N+++W+  H S   + K +ID  + G
Sbjct: 280 TAKSDVWSYGIFLYELITGRRPFDRNRPRN--EQNILEWIRPHLSDIKKFKMIIDPRLEG 337

Query: 424 RGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEP 284
             + +  ++   +A  C++ ++K R +M Q  E L ++        P
Sbjct: 338 NYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLERIVETSSDGAP 384



>gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specific
           protein kinase -like (At3g55450) mRNA, complete cds.
          Length = 389

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 60/172 (34%), Positives = 91/172 (52%), Gaps = 1/172 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++  +  ILLD DF+A++ DFGLAR    P   ++      +G FGY APEY ST   +
Sbjct: 195 YRDIKASNILLDSDFNAKLSDFGLAR--DGPMGEQSYVSTRVMGTFGYAAPEYVSTGHLN 252

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            + D YSFGVVLLEL  G++ L+     +  + NLVDW   +  S R +  ++D  +  +
Sbjct: 253 ARSDVYSFGVVLLELLCGRQALDHNRPAK--EQNLVDWARPYLTSRRKVLLIVDTRLNSQ 310

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL 266
              E  V+   IA  C+    K R +M Q   AL ++  Q  + +P +  PL
Sbjct: 311 YKPEGAVRLASIAVQCLSFEPKSRPTMDQVVRALVQL--QDSVVKPANVDPL 360



>gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specific
           protein kinase -like (At3g55450) mRNA, complete cds.
          Length = 389

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 60/172 (34%), Positives = 91/172 (52%), Gaps = 1/172 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++  +  ILLD DF+A++ DFGLAR    P   ++      +G FGY APEY ST   +
Sbjct: 195 YRDIKASNILLDSDFNAKLSDFGLAR--DGPMGEQSYVSTRVMGTFGYAAPEYVSTGHLN 252

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGR-IKDVIDKSICGR 422
            + D YSFGVVLLEL  G++ L+     +  + NLVDW   +  S R +  ++D  +  +
Sbjct: 253 ARSDVYSFGVVLLELLCGRQALDHNRPAK--EQNLVDWARPYLTSRRKVLLIVDTRLNSQ 310

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPL 266
              E  V+   IA  C+    K R +M Q   AL ++  Q  + +P +  PL
Sbjct: 311 YKPEGAVRLASIAVQCLSFEPKSRPTMDQVVRALVQL--QDSVVKPANVDPL 360



>gb:AB120627_1527973 Populus nigra PnLRK1 mRNA for leucine-rich repeat
            receptor-like protein kinase 1, complete cds.
          Length = 856

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 56/157 (35%), Positives = 84/157 (53%), Gaps = 4/157 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++ SS  +LLD +++A + DFG ARL+ P   + TSF     G  GY APE + TM  +
Sbjct: 680  HRDISSSNVLLDSEYEAHVSDFGTARLLMPDSTNWTSFA----GTLGYTAPELAYTMRVN 735

Query: 598  TKGDAYSFGVVLLELATGQKPLELTT--AEEGFKGNLVDWVNQHSGSGRIKDVIDKSI-- 431
             K D YSFGVV +E+  G  P +L +      F  +    +NQH+    +KDVID+ I  
Sbjct: 736  EKCDVYSFGVVTMEVIMGMHPGDLISFLYASAFSSSSCSQINQHA---LLKDVIDQRIPL 792

Query: 430  CGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEAL 320
                  E +V  ++IA  C+++  + R +M Q    L
Sbjct: 793  PENRVAEGVVSIIKIAFACLLANPQSRPTMRQVASEL 829



>gb:AB090881_1524972 Aster tripolium mRNA for serine/threonine
           protein kinase, complete cds.
          Length = 439

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 57/182 (31%), Positives = 94/182 (51%), Gaps = 1/182 (0%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           +++F +  ILLD +++A++ DFGLA+    P+  +T      +G +GY APEY  T   S
Sbjct: 218 YRDFKTSNILLDAEYNAKLSDFGLAK--DGPEGDKTHISTRVMGTYGYAAPEYVMTGHLS 275

Query: 598 TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGS-GRIKDVIDKSICGR 422
           +K D YSFGVVLLE+ TG++ ++        + NLV+W   H G   R   +ID  + G 
Sbjct: 276 SKSDVYSFGVVLLEMLTGRRSMD--KKRPNGEHNLVEWARPHLGERRRFYRLIDPRLEGH 333

Query: 421 GHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYDEFPLIFTEQDTS 242
              +   +  ++A  C+    K R  M +  + L  + A + ++ P      +  E+  S
Sbjct: 334 FSIKGAQKAAQLASRCLSRDPKARPLMSEVVDCLKPLPALKDMAGPSYYLQTVQPERAGS 393

Query: 241 SP 236
           SP
Sbjct: 394 SP 395



>gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MBM17.
          Length = 1102

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 61/172 (35%), Positives = 93/172 (54%), Gaps = 5/172 (2%)
 Frame = -2

Query: 778  HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
            H++  S+ ILLD+ F+A + DFGLA+++  P +   S + G    +GY+APEY+ TM  +
Sbjct: 930  HRDIKSNNILLDDKFEAHVGDFGLAKVIDMPHSKSMSAIAGS---YGYIAPEYAYTMKVT 986

Query: 598  TKGDAYSFGVVLLELATGQKPLELTTAEEGFKGNLVDWVNQHSGSGRIKD-VIDKSICGR 422
             K D YS+GVVLLEL TG+ P++    ++G  G++V+WV  +     +   V+D  +   
Sbjct: 987  EKSDIYSYGVVLLELLTGKAPVQ--PIDQG--GDVVNWVRSYIRRDALSSGVLDARL--T 1040

Query: 421  GHDEQIVQ----FLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGISEPYD 278
              DE+IV      L+IA  C       R SM Q    L +    +G  E  D
Sbjct: 1041 LEDERIVSHMLTVLKIALLCTSVSPVARPSMRQVVLMLIESERSEGEQEHLD 1092



>pir|D96728|D96728 hypothetical protein F24J13.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_894630 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010796_1537105 Arabidopsis thaliana
           chromosome 1 BAC F24J13 genomic sequence, complete
           sequence.
          Length = 710

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 55/169 (32%), Positives = 93/169 (55%), Gaps = 6/169 (3%)
 Frame = -2

Query: 778 HQNFSSHAILLDEDFDARIMDFGLARLMAPPDAHETSFVKGDLGEFGYVAPEYSSTMIPS 599
           H++  S  ILLD++F+A++ DFGLA+L      H ++ V   +G FGY+APEY+ +   +
Sbjct: 475 HRDIKSANILLDDEFEAQVADFGLAKLNDSTQTHVSTRV---MGTFGYLAPEYAQSGKLT 531

Query: 598 TKGDAYSFGVVLLELATGQKPLE--LTTAEEGFKGNLVDW----VNQHSGSGRIKDVIDK 437
            + D +SFGVVLLEL TG+KP++      EE    +LV+W    +++   +G   +++D+
Sbjct: 532 DRSDVFSFGVVLLELITGRKPVDQYQPLGEE----SLVEWARPLLHKAIETGDFSELVDR 587

Query: 436 SICGRGHDEQIVQFLRIACNCVVSRSKERWSMYQAYEALNKMAAQQGIS 290
            +     + ++ + +  A  CV     +R  M Q   AL+       IS
Sbjct: 588 RLEKHYVENEVFRMIETAAACVRHSGPKRPRMVQVVRALDSEGDMGDIS 636


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 906,622,058
Number of Sequences: 1806583
Number of extensions: 20078462
Number of successful extensions: 60049
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 54034
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56125
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51696623407
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)