BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8064
         (1264 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:STPPC1_1722877 S.tuberosum ppc1 gene.                              699   0.0     
sp|P29196|CAPP_SOLTU|CAPP_SOLTU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   698   0.0     Solanum tuberosum [potatoes]
sp|P27154|CAPP_TOBAC|CAPP_TOBAC Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   696   0.0     Nicotiana tabacum [American tobacco]
gb:AF248080_1780629 Flaveria trinervia phosphoenolpyruvate carbo...   695   0.0     
pir|T09846|T09846 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   691   0.0     Gossypium hirsutum [American cotton]
pir|S52853|S52853 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   689   0.0     Flaveria pringlei
gb:AF494192_1805149 Flaveria pubescens phosphoenolpyruvate carbo...   689   0.0     
gb:AY563044_1615006 Glycine max phosphoenolpyruvate carboxylase ...   687   0.0     
gb:SRO286750_1722426 Sesbania rostrata mRNA for phosphoenolpyruv...   687   0.0     
pir|S40304|S40304 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   687   0.0     Solanum tuberosum [potatoes]
gb:AF494191_1805148 Flaveria brownii phosphoenolpyruvate carboxy...   684   0.0     
sp|Q02909|CAP1_SOYBN|CAP1_SOYBN Phosphoenolpyruvate carboxylase, housekeepi...   684   0.0     Glycine max [soybeans]
sp|P51061|CAP2_SOYBN|CAP2_SOYBN Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   683   0.0     Glycine max [soybeans]
sp|Q01647|CAP1_FLAPR|CAP1_FLAPR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   683   0.0     Flaveria pringlei
gb:AF248079_1780628 Flaveria trinervia phosphoenolpyruvate carbo...   682   0.0     
sp|P16097|CAP2_MESCR|CAP2_MESCR Phosphoenolpyruvate carboxylase 2 (EC 4.1.1...   681   0.0     Mesembryanthemum crystallinum
gb:AB097088_1525936 Glycine max GmPEPC7 gene for phosphoenolpyru...   680   0.0     
gb:AB008540_1510531 Glycine max mRNA for phosphoenolpyruvate car...   680   0.0     
gb:AP003913_1835124 Oryza sativa (japonica cultivar-group) genom...   679   0.0     
sp|P29194|CAP2_SORBI|CAP2_SORBI Phosphoenolpyruvate carboxylase 2 (EC 4.1.1...   677   0.0     Sorghum bicolor [broomcorn]
pir|T52186|T52186 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   676   0.0     Arabidopsis thaliana [mouse-ear cress]
gb:AF271161_1782128 Hydrilla verticillata phosphoenolpyruvate ca...   675   0.0     
gb:LES243416_1684494 Lycopersicon esculentum mRNA for phosphoeno...   675   0.0     
gb:AB097087_1525935 Glycine max GmPEPC15 gene for phosphoenolpyr...   674   0.0     
sp|Q9AU12|CAPP_PHAVU|CAPP_PHAVU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   673   0.0     Phaseolus vulgaris [French bean]
sp|Q9MAH0|CAPP_ARATH|CAPP_ARATH Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   673   0.0     Arabidopsis thaliana [mouse-ear cress]
gb:BT004642_1637676 Arabidopsis thaliana At3g14940 gene, complet...   672   0.0     
sp|P51063|CAPP_PICAB|CAPP_PICAB Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   672   0.0     Picea abies
sp|Q02735|CAPP_MEDSA|CAPP_MEDSA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   672   0.0     Medicago sativa [alfalfa]
gb:AY663387_1620488 Lupinus albus phosphoenolpyruvate carboxylas...   672   0.0     
gb:AB092820_1525119 Lotus corniculatus var. japonicus LjPEPC1 mR...   672   0.0     
sp|Q42730|CAPP_FLAAU|CAPP_FLAAU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   672   0.0     
sp|P30694|CAP2_FLATR|CAP2_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   672   0.0     Flaveria trinervia
gb:AY187619_1588160 Oryza sativa (indica cultivar-group) phospho...   671   0.0     
gb:AF271163_1782130 Hydrilla verticillata phosphoenolpyruvate ca...   671   0.0     
sp|P51059|CAP2_MAIZE|CAP2_MAIZE Phosphoenolpyruvate carboxylase 2 (EC 4.1.1...   669   0.0     Zea mays [maize]
sp|Q01648|CAP1_FLATR|CAP1_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   669   0.0     Flaveria trinervia
gb:TAE7705_1724514 Triticum aestivum PEPC gene.                       669   0.0     
gb:AY663386_1620487 Lupinus albus phosphoenolpyruvate carboxylas...   669   0.0     
pir|S18318|S18318 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   669   0.0     Flaveria trinervia
gb:AF459644_1801729 Lupinus albus phosphoenolpyruvate carboxylas...   668   0.0     
gb:AF271162_1782129 Hydrilla verticillata phosphoenolpyruvate ca...   668   0.0     
gb:STU011844_1722943 Solanum tuberosum ppc2 gene.                     667   0.0     
gb:PEQ300741_1699811 Phalaenopsis equestris partial ppc gene for...   666   0.0     
gb:PAM300742_1698747 Phalaenopsis amabilis partial ppc gene for ...   666   0.0     
gb:BRJ223497_1634163 Brassica juncea mRNA for phosphoenolpyruvat...   666   0.0     
sp|P51062|CAPP_PEA|CAPP_PEA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)...   665   0.0     Pisum sativum [garden pea]
gb:VFA011302_1727073 Vicia faba mRNA for phosphoenolpyruvate-car...   665   0.0     
gb:AF159051_1773194 Picea abies phosphoenolpyruvate carboxylase ...   664   0.0     
gb:AF135371_1771078 Lotus corniculatus phosphoenol pyruvate carb...   664   0.0     
gb:AY663388_1620489 Lupinus albus phosphoenolpyruvate carboxylas...   663   0.0     
gb:BRJ223496_1634162 Brassica juncea mRNA for phosphoenolpyruvat...   661   0.0     
gb:AB092821_1525120 Lotus corniculatus var. japonicus LjPEPC2 mR...   660   0.0     
gb:VPPPCGE1_1727330 V.planifolia mRNA for phosphoenolpyruvate ca...   659   0.0     
gb:AP005802_1858075 Oryza sativa (japonica cultivar-group) genom...   659   0.0     
gb:LES313434_1684576 Lycopersicon esculentum ppc2 gene for phosp...   657   0.0     
gb:LES243417_1684495 Lycopersicon esculentum mRNA for phosphoeno...   657   0.0     
sp|P29193|CAP1_SACHY|CAP1_SACHY Phosphoenolpyruvate carboxylase, housekeepi...   656   0.0     Saccharum sp.
gb:AY210895_1589694 Arabidopsis thaliana phosphoenolpyruvate car...   655   0.0     
gb:ATH532902_1552867 Arabidopsis thaliana mRNA for phosphoenolpy...   655   0.0     
pir|H84855|H84855 phosphoenolpyruvate carboxylase [imported] - A...   655   0.0     Arabidopsis thaliana [mouse-ear cress]
gb:AB012228_1511657 Zea mays mRNA for phosphoenolpyruvate carbox...   646   0.0     
sp|P29195|CAP1_SORBI|CAP1_SORBI Phosphoenolpyruvate carboxylase 1 (EC 4.1.1...   644   0.0     Sorghum bicolor [broomcorn]
sp|P10490|CAP1_MESCR|CAP1_MESCR Phosphoenolpyruvate carboxylase 1 (EC 4.1.1...   644   0.0     Mesembryanthemum crystallinum
gb:AB085948_1524434 Eleocharis vivipara pep1 mRNA for phosphoeno...   642   0.0     
gb:AY491400_1608695 Setaria italica C3 phosphoenolpyruvate carbo...   641   0.0     
gb:AY251482_1592766 Echinochloa crus-galli phosphoenolpyruvate c...   640   0.0     
gb:AP004117_1837801 Oryza sativa (japonica cultivar-group) genom...   640   0.0     
gb:AP004117_1837800 Oryza sativa (japonica cultivar-group) genom...   640   0.0     
gb:AF271995_1782197 Oryza sativa phosphoenolpyruvate carboxylase...   640   0.0     
gb:WWPPC_1727779 W.mirabilis mRNA for phosphoenolpyruvate carbox...   633   e-180   
gb:VPPPCGEN_1727331 V.planifolia mRNA for phosphoenolpyruvate ca...   632   e-180   
sp|Q43299|CAPP_AMAHP|CAPP_AMAHP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   632   e-180   Amaranthus hypochondriacus [prince's feather]
pir|JH0381|JH0381 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   630   e-179   Sorghum bicolor [broomcorn]
gb:AF530570_1809082 X Mokara cv. 'Yellow' phosphoenolpyruvate ca...   622   e-177   
pir|T08138|T08138 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   615   e-175   Brassica napus [oilseed rape]
gb:AF495586_1805546 Setaria italica putative C4 phosphoenolpyruv...   613   e-174   
gb:AF268091_1782031 Chloris gayana phosphoenolpyruvate carboxyla...   598   e-170   
gb:VPL249988_1727317 Vanilla planifolia partial mRNA for phospho...   591   e-167   
gb:ZMPEP_1731956 Z.mays gene for phosphoenolpyruvate carboxylase...   590   e-167   
gb:ZMA536629_1731578 Zea mays mRNA for phosphoenolpyruvate carbo...   590   e-167   
pir|S04546|QYZM phosphoenolpyruvate carboxylase (EC 4.1.1.31) - ...   590   e-167   
sp|P04711|CAP1_MAIZE|CAP1_MAIZE Phosphoenolpyruvate carboxylase 1 (EC 4.1.1...   587   e-166   Zea mays [maize]
gb:SOF293346_1715673 Saccharum officinarum mRNA for putative C4 ...   563   e-159   
gb:SSP318338_1722549 Saccharum spontaneum mRNA for putative C4 p...   561   e-158   
gb:AP003409_1828980 Oryza sativa (japonica cultivar-group) genom...   560   e-158   
gb:AY135709_1581780 Saccharum hybrid cultivar putative C4 phosph...   560   e-158   
gb:AP003052_1824492 Oryza sativa (japonica cultivar-group) genom...   557   e-157   
sp|P15804|CAP3_SORBI|CAP3_SORBI Phosphoenolpyruvate carboxylase 3 (EC 4.1.1...   556   e-157   Sorghum bicolor [broomcorn]
gb:ZMPEPCR_1731963 Maize mRNA for phosphoenolpyruvate carboxylas...   550   e-155   
pir|S08216|QYMG phosphoenolpyruvate carboxylase (EC 4.1.1.31) - ...   540   e-152   
gb:AB078719_1523751 Nicotiana sylvestris Nsppc2 gene for phospho...   452   e-126   
gb:PGE318584_1699976 Paspalidium geminatum partial mRNA for puta...   379   e-104   
gb:PMA318586_1700691 Panicum maximum partial mRNA for putative p...   373   e-102   
gb:IKO318574_1683120 Ischaemum koleostachys partial mRNA for put...   361   2e-98   
gb:EAU318576_1676257 Eulalia aurea partial internal mRNA for put...   360   3e-98   
gb:AMA318588_1819161 Aristida mauritiana partial mRNA for putati...   357   2e-97   
gb:EIN318591_1676556 Eleusine indica partial mRNA for putative p...   357   4e-97   
gb:MRE318585_1686973 Melinis repens partial mRNA for putative ph...   356   6e-97   
gb:CBA318589_1645650 Chloris barbata partial mRNA for putative p...   356   6e-97   
gb:PPA318587_1701212 Paspalum paniculatum partial mRNA for putat...   355   8e-97   
gb:HCO318577_1681653 Heteropogon contortus partial mRNA for puta...   355   1e-96   
gb:ETE318590_1677059 Eragrostis tenuifolia partial mRNA for puta...   355   1e-96   
gb:SVE318575_1723228 Sorghum verticilliflorum partial mRNA for p...   354   2e-96   
gb:HRU318580_1682106 Hyparrhenia rufa partial mRNA for putative ...   354   2e-96   
gb:VZI318573_1727554 Vetiveria zizanioides partial internal mRNA...   353   3e-96   
gb:CDA279036_1646024 Cynodon dactylon (L.) Pers. partial mRNA fo...   353   3e-96   
gb:PPA318578_1701211 Pogonatherum paniceum partial mRNA for puta...   350   3e-95   
gb:TQU318581_1725778 Themeda quadrivalvis partial mRNA for putat...   347   2e-94   
gb:CLA318579_1647723 Coix lacryma-jobi partial mRNA for putative...   335   1e-90   
gb:AB078718_1523750 Nicotiana sylvestris Nsppc1 gene for phospho...   318   1e-85   
gb:PHA276508_1700045 Pinus halepensis partial mRNA for phosphoen...   300   4e-80   
gb:AY517644_1610773 Chlamydomonas reinhardtii phosphoenolpyruvat...   285   2e-75   
gb:AY548401_1613164 Australopyrum velutinum voucher D-2873-2878 ...   235   1e-60   
gb:AY548413_1613175 Elymus glaucus voucher W6-10215(2) ID phosph...   234   4e-60   
gb:AY548406_1613169 Elymus canadensis voucher PI-578675 ID phosp...   233   5e-60   
gb:AY548405_1613168 Elymus canadensis voucher PI-531568(2) ID ph...   232   1e-59   
gb:AY548421_1613182 Hordeum marinum voucher PI-304346(1&2) ID ph...   231   2e-59   
gb:AY548399_1613162 Aegilops comosa voucher G-602 GH phosphoenol...   231   3e-59   
gb:AY548415_1613177 Elymus lanceolatus voucher PI-531623 ID phos...   230   4e-59   
gb:AY548409_1613172 Elymus lanceolatus voucher PI-531623 ID phos...   229   7e-59   
gb:AY548422_1613183 Hordeum murinum voucher Ciho-15683(2) ID pho...   228   3e-58   
gb:AY548404_1613167 Elymus californicus voucher M.E.Barkworth s....   226   1e-57   
gb:AY548426_1613186 Pseudoroegneria spicata voucher PI-610986 ID...   225   1e-57   
gb:AY548416_1613178 Elymus wawawaiensis voucher PI-598812(2) ID ...   224   3e-57   
gb:AY548412_1613174 Elymus elymoides voucher PI-531606(3) ID pho...   224   3e-57   
gb:AY548403_1613166 Haynaldia villosa voucher MA-141-46-75 GH ph...   221   2e-56   
gb:AY548425_1613185 Peridictyon sanctum voucher KJ248 GH phospho...   218   2e-55   
gb:VFA011303_1727074 Vicia faba mRNA for phosphoenolpyruvate-car...   217   4e-55   
gb:AY548432_1613191 Thinopyrum elongatum voucher RJMG113 ID phos...   216   6e-55   
gb:AY548423_1613184 Hordeum vulgare voucher RJMG107 ID phosphoen...   209   1e-52   
gb:D26377S1_1674495 Brassica napus PE15-PEPCase gene for phospho...   202   9e-51   
gb:AP002882_1823608 Oryza sativa (japonica cultivar-group) genom...   199   1e-49   
gb:D26379S1_1674497 Brassica napus PE105-PEPCase gene for phosph...   197   5e-49   
pir|PC2169|PC2169 phosphoenolpyruvate carboxykinase (diphosphate...   197   5e-49   Brassica napus [oilseed rape]
sp|Q88MR4|CAPP_PSEPK|CAPP_PSEPK Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   191   3e-47   Pseudomonas putida
gb:AY563043_1615005 Glycine max phosphoenolpyruvate carboxylase ...   187   3e-46   
gb:CR378663_93681 Photobacterium profundum SS9; segment 1/12.         187   3e-46   
sp|Q9HXV3|CAPP_PSEAE|CAPP_PSEAE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   184   3e-45   Pseudomonas aeruginosa
gb:AY548400_1613163 Agropyron cristatum voucher C-3-6-10(2) GH p...   184   3e-45   
gb:AE016827_342646 Mannheimia succiniciproducens MBEL55E, comple...   184   3e-45   
gb:ATH532903_1552868 Arabidopsis thaliana mRNA for phosphoenolpy...   182   1e-44   
gb:BX950851_838943 Erwinia carotovora subsp. atroseptica SCRI104...   182   1e-44   
pir|C96712|C96712 hypothetical protein F14K14.14 [imported] - Ar...   182   1e-44   Arabidopsis thaliana [mouse-ear cress]
sp|P43920|CAPP_HAEIN|CAPP_HAEIN Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   180   5e-44   Haemophilus influenzae
pir|PC2170|PC2170 phosphoenolpyruvate carboxykinase (diphosphate...   179   8e-44   Brassica napus [oilseed rape]
gb:AE017138_388868 Yersinia pestis biovar Medievalis str. 91001 ...   179   1e-43   
gb:AE013630_298641 Yersinia pestis KIM section 30 of 415 of the ...   179   1e-43   
gb:CP000020_872484 Vibrio fischeri ES114 chromosome I, complete ...   178   2e-43   
sp|Q8EK30|CAPP_SHEON|CAPP_SHEON Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   177   3e-43   Shewanella oneidensis
sp|Q886R9|CAPP_PSESM|CAPP_PSESM Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   177   3e-43   Pseudomonas syringae pv. tomato
gb:TUPPC_1726101 T.usneoides mRNA for phosphoenolpyruvate decarb...   177   4e-43   
gb:BX936398_834753 Yersinia pseudotuberculosis IP32953 genome, c...   177   4e-43   
sp|Q8ZA84|CAPP_YERPE|CAPP_YERPE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   177   4e-43   Yersinia pestis
sp|Q83IS7|CAPP_SHIFL|CAPP_SHIFL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   177   5e-43   Shigella flexneri
sp|Q9CN89|CAPP_PASMU|CAPP_PASMU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   177   5e-43   Pasteurella multocida
gb:CR543861_105357 Acinetobacter sp. ADP1 complete genome.            176   7e-43   
gb:AY517643_1610772 Chlamydomonas reinhardtii phosphoenolpyruvat...   176   9e-43   
pir|B86087|B86087 phosphoenolpyruvate carboxylase [imported] - E...   176   1e-42   Escherichia coli O157:H7
sp|P00864|CAPP_ECOLI|CAPP_ECOLI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   176   1e-42   Escherichia coli [E. coli]
sp|Q8FB98|CAPP_ECOL6|CAPP_ECOL6 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   176   1e-42   
sp|Q8X743|CAPP_ECO57|CAPP_ECO57 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   176   1e-42   Escherichia coli O157:H7
pir|D82049|D82049 phosphoenolpyruvate carboxylase VC2646 [import...   174   3e-42   Vibrio cholerae
sp|Q9KNT4|CAPP_VIBCH|CAPP_VIBCH Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   174   3e-42   
gb:BA000037_723830 Vibrio vulnificus YJ016 DNA, chromosome I, co...   174   4e-42   
sp|Q7MH68|CAPP_VIBVY|CAPP_VIBVY Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   174   4e-42   Vibrio vulnificus
sp|Q8DCN2|CAPP_VIBVU|CAPP_VIBVU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   174   4e-42   Vibrio vulnificus
gb:BA000031_708221 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   172   1e-41   
sp|Q87L54|CAPP_VIBPA|CAPP_VIBPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   172   1e-41   
gb:PNPPC_1700913 P.nudum mRNA for phosphoenolpyruvate decarboxyl...   171   2e-41   
sp|Q8Z307|CAPP_SALTI|CAPP_SALTI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   169   8e-41   Salmonella enterica subsp. enterica serovar Typhi
sp|Q8ZKM0|CAPP_SALTY|CAPP_SALTY Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   168   2e-40   Salmonella enterica subsp. enterica serovar Typhimurium
gb:CP000026_78604 Salmonella enterica subsp. enterica serovar Pa...   167   3e-40   
gb:AY046371_1561581 Gaertnera aphanodioica clone 1 phosphoenolpy...   166   7e-40   
gb:AY046346_1561556 Gaertnera cuneifolia clone 2 phosphoenolpyru...   166   7e-40   
gb:AY046333_1561543 Gaertnera globigera clone 1 phosphoenolpyruv...   166   7e-40   
gb:AY046363_1561573 Gaertnera longifolia clone 3 phosphoenolpyru...   166   9e-40   
gb:AF333904_1787407 Morinda royoc phosphoenolpyruvate carboxylas...   166   1e-39   
gb:F24J5_1677991 Arabidopsis thaliana chromosome 1 BAC F24J5 seq...   166   1e-39   
gb:AY046374_1561584 Gaertnera brevipedicellata clone 1 phosphoen...   166   1e-39   
gb:AF333892_1787395 Gaertnera paniculata phosphoenolpyruvate car...   165   2e-39   
gb:AY185551_1588076 Gaertnera longevaginalis phosphoenolpyruvate...   165   2e-39   
gb:AY046351_1561561 Gaertnera vaginans clone 2 phosphoenolpyruva...   165   2e-39   
gb:AY046373_1561583 Gaertnera brevipedicellata clone 2 phosphoen...   165   2e-39   
gb:AY046357_1561567 Gaertnera fractiflexa clone 1 phosphoenolpyr...   165   2e-39   
gb:AF333863_1787366 Gaertnera madagascariensis phosphoenolpyruva...   164   3e-39   
gb:AF333858_1787361 Gaertnera inflexa phosphoenolpyruvate carbox...   164   3e-39   
gb:AY046366_1561576 Gaertnera junghuhniana clone 2 phosphoenolpy...   164   3e-39   
gb:AF333890_1787393 Gaertnera macrostipula phosphoenolpyruvate c...   164   4e-39   
gb:AF333889_1787392 Gaertnera lowryi phosphoenolpyruvate carboxy...   164   4e-39   
gb:AF333869_1787372 Gaertnera schizocalyx phosphoenolpyruvate ca...   164   4e-39   
gb:AF333861_1787364 Gaertnera lowryi phosphoenolpyruvate carboxy...   164   4e-39   
gb:AF333847_1787350 Gaertnera acuminata phosphoenolpyruvate carb...   164   4e-39   
gb:AF333880_1787383 Gaertnera cuneifolia phosphoenolpyruvate car...   164   5e-39   
gb:AF333850_1787353 Gaertnera brevipedicellata phosphoenolpyruva...   164   5e-39   
gb:AY185545_1588072 Gaertnera arenaria phosphoenolpyruvate carbo...   164   5e-39   
gb:AY185544_1588071 Gaertnera arenaria phosphoenolpyruvate carbo...   164   5e-39   
gb:AY046380_1561590 Gaertnera lowryi clone 2 phosphoenolpyruvate...   164   5e-39   
gb:AY046342_1561552 Gaertnera macrostipula clone 2 phosphoenolpy...   164   5e-39   
gb:AY046336_1561546 Gaertnera inflexa clone 1 phosphoenolpyruvat...   164   5e-39   
gb:AF333883_1787386 Gaertnera fractiflexa phosphoenolpyruvate ca...   163   6e-39   
gb:FPPPCBX23_1679181 F.pringlei ppcB gene (exons 2 and 3).            163   6e-39   
gb:AY046364_1561574 Gaertnera lowryi clone 2 phosphoenolpyruvate...   163   6e-39   
gb:AF333903_1787406 Morinda citrifolia phosphoenolpyruvate carbo...   163   8e-39   
gb:AF333870_1787373 Gaertnera ternifolia phosphoenolpyruvate car...   163   8e-39   
gb:AF333897_1787400 Gaertnera schatzii phosphoenolpyruvate carbo...   162   1e-38   
gb:AF333887_1787390 Gaertnera junghuhniana phosphoenolpyruvate c...   162   1e-38   
sp|Q7MAX5|CAPP_PHOLL|CAPP_PHOLL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   162   1e-38   Photorhabdus laumondii subsp. laumondii
gb:AF333873_1787376 Morinda citrifolia phosphoenolpyruvate carbo...   162   2e-38   
gb:AF333868_1787371 Gaertnera schatzii phosphoenolpyruvate carbo...   162   2e-38   
gb:AF333855_1787358 Gaertnera fractiflexa phosphoenolpyruvate ca...   162   2e-38   
gb:AF333864_1787367 Gaertnera paniculata phosphoenolpyruvate car...   161   3e-38   
gb:AF333882_1787385 Gaertnera edentata phosphoenolpyruvate carbo...   159   9e-38   
gb:AF333872_1787375 Gaertnera walkeri phosphoenolpyruvate carbox...   159   9e-38   
gb:AF333853_1787356 Gaertnera drakeana phosphoenolpyruvate carbo...   159   9e-38   
gb:AF333896_1787399 Gaertnera rosea phosphoenolpyruvate carboxyl...   159   1e-37   
gb:AY185550_1588075 Gaertnera longevaginalis phosphoenolpyruvate...   156   1e-36   
gb:AF333851_1787354 Gaertnera cooperi phosphoenolpyruvate carbox...   155   2e-36   
gb:AY185547_1588073 Gaertnera capitulata phosphoenolpyruvate car...   152   1e-35   
gb:AE014187_938712 Plasmodium falciparum 3D7 chromosome 14 compl...   152   1e-35   
gb:AY458648_620069 Uncultured bacterium 581 clone EBAC000-69B03 ...   149   2e-34   
gb:AE008919_246236 Uncultured proteobacterium BAC EBAC000-65D09 ...   149   2e-34   
pir|PC2167|PC2167 phosphoenolpyruvate carboxykinase (diphosphate...   141   2e-32   Brassica napus [oilseed rape]
sp|Q59757|CAPP_RHOMR|CAPP_RHOMR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   132   1e-29   Rhodothermus marinus
gb:AB078720_1523752 Nicotiana sylvestris Nsppc3 gene for phospho...   132   2e-29   
sp|Q82WS3|CAPP_NITEU|CAPP_NITEU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   129   1e-28   Nitrosomonas europaea
gb:AB008541_1510532 Glycine max mRNA for phosphoenolpyruvate car...   128   2e-28   
sp|Q7U4M0|CAPP_SYNPX|CAPP_SYNPX Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   124   5e-27   Synechococcus sp.
sp|Q7V9U4|CAPP_PROMA|CAPP_PROMA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   122   1e-26   Prochlorococcus marinus
sp|Q89R17|CAPP_BRAJA|CAPP_BRAJA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   122   2e-26   Bradyrhizobium japonicum
sp|Q7UZT0|CAPP_PROMP|CAPP_PROMP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   120   5e-26   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
sp|Q9RNU9|CAPP_STRCO|CAPP_STRCO Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   118   2e-25   
sp|Q7P206|CAPP_CHRVO|CAPP_CHRVO Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   115   2e-24   Chromobacterium violaceum
gb:ZMPEPC5A_1731961 Maize MRNA for phosphoenolpyruvate carboxyla...   114   4e-24   
sp|Q93MH3|CAPP_CORCT|CAPP_CORCT Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   114   6e-24   Corynebacterium crenatum
gb:AB115089_13996 Corynebacterium glutamicum ppc gene for phosph...   113   9e-24   
gb:D89668_121217 Rhodopseudomonas palustris gene for phosphoenol...   112   1e-23   
gb:CR555306_106020 Azoarcus sp. EbN1 complete genome.                 112   1e-23   
sp|Q82HE3|CAPP_STRAW|CAPP_STRAW Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   112   1e-23   Streptomyces avermitilis
sp|Q8RQL3|CAPP_COREF|CAPP_COREF Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   112   1e-23   Corynebacterium efficiens
gb:AX064983_1459405 Sequence 109 from Patent WO0100844.               112   2e-23   
gb:BA000036_719312 Corynebacterium glutamicum ATCC 13032 DNA, co...   111   3e-23   
gb:AE017301_435900 Thermus thermophilus HB27 section 1 of 7 of t...   111   3e-23   
pir|S05512|QYFKG phosphoenolpyruvate carboxylase (EC 4.1.1.31) -...   111   3e-23   
sp|O32483|CAPP_RHOPA|CAPP_RHOPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   111   3e-23   Rhodopseudomonas palustris
sp|P12880|CAPP_CORGL|CAPP_CORGL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   111   3e-23   Corynebacterium glutamicum
gb:AF378606_1793405 Moringa drouhardii phosphoenolpyruvate carbo...   110   5e-23   
sp|P51060|CAPP_THES7|CAPP_THES7 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   110   6e-23   Thermus sp.
pir|F75415|F75415 phosphoenolpyruvate carboxylase - Deinococcus ...   109   1e-22   Deinococcus radiodurans
gb:AF378613_1793410 Moringa concanensis phosphoenolpyruvate carb...   109   1e-22   
gb:AF378617_1793413 Moringa borziana phosphoenolpyruvate carboxy...   108   2e-22   
sp|P06516|CAPP_SYNP6|CAPP_SYNP6 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   107   4e-22   Synechococcus sp.
gb:BX571965_790797 Burkholderia pseudomallei strain K96243, chro...   107   7e-22   
gb:AF317284_499274 Burkholderia pseudomallei PEP carboxylase gen...   107   7e-22   
sp|Q7W0D0|CAPP_BORPE|CAPP_BORPE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   106   9e-22   Bordetella pertussis
gb:AY830136_646928 Synechococcus sp. PCC 7002 phosphoenolpyruvat...   106   1e-21   
gb:AP006618_558323 Nocardia farcinica IFM 10152 DNA, complete ge...   106   1e-21   
sp|Q7V561|CAPP_PROMM|CAPP_PROMM Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   106   1e-21   Prochlorococcus marinus
sp|Q7WCA9|CAPP_BORPA|CAPP_BORPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   105   1e-21   Bordetella parapertussis
sp|Q7WQB3|CAPP_BORBR|CAPP_BORBR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   105   1e-21   Bordetella bronchiseptica
gb:AF378615_1793412 Moringa peregrina phosphoenolpyruvate carbox...   105   3e-21   
sp|P61449|CAPP_MYCPA|CAPP_MYCPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   104   3e-21   Mycobacterium avium subsp. paratuberculosis
gb:BX294141_767755 Pirellula sp. strain 1 complete genome; segme...   104   4e-21   
sp|Q94QB2|CAPP_SYNEL|CAPP_SYNEL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   104   4e-21   Synechococcus elongatus
pir|S72765|S72765 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   103   6e-21   Mycobacterium leprae
sp|P46710|CAPP_MYCLE|CAPP_MYCLE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   103   6e-21   Mycobacterium leprae
sp|P28594|CAPP_ANASP|CAPP_ANASP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   103   6e-21   Anabaena sp.
gb:AB003908_1509052 Glycine max gene for phosphoenolpyruvate car...   102   1e-20   
gb:FTPPCCEX2_1679466 F.trinervia ppcC gene (exon 2).                  102   2e-20   
sp|P74299|CAPP_SYNY3|CAPP_SYNY3 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   102   2e-20   Synechocystis sp.
pir|AE2413|AE2413 phosphoenolpyruvate carboxylase [imported] - N...   101   4e-20   Nostoc sp. PCC 7120
pir|A44831|A44831 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   101   4e-20   Nostoc sp. PCC 7120
pir|JW0072|JW0072 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   100   6e-20   Glycine max [soybeans]
gb:AE014295_311973 Bifidobacterium longum NCC2705, complete genome.   100   1e-19   
gb:CP000023_874659 Streptococcus thermophilus LMG 18311, complet...    99   2e-19   
sp|Q8DPW5|CAPP_STRR6|CAPP_STRR6 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    99   2e-19   Streptococcus pneumoniae
sp|Q8XWW2|CAPP_RALSO|CAPP_RALSO Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    99   2e-19   Ralstonia solanacearum
sp|Q97QX6|CAPP_STRPN|CAPP_STRPN Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    97   5e-19   
gb:AB008543_1510534 Glycine max mRNA for phosphoenolpyruvate car...    97   7e-19   
gb:CP000024_876561 Streptococcus thermophilus CNRZ1066, complete...    97   7e-19   
pir|T05702|T05702 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    97   7e-19   
sp|Q8DV10|CAPP_STRMU|CAPP_STRMU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    97   9e-19   
sp|Q8E647|CAPP_STRA3|CAPP_STRA3 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    97   9e-19   
gb:AY596297_632041 Haloarcula marismortui ATCC 43049 chromosome ...    96   2e-18   
gb:AF287481_495886 Chlorobium tepidum phosphoenolpyruvate carbox...    95   3e-18   
gb:AE012919_287107 Chlorobium tepidum TLS section 140 of 194 of ...    95   3e-18   
sp|Q7NNJ7|CAPP_GLOVI|CAPP_GLOVI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    94   8e-18   
gb:AE017203_404482 Lactobacillus johnsonii NCC 533, section 4 of...    92   2e-17   
gb:CP000031_85610 Silicibacter pomeroyi DSS-3, complete genome.        91   4e-17   
sp|P61448|CAPP_CORDI|CAPP_CORDI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    91   4e-17   
gb:AE004969_61657 Neisseria gonorrhoeae FA 1090, complete genome.      90   1e-16   
sp|Q9A871|CAPP_CAUCR|CAPP_CAUCR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    90   1e-16   
gb:MEU72662_143328 Methylobacterium extorquens methylotrophy reg...    89   2e-16   
gb:CP000033_89351 Lactobacillus acidophilus NCFM, complete genome.     88   3e-16   
gb:ZMPEPC5B_1731962 Maize mRNA for phosphoenolpyruvate carboxyla...    87   6e-16   
pir|T03658|T03658 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    87   6e-16   
gb:ZMPEPC2A_1731959 Z.mays pepcZm2A gene for phosphoenolpyruvate...    85   3e-15   
pir|S23750|S23750 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    85   3e-15   
pir|D81953|D81953 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    85   3e-15   
sp|Q9JWH1|CAPP_NEIMA|CAPP_NEIMA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    85   3e-15   
sp|Q9JXG5|CAPP_NEIMB|CAPP_NEIMB Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    84   5e-15   
gb:ECOPPCMUT_129844 E.coli (mutant PpcI) ppc gene encoding a pho...    84   6e-15   
gb:S60262_1704335 pepcZm1=phosphoenolpyruvate carboxylase {5' re...    83   1e-14   
gb:AE013598_297497 Xanthomonas oryzae pv. oryzae KACC10331, comp...    82   2e-14   
sp|Q8PP82|CAPP_XANAC|CAPP_XANAC Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    80   9e-14   
sp|Q9A0U7|CAPP_STRPY|CAPP_STRPY Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    80   1e-13   
gb:AE008692_241234 Zymomonas mobilis subsp. mobilis ZM4, complet...    79   3e-13   
sp|Q8K873|CAPP_STRP3|CAPP_STRP3 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    78   4e-13   
gb:CP000003_860451 Streptococcus pyogenes MGAS10394, complete ge...    77   1e-12   
gb:AF378605_1793404 Cylicomorpha parviflora phosphoenolpyruvate ...    76   2e-12   
sp|Q8P336|CAPP_XANCP|CAPP_XANCP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    76   2e-12   
sp|Q8P1W7|CAPP_STRP8|CAPP_STRP8 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    76   2e-12   
gb:BX571662_779142 Wolinella succinogenes, complete genome; segm...    73   1e-11   
gb:BA000026_694286 Mycoplasma penetrans HF-2 DNA, complete genome.     71   4e-11   
gb:AE017147_390956 Helicobacter hepaticus ATCC 51449 section 4 o...    65   4e-09   
gb:S60264_1704336 pepcZm3B=phosphoenolpyruvate carboxylase {5' r...    60   1e-07   
pir|S40297|S40297 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    60   1e-07   
gb:FTPPCBEX2_1679464 F.trinervia ppcB gene (exon 2).                   54   5e-06   
gb:D26379S2_1674498 Brassica napus PE105-PEPCase gene for phosph...    50   1e-04   
gb:D26377S2_1674496 Brassica napus PE15-PEPCase gene for phospho...    50   1e-04   
pir|PC2168|PC2168 phosphoenolpyruvate carboxykinase (diphosphate...    50   1e-04   
gb:AY553256_1613460 Hordeum brachyantherum subsp. californicum i...    49   3e-04   
gb:AY553237_1613441 Agropyron cristatum isolate Agr_cri phosphoe...    48   4e-04   
gb:AY553244_1613448 Elymus elymoides isolate Ely_ely_H phosphoen...    48   5e-04   
gb:AY553249_1613453 Elymus elymoides isolate Ely_ely_St phosphoe...    47   6e-04   
gb:AY553236_1613440 Aegilops comosa isolate Aeg_com phosphoenolp...    47   0.001   
gb:AY553260_1613464 Hordeum vulgare isolate Hor_vul phosphoenolp...    46   0.001   
gb:AY553252_1613456 Elymus lanceolatus isolate Ely_lan_St phosph...    46   0.002   
gb:AF496503_516399 Lactobacillus delbrueckii subsp. lactis phosp...    46   0.002   
gb:AY553239_1613443 Bromus tectorum isolate Bro_tec phosphoenolp...    45   0.002   
gb:AP004360_1840708 Oryza sativa (japonica cultivar-group) genom...    45   0.004   
gb:AE017354_459973 Legionella pneumophila subsp. pneumophila str...    44   0.007   
gb:CR628337_114622 Legionella pneumophila str. Lens complete gen...    44   0.009   
gb:CR628336_111687 Legionella pneumophila str. Paris complete ge...    44   0.009   
gb:AB020719_1865317 Homo sapiens mRNA for KIAA0912 protein, part...    40   0.13    
gb:AY553263_1613467 Pseudoroegneria spicata isolate Pse_spi_1 ph...    39   0.17    
gb:CR382124_1656728 Kluyveromyces lactis strain NRRL Y-1140 chro...    38   0.38    
gb:AB026618_1517012 Nicotiana sylvestris Nsppc2 gene for phospho...    37   0.86    
gb:AE015938_319913 Clostridium tetani E88, section 3 of 10 of th...    37   0.86    
gb:AY157774_1585459 Arachis cardenasii clone C8_A_172 resistance...    37   1.1     
gb:CR382139_1672963 Debaryomyces hansenii chromosome G of strain...    36   1.5     
gb:MGA249992_1389644 Mytilus galloprovincialis partial mRNA for ...    36   1.5     
sp|Q8PN59|GCSP_XANAC|GCSP_XANAC Glycine dehydrogenase [decarboxylating] (EC...    36   1.9     
gb:AE017282_426850 Methylococcus capsulatus str. Bath, complete ...    35   2.5     
gb:AB026619_1517013 Nicotiana sylvestris Nsppc3 gene for phospho...    35   3.3     
gb:AF040645_1235636 Caenorhabditis elegans cosmid F52C6, complet...    35   4.2     
gb:AB015484_1193578 Dugesia japonica mRNA for myosin heavy chain...    35   4.2     
gb:HSM801462_1186187 Homo sapiens mRNA; cDNA DKFZp434A2017 (from...    35   4.2     
pir|T32802|T32802 hypothetical protein F52C6.9 - Caenorhabditis ...    35   4.2     
pir|T43445|T43445 hypothetical protein DKFZp434A2017.1 - human (...    35   4.2     
pir|A97295|A97295 fusion of Uroporphyrinogen-III methylase relat...    35   4.2     
gb:AE016817_1747534 Ashbya gossypii (= Eremothecium gossypii) AT...    34   5.5     
gb:AY692803_1622850 Saccharomyces cerevisiae clone FLH003435.01X...    34   5.5     
gb:AY553267_1613471 Secale montanum subsp. montanum isolate Sec_...    34   5.5     
sp|P38853|KEL1_YEAST|KEL1_YEAST Kelch repeats protein 1.>pir|S46769|S46769 ...    34   5.5     
gb:AY491507_2534788 Danio rerio Ift88 mRNA, complete cds.              34   7.2     
gb:AK126101_1916208 Homo sapiens cDNA FLJ44113 fis, clone TESTI4...    34   7.2     
gb:AP003228_1825692 Oryza sativa (japonica cultivar-group) genom...    34   7.2     
gb:ECOCLPAA_128286 E.coli ATP-dependent C1p protease (clpA) gene...    34   7.2     
gb:CR378664_93857 Photobacterium profundum SS9; segment 2/12.          34   7.2     
pir|S76330|S76330 endopeptidase Clp (EC 3.4.21.-) ATP-binding ch...    34   7.2     
gb:BX640593_2567721 Zebrafish DNA sequence from clone DKEY-183C1...    33   9.5     
gb:AY534731_2358211 Horseradish latent virus capsid protein gene...    33   9.5     
gb:OSJN00152_1695756 Oryza sativa genomic DNA, chromosome 4, BAC...    33   9.5     
gb:AF498128_1421437 Procyon lotor apolipoprotein B-100 (apoB-100...    33   9.5     
gb:DROTRO13_1383051 D.melanogaster tropomyosin gene 1, isoform 9...    33   9.5     
gb:DROTRO12_1383050 D.melanogaster tropomyosin gene isoform 33 (...    33   9.5     
gb:DROTRO11_1383049 D.melanogaster tropomyosin gene isoform 33 (...    33   9.5     
gb:DROTRO10_1383048 D.melanogaster tropomyosin gene 1, isoform 9...    33   9.5     
gb:DROTRO09_1383047 D.melanogaster tropomyosin gene 1 constant r...    33   9.5     
gb:AE014298_1125351 Drosophila melanogaster chromosome X, comple...    33   9.5     
gb:BX571863_786114 Photorhabdus luminescens subsp. laumondii TTO...    33   9.5     
gb:AE016938_362410 Bacteroides thetaiotaomicron VPI-5482, sectio...    33   9.5     


>gb:STPPC1_1722877 S.tuberosum ppc1 gene.
          Length = 965

 Score =  699 bits (1805), Expect = 0.0
 Identities = 347/378 (91%), Positives = 362/378 (95%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            M  RNLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct: 1    MTTRNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct: 61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK 120

Query: 492  LKK-GDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            LKK GDF DE++A TESDIEET K+LV D+KKSPQEVFDA+KNQTVDLVLTAHPTQSVRR
Sbjct: 121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 181  SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA NLYYSQIEDLMFE+SMWRCN+ELR RAD+L RSSRRD KHYIEFWKQV
Sbjct: 301  RDVCLLARMMAANLYYSQIEDLMFELSMWRCNEELRVRADDLQRSSRRDEKHYIEFWKQV 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PPNEPYRVILGDVRDKLY
Sbjct: 361  PPNEPYRVILGDVRDKLY 378



>sp|P29196|CAPP_SOLTU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:STPPC_1722876 S.tuberosum ppc mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 965

 Score =  698 bits (1802), Expect = 0.0
 Identities = 346/378 (91%), Positives = 362/378 (95%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct: 1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct: 61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK 120

Query: 492  LKK-GDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            LKK GDF DE++A TESDIEET K+LV D+KKSPQEVFDA+KNQTVDLVLTAHPTQSVRR
Sbjct: 121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 181  SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA NLYYSQIEDLMFE+SMWRCN+ELR RAD+L RSSRRD KHYIEFWKQV
Sbjct: 301  RDVCLLARMMAANLYYSQIEDLMFELSMWRCNEELRVRADDLQRSSRRDEKHYIEFWKQV 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PPNEPYRVILGDVRDKLY
Sbjct: 361  PPNEPYRVILGDVRDKLY 378



>sp|P27154|CAPP_TOBAC Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S17440|QYNT phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - common
            tobacco>gb:NTPPC_1691705 N.tabacum mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 964

 Score =  696 bits (1797), Expect = 0.0
 Identities = 343/377 (90%), Positives = 362/377 (96%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA R+LEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct: 1    MATRSLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct: 61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK+GDF DEN+A TESDIEET K+LV D+KKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKRGDFADENNATTESDIEETFKKLVGDLKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGM
Sbjct: 181  LLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTAPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVT EVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTLEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLYYSQIE+LMFE+SMWRCND+LR RA EL+RSSRRD KHYIEFWK +P
Sbjct: 301  DVCLLARMMAANLYYSQIEELMFELSMWRCNDDLRIRAAELYRSSRRDTKHYIEFWKTIP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P+EPYRVILGDVRDKLY
Sbjct: 361  PSEPYRVILGDVRDKLY 377



>gb:AF248080_1780629 Flaveria trinervia phosphoenolpyruvate
            carboxylase (ppcC) mRNA, complete cds.
          Length = 967

 Score =  695 bits (1793), Expect = 0.0
 Identities = 344/378 (91%), Positives = 360/378 (95%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE L+ETVQEC
Sbjct: 1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEGLKETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DE SA TESDIEET K+LV  +KKSP+EVFDALKNQTVDLV TAHPTQSVRRS
Sbjct: 121  LKKGDFADEASATTESDIEETFKKLVHKLKKSPEEVFDALKNQTVDLVFTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIRDCLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRDCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR-SSRRDAKHYIEFWKQV 1208
            DVCLLA+MMA N+Y+SQIEDLMFEMSMWRC+DELR RA+ELHR SS+RD KHYIEFWKQV
Sbjct: 301  DVCLLARMMAANMYFSQIEDLMFEMSMWRCSDELRVRAEELHRSSSKRDVKHYIEFWKQV 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PP EPYRVILGDVRDKLY
Sbjct: 361  PPTEPYRVILGDVRDKLY 378



>pir|T09846|T09846 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 1 -
            upland cotton>gb:AF008939_1761055 Gossypium hirsutum
            phosphoenolpyruvate carboxylase 1 (PEPC1) mRNA, complete
            cds.
          Length = 965

 Score =  691 bits (1784), Expect = 0.0
 Identities = 338/377 (89%), Positives = 357/377 (94%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDA+LLDRFLDILQDLHGE++RETVQEC
Sbjct: 1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDAVLLDRFLDILQDLHGEDIRETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DE+SA TESDIEET KRLV  + KSP+EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADESSATTESDIEETFKRLVGQLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CL QLY KDITPDDKQELDEALQREIQAAFRTDEIRR PPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRNPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLY+SQIEDLMFE+SMWRC+DELR RADELHRSS++DAKHYIEFWKQ+P
Sbjct: 301  DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSKKDAKHYIEFWKQIP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            PNEPYR+ILGDVRDKLY
Sbjct: 361  PNEPYRIILGDVRDKLY 377



>pir|S52853|S52853 phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            Flaveria pringlei>gb:FPPPCAMR_1679178 F.pringlei ppcA
            mRNA for phosphoenolpyruvate carboxylase.
          Length = 966

 Score =  689 bits (1779), Expect = 0.0
 Identities = 337/377 (89%), Positives = 361/377 (95%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct: 1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK+GDF DE +A TESDIEET K+LV+ + KSP+EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKRGDFADEANATTESDIEETFKKLVLKLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA+N+Y+SQIEDLMFEMSMWRCN ELR RA+EL+R++RRD KHYIEFWKQVP
Sbjct: 301  DVCLLARMMASNMYFSQIEDLMFEMSMWRCNSELRVRAEELYRTARRDVKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P EPYRVILGDVRDKLY
Sbjct: 361  PTEPYRVILGDVRDKLY 377



>gb:AF494192_1805149 Flaveria pubescens phosphoenolpyruvate
            carboxylase FPUB966 (ppcA) mRNA, complete cds.
          Length = 966

 Score =  689 bits (1778), Expect = 0.0
 Identities = 338/377 (89%), Positives = 360/377 (95%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct: 1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK+GDF DE +A TESDIEET KRLV  + KSP+EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKRGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA+N+Y+SQIEDLMFEMSMWRCN ELR RA+EL+R++RRD KHYIEFWKQVP
Sbjct: 301  DVCLLARMMASNMYFSQIEDLMFEMSMWRCNSELRVRAEELYRTARRDVKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P EPYRVILGDVRDKLY
Sbjct: 361  PTEPYRVILGDVRDKLY 377



>gb:AY563044_1615006 Glycine max phosphoenolpyruvate carboxylase
            (PEPC4) mRNA, complete cds.
          Length = 966

 Score =  687 bits (1774), Expect = 0.0
 Identities = 338/378 (89%), Positives = 359/378 (94%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct: 1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG H P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGEHKPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  L-KKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            L KKGDF DENSAITESDIEET K+LV  +KK+PQE+FDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  LLKKGDFADENSAITESDIEETFKKLVAQLKKTPQEIFDALKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIR+CL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 181  SLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWKGVPQFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA N+Y+SQIEDLMFE+SMWRC DELR RA ELHRSS+RDAKHYIEFWKQ+
Sbjct: 301  RDVCLLARMMAANMYFSQIEDLMFELSMWRCTDELRVRAHELHRSSKRDAKHYIEFWKQI 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PPNEPYRVILGDVRDKLY
Sbjct: 361  PPNEPYRVILGDVRDKLY 378



>gb:SRO286750_1722426 Sesbania rostrata mRNA for phosphoenolpyruvate
            carboxylase (pepc gene).
          Length = 961

 Score =  687 bits (1773), Expect = 0.0
 Identities = 339/379 (89%), Positives = 363/379 (95%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DE++A TESDIEETLK+LV +MKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADESNATTESDIEETLKKLVGEMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH R+R+CL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRVRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RADEL+RSS++D  AKHYIEFWK 
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADELNRSSKKDAVAKHYIEFWKI 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +PP+EPYRV+LG+VRD+LY
Sbjct: 361  IPPSEPYRVVLGEVRDRLY 379



>pir|S40304|S40304 phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            potato  (fragment)
          Length = 956

 Score =  687 bits (1773), Expect = 0.0
 Identities = 341/369 (92%), Positives = 355/369 (96%), Gaps = 1/369 (0%)
 Frame = +3

Query: 159  ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEG 338
            ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSAEYE 
Sbjct: 1    ASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSAEYEA 60

Query: 339  RHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK-GDFVD 515
            +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQKLKK GDF D
Sbjct: 61   KHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQKLKKKGDFGD 120

Query: 516  ENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARI 695
            E++A TESDIEET K+LV D+KKSPQEVFDA+KNQTVDLVLTAHPTQSVRRSLLQKH RI
Sbjct: 121  ESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQTVDLVLTAHPTQSVRRSLLQKHGRI 180

Query: 696  RDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW 875
            RDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW
Sbjct: 181  RDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW 240

Query: 876  KGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKM 1055
            KGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+M
Sbjct: 241  KGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARM 300

Query: 1056 MATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVI 1235
            MA NLYYSQIEDLMFE+SMWRCN+ELR RAD+L RSSRRD KHYIEFWKQVPPNEPYRVI
Sbjct: 301  MAANLYYSQIEDLMFELSMWRCNEELRVRADDLQRSSRRDEKHYIEFWKQVPPNEPYRVI 360

Query: 1236 LGDVRDKLY 1262
            LGDVRDKLY
Sbjct: 361  LGDVRDKLY 369



>gb:AF494191_1805148 Flaveria brownii phosphoenolpyruvate carboxylase
            FB966 (ppcA) mRNA, complete cds.
          Length = 966

 Score =  684 bits (1766), Expect = 0.0
 Identities = 334/377 (88%), Positives = 360/377 (95%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA +N+EK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct: 1    MANKNVEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK+GDF DE +A TESDIEET KRLV  + KSP+EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKRGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA+N+Y+SQIEDLMFEMSMWRCN E+R RA+EL+R++R+D KHYIEFWKQVP
Sbjct: 301  DVCLLARMMASNMYFSQIEDLMFEMSMWRCNSEVRVRAEELYRTARKDVKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P EPYRVILGDVRDKLY
Sbjct: 361  PTEPYRVILGDVRDKLY 377



>sp|Q02909|CAP1_SOYBN Phosphoenolpyruvate carboxylase, housekeeping
            isozyme (EC 4.1.1.31) (PEPCase).>pir|S28428|S28428
            phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            soybean>gb:SOYGMPPC_1716015 Glycine max mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  684 bits (1765), Expect = 0.0
 Identities = 340/379 (89%), Positives = 361/379 (95%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+ L QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNNLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPTFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RADEL+RSS+++  AKHYIEFWK 
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADELNRSSKKNSVAKHYIEFWKA 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +PPNEPYRV+LG+VR++LY
Sbjct: 361  IPPNEPYRVLLGEVRNRLY 379



>sp|P51061|CAP2_SOYBN Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:SOYPEPC_1716073 Glycine max gmppc1 mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  683 bits (1763), Expect = 0.0
 Identities = 335/379 (88%), Positives = 359/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct: 1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LV D+KKSPQEVFDALKNQTVDLVLTAHPTQS+RRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVFDLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CL+QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIW GVPRFLRRVDTAL NIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+ELHRSS++D  AKHYIEFWK+
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELHRSSKKDEVAKHYIEFWKK 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            VPPNEPYRV+LG+VRD+LY
Sbjct: 361  VPPNEPYRVVLGEVRDRLY 379



>sp|Q01647|CAP1_FLAPR Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S25081|S25081 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Flaveria
            pringlei>gb:FPPPCA_1679177 Flaveria pringlei ppcA1 gene
            for phosphoenolpyruvate carboxylase.
          Length = 967

 Score =  683 bits (1762), Expect = 0.0
 Identities = 336/378 (88%), Positives = 361/378 (95%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct: 1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK+GDF DE +A TESDIEET K+LV+ + KSP+EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKRGDFADEANATTESDIEETFKKLVLKLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG-NPRVTPEVT 1028
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG +PRVTPEVT
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGKHPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA+N+Y+SQIEDLMFEMSMWRCN ELR RA+EL+R++RRD KHYIEFWKQV
Sbjct: 301  RDVCLLARMMASNMYFSQIEDLMFEMSMWRCNSELRVRAEELYRTARRDVKHYIEFWKQV 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PP EPYRVILGDVRDKLY
Sbjct: 361  PPTEPYRVILGDVRDKLY 378



>gb:AF248079_1780628 Flaveria trinervia phosphoenolpyruvate
            carboxylase (ppcB) mRNA, complete cds.
          Length = 965

 Score =  682 bits (1759), Expect = 0.0
 Identities = 336/377 (89%), Positives = 356/377 (94%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK+ASIDA LRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+ETVQEC
Sbjct: 1    MANRNLEKLASIDAHLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DE  A TESD+EETLK+LV  + KSP+EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADEAHATTESDMEETLKKLVYKLNKSPEEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRT PTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTQPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA N+Y+SQIEDLMFEMSMWRC DELR RA+EL R++RRD KHYIEFWKQVP
Sbjct: 301  DVCLLARMMAANMYFSQIEDLMFEMSMWRCTDELRVRAEELFRTARRDVKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P EPYRVILGDVRDKLY
Sbjct: 361  PTEPYRVILGDVRDKLY 377



>sp|P16097|CAP2_MESCR Phosphoenolpyruvate carboxylase 2 (EC 4.1.1.31)
            (PEPCase 2).>pir|S05550|QYIX2 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) 2 - common ice
            plant>gb:MCPPCB_1685805 Mesembryanthemum crystallinum
            ppc2 gene for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).
          Length = 960

 Score =  681 bits (1756), Expect = 0.0
 Identities = 336/370 (90%), Positives = 353/370 (95%), Gaps = 1/370 (0%)
 Frame = +3

Query: 156  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE 335
            MASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE SAEYE
Sbjct: 1    MASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYERSAEYE 60

Query: 336  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKLKKGDFV 512
            G+HDPKKL+ELG+VLTSLD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR +KLKKGD  
Sbjct: 61   GKHDPKKLDELGSVLTSLDAGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIKKLKKGDLS 120

Query: 513  DENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHAR 692
            DENSA TESDIEET KRLV ++ KSP+E+FDALKNQTVDLV TAHPTQSVRRSLLQKH R
Sbjct: 121  DENSATTESDIEETFKRLVAELGKSPEEIFDALKNQTVDLVFTAHPTQSVRRSLLQKHGR 180

Query: 693  IRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 872
            IR+CLAQLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI
Sbjct: 181  IRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 240

Query: 873  WKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAK 1052
            WKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+
Sbjct: 241  WKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAR 300

Query: 1053 MMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRV 1232
            MMA NLY+SQIEDLMFE+SMWRC DELRARADELH SSRRDAKHYIEFWK +PPNEPYRV
Sbjct: 301  MMAANLYFSQIEDLMFELSMWRCTDELRARADELHSSSRRDAKHYIEFWKHIPPNEPYRV 360

Query: 1233 ILGDVRDKLY 1262
            ILGDVRDKLY
Sbjct: 361  ILGDVRDKLY 370



>gb:AB097088_1525936 Glycine max GmPEPC7 gene for phosphoenolpyruvate
            carboxylase, complete cds.
          Length = 967

 Score =  680 bits (1754), Expect = 0.0
 Identities = 334/379 (88%), Positives = 358/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LV  +KKSPQEVFDALKNQTVDLVLTAHPTQS+RRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CL+QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIW GVPRFLRRVDTAL NIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+ELHRSS++D  AKHYIEFWK+
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELHRSSKKDEVAKHYIEFWKK 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            VPPNEPYRV+LG+VRD+LY
Sbjct: 361  VPPNEPYRVVLGEVRDRLY 379



>gb:AB008540_1510531 Glycine max mRNA for phosphoenolpyruvate
            carboxylase, complete cds, clone:GmPEPC7.
          Length = 967

 Score =  680 bits (1754), Expect = 0.0
 Identities = 334/379 (88%), Positives = 358/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LV  +KKSPQEVFDALKNQTVDLVLTAHPTQS+RRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVFGLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CL+QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIW GVPRFLRRVDTAL NIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+ELHRSS++D  AKHYIEFWK+
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELHRSSKKDEVAKHYIEFWKK 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            VPPNEPYRV+LG+VRD+LY
Sbjct: 361  VPPNEPYRVVLGEVRDRLY 379



>gb:AP003913_1835124 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1484_G09.
          Length = 964

 Score =  679 bits (1753), Expect = 0.0
 Identities = 331/375 (88%), Positives = 361/375 (96%)
 Frame = +3

Query: 138  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE 317
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct: 2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLRELVQECYE 61

Query: 318  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK 497
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct: 62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK 121

Query: 498  KGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 677
            KGDF DENSA+TESDIEET KRLVVD+KKSP EVFDALK+QTVDLVLTAHPTQSVRRSLL
Sbjct: 122  KGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSLL 181

Query: 678  QKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSY 857
            QKH+RIR+CL QLY+KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSY
Sbjct: 182  QKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSY 241

Query: 858  FHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 1037
            FHETIWKGVP+FLRR+DTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct: 242  FHETIWKGVPKFLRRLDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 301

Query: 1038 CLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPN 1217
            CLLA+MMA+NLY SQIEDLMFE+SMWRCNDELRARADELH SS++DAKHYIEFWK+VPP+
Sbjct: 302  CLLARMMASNLYCSQIEDLMFELSMWRCNDELRARADELHLSSKKDAKHYIEFWKKVPPS 361

Query: 1218 EPYRVILGDVRDKLY 1262
            EPYRV+LGDVRDKLY
Sbjct: 362  EPYRVVLGDVRDKLY 376



>sp|P29194|CAP2_SORBI Phosphoenolpyruvate carboxylase 2 (EC 4.1.1.31)
            (PEPCase 2) (CP28).>pir|S18240|S18240 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - sorghum>gb:SVPEPCG_1723259
            S.vulgare PEPC gene for phosphoenolpyruvate carboxylase.
          Length = 960

 Score =  677 bits (1747), Expect = 0.0
 Identities = 330/372 (88%), Positives = 360/372 (96%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct: 1    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA 60

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD 506
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct: 61   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKGD 120

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DENSAITESDIEETLKRLVVD+KKSP EVFDALK+QTVDLVLTAHPTQSVRRSLLQKH
Sbjct: 121  FADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSLLQKH 180

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            +RIR+CL QLY+KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHE
Sbjct: 181  SRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHE 240

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 241  TIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 300

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA+NLY SQIEDLMFE+SMWRC+DELR RADELHRS+++DAKHYIEFWK+VPPNEPY
Sbjct: 301  ARMMASNLYCSQIEDLMFELSMWRCSDELRMRADELHRSTKKDAKHYIEFWKKVPPNEPY 360

Query: 1227 RVILGDVRDKLY 1262
            RVIL DVRDKLY
Sbjct: 361  RVILSDVRDKLY 372



>pir|T52186|T52186 phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            [imported] - Arabidopsis thaliana>gb:ATH131710_1551995
            Arabidopsis thaliana pepc gene, exons
            1-10.>gb:AF071788_1765809 Arabidopsis thaliana
            phosphoenolpyruvate carboxylase (PPC) mRNA, complete
            cds.>gb:AP000370_1819759 Arabidopsis thaliana genomic
            DNA, chromosome 3, TAC clone:K15M2.
          Length = 968

 Score =  676 bits (1743), Expect = 0.0
 Identities = 336/379 (88%), Positives = 359/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct: 1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct: 61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCLAQLY KDITPDDKQELDE+LQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 181  SLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD-AKHYIEFWKQ 1205
            RDVCLLA+MMA NLYY+QIE+LMFE+SMWRC DE R RADELHR+SR+D AKHYIEFWK 
Sbjct: 301  RDVCLLARMMAANLYYNQIENLMFELSMWRCTDEFRVRADELHRNSRKDAAKHYIEFWKT 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +PP EPYRVILGDVRDKLY
Sbjct: 361  IPPTEPYRVILGDVRDKLY 379



>gb:AF271161_1782128 Hydrilla verticillata phosphoenolpyruvate
            carboxylase isoform 1 mRNA, complete cds.
          Length = 970

 Score =  675 bits (1741), Expect = 0.0
 Identities = 330/373 (88%), Positives = 353/373 (94%)
 Frame = +3

Query: 144  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS 323
            +LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ CYELS
Sbjct: 10   HLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQSCYELS 69

Query: 324  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG 503
            AEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR KLKKG
Sbjct: 70   AEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRRIKLKKG 129

Query: 504  DFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQK 683
            DF DENSA TESDIEETLK+LVV +KKSPQEVFDALKNQTVDLVLTAHPTQS+RRSLLQK
Sbjct: 130  DFADENSAATESDIEETLKKLVVQLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRSLLQK 189

Query: 684  HARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH 863
            H+RIR+CLAQLY KD+TPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH
Sbjct: 190  HSRIRNCLAQLYAKDVTPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH 249

Query: 864  ETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 1043
            ETIWKGVP+FLRRVDTAL+NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL
Sbjct: 250  ETIWKGVPKFLRRVDTALRNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 309

Query: 1044 LAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEP 1223
            LA+MMA NLYYSQIEDLMFE+SMWRC+DELR RA  LHRSSR  AKHYIEFWKQ+PPNEP
Sbjct: 310  LARMMAANLYYSQIEDLMFELSMWRCSDELRVRATALHRSSRSVAKHYIEFWKQIPPNEP 369

Query: 1224 YRVILGDVRDKLY 1262
            YRVILG+VRDKLY
Sbjct: 370  YRVILGEVRDKLY 382



>gb:LES243416_1684494 Lycopersicon esculentum mRNA for
            phosphoenolpyruvate carboxylase 1 (ppc1 gene).
          Length = 964

 Score =  675 bits (1741), Expect = 0.0
 Identities = 338/378 (89%), Positives = 357/378 (94%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ TVQ+C
Sbjct: 1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKGTVQDC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE +HDPKKLEELGNVLTSL PGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct: 61   YELSAEYEAKHDPKKLEELGNVLTSLVPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK 120

Query: 492  LKK-GDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            LKK GDF DE++A TESDIEET K+LV D+KKSPQEVFDA+KNQTVDLVLTAHPTQSVRR
Sbjct: 121  LKKKGDFGDESNATTESDIEETFKKLVGDLKKSPQEVFDAIKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 181  SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA NLYYSQIEDLMFE+SMWRC++ELR RA +L R S RD KHYIEFWKQV
Sbjct: 301  RDVCLLARMMAANLYYSQIEDLMFELSMWRCSEELRVRAHKLQR-SWRDEKHYIEFWKQV 359

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PPNEPYRVILGDVRDKLY
Sbjct: 360  PPNEPYRVILGDVRDKLY 377



>gb:AB097087_1525935 Glycine max GmPEPC15 gene for phosphoenolpyruvate
            carboxylase, complete cds.
          Length = 967

 Score =  674 bits (1739), Expect = 0.0
 Identities = 332/379 (87%), Positives = 355/379 (93%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ    ENL+ETVQE 
Sbjct: 1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQGFTWENLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LV D+KKSPQEVFDALKNQTVDLVLTAHPTQS+RRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVFDLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CL+QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIW GVPRFLRRVDTAL NIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+ELHRSS++D  AKHYIEFWK+
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELHRSSKKDEVAKHYIEFWKK 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            VPPNEPYRV+LG+VRD+LY
Sbjct: 361  VPPNEPYRVVLGEVRDRLY 379



>sp|Q9AU12|CAPP_PHAVU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:AF288382_1783464 Phaseolus vulgaris
            phosphoenolpyruvate carboxylase mRNA, complete cds.
          Length = 968

 Score =  673 bits (1737), Expect = 0.0
 Identities = 332/379 (87%), Positives = 356/379 (93%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+L+ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LV ++KKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVFELKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+CL++LY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHARIRNCLSKLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIW GVP FLRRVDTAL NIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWNGVPSFLRRVDTALNNIGIKERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA N+YYSQIEDLMFE+SMWRCNDELR  ADE+HRSS +D  AKHYIEFWK+
Sbjct: 301  DVCLLARMMAANMYYSQIEDLMFELSMWRCNDELRVHADEVHRSSNKDEVAKHYIEFWKK 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            VP NEPYRV+LG+VRD+LY
Sbjct: 361  VPTNEPYRVVLGEVRDRLY 379



>sp|Q9MAH0|CAPP_ARATH Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|D96573|D96573 protein F12M16.21 [imported]
            - Arabidopsis thaliana>gb:AE005173_893234 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC008007_1536415 Genomic sequence for
            Arabidopsis thaliana BAC F12M16 from chromosome I,
            complete sequence.>gb:ATH532901_1552866 Arabidopsis
            thaliana mRNA for phosphoenolpyruvate carboxylase (ppc1
            gene).>gb:AY057507_1563926 Arabidopsis thaliana
            At1g53310/F12M16_21 mRNA, complete
            cds.>gb:BT000647_1634925 Arabidopsis thaliana putative
            phosphoenolpyrovate carboxylase gb|AAC24594.1; similar to
            ESTs gb|R30301.1, gb|AI992716.1, emb|Z29154.1,
            gb|W43080.1, emb|Z30862.1, (At1g53310/F12M16_21) mRNA,
            complete cds.
          Length = 967

 Score =  673 bits (1737), Expect = 0.0
 Identities = 335/379 (88%), Positives = 357/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct: 1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct: 61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDFVDE+SA TESD+EET K+LV D+ KSP+E+FDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEI+RTPPTPQDEMRAG
Sbjct: 181  SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD-AKHYIEFWKQ 1205
            RDVCLLA+MMA  +Y++QIEDLMFEMSMWRCNDELRARADE+H +SR+D AKHYIEFWK 
Sbjct: 301  RDVCLLARMMAATMYFNQIEDLMFEMSMWRCNDELRARADEVHANSRKDAAKHYIEFWKS 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +P  EPYRVILGDVRDKLY
Sbjct: 361  IPTTEPYRVILGDVRDKLY 379



>gb:BT004642_1637676 Arabidopsis thaliana At3g14940 gene, complete
            cds.
          Length = 968

 Score =  672 bits (1735), Expect = 0.0
 Identities = 335/379 (88%), Positives = 358/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct: 1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct: 61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDFVDE+SA TESDIEET KRLV D+ KSP+E+FDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCLAQLY KDITPDDKQELDE+LQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 181  SLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYF ETIWKGVP+FLRRVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFRETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD-AKHYIEFWKQ 1205
            RDVCLLA+MMA NLYY+QIE+LMFE+SMWRC DE R RADELHR+SR+D AKHYIEFWK 
Sbjct: 301  RDVCLLARMMAANLYYNQIENLMFELSMWRCTDEFRVRADELHRNSRKDAAKHYIEFWKT 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +PP EPYRVILGDVRDKLY
Sbjct: 361  IPPTEPYRVILGDVRDKLY 379



>sp|P51063|CAPP_PICAB Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S49344|S49344 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Norway
            spruce>gb:PAPPCG_1698837 P.abies (L.)Karst. ppc mRNA.
          Length = 963

 Score =  672 bits (1735), Expect = 0.0
 Identities = 328/377 (87%), Positives = 355/377 (94%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA  NLEKMASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++R  VQEC
Sbjct: 1    MARNNLEKMASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIRAMVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YE S EYEG++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YERSGEYEGKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            +K+G F DE++A TESDIEET KRLV  + KSP EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  IKRGGFADESNATTESDIEETFKRLVNQLGKSPAEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+CL+QLY KDITPD+KQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHARIRNCLSQLYGKDITPDEKQELDEALLREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRR+DTALK+IGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRIDTALKSIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRC+DELRARA +LH +S++DAKHYIEFWKQ+P
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCSDELRARALQLHSASKKDAKHYIEFWKQIP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            PNEP+RVILGDVRDKLY
Sbjct: 361  PNEPFRVILGDVRDKLY 377



>sp|Q02735|CAPP_MEDSA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S26235|S26235 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - alfalfa>gb:AX059586_1458525
            Sequence 1 from Patent WO0100852.>gb:ALFPEPC_1819001
            Medicago sativa phosphoenolpyruvate carboxylase (PEPC)
            gene, complete cds.>gb:ALFPPPCA_1819004 Medicago sativa
            phosphoenolpyruvate carboxylase mRNA, complete cds.
          Length = 966

 Score =  672 bits (1734), Expect = 0.0
 Identities = 329/377 (87%), Positives = 358/377 (94%), Gaps = 2/377 (0%)
 Frame = +3

Query: 138  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE 317
            A  +EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct: 2    ANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE 61

Query: 318  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK 497
            LSAEYE +HDPKKLEELGN++TS D GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct: 62   LSAEYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK 121

Query: 498  KGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 677
            KGDF DE++A TESDIEETLK+LV DMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL
Sbjct: 122  KGDFRDESNATTESDIEETLKKLVFDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 181

Query: 678  QKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSY 857
            QKH R+R+CL+QLY KDITPDDKQELDEALQREIQAAFRTDEI+RTPPTPQDEMRAGMSY
Sbjct: 182  QKHGRVRNCLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAGMSY 241

Query: 858  FHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 1037
            FHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct: 242  FHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 301

Query: 1038 CLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQVP 1211
            CLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+ELHR+S++D  AKHYIEFWK++P
Sbjct: 302  CLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELHRNSKKDEVAKHYIEFWKKIP 361

Query: 1212 PNEPYRVILGDVRDKLY 1262
             NEPYRV+LG+VRDKLY
Sbjct: 362  LNEPYRVVLGEVRDKLY 378



>gb:AY663387_1620488 Lupinus albus phosphoenolpyruvate carboxylase 3
            mRNA, complete cds.
          Length = 968

 Score =  672 bits (1733), Expect = 0.0
 Identities = 325/376 (86%), Positives = 359/376 (95%), Gaps = 2/376 (0%)
 Frame = +3

Query: 141  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL 320
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ TVQ+ YEL
Sbjct: 5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKNTVQDVYEL 64

Query: 321  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK 500
            S+EYEG+HDPKKLEE+GN +TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct: 65   SSEYEGKHDPKKLEEIGNAITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK 124

Query: 501  GDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQ 680
            G+F DE +A TESDIEETLKRLV D+KKSPQEVFDALKNQTVDLVLTAHPTQS+RRSLLQ
Sbjct: 125  GNFADETNATTESDIEETLKRLVFDLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRSLLQ 184

Query: 681  KHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYF 860
            KHARIR+CL+QLY KDITPDDKQELDE+LQREIQAAFRTDEI+RTPPTPQDEMRAGMSYF
Sbjct: 185  KHARIRNCLSQLYAKDITPDDKQELDESLQREIQAAFRTDEIKRTPPTPQDEMRAGMSYF 244

Query: 861  HETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVC 1040
            HETIWKGVP+FLRR+DTALKNIGINERVP+NAP+IQFSSWMGGDRDGNPRVTPEVTRDVC
Sbjct: 245  HETIWKGVPKFLRRIDTALKNIGINERVPHNAPVIQFSSWMGGDRDGNPRVTPEVTRDVC 304

Query: 1041 LLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQVPP 1214
            LLA+MMA+N+YYSQIEDLMFE+SMWRC+DELR RADELHRSS +D  AKHYIEFWK+VPP
Sbjct: 305  LLARMMASNMYYSQIEDLMFELSMWRCSDELRDRADELHRSSNKDEVAKHYIEFWKKVPP 364

Query: 1215 NEPYRVILGDVRDKLY 1262
            NEPYRV+LG+VRD+LY
Sbjct: 365  NEPYRVVLGEVRDRLY 380



>gb:AB092820_1525119 Lotus corniculatus var. japonicus LjPEPC1 mRNA
            for phosphoenolpyruvate carboxylase, complete cds.
          Length = 961

 Score =  672 bits (1733), Expect = 0.0
 Identities = 333/379 (87%), Positives = 357/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE +HD +KLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct: 61   YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LV  +KKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+ L+QLY KDITPDDKQELDEALQREIQAAFRTDEI+RTPPTPQDEMRAGM
Sbjct: 181  LLQKHARIRNSLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA+NLYYSQIEDLMFE+SMWRCNDELR  ADELHR+S +D  AKHYIEFWK+
Sbjct: 301  DVCLLARMMASNLYYSQIEDLMFELSMWRCNDELRVHADELHRNSNKDEVAKHYIEFWKK 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            VPPNEPYRV+LG+VRD+LY
Sbjct: 361  VPPNEPYRVVLGEVRDRLY 379



>sp|Q42730|CAPP_FLAAU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S37072|S37072 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Flaveria
            australasica>gb:FAPHOCAR_1678787 F.australasica mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 966

 Score =  672 bits (1733), Expect = 0.0
 Identities = 327/377 (86%), Positives = 356/377 (94%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct: 1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK GDF DE +A TESDIEET KRLV  + KSP+EVFDALKNQTV+LVLTAHPTQSVRRS
Sbjct: 121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQTVELVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINER PYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERFPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MM +N+Y+SQIEDLM EMSMWRCN ELR RA+EL+R++R+D KHYIEFWK++P
Sbjct: 301  DVCLLARMMTSNMYFSQIEDLMIEMSMWRCNSELRVRAEELYRTARKDVKHYIEFWKRIP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            PN+PYRVILGDVRDKLY
Sbjct: 361  PNQPYRVILGDVRDKLY 377



>sp|P30694|CAP2_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:FTPEPC_1679461 F.trinervia mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 966

 Score =  672 bits (1733), Expect = 0.0
 Identities = 327/377 (86%), Positives = 356/377 (94%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct: 1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK GDF DE +A TESDIEET KRLV  + KSP+EVFDALKNQTV+LVLTAHPTQSVRRS
Sbjct: 121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQTVELVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINER PYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERFPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MM +N+Y+SQIEDLM EMSMWRCN ELR RA+EL+R++R+D KHYIEFWK++P
Sbjct: 301  DVCLLARMMTSNMYFSQIEDLMIEMSMWRCNSELRVRAEELYRTARKDVKHYIEFWKRIP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            PN+PYRVILGDVRDKLY
Sbjct: 361  PNQPYRVILGDVRDKLY 377



>gb:AY187619_1588160 Oryza sativa (indica cultivar-group)
            phosphoenolpyruvate carboxylase (PEPC) mRNA, complete
            cds.
          Length = 964

 Score =  671 bits (1732), Expect = 0.0
 Identities = 328/375 (87%), Positives = 357/375 (95%)
 Frame = +3

Query: 138  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE 317
            A  +EKMASIDAQLR+L P   SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct: 2    AGKVEKMASIDAQLRMLAPAHRSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE 61

Query: 318  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK 497
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct: 62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK 121

Query: 498  KGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 677
            KGDF DENSA+TESDIEET KRLVVD+KKSP EVFDALK+QTVDLVLTAHPTQSVRRSLL
Sbjct: 122  KGDFADENSALTESDIEETFKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSLL 181

Query: 678  QKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSY 857
            QKH+RIR+CL QLY+KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSY
Sbjct: 182  QKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSY 241

Query: 858  FHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 1037
            FHETIWKGVP+FLRR+DTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPE TR V
Sbjct: 242  FHETIWKGVPKFLRRLDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEATRGV 301

Query: 1038 CLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPN 1217
            CLLA+MMA+NLY SQIEDLMFE+SMWRCNDELRARADELH SS++DAKHYIEFWK+VPP+
Sbjct: 302  CLLARMMASNLYCSQIEDLMFELSMWRCNDELRARADELHLSSKKDAKHYIEFWKKVPPS 361

Query: 1218 EPYRVILGDVRDKLY 1262
            EPYRV+LGDVRDKLY
Sbjct: 362  EPYRVVLGDVRDKLY 376



>gb:AF271163_1782130 Hydrilla verticillata phosphoenolpyruvate
            carboxylase isoform 3 mRNA, complete cds.
          Length = 970

 Score =  671 bits (1731), Expect = 0.0
 Identities = 329/373 (88%), Positives = 352/373 (94%)
 Frame = +3

Query: 144  NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS 323
            +LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ CYELS
Sbjct: 10   HLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQSCYELS 69

Query: 324  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG 503
            AEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR KLKKG
Sbjct: 70   AEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRRIKLKKG 129

Query: 504  DFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQK 683
            DF DENSA TESDIEETLK+LVV +KKSPQEVFDALKNQTVDLVLTAHPTQS+RRSLLQK
Sbjct: 130  DFADENSAATESDIEETLKKLVVQLKKSPQEVFDALKNQTVDLVLTAHPTQSIRRSLLQK 189

Query: 684  HARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH 863
            H+RIR+ LAQLY KD+TPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH
Sbjct: 190  HSRIRNSLAQLYAKDVTPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH 249

Query: 864  ETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 1043
            ETIWKGVP+FLRRVDTAL+NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL
Sbjct: 250  ETIWKGVPKFLRRVDTALRNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 309

Query: 1044 LAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEP 1223
            LA+MMA NLYYSQIEDLMFE+SMWRC+DELR RA  LHRSSR  AKHYIEFWKQ+PPNEP
Sbjct: 310  LARMMAANLYYSQIEDLMFELSMWRCSDELRVRATALHRSSRSVAKHYIEFWKQIPPNEP 369

Query: 1224 YRVILGDVRDKLY 1262
            YRVILG+VRDKLY
Sbjct: 370  YRVILGEVRDKLY 382



>sp|P51059|CAP2_MAIZE Phosphoenolpyruvate carboxylase 2 (EC 4.1.1.31)
            (PEPCase 2).>pir|JH0667|JH0667 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) C3-form -
            maize>gb:ZMPHOPCAR_1731980 Zea mays pep gene for (C3
            type) phosphoenolpyruvate carboxylase.
          Length = 967

 Score =  669 bits (1727), Expect = 0.0
 Identities = 327/372 (87%), Positives = 357/372 (95%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct: 8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA 67

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD 506
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKS SHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct: 68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSLSHMLNLANLAEEVQIAYRRRIKLKKGD 127

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DENSAITESDIEETLKRLVVD+KKSP EVFDALK+QTVDLVLTAHPTQSVRRSLLQKH
Sbjct: 128  FADENSAITESDIEETLKRLVVDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSLLQKH 187

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            +RIR+CL QLY+KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHE
Sbjct: 188  SRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHE 247

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 248  TIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 307

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA+NLY SQIEDLMFE+SMWRC+DELR RAD LH S+++DAKHYIEFWK+VPPNEPY
Sbjct: 308  ARMMASNLYCSQIEDLMFELSMWRCSDELRMRADVLHLSTKKDAKHYIEFWKKVPPNEPY 367

Query: 1227 RVILGDVRDKLY 1262
            RVIL DVRDKLY
Sbjct: 368  RVILSDVRDKLY 379



>sp|Q01648|CAP1_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S25082|S25082 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) isoform C4  (clone ppcA1) -
            Flaveria trinervia>gb:FTPPCA_1679462 Flaveria trinervia
            ppcA1 gene for phosphoenolpyruvate carboxylase.
          Length = 967

 Score =  669 bits (1727), Expect = 0.0
 Identities = 327/378 (86%), Positives = 357/378 (94%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct: 1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKL+ELG++LTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLDELGSLLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK GDF DE +A TESDIEET KRLV  + KSP+EVFDALKNQTV+LVLTAHPTQS+RRS
Sbjct: 121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQTVELVLTAHPTQSIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG-NPRVTPEVT 1028
            SYFHETIWKGVP+FLRRVDTALKNIGINER PYNAPLIQFSSWMGGDRDG +PRVTPEVT
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERFPYNAPLIQFSSWMGGDRDGKHPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MM +N+Y+SQIEDLM EMSMWRCN ELR RA+EL+R++R+D KHYIEFWKQ+
Sbjct: 301  RDVCLLARMMTSNMYFSQIEDLMIEMSMWRCNSELRVRAEELYRTARKDVKHYIEFWKQI 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PPN+PYRVILGDVRDKLY
Sbjct: 361  PPNQPYRVILGDVRDKLY 378



>gb:TAE7705_1724514 Triticum aestivum PEPC gene.
          Length = 972

 Score =  669 bits (1725), Expect = 0.0
 Identities = 327/372 (87%), Positives = 354/372 (95%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct: 13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA 72

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD 506
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct: 73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD 132

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DENSAITESDIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH
Sbjct: 133  FADENSAITESDIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 192

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            +RIR+CL QLY+KDITPDDKQELDEALQREIQAAFRTDEIRR  PTPQD MRAGMS FHE
Sbjct: 193  SRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRLSPTPQDHMRAGMSDFHE 252

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 253  TIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 312

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA NLY +QIEDLMFE+SMWRCNDELR+RADELHRSS++DAKHYIEFWK+VPPNEPY
Sbjct: 313  ARMMAANLYCAQIEDLMFELSMWRCNDELRSRADELHRSSKKDAKHYIEFWKKVPPNEPY 372

Query: 1227 RVILGDVRDKLY 1262
            RVILGDVRD LY
Sbjct: 373  RVILGDVRDNLY 384



>gb:AY663386_1620487 Lupinus albus phosphoenolpyruvate carboxylase 2
            mRNA, complete cds.
          Length = 967

 Score =  669 bits (1725), Expect = 0.0
 Identities = 331/379 (87%), Positives = 355/379 (93%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEET KRLV ++KKSPQEVFDALKNQTVDLVLTAHPTQS+RRS
Sbjct: 121  LKKGDFADENNATTESDIEETFKRLVRELKKSPQEVFDALKNQTVDLVLTAHPTQSIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+ L +LY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNNLTELYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPQFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYS I+DLMFE+SMWRCNDELR RADE+ RSS++D  AKHYIEFWK 
Sbjct: 301  DVCLLARMMAANLYYSMIDDLMFELSMWRCNDELRVRADEISRSSKKDAVAKHYIEFWKI 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +P +EPYRVILGDVRD+LY
Sbjct: 361  IPSSEPYRVILGDVRDRLY 379



>pir|S18318|S18318 phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            isoform C4  (clone ppc1-1) - Flaveria trinervia
          Length = 966

 Score =  669 bits (1725), Expect = 0.0
 Identities = 326/377 (86%), Positives = 355/377 (94%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct: 1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct: 61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK GDF DE +A TESDIEET KRLV  + KSP+EVFDALKNQTV+LVLTAHPTQSVRRS
Sbjct: 121  LKSGDFADEANATTESDIEETFKRLVHKLNKSPEEVFDALKNQTVELVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CLAQLY KDITPDDKQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLAQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLR VDTALKNIGINER PYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRCVDTALKNIGINERFPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MM +N+Y+SQIEDLM EMSMWRCN ELR RA+EL+R++R+D KHYIEFWK++P
Sbjct: 301  DVCLLARMMTSNMYFSQIEDLMIEMSMWRCNSELRVRAEELYRTARKDVKHYIEFWKRIP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            PN+PYRVILGDVRDKLY
Sbjct: 361  PNQPYRVILGDVRDKLY 377



>gb:AF459644_1801729 Lupinus albus phosphoenolpyruvate carboxylase
            (PEPC1) mRNA, complete cds.
          Length = 967

 Score =  668 bits (1723), Expect = 0.0
 Identities = 331/379 (87%), Positives = 354/379 (93%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR  
Sbjct: 61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNN 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEET KRLV ++KKSPQEVFDALKNQTVDLVLTAHPTQS+RRS
Sbjct: 121  LKKGDFADENNATTESDIEETFKRLVRELKKSPQEVFDALKNQTVDLVLTAHPTQSIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+ L +LY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNNLTELYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPQFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYS I+DLMFE+SMWRCNDELR RADE+ RSS++D  AKHYIEFWK 
Sbjct: 301  DVCLLARMMAANLYYSMIDDLMFELSMWRCNDELRVRADEISRSSKKDAVAKHYIEFWKI 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +P +EPYRVILGDVRDKLY
Sbjct: 361  IPSSEPYRVILGDVRDKLY 379



>gb:AF271162_1782129 Hydrilla verticillata phosphoenolpyruvate
            carboxylase isoform 2 mRNA, complete cds.
          Length = 968

 Score =  668 bits (1723), Expect = 0.0
 Identities = 327/380 (86%), Positives = 356/380 (93%), Gaps = 3/380 (0%)
 Frame = +3

Query: 132  MAARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETV 302
            MAARN   +E+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFLDILQDLHGE+LRETV
Sbjct: 1    MAARNSNHVERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLDILQDLHGEDLRETV 60

Query: 303  QECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRR 482
            Q CYELSAEYE   +P+KLEELG +LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RR
Sbjct: 61   QSCYELSAEYESTLNPEKLEELGKMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRR 120

Query: 483  RQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSV 662
            R KLKKGDF DENSA TESDIEETL+++VV +KKSPQEVFDALKNQTVDLVLTAHPTQS+
Sbjct: 121  RIKLKKGDFADENSATTESDIEETLRKMVVQLKKSPQEVFDALKNQTVDLVLTAHPTQSI 180

Query: 663  RRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMR 842
            RRSLLQKH+RIR+CLAQLY KD+TPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMR
Sbjct: 181  RRSLLQKHSRIRNCLAQLYAKDVTPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMR 240

Query: 843  AGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPE 1022
            AGMSYFHETIWKGVP+FLRRVDTAL+NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPE
Sbjct: 241  AGMSYFHETIWKGVPKFLRRVDTALRNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPE 300

Query: 1023 VTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWK 1202
            VTRDVCLLA+MMA NLYYSQIEDLMFE+SMWRC+DELR RA E+H SS+  AKHYIEFWK
Sbjct: 301  VTRDVCLLARMMAANLYYSQIEDLMFELSMWRCSDELRVRATEIHGSSKSVAKHYIEFWK 360

Query: 1203 QVPPNEPYRVILGDVRDKLY 1262
            Q+PP+EPYRV+LG+VRDKLY
Sbjct: 361  QIPPHEPYRVVLGEVRDKLY 380



>gb:STU011844_1722943 Solanum tuberosum ppc2 gene.
          Length = 964

 Score =  667 bits (1721), Expect = 0.0
 Identities = 327/377 (86%), Positives = 353/377 (93%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDIL+ LHGE ++ETVQEC
Sbjct: 1    MATRNLEKLASIDAQLRLLVPTKVSEDDKLVEYDALLLDRFLDILEGLHGEGIKETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE   D KKLEELG+VLTSLDPGDSIV+AKS SHMLN+ANLAEEVQIA   R+K
Sbjct: 61   YELSAEYENTRDKKKLEELGSVLTSLDPGDSIVVAKSISHMLNMANLAEEVQIANSGREK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
             KKGDF DE++ +TESDIEETLKRLVVD+KKSP+EVF+ALKNQTVDLV TAHPTQ+ RRS
Sbjct: 121  SKKGDFSDESNLMTESDIEETLKRLVVDLKKSPREVFEALKNQTVDLVFTAHPTQATRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+CLAQLY KDITPDDK+ELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHARIRNCLAQLYAKDITPDDKEELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            +YFHETIW GVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  NYFHETIWNGVPKFLRRVDTALKNIGINERIPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLYYSQI+DLMFE+SMWRCNDELR RADE HRS +RD KHYIEFWKQVP
Sbjct: 301  DVCLLARMMAANLYYSQIDDLMFELSMWRCNDELRDRADEQHRSLKRDEKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P+EPYRVI+GDVRDKLY
Sbjct: 361  PSEPYRVIIGDVRDKLY 377



>gb:PEQ300741_1699811 Phalaenopsis equestris partial ppc gene for
            phosphoenolpyruvate carboxylase.
          Length = 965

 Score =  666 bits (1719), Expect = 0.0
 Identities = 327/377 (86%), Positives = 354/377 (93%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct: 1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct: 61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDFVDENSA TESDIEETL+RLV ++KKSP+EVFDALKNQT+DLV TAHPTQSVRRS
Sbjct: 121  LKKGDFVDENSAATESDIEETLRRLVHELKKSPEEVFDALKNQTIDLVFTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+ L QLY KDITPDD+QELDE  QREIQAAFRTDEIRRT PTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNWLLQLYAKDITPDDEQELDETXQREIQAAFRTDEIRRTAPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLY+SQIEDLMFE+SMWRC+DELR RADELHR+S++DAKHYIEFWKQVP
Sbjct: 301  DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRVRADELHRASKKDAKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            PNEPYRV+L DVRDKLY
Sbjct: 361  PNEPYRVVLADVRDKLY 377



>gb:PAM300742_1698747 Phalaenopsis amabilis partial ppc gene for
            phosphoenolpyruvate carboxylase.
          Length = 965

 Score =  666 bits (1719), Expect = 0.0
 Identities = 327/377 (86%), Positives = 354/377 (93%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct: 1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct: 61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDFVDENSA TESDIEETL+RLV ++KKSP+EVFDALKNQT+DLV TAHPTQSVRRS
Sbjct: 121  LKKGDFVDENSAATESDIEETLRRLVHELKKSPEEVFDALKNQTIDLVFTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+ L QLY KDITPDD+QELDE  QREIQAAFRTDEIRRT PTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNWLLQLYAKDITPDDEQELDETXQREIQAAFRTDEIRRTAPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLY+SQIEDLMFE+SMWRC+DELR RADELHR+S++DAKHYIEFWKQVP
Sbjct: 301  DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRVRADELHRASKKDAKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            PNEPYRV+L DVRDKLY
Sbjct: 361  PNEPYRVVLADVRDKLY 377



>gb:BRJ223497_1634163 Brassica juncea mRNA for phosphoenolpyruvate
            carboxylase.
          Length = 964

 Score =  666 bits (1719), Expect = 0.0
 Identities = 329/374 (87%), Positives = 353/374 (94%), Gaps = 2/374 (0%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE YE SA
Sbjct: 6    LEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQELYEHSA 65

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKLKKG 503
            EYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +KLKKG
Sbjct: 66   EYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKKLKKG 125

Query: 504  DFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQK 683
            DFVDE+SA TESD+EET K+LV D+ KSP+E+FDALKNQTVDLVLTAHPTQSVRRSLLQK
Sbjct: 126  DFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRRSLLQK 185

Query: 684  HARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH 863
            H RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEI+RTPPTPQDEMRAGMSYFH
Sbjct: 186  HGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAGMSYFH 245

Query: 864  ETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 1043
            ETIWKGVP+FLRRVDTALKNIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL
Sbjct: 246  ETIWKGVPKFLRRVDTALKNIGIEERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 305

Query: 1044 LAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD-AKHYIEFWKQVPPNE 1220
            LA+MMA  +Y++QIEDLMFE+SMWRCNDELR RADELH + R+D AKHYIEFWK +PP E
Sbjct: 306  LARMMAATMYFNQIEDLMFELSMWRCNDELRVRADELHVNRRKDAAKHYIEFWKSIPPTE 365

Query: 1221 PYRVILGDVRDKLY 1262
            PYRV+LGDVRDKLY
Sbjct: 366  PYRVVLGDVRDKLY 379



>sp|P51062|CAPP_PEA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:PEASPARKLE_1699749 Pea mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  665 bits (1717), Expect = 0.0
 Identities = 328/377 (87%), Positives = 356/377 (94%), Gaps = 2/377 (0%)
 Frame = +3

Query: 138  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE 317
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct: 2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE 61

Query: 318  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK 497
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct: 62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK 121

Query: 498  KGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 677
            KGDF DE++A TESDIEETLK+LV +MKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL
Sbjct: 122  KGDFRDESNATTESDIEETLKKLVFNMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 181

Query: 678  QKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSY 857
            QKHAR+R+CL+QLY KDITPDDKQELDE+LQREIQAAFRTDEI+RTPPTPQDEMRAGMSY
Sbjct: 182  QKHARVRNCLSQLYAKDITPDDKQELDESLQREIQAAFRTDEIKRTPPTPQDEMRAGMSY 241

Query: 858  FHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 1037
            FHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct: 242  FHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 301

Query: 1038 CLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQVP 1211
            CLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+ELHR+S++D  AKHYIEFWK+VP
Sbjct: 302  CLLARMMAANLYYSQIEDLMFELSMWRCNDELRDRAEELHRNSKKDEVAKHYIEFWKKVP 361

Query: 1212 PNEPYRVILGDVRDKLY 1262
             NEPYRVILG VRDKLY
Sbjct: 362  LNEPYRVILGHVRDKLY 378



>gb:VFA011302_1727073 Vicia faba mRNA for
            phosphoenolpyruvate-carboxylase, pepc1 isoform.
          Length = 966

 Score =  665 bits (1715), Expect = 0.0
 Identities = 326/377 (86%), Positives = 356/377 (94%), Gaps = 2/377 (0%)
 Frame = +3

Query: 138  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE 317
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct: 2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE 61

Query: 318  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK 497
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct: 62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK 121

Query: 498  KGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 677
            KGDF DE++A TES+IEETLKRLV +MKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL
Sbjct: 122  KGDFRDESNATTESNIEETLKRLVFNMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 181

Query: 678  QKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSY 857
            QKHARIR+CL+ LY KDITPDDKQELDE+LQREIQAAFRTDEI+RTPPTPQDEMRAGMSY
Sbjct: 182  QKHARIRNCLSHLYAKDITPDDKQELDESLQREIQAAFRTDEIKRTPPTPQDEMRAGMSY 241

Query: 858  FHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 1037
            FHETIWKGVP+FLRRVDTALKN+GINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct: 242  FHETIWKGVPKFLRRVDTALKNVGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 301

Query: 1038 CLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQVP 1211
            CLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+ELHR+S++D  AKHYIEFWK+VP
Sbjct: 302  CLLARMMAANLYYSQIEDLMFELSMWRCNDELRDRAEELHRNSKKDEVAKHYIEFWKKVP 361

Query: 1212 PNEPYRVILGDVRDKLY 1262
             NEPYRV+LGD+RDKLY
Sbjct: 362  LNEPYRVVLGDIRDKLY 378



>gb:AF159051_1773194 Picea abies phosphoenolpyruvate carboxylase
            (PEPC-1) gene, PEPC-1b allele, complete cds.
          Length = 955

 Score =  664 bits (1713), Expect = 0.0
 Identities = 323/369 (87%), Positives = 350/369 (94%)
 Frame = +3

Query: 156  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE 335
            MASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQECYE S EYE
Sbjct: 1    MASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIREMVQECYERSGEYE 60

Query: 336  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVD 515
            G++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K+K+G F D
Sbjct: 61   GKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNKIKRGGFAD 120

Query: 516  ENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARI 695
            E++A TESDIEET KRLV  + KSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARI
Sbjct: 121  ESNATTESDIEETFKRLVNQLGKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARI 180

Query: 696  RDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW 875
            R+CL+QLY KDITPD+KQELDEAL REIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW
Sbjct: 181  RNCLSQLYGKDITPDEKQELDEALLREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW 240

Query: 876  KGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKM 1055
            KGVP+FLRR+DTALK+IGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+M
Sbjct: 241  KGVPKFLRRIDTALKSIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARM 300

Query: 1056 MATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVI 1235
            MA NLYYSQIEDLMFE+SMWRC+DELRARA +LH +S++DAKHYIEFWKQ+PPNEP+RVI
Sbjct: 301  MAANLYYSQIEDLMFELSMWRCSDELRARALQLHSASKKDAKHYIEFWKQIPPNEPFRVI 360

Query: 1236 LGDVRDKLY 1262
            LGDVRDKLY
Sbjct: 361  LGDVRDKLY 369



>gb:AF135371_1771078 Lotus corniculatus phosphoenol pyruvate
            carboxylase mRNA, complete cds.
          Length = 957

 Score =  664 bits (1712), Expect = 0.0
 Identities = 331/379 (87%), Positives = 357/379 (94%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE +HD +KLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct: 61   YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DEN+A TESDIEETLK+LV  +KKSPQEVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADENNATTESDIEETLKKLVFKLKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+ L+QLY KDITPDDKQELDEALQREIQAAFRTDEI+RTPPTPQDEMRAGM
Sbjct: 181  LLQKHARIRNSLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGN +VTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGN-QVTPEVTR 299

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA+NLYYSQIEDLMFE+SMWRCNDELR  ADELHR+S++D  AKHYIEFWK+
Sbjct: 300  DVCLLARMMASNLYYSQIEDLMFELSMWRCNDELRVHADELHRNSKKDEVAKHYIEFWKK 359

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            VPPNEPYRV+LG+VRD+LY
Sbjct: 360  VPPNEPYRVVLGEVRDRLY 378



>gb:AY663388_1620489 Lupinus albus phosphoenolpyruvate carboxylase 4
            mRNA, complete cds.
          Length = 968

 Score =  663 bits (1711), Expect = 0.0
 Identities = 322/376 (85%), Positives = 356/376 (94%), Gaps = 2/376 (0%)
 Frame = +3

Query: 141  RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL 320
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L++TVQE YEL
Sbjct: 5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDTVQEVYEL 64

Query: 321  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK 500
            S++YEG+HDPKKLEE+GNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct: 65   SSQYEGKHDPKKLEEIGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK 124

Query: 501  GDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQ 680
            G+F DE +A TESDIEETLKRLV D+KKSP EVFDALK+QTVDLVLTAHPTQS+RRSLLQ
Sbjct: 125  GNFADETNATTESDIEETLKRLVFDLKKSPHEVFDALKSQTVDLVLTAHPTQSIRRSLLQ 184

Query: 681  KHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYF 860
            KHARIRDCL+ LY KDITPDDK+ELDEALQREIQAAFRTDEI+RTPPTPQDEMRAGMSYF
Sbjct: 185  KHARIRDCLSHLYAKDITPDDKKELDEALQREIQAAFRTDEIKRTPPTPQDEMRAGMSYF 244

Query: 861  HETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVC 1040
            HETIWKGVP+FLRRVDTALKNIGINE +P+NAP+IQFSSWMGGDRDGNPRVTPEVTRDVC
Sbjct: 245  HETIWKGVPKFLRRVDTALKNIGINECIPHNAPVIQFSSWMGGDRDGNPRVTPEVTRDVC 304

Query: 1041 LLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQVPP 1214
            LLA+MMA N+YYSQIEDLMFE+SMWRC+DELR RADELHRSS +D  AKHYIEFWK+VP 
Sbjct: 305  LLARMMAANMYYSQIEDLMFELSMWRCSDELRNRADELHRSSNKDEVAKHYIEFWKKVPA 364

Query: 1215 NEPYRVILGDVRDKLY 1262
            NEPYRV+LG+VRD+LY
Sbjct: 365  NEPYRVVLGEVRDRLY 380



>gb:BRJ223496_1634162 Brassica juncea mRNA for phosphoenolpyruvate
            carboxylase.
          Length = 964

 Score =  661 bits (1705), Expect = 0.0
 Identities = 327/374 (87%), Positives = 351/374 (93%), Gaps = 2/374 (0%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE YE SA
Sbjct: 6    LEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQELYEHSA 65

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKLKKG 503
            EYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +KLKKG
Sbjct: 66   EYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKKLKKG 125

Query: 504  DFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQK 683
            DFVDE+SA TESD+EET K+LV D+ KSP+E+FDALKNQTVDLVLTAHP QSVRRSLLQK
Sbjct: 126  DFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPPQSVRRSLLQK 185

Query: 684  HARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFH 863
            H RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEI+RTPPTPQDEMRAGMSYFH
Sbjct: 186  HGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAGMSYFH 245

Query: 864  ETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 1043
            ETIWKGVP+FLRRVDTALKNIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL
Sbjct: 246  ETIWKGVPKFLRRVDTALKNIGIEERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 305

Query: 1044 LAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD-AKHYIEFWKQVPPNE 1220
            LA+MMA  +Y++QIEDLMFE+SMWRCNDELR RADELH + R+D AKHYIEFWK +P  E
Sbjct: 306  LARMMAATMYFNQIEDLMFELSMWRCNDELRVRADELHVNRRKDAAKHYIEFWKSIPTTE 365

Query: 1221 PYRVILGDVRDKLY 1262
            PYRV+LGDVRDKLY
Sbjct: 366  PYRVVLGDVRDKLY 379



>gb:AB092821_1525120 Lotus corniculatus var. japonicus LjPEPC2 mRNA
            for phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  660 bits (1704), Expect = 0.0
 Identities = 328/379 (86%), Positives = 353/379 (93%), Gaps = 2/379 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct: 1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEV 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE +H+P++LE LGN++TSLD GDSIV+AKSF+HMLNLANLAEEVQIA+RRR K
Sbjct: 61   YELSAEYERKHEPQRLEVLGNLITSLDAGDSIVVAKSFAHMLNLANLAEEVQIAHRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DE +A TESDIEET K+LV +MKKSPQEVFD LKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFADEGNATTESDIEETFKKLVGEMKKSPQEVFDELKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTAPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQ 1205
            DVCLLA+MMA NLYYSQIEDLMFE+SMWRCNDELR RA+EL  SS +D  AKHYIEFWK 
Sbjct: 301  DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELTSSSNKDAVAKHYIEFWKN 360

Query: 1206 VPPNEPYRVILGDVRDKLY 1262
            +PP+EPYRV+LG+VR++LY
Sbjct: 361  IPPSEPYRVVLGEVRNRLY 379



>gb:VPPPCGE1_1727330 V.planifolia mRNA for phosphoenolpyruvate
            carboxylase, air roots.
          Length = 956

 Score =  659 bits (1701), Expect = 0.0
 Identities = 329/368 (89%), Positives = 348/368 (94%)
 Frame = +3

Query: 159  ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEG 338
            +SIDAQLRLL P KVSEDDKLVEY  LLLDRFLDILQDLHGE +RETVQE YELSAEYE 
Sbjct: 3    SSIDAQLRLLAPAKVSEDDKLVEYVRLLLDRFLDILQDLHGEVVRETVQELYELSAEYES 62

Query: 339  RHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDE 518
            +HDPKKL+ELGN+L SLDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KLKKGDFVDE
Sbjct: 63   KHDPKKLDELGNLLISLDPGNSIVIASSFSHMLNLANLAEEVQIAHRRRIKLKKGDFVDE 122

Query: 519  NSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIR 698
            NSA TESDIEETLKRLV D+KKSP+EVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIR
Sbjct: 123  NSATTESDIEETLKRLVHDLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIR 182

Query: 699  DCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWK 878
            +CLAQLY KDITPDDKQELDEAL+    AAFRTDEIRRTPPTPQDEMRAGMSYFHETIWK
Sbjct: 183  NCLAQLYAKDITPDDKQELDEALKGG-SAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWK 241

Query: 879  GVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMM 1058
            GVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+MM
Sbjct: 242  GVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMM 301

Query: 1059 ATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVIL 1238
            A NLY+SQIEDLMFE+SMWRC+DELR RADELHRSS+RDAKH+IEFWKQVPPNEPYRV+L
Sbjct: 302  AANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSKRDAKHFIEFWKQVPPNEPYRVVL 361

Query: 1239 GDVRDKLY 1262
             DVRDKLY
Sbjct: 362  ADVRDKLY 369



>gb:AP005802_1858075 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OSJNBa0057D11.
          Length = 972

 Score =  659 bits (1700), Expect = 0.0
 Identities = 320/372 (86%), Positives = 355/372 (95%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            +E+++SIDAQLR LVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L++ VQECYE++A
Sbjct: 13   VERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKDLVQECYEVAA 72

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD 506
            EYE +HD +KL+ELGN++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct: 73   EYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKGD 132

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DENSA+TESDIEETLKRLV D+KKSP EVFDALK+QTVDLVLTAHPTQSVRRSLLQKH
Sbjct: 133  FADENSAMTESDIEETLKRLVFDLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRSLLQKH 192

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            +RIR+CL QLY+KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHE
Sbjct: 193  SRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHE 252

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRRVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 253  TIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 312

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA NLY SQIEDLMFE+SMWRCN+ELR+RAD+LHRSS++DAKHYIEFWK+VP NEPY
Sbjct: 313  ARMMAANLYCSQIEDLMFELSMWRCNEELRSRADDLHRSSKKDAKHYIEFWKKVPLNEPY 372

Query: 1227 RVILGDVRDKLY 1262
            RVIL DVRDKLY
Sbjct: 373  RVILSDVRDKLY 384



>gb:LES313434_1684576 Lycopersicon esculentum ppc2 gene for
            phosphoenolpyruvate carboxylase 2, exons 1-10.
          Length = 964

 Score =  657 bits (1695), Expect = 0.0
 Identities = 321/377 (85%), Positives = 351/377 (93%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK ASIDAQ+RLLVP KVSEDD LVEYDALLLDRFLDIL+DLHGE ++ TVQEC
Sbjct: 1    MATRNLEKFASIDAQMRLLVPTKVSEDDMLVEYDALLLDRFLDILEDLHGEGIKTTVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE  HD KKLEELG+VLT+LDPGDSIV+AKS SHMLN+ANLAEEVQIA   R K
Sbjct: 61   YELSAEYENTHDKKKLEELGSVLTTLDPGDSIVVAKSISHMLNMANLAEEVQIANSGRAK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
             KKG+  DE++ +TESDIEETLKRLVV++ KSP+EVF+ALKNQTVDLV TAHPTQ++RRS
Sbjct: 121  SKKGELSDESNLMTESDIEETLKRLVVNLNKSPREVFNALKNQTVDLVFTAHPTQAIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+CL+QLY KDITPDDK+ELDEAL+REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHARIRNCLSQLYAKDITPDDKEELDEALEREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLYYSQI+DLMFE+SMWRCNDELR RADELHRS +RD KHYIEFWKQVP
Sbjct: 301  DVCLLARMMAANLYYSQIDDLMFELSMWRCNDELRDRADELHRSLKRDEKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P+EPYRVI+GDVRDKLY
Sbjct: 361  PSEPYRVIIGDVRDKLY 377



>gb:LES243417_1684495 Lycopersicon esculentum mRNA for
            phosphoenolpyruvate carboxylase 2 (ppc2 gene).
          Length = 964

 Score =  657 bits (1695), Expect = 0.0
 Identities = 321/377 (85%), Positives = 351/377 (93%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA RNLEK ASIDAQ+RLLVP KVSEDD LVEYDALLLDRFLDIL+DLHGE ++ TVQEC
Sbjct: 1    MATRNLEKFASIDAQMRLLVPTKVSEDDMLVEYDALLLDRFLDILEDLHGEGIKTTVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE  HD KKLEELG+VLT+LDPGDSIV+AKS SHMLN+ANLAEEVQIA   R K
Sbjct: 61   YELSAEYENTHDKKKLEELGSVLTTLDPGDSIVVAKSISHMLNMANLAEEVQIANSGRAK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
             KKG+  DE++ +TESDIEETLKRLVV++ KSP+EVF+ALKNQTVDLV TAHPTQ++RRS
Sbjct: 121  SKKGELSDESNLMTESDIEETLKRLVVNLNKSPREVFNALKNQTVDLVFTAHPTQAIRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+CL+QLY KDITPDDK+ELDEAL+REIQAAFRTDEIRRTPPTPQDEMRAGM
Sbjct: 181  LLQKHARIRNCLSQLYAKDITPDDKEELDEALEREIQAAFRTDEIRRTPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA NLYYSQI+DLMFE+SMWRCNDELR RADELHRS +RD KHYIEFWKQVP
Sbjct: 301  DVCLLARMMAANLYYSQIDDLMFELSMWRCNDELRDRADELHRSLKRDEKHYIEFWKQVP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P+EPYRVI+GDVRDKLY
Sbjct: 361  PSEPYRVIIGDVRDKLY 377



>sp|P29193|CAP1_SACHY Phosphoenolpyruvate carboxylase, housekeeping
            isozyme (EC 4.1.1.31) (PEPCase).>pir|S28614|S28614
            phosphoenolpyruvate carboxylase (EC 4.1.1.31) - sugarcane
            hybrid H32-8560>gb:SCFSCPEPCD_1708333 Saccharum hybrid
            cultivar H32-8560 phosphoenolpyruvate carboxylase
            (SCPEPCD1) gene, complete cds.
          Length = 966

 Score =  656 bits (1693), Expect = 0.0
 Identities = 324/378 (85%), Positives = 350/378 (92%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA   ++K  SIDAQLRLL P K+S+DDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct: 1    MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct: 61   YELAAEYENKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDFVDENSA TESDIEETLKRL+  +KKSP EVFDALKNQTVDLVLTAHPTQSVRRS
Sbjct: 121  LKKGDFVDENSATTESDIEETLKRLMHQLKKSPLEVFDALKNQTVDLVLTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+CL QLY KDITPD+KQELDEALQREIQAAFRTDEIRR PPTPQDEMRAGM
Sbjct: 181  LLQKHGRIRNCLTQLYAKDITPDEKQELDEALQREIQAAFRTDEIRRAPPTPQDEMRAGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAP+IQFSSWMGGDRDGNPRVTPE+TR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPIIQFSSWMGGDRDGNPRVTPEITR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD-AKHYIEFWKQV 1208
            DVCLLA+MMA NLY +QIEDLMFE+SMWRC+DELR + DELHRSS++D  KHYIEFWKQV
Sbjct: 301  DVCLLARMMAANLYNAQIEDLMFELSMWRCSDELRVKVDELHRSSKKDTTKHYIEFWKQV 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PP+EPYRVIL DVRDKLY
Sbjct: 361  PPSEPYRVILSDVRDKLY 378



>gb:AY210895_1589694 Arabidopsis thaliana phosphoenolpyruvate
            carboxylase mRNA, complete cds.
          Length = 963

 Score =  655 bits (1691), Expect = 0.0
 Identities = 328/378 (86%), Positives = 353/378 (93%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct: 1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct: 61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDF DE SA TESDIEETLKRL+  + K+P+EVFDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFADEASATTESDIEETLKRLL-QLNKTPEEVFDALKNQTVDLVLTAHPTQSVRR 179

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQK  RIRDCL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 180  SLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 239

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 240  MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 299

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA NLY+SQIEDLMFEMSMWRCN+ELR RA E  R ++RDAKHYIEFWKQ+
Sbjct: 300  RDVCLLARMMAANLYFSQIEDLMFEMSMWRCNEELRVRA-ERQRCAKRDAKHYIEFWKQI 358

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            P NEPYR ILGDVRDKLY
Sbjct: 359  PANEPYRAILGDVRDKLY 376



>gb:ATH532902_1552867 Arabidopsis thaliana mRNA for
            phosphoenolpyruvate carboxylase (ppc2 gene).
          Length = 963

 Score =  655 bits (1691), Expect = 0.0
 Identities = 328/378 (86%), Positives = 353/378 (93%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct: 1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct: 61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDF DE SA TESDIEETLKRL+  + K+P+EVFDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFADEASATTESDIEETLKRLL-QLNKTPEEVFDALKNQTVDLVLTAHPTQSVRR 179

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQK  RIRDCL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 180  SLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 239

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 240  MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 299

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA NLY+SQIEDLMFEMSMWRCN+ELR RA E  R ++RDAKHYIEFWKQ+
Sbjct: 300  RDVCLLARMMAANLYFSQIEDLMFEMSMWRCNEELRVRA-ERQRCAKRDAKHYIEFWKQI 358

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            P NEPYR ILGDVRDKLY
Sbjct: 359  PANEPYRAILGDVRDKLY 376



>pir|H84855|H84855 phosphoenolpyruvate carboxylase [imported] -
            Arabidopsis thaliana>gb:AC007087_1535214 Arabidopsis
            thaliana chromosome 2 clone F14N22 map mi551, complete
            sequence.
          Length = 941

 Score =  655 bits (1691), Expect = 0.0
 Identities = 328/378 (86%), Positives = 353/378 (93%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct: 1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct: 61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDF DE SA TESDIEETLKRL+  + K+P+EVFDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFADEASATTESDIEETLKRLL-QLNKTPEEVFDALKNQTVDLVLTAHPTQSVRR 179

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQK  RIRDCL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 180  SLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 239

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 240  MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 299

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA NLY+SQIEDLMFEMSMWRCN+ELR RA E  R ++RDAKHYIEFWKQ+
Sbjct: 300  RDVCLLARMMAANLYFSQIEDLMFEMSMWRCNEELRVRA-ERQRCAKRDAKHYIEFWKQI 358

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            P NEPYR ILGDVRDKLY
Sbjct: 359  PANEPYRAILGDVRDKLY 376



>gb:AB012228_1511657 Zea mays mRNA for phosphoenolpyruvate
            carboxylase, complete cds.
          Length = 960

 Score =  646 bits (1666), Expect = 0.0
 Identities = 322/371 (86%), Positives = 341/371 (91%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQECYELSAE
Sbjct: 3    ERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELSAE 62

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDF 509
            YE   D  +L ELG+ LTSL PGDSIV+A SFSHMLNLANLAEEVQIA+RRR KLK+GDF
Sbjct: 63   YENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIKLKRGDF 122

Query: 510  VDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHA 689
             DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQSVRRSLLQKH 
Sbjct: 123  ADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQKHG 182

Query: 690  RIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 869
            RIR+CL QLY KDIT DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET
Sbjct: 183  RIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 242

Query: 870  IWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 1049
            IWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA
Sbjct: 243  IWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 302

Query: 1050 KMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYR 1229
            +MMA NLY+SQIEDLMFE+SMWRC+DELR RADELHRSSR+ AKHYIEFWKQVPPNEPYR
Sbjct: 303  RMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSRKAAKHYIEFWKQVPPNEPYR 362

Query: 1230 VILGDVRDKLY 1262
            VILGDVRDKLY
Sbjct: 363  VILGDVRDKLY 373



>sp|P29195|CAP1_SORBI Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31)
            (PEPCase 1) (CP21).>pir|S31159|S31159 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) CP21 -
            sorghum>gb:SVPEPCA_1723257 Sorghum vulgare mRNA for
            phosphoenolpyruvate carboxylase
            (PEPC).>gb:SVPEPCGX_1723260 S.vulgare pepC gene for PEP
            carboxylase.
          Length = 960

 Score =  644 bits (1662), Expect = 0.0
 Identities = 321/371 (86%), Positives = 340/371 (91%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQECYELSAE
Sbjct: 3    ERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELSAE 62

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDF 509
            YE   D  +L ELG+ LTSL PGDSIV+A SFSHMLNLANLAEEVQ+A RRR KLK+GDF
Sbjct: 63   YENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQVAQRRRIKLKRGDF 122

Query: 510  VDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHA 689
             DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQSVRRSLLQKH 
Sbjct: 123  ADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQKHG 182

Query: 690  RIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 869
            RIR+CL QLY KDIT DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET
Sbjct: 183  RIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 242

Query: 870  IWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 1049
            IWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA
Sbjct: 243  IWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 302

Query: 1050 KMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYR 1229
            +MMA NLY+SQIEDLMFE+SMWRC+DELR RADELHRSS+R AKHYIEFWKQVPPNEPYR
Sbjct: 303  RMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSKRAAKHYIEFWKQVPPNEPYR 362

Query: 1230 VILGDVRDKLY 1262
            VILGDVRDKLY
Sbjct: 363  VILGDVRDKLY 373



>sp|P10490|CAP1_MESCR Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31)
            (PEPCase 1).>pir|S05506|QYIX1 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) 1 - common ice
            plant>gb:MCPPCA_1685804 Mesembryanthemum crystallinum
            ppc1 gene for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).>gb:MCPPCR_1685806 Mesembryanthemum
            crystallinum mRNA for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).
          Length = 966

 Score =  644 bits (1660), Expect = 0.0
 Identities = 312/378 (82%), Positives = 352/378 (93%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            M+   L+++ SIDAQLRLL P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+++ETVQE 
Sbjct: 1    MSTVKLDRLTSIDAQLRLLAPKKVSEDDKLIEYDALLLDRFLDILQNLHGEDIKETVQEL 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YE SAEYE  HDPKKLEELG+++TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ R+R +
Sbjct: 61   YEQSAEYERTHDPKKLEELGSMVTSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRKRVK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            K+KKGDF+DEN+A+TESD+EETL+RL+VD+KKSPQE+F+ LKNQTVDLV TAHPTQSVRR
Sbjct: 121  KVKKGDFMDENTAMTESDMEETLRRLIVDLKKSPQEIFETLKNQTVDLVFTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCLAQLY KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAG
Sbjct: 181  SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIW GVP+FLRR+DTALKNIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWNGVPKFLRRLDTALKNIGITERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA N+Y+SQI++LMFE+SMWRC DELR RA+ELH+ S+RD+KHYIEFWKQ+
Sbjct: 301  RDVCLLARMMAANMYFSQIDELMFELSMWRCTDELRERAEELHKYSKRDSKHYIEFWKQI 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            P +EPYRVIL DVRDKLY
Sbjct: 361  PSSEPYRVILADVRDKLY 378



>gb:AB085948_1524434 Eleocharis vivipara pep1 mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 968

 Score =  642 bits (1656), Expect = 0.0
 Identities = 318/378 (84%), Positives = 347/378 (91%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA +N+EK+ASIDA LRLL P KVSEDDKLVEYDALLLDRFLDILQ LHGE+L+ETVQEC
Sbjct: 1    MATKNVEKLASIDAHLRLLAPKKVSEDDKLVEYDALLLDRFLDILQALHGEDLKETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YEL+AEYE   D  KL+ELGNVL SLD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR +
Sbjct: 61   YELAAEYEKNLDQAKLDELGNVLMSLDAGDSIVLAKSFSHMLNLANLAEEVQIAYRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDF DENSA TESD++ETL RLV D+ KSP E+F+ALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFGDENSATTESDLDETLMRLVSDLNKSPAEIFEALKNQTVDLVLTAHPTQSVRR 180

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKHAR+RDCLAQL  KDITPDDKQE+DEALQ  IQAAFRTDEIRR PPTPQDEMRAG
Sbjct: 181  SLLQKHARVRDCLAQLNEKDITPDDKQEIDEALQGAIQAAFRTDEIRRAPPTPQDEMRAG 240

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALK+IGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 241  MSYFHETIWKGVPKFLRRVDTALKDIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 300

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA++MA N+YYSQIEDLMFE+SMWRC++ELR R + LH S ++D KHYIEFWK+V
Sbjct: 301  RDVCLLARLMAANMYYSQIEDLMFELSMWRCSEELRQRVELLHSSIKKDNKHYIEFWKKV 360

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PPNEPYRVILGDVR+KLY
Sbjct: 361  PPNEPYRVILGDVRNKLY 378



>gb:AY491400_1608695 Setaria italica C3 phosphoenolpyruvate
            carboxylase (ppc1) mRNA, complete cds.
          Length = 961

 Score =  641 bits (1653), Expect = 0.0
 Identities = 320/371 (86%), Positives = 339/371 (91%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQECYELSAE
Sbjct: 4    ERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELSAE 63

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDF 509
            YE   D  +L ELG+ LTSL PGDSIV+A SFSHMLNLANLAEEVQIA+RRR KLK+GDF
Sbjct: 64   YENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIKLKRGDF 123

Query: 510  VDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHA 689
             DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQ VRRSLLQKH 
Sbjct: 124  ADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQPVRRSLLQKHG 183

Query: 690  RIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 869
            RIR+CL QLY KDIT DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET
Sbjct: 184  RIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 243

Query: 870  IWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 1049
            IWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA
Sbjct: 244  IWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 303

Query: 1050 KMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYR 1229
            +MMA NLY+SQIEDLMFE+SMWRC+DELR RADEL RSS+R AKHYIEFWKQVPPNEPYR
Sbjct: 304  RMMAANLYFSQIEDLMFELSMWRCSDELRIRADELRRSSKRAAKHYIEFWKQVPPNEPYR 363

Query: 1230 VILGDVRDKLY 1262
            VILGDVRDKLY
Sbjct: 364  VILGDVRDKLY 374



>gb:AY251482_1592766 Echinochloa crus-galli phosphoenolpyruvate
            carboxylase (ppc) mRNA, complete cds.
          Length = 961

 Score =  640 bits (1652), Expect = 0.0
 Identities = 318/371 (85%), Positives = 341/371 (91%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQECYELSAE
Sbjct: 4    ERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELSAE 63

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDF 509
            YE   D  +L ELG+ LTSL PG+SIV+A SFSHMLNLANLAEEVQIA+RRR KLK+GDF
Sbjct: 64   YENDRDEARLGELGSKLTSLPPGESIVVASSFSHMLNLANLAEEVQIAHRRRIKLKRGDF 123

Query: 510  VDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHA 689
             DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQSVRRSLLQKH 
Sbjct: 124  ADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQKHG 183

Query: 690  RIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 869
            RIR+CL QLY KDIT DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET
Sbjct: 184  RIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 243

Query: 870  IWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 1049
            IWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA
Sbjct: 244  IWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 303

Query: 1050 KMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYR 1229
            +MMA NLY+SQIEDLMFE+SMWRC+DELR RAD+LHRS++R A+HYIEFWKQVPPNEPYR
Sbjct: 304  RMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHRSTKRAAEHYIEFWKQVPPNEPYR 363

Query: 1230 VILGDVRDKLY 1262
            VILGDVRDKLY
Sbjct: 364  VILGDVRDKLY 374



>gb:AP004117_1837801 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1134_F06.
          Length = 968

 Score =  640 bits (1651), Expect = 0.0
 Identities = 317/372 (85%), Positives = 340/372 (91%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            +E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQECYELSA
Sbjct: 10   MERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELSA 69

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD 506
            EYE   D  +L+ELG  LTSL PGDSIV++ SFSHMLNLANLAEEVQIA+RRR KLK+GD
Sbjct: 70   EYENDRDEARLDELGRKLTSLPPGDSIVVSSSFSHMLNLANLAEEVQIAHRRRIKLKRGD 129

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQSVRRSLLQKH
Sbjct: 130  FADEASAPTESDIEETLKRLVTQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQKH 189

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
             RIR+CL QLY KDIT DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE
Sbjct: 190  GRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 249

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 250  TIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 309

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA NLY+SQIEDLMFE+SMWRC+DELR RAD+LH SSR+ AKHYIEFWKQ+PPNEPY
Sbjct: 310  ARMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHCSSRKAAKHYIEFWKQIPPNEPY 369

Query: 1227 RVILGDVRDKLY 1262
            RVILG VRDKLY
Sbjct: 370  RVILGGVRDKLY 381



>gb:AP004117_1837800 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1134_F06.
          Length = 452

 Score =  640 bits (1651), Expect = 0.0
 Identities = 317/372 (85%), Positives = 340/372 (91%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            +E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQECYELSA
Sbjct: 10   MERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELSA 69

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD 506
            EYE   D  +L+ELG  LTSL PGDSIV++ SFSHMLNLANLAEEVQIA+RRR KLK+GD
Sbjct: 70   EYENDRDEARLDELGRKLTSLPPGDSIVVSSSFSHMLNLANLAEEVQIAHRRRIKLKRGD 129

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQSVRRSLLQKH
Sbjct: 130  FADEASAPTESDIEETLKRLVTQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQKH 189

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
             RIR+CL QLY KDIT DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE
Sbjct: 190  GRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 249

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 250  TIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 309

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA NLY+SQIEDLMFE+SMWRC+DELR RAD+LH SSR+ AKHYIEFWKQ+PPNEPY
Sbjct: 310  ARMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHCSSRKAAKHYIEFWKQIPPNEPY 369

Query: 1227 RVILGDVRDKLY 1262
            RVILG VRDKLY
Sbjct: 370  RVILGGVRDKLY 381



>gb:AF271995_1782197 Oryza sativa phosphoenolpyruvate carboxylase
            mRNA, complete cds.
          Length = 959

 Score =  640 bits (1651), Expect = 0.0
 Identities = 317/372 (85%), Positives = 340/372 (91%)
 Frame = +3

Query: 147  LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA 326
            +E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQECYELSA
Sbjct: 1    MERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECYELSA 60

Query: 327  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD 506
            EYE   D  +L+ELG  LTSL PGDSIV++ SFSHMLNLANLAEEVQIA+RRR KLK+GD
Sbjct: 61   EYENDRDEARLDELGRKLTSLPPGDSIVVSSSFSHMLNLANLAEEVQIAHRRRIKLKRGD 120

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQSVRRSLLQKH
Sbjct: 121  FADEASAPTESDIEETLKRLVTQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQKH 180

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
             RIR+CL QLY KDIT DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE
Sbjct: 181  GRIRNCLRQLYAKDITADDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 240

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 241  TIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 300

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA NLY+SQIEDLMFE+SMWRC+DELR RAD+LH SSR+ AKHYIEFWKQ+PPNEPY
Sbjct: 301  ARMMAANLYFSQIEDLMFELSMWRCSDELRIRADDLHCSSRKAAKHYIEFWKQIPPNEPY 360

Query: 1227 RVILGDVRDKLY 1262
            RVILG VRDKLY
Sbjct: 361  RVILGGVRDKLY 372



>gb:WWPPC_1727779 W.mirabilis mRNA for phosphoenolpyruvate
            carboxylase.
          Length = 944

 Score =  633 bits (1632), Expect = e-180
 Identities = 320/369 (86%), Positives = 342/369 (92%), Gaps = 2/369 (0%)
 Frame = +3

Query: 162  SIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGR 341
            SIDAQLRLLVP KVSEDDKL+EYDALL+DRFLDILQDLHGE +RETVQECYELS EYEG+
Sbjct: 1    SIDAQLRLLVPTKVSEDDKLIEYDALLMDRFLDILQDLHGEEIRETVQECYELSGEYEGK 60

Query: 342  HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK-LKKGDFVDE 518
             D  KLEELG VLTSLD GDSIV+A + SHMLNLANLAEEVQIAYRRR K  KKGDF DE
Sbjct: 61   FDTAKLEELGGVLTSLDAGDSIVVA-ALSHMLNLANLAEEVQIAYRRRIKHKKKGDFADE 119

Query: 519  NSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPT-QSVRRSLLQKHARI 695
            NSA TESDIEET KRLV  + +SPQEVFDALKNQT+DLVLTAHPT QSV  SLLQKH RI
Sbjct: 120  NSATTESDIEETFKRLVNQLGRSPQEVFDALKNQTIDLVLTAHPTHQSV--SLLQKHGRI 177

Query: 696  RDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW 875
            R+CL+QLY KDITPD+KQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW
Sbjct: 178  RNCLSQLYAKDITPDEKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW 237

Query: 876  KGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKM 1055
            KGVP+FLRRVDTALK+IGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+M
Sbjct: 238  KGVPKFLRRVDTALKSIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARM 297

Query: 1056 MATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVI 1235
            MATNLYYSQIEDLMFE+SMWRC+DELR RA +LH S++RDAKHYIEFWKQVPPNEP+RVI
Sbjct: 298  MATNLYYSQIEDLMFELSMWRCSDELRQRALQLHNSAKRDAKHYIEFWKQVPPNEPFRVI 357

Query: 1236 LGDVRDKLY 1262
            LGDVRDKLY
Sbjct: 358  LGDVRDKLY 366



>gb:VPPPCGEN_1727331 V.planifolia mRNA for phosphoenolpyruvate
            carboxylase, leaf.
          Length = 958

 Score =  632 bits (1631), Expect = e-180
 Identities = 315/370 (85%), Positives = 340/370 (91%), Gaps = 1/370 (0%)
 Frame = +3

Query: 156  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE 335
            +ASIDAQLRLL P KVSEDDKL+EY +LLLDRFLDILQDLHGE LRETVQE YELS+EYE
Sbjct: 2    LASIDAQLRLLAPAKVSEDDKLLEYVSLLLDRFLDILQDLHGEVLRETVQELYELSSEYE 61

Query: 336  GRHDPKKLE-ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFV 512
             +HDPKK    LG +L +LDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KLKKGDF 
Sbjct: 62   SKHDPKKFGMNLGILLITLDPGNSIVIASSFSHMLNLANLAEEVQIAFRRRIKLKKGDFA 121

Query: 513  DENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHAR 692
            DE SA TESD EETLKRLV  +KK+PQE+FDALK+QTVDLVLTAHPTQSVRRSLLQKH R
Sbjct: 122  DEASATTESDFEETLKRLVGKLKKTPQEIFDALKSQTVDLVLTAHPTQSVRRSLLQKHGR 181

Query: 693  IRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 872
            IR+CL QLY KDITPDDKQELDEAL REIQAAFRTDEIRR PPTPQDEMRAGMSYFHETI
Sbjct: 182  IRNCLTQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRIPPTPQDEMRAGMSYFHETI 241

Query: 873  WKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAK 1052
            WKGVP+FLRRVDTALKN+GINER+PYNAPLIQFS WMGGDRDGNPRVTPEVTRDVCLLA+
Sbjct: 242  WKGVPQFLRRVDTALKNLGINERLPYNAPLIQFSPWMGGDRDGNPRVTPEVTRDVCLLAR 301

Query: 1053 MMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRV 1232
            MMA NLY+SQIEDLMFE+SMW C+DELR RADEL+ SS++DAKHYIEFWK+VPPNEPYRV
Sbjct: 302  MMAANLYFSQIEDLMFELSMWPCSDELRLRADELNVSSKKDAKHYIEFWKKVPPNEPYRV 361

Query: 1233 ILGDVRDKLY 1262
            ILGDVRDKLY
Sbjct: 362  ILGDVRDKLY 371



>sp|Q43299|CAPP_AMAHP Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:AHC4PHPEC_1811112 A.hypochondriacus mRNA
            for C4 photosynthetic phosphoenolpyruvate
            carboxylase.>gb:AMHCPPC_1819229 Amaranthus
            hypochondriacus C4 photosynthetic phosphoenolpyruvate
            carboxylase mRNA, complete cds.
          Length = 964

 Score =  632 bits (1629), Expect = e-180
 Identities = 316/378 (83%), Positives = 342/378 (90%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA+  +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDIL+ LHG  +RETVQE 
Sbjct: 1    MASGKVEKMASIDAQLRLLAPKKVSEDDKLVEYDALLLDRFLDILESLHGSGIRETVQEL 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YE +AEYE  HD KKLEELGN++TSLD GDSIVIAKSFS MLNLANLAEEVQ+AYRRR +
Sbjct: 61   YEHAAEYERTHDTKKLEELGNLITSLDAGDSIVIAKSFSQMLNLANLAEEVQLAYRRRIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            K KKGDF DE+SAITESD EETL+RLV D+KKSP+E+F  LKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KTKKGDFADESSAITESDFEETLRRLV-DLKKSPEEIFATLKNQTVDLVLTAHPTQSVRR 179

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQKH RIRDCL+QLY KDI+PDDKQELDEALQR IQAAFRTDEIRR  PTPQDEMR G
Sbjct: 180  SLLQKHGRIRDCLSQLYAKDISPDDKQELDEALQRAIQAAFRTDEIRRVQPTPQDEMRMG 239

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYN PLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 240  MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNVPLIQFSSWMGGDRDGNPRVTPEVT 299

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDV LLA+MMA N+Y++QI DLMFE+SMWRCNDE+RARA ELH  S+ DAKHYIEFWKQ+
Sbjct: 300  RDVVLLARMMAANMYFTQITDLMFELSMWRCNDEVRARAQELHSQSKSDAKHYIEFWKQI 359

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            P +EPYRVILGDVRDKLY
Sbjct: 360  PLSEPYRVILGDVRDKLY 377



>pir|JH0381|JH0381 phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            sorghum
          Length = 960

 Score =  630 bits (1625), Expect = e-179
 Identities = 317/372 (85%), Positives = 337/372 (90%), Gaps = 1/372 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQDLHG +LRE VQEC ELSAE
Sbjct: 3    ERHQSIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQDLHGPHLREFVQECTELSAE 62

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDF 509
            YE   D  +L ELG+ LTSL PGDSIV+A SFSHMLNLANLAEEVQ+A RRR KLK+GDF
Sbjct: 63   YENDRDEARLGELGSKLTSLPPGDSIVVASSFSHMLNLANLAEEVQVAQRRRIKLKRGDF 122

Query: 510  VDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHA 689
             DE SA TESDIEETLKRLV  + KS +EVFDALKNQTVDLV TAHPTQSVRRSLLQKH 
Sbjct: 123  ADEASAPTESDIEETLKRLVSQLGKSREEVFDALKNQTVDLVFTAHPTQSVRRSLLQKHG 182

Query: 690  RIRDCLAQLYNKDITPDDKQ-ELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            RIR+CL QLY KDIT DDKQ  L +ALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE
Sbjct: 183  RIRNCLRQLYAKDITADDKQGSLTKALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 242

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            TIWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 243  TIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 302

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPY 1226
            A+MMA NLY+SQIEDLMFE+SMWRC+DELR RADELHRSS+R AKHYIEFWKQVPPNEPY
Sbjct: 303  ARMMAANLYFSQIEDLMFELSMWRCSDELRIRADELHRSSKRAAKHYIEFWKQVPPNEPY 362

Query: 1227 RVILGDVRDKLY 1262
            RVILGDVRDKLY
Sbjct: 363  RVILGDVRDKLY 374



>gb:AF530570_1809082 X Mokara cv. 'Yellow' phosphoenolpyruvate
            carboxylase (PEPC) mRNA, complete cds.
          Length = 954

 Score =  622 bits (1605), Expect = e-177
 Identities = 306/377 (81%), Positives = 341/377 (90%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA  ++ K+ S+DA LRLL PGKVS+DDKLVEYDA+LLDRFL+I+QDLHGE +RETVQEC
Sbjct: 1    MAKASVAKLPSMDAHLRLLAPGKVSDDDKLVEYDAMLLDRFLEIVQDLHGEGIRETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YELSAEYE  HD KKL+ELGNVLTSL+PGDSIV+A SFSHMLNLANLAEEVQIA RRR K
Sbjct: 61   YELSAEYERTHDSKKLDELGNVLTSLEPGDSIVVASSFSHMLNLANLAEEVQIAQRRRTK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
             KKG F        ES++EET KRL+ ++KK+P+E+FDALKNQTVDLV TAHPTQS+RRS
Sbjct: 121  PKKGYF--------ESNLEETFKRLIGELKKTPEEIFDALKNQTVDLVFTAHPTQSIRRS 172

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR+ L QL  KDITPD+KQELDEALQREIQAAFRTDEIRRT P PQDEMRAGM
Sbjct: 173  LLQKHGRIRNSLTQLCAKDITPDEKQELDEALQREIQAAFRTDEIRRTQPQPQDEMRAGM 232

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTA K+IGINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 233  SYFHETIWKGVPKFLRRVDTAPKSIGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 292

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA++MA NLY+SQIEDLMFE+SMWRC+DELR RADELHRSS++DAKHYIEFWK+VP
Sbjct: 293  DVCLLARLMAANLYFSQIEDLMFELSMWRCSDELRLRADELHRSSKKDAKHYIEFWKKVP 352

Query: 1212 PNEPYRVILGDVRDKLY 1262
            P+EPYRVILGDVRDKLY
Sbjct: 353  PSEPYRVILGDVRDKLY 369



>pir|T08138|T08138 phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            PE3-PEPCase - rape>gb:BNAPE3_1633477 Brassica napus
            PE3-PEPCase gene for phosphoenolpyruvate carboxylase,
            complete cds.
          Length = 964

 Score =  615 bits (1587), Expect = e-175
 Identities = 310/378 (82%), Positives = 338/378 (89%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA  +L+KM SIDAQLRL+ P KVSEDDKL+EYDALLLDRF    +    +  RE VQEC
Sbjct: 1    MATGSLKKMGSIDAQLRLIAPAKVSEDDKLLEYDALLLDRFSIFSRTCMAKKSREFVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q 488
            YE++A+Y+G  +  KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYR R +
Sbjct: 61   YEVAADYDGNRNTAKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRARIK 120

Query: 489  KLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRR 668
            KLKKGDF DE SA TESDIEETLKRL+  + K+P+EVFDALKNQTVDLVLTAHPTQSVRR
Sbjct: 121  KLKKGDFADEASATTESDIEETLKRLL-QLNKTPEEVFDALKNQTVDLVLTAHPTQSVRR 179

Query: 669  SLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 848
            SLLQK  RIRDCL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
Sbjct: 180  SLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG 239

Query: 849  MSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 1028
            MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
Sbjct: 240  MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT 299

Query: 1029 RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQV 1208
            RDVCLLA+MMA NLY+SQIEDLMFEMSMWRCN+ELR RA E+ R ++RDAKHYIEFWKQ+
Sbjct: 300  RDVCLLARMMAANLYFSQIEDLMFEMSMWRCNEELRVRA-EVQRCAKRDAKHYIEFWKQI 358

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            P NEPYR ILGDVRDKLY
Sbjct: 359  PSNEPYRAILGDVRDKLY 376



>gb:AF495586_1805546 Setaria italica putative C4 phosphoenolpyruvate
            carboxylase (ppc) mRNA, complete cds.
          Length = 964

 Score =  613 bits (1580), Expect = e-174
 Identities = 302/377 (80%), Positives = 336/377 (89%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA++ +EK  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDI QDLHG N+RE VQEC
Sbjct: 1    MASKPVEKHHSIDAQLRLLAPGKVSEDDKLVEYDALLIDRFLDIFQDLHGPNIREFVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YE++AEYE   D  KL ELG+ LT L P D+IV+A SFS+MLNL NLAEEVQ+A+ RR K
Sbjct: 61   YEVAAEYERDRDAAKLSELGSRLTKLSPNDAIVVASSFSNMLNLTNLAEEVQLAHLRRNK 120

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LK+GDF DE  A TESDIEETLKRLV ++ KS +EVFDALKNQTVDLV TAHPTQSVRRS
Sbjct: 121  LKRGDFADEGFAATESDIEETLKRLVTELGKSKEEVFDALKNQTVDLVFTAHPTQSVRRS 180

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKHARIR+CL QLY KD T DDKQELDEALQREIQA FRTDEIRR  PTPQDEMR GM
Sbjct: 181  LLQKHARIRNCLTQLYAKDNTEDDKQELDEALQREIQACFRTDEIRRAQPTPQDEMRYGM 240

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGI+ER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 241  SYFHETIWKGVPKFLRRVDTALKNIGIDERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 300

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVP 1211
            DVCLLA+MMA+NLY+S+IE+LMFE+SMWRCNDELRARA+ELH SS+R +KHYIEFW+Q+P
Sbjct: 301  DVCLLARMMASNLYFSRIEELMFELSMWRCNDELRARAEELHASSQRISKHYIEFWRQLP 360

Query: 1212 PNEPYRVILGDVRDKLY 1262
             NEPYRV+LG VRD+LY
Sbjct: 361  ANEPYRVVLGYVRDELY 377



>gb:AF268091_1782031 Chloris gayana phosphoenolpyruvate carboxylase
            (ppc) mRNA, complete cds.
          Length = 955

 Score =  598 bits (1542), Expect = e-170
 Identities = 298/375 (79%), Positives = 330/375 (88%)
 Frame = +3

Query: 138  ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE 317
            A   EK  SIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQ+LHG  LRE VQECYE
Sbjct: 2    ATKAEKHHSIDAQLRLLAPGKVSEDDKLVEYDALLIDRFLDILQNLHGSALRELVQECYE 61

Query: 318  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK 497
            +SAEY+ + D  +L+ELG  L+ LDP D+I +A SFSHMLNLANLAEEVQIA RRR KLK
Sbjct: 62   MSAEYDVKRDETRLDELGAKLSGLDPADAITVASSFSHMLNLANLAEEVQIAQRRRSKLK 121

Query: 498  KGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL 677
             GDF DE SA TESDIEETLKRLV ++ KSPQEVFDALKNQTV+LVLTAHPTQS+RRSLL
Sbjct: 122  HGDFSDEGSATTESDIEETLKRLVSEIGKSPQEVFDALKNQTVELVLTAHPTQSLRRSLL 181

Query: 678  QKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSY 857
            QKH +IR+CL QLY KDIT D+K+ELDEALQ EIQAAFRTDEIRR+ PTPQDEMR GMSY
Sbjct: 182  QKHTKIRNCLTQLYAKDITEDEKKELDEALQAEIQAAFRTDEIRRSQPTPQDEMRYGMSY 241

Query: 858  FHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDV 1037
            FHETIWKGVP+FLRRVDTALK+IGINER+PY+AP+I+FSSWMGGDRDGNPRVTPEVTRDV
Sbjct: 242  FHETIWKGVPKFLRRVDTALKSIGINERLPYDAPVIKFSSWMGGDRDGNPRVTPEVTRDV 301

Query: 1038 CLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPN 1217
            CLLA+MMA NLY S IEDLMFE+SMWRCNDELRARADE H +SR   KHYIEFW+ +P +
Sbjct: 302  CLLARMMAANLYVSSIEDLMFELSMWRCNDELRARADE-HLASRETKKHYIEFWRAIPES 360

Query: 1218 EPYRVILGDVRDKLY 1262
            EPYRV+LG VRDKLY
Sbjct: 361  EPYRVLLGYVRDKLY 375



>gb:VPL249988_1727317 Vanilla planifolia partial mRNA for
            phosphoenolpyruvate carboxylase (ppc3 gene, 1005 bp).
          Length = 335

 Score =  591 bits (1523), Expect = e-167
 Identities = 295/335 (88%), Positives = 312/335 (93%)
 Frame = +3

Query: 162  SIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGR 341
            SIDAQLRLL P KVSEDDKLVEY ALLLDRFLDILQDLHGE +RETVQE YELSAEYE +
Sbjct: 1    SIDAQLRLLAPAKVSEDDKLVEYVALLLDRFLDILQDLHGEVVRETVQELYELSAEYESK 60

Query: 342  HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDEN 521
            HDPKKL+ELGN+L SLDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KLKKGDF DE 
Sbjct: 61   HDPKKLDELGNLLISLDPGNSIVIASSFSHMLNLANLAEEVQIAFRRRIKLKKGDFADEA 120

Query: 522  SAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRD 701
            SA TESD EETLKRLV  +KK+PQE+FDALKNQTVDLVLTAHPTQSVRRSLLQKH RIR+
Sbjct: 121  SATTESDFEETLKRLVGKLKKTPQEIFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRN 180

Query: 702  CLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKG 881
            CL QLY KDITPDDKQELDEAL REIQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKG
Sbjct: 181  CLTQLYAKDITPDDKQELDEALHREIQAAFRTDEIRRIPPTPQDEMRAGMSYFHETIWKG 240

Query: 882  VPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMA 1061
            VP+FLRRVDTALKN+GINER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+MMA
Sbjct: 241  VPQFLRRVDTALKNLGINERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMA 300

Query: 1062 TNLYYSQIEDLMFEMSMWRCNDELRARADELHRSS 1166
             NLY+SQIEDLMFE+SMWRC+DELR RADEL RSS
Sbjct: 301  ANLYFSQIEDLMFELSMWRCSDELRLRADELQRSS 335



>gb:ZMPEP_1731956 Z.mays gene for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).
          Length = 970

 Score =  590 bits (1521), Expect = e-167
 Identities = 298/373 (79%), Positives = 326/373 (87%), Gaps = 2/373 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            EK  SIDAQLR LVPGKVSEDDKL+EYDALL+DRFL+ILQDLHG +LRE VQECYE+SA+
Sbjct: 11   EKHHSIDAQLRQLVPGKVSEDDKLIEYDALLVDRFLNILQDLHGPSLREFVQECYEVSAD 70

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEVQIA+RRR  KLKKG 
Sbjct: 71   YEGKGDTTKLGELGAKLTGLAPADAILVASSILHMLNLANLAEEVQIAHRRRNSKLKKGG 130

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV ++ KSP+EVF+ALKNQTVDLV TAHPTQS RRSLLQK+
Sbjct: 131  FADEGSATTESDIEETLKRLVSEVGKSPEEVFEALKNQTVDLVFTAHPTQSARRSLLQKN 190

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KDIT DDKQELDEALQREIQAAFRTDEIRR  PTPQDEMR GMSY HE
Sbjct: 191  ARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHE 250

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+WKGVP+FLRRVDTALKNIGINER+PYN  LI+FSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 251  TVWKGVPKFLRRVDTALKNIGINERLPYNVSLIRFSSWMGGDRDGNPRVTPEVTRDVCLL 310

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSS-RRDAKHYIEFWKQVPPNEP 1223
            A+MMA NLY  QIE+LMFE+SMWRCNDELR RA+ELH SS  +  K+YIEFWKQ+PPNEP
Sbjct: 311  ARMMAANLYIDQIEELMFELSMWRCNDELRVRAEELHSSSGSKVTKYYIEFWKQIPPNEP 370

Query: 1224 YRVILGDVRDKLY 1262
            YRVILG VRDKLY
Sbjct: 371  YRVILGHVRDKLY 383



>gb:ZMA536629_1731578 Zea mays mRNA for phosphoenolpyruvate
            carboxylase (ppc1 gene), clone pM500.
          Length = 970

 Score =  590 bits (1521), Expect = e-167
 Identities = 298/373 (79%), Positives = 326/373 (87%), Gaps = 2/373 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            EK  SIDAQLR LVPGKVSEDDKL+EYDALL+DRFL+ILQDLHG +LRE VQECYE+SA+
Sbjct: 11   EKHHSIDAQLRQLVPGKVSEDDKLIEYDALLVDRFLNILQDLHGPSLREFVQECYEVSAD 70

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEVQIA+RRR  KLKKG 
Sbjct: 71   YEGKGDTTKLGELGAKLTGLAPADAILVASSILHMLNLANLAEEVQIAHRRRNSKLKKGG 130

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV ++ KSP+EVF+ALKNQTVDLV TAHPTQS RRSLLQK+
Sbjct: 131  FADEGSATTESDIEETLKRLVSEVGKSPEEVFEALKNQTVDLVFTAHPTQSARRSLLQKN 190

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KDIT DDKQELDEALQREIQAAFRTDEIRR  PTPQDEMR GMSY HE
Sbjct: 191  ARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHE 250

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+WKGVP+FLRRVDTALKNIGINER+PYN  LI+FSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 251  TVWKGVPKFLRRVDTALKNIGINERLPYNVSLIRFSSWMGGDRDGNPRVTPEVTRDVCLL 310

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSS-RRDAKHYIEFWKQVPPNEP 1223
            A+MMA NLY  QIE+LMFE+SMWRCNDELR RA+ELH SS  +  K+YIEFWKQ+PPNEP
Sbjct: 311  ARMMAANLYIDQIEELMFELSMWRCNDELRVRAEELHSSSGSKVTKYYIEFWKQIPPNEP 370

Query: 1224 YRVILGDVRDKLY 1262
            YRVILG VRDKLY
Sbjct: 371  YRVILGHVRDKLY 383



>pir|S04546|QYZM phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            maize>gb:ZMPEPC1G_1731958 Maize PEPC1 gene for
            phosphoenolpyruvate carboxylase (EC 4.1.1.31).
          Length = 970

 Score =  590 bits (1521), Expect = e-167
 Identities = 298/373 (79%), Positives = 326/373 (87%), Gaps = 2/373 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            EK  SIDAQLR LVPGKVSEDDKL+EYDALL+DRFL+ILQDLHG +LRE VQECYE+SA+
Sbjct: 11   EKHHSIDAQLRQLVPGKVSEDDKLIEYDALLVDRFLNILQDLHGPSLREFVQECYEVSAD 70

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEVQIA+RRR  KLKKG 
Sbjct: 71   YEGKGDTTKLGELGAKLTGLAPADAILVASSILHMLNLANLAEEVQIAHRRRNSKLKKGG 130

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV ++ KSP+EVF+ALKNQTVDLV TAHPTQS RRSLLQK+
Sbjct: 131  FADEGSATTESDIEETLKRLVSEVGKSPEEVFEALKNQTVDLVFTAHPTQSARRSLLQKN 190

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KDIT DDKQELDEALQREIQAAFRTDEIRR  PTPQDEMR GMSY HE
Sbjct: 191  ARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHE 250

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+WKGVP+FLRRVDTALKNIGINER+PYN  LI+FSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 251  TVWKGVPKFLRRVDTALKNIGINERLPYNVSLIRFSSWMGGDRDGNPRVTPEVTRDVCLL 310

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSS-RRDAKHYIEFWKQVPPNEP 1223
            A+MMA NLY  QIE+LMFE+SMWRCNDELR RA+ELH SS  +  K+YIEFWKQ+PPNEP
Sbjct: 311  ARMMAANLYIDQIEELMFELSMWRCNDELRVRAEELHSSSGSKVTKYYIEFWKQIPPNEP 370

Query: 1224 YRVILGDVRDKLY 1262
            YRVILG VRDKLY
Sbjct: 371  YRVILGHVRDKLY 383



>sp|P04711|CAP1_MAIZE Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31)
            (PEPCase 1).>gb:ZMPEPC1_1731957 Maize mRNA for
            phosphoenolpyruvate carboxylase (EC 4.1.1.31).
          Length = 970

 Score =  587 bits (1513), Expect = e-166
 Identities = 297/373 (79%), Positives = 325/373 (87%), Gaps = 2/373 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            EK  SIDAQLR LVPGKVSEDDKL+EYDALL+DRFL+ILQDLHG +LRE VQECYE+SA+
Sbjct: 11   EKHHSIDAQLRQLVPGKVSEDDKLIEYDALLVDRFLNILQDLHGPSLREFVQECYEVSAD 70

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEVQIA+RRR  KLKKG 
Sbjct: 71   YEGKGDTTKLGELGAKLTGLAPADAILVASSILHMLNLANLAEEVQIAHRRRNSKLKKGG 130

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV ++ KSP+EVF+ALKNQTVDLV TAHPTQS RRSLLQK+
Sbjct: 131  FADEGSATTESDIEETLKRLVSEVGKSPEEVFEALKNQTVDLVFTAHPTQSARRSLLQKN 190

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KDIT DDKQELDEALQREIQAAFRTDEIRR  PTPQ EMR GMSY HE
Sbjct: 191  ARIRNCLTQLNAKDITDDDKQELDEALQREIQAAFRTDEIRRAQPTPQAEMRYGMSYIHE 250

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+WKGVP+FLRRVDTALKNIGINER+PYN  LI+FSSWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 251  TVWKGVPKFLRRVDTALKNIGINERLPYNVSLIRFSSWMGGDRDGNPRVTPEVTRDVCLL 310

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSS-RRDAKHYIEFWKQVPPNEP 1223
            A+MMA NLY  QIE+LMFE+SMWRCNDELR RA+ELH SS  +  K+YIEFWKQ+PPNEP
Sbjct: 311  ARMMAANLYIDQIEELMFELSMWRCNDELRVRAEELHSSSGSKVTKYYIEFWKQIPPNEP 370

Query: 1224 YRVILGDVRDKLY 1262
            YRVILG VRDKLY
Sbjct: 371  YRVILGHVRDKLY 383



>gb:SOF293346_1715673 Saccharum officinarum mRNA for putative C4
            phosphoenolpyruvate carboxylase (PEPC gene).
          Length = 961

 Score =  563 bits (1452), Expect = e-159
 Identities = 282/374 (75%), Positives = 323/374 (86%), Gaps = 3/374 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLR L PGKVSE+  L++YDALL+DRFLDILQDLHG +LRE VQECYE+SA+
Sbjct: 4    ERHHSIDAQLRALAPGKVSEE--LIQYDALLVDRFLDILQDLHGPSLREFVQECYEVSAD 61

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEV++A+RRR  KLK GD
Sbjct: 62   YEGKKDTSKLGELGTKLTGLAPADAILVASSILHMLNLANLAEEVELAHRRRNSKLKHGD 121

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV  + K+P+EVF+ALKNQ+VDLV TAHPTQS RRSLLQK+
Sbjct: 122  FSDEGSATTESDIEETLKRLV-SLGKTPEEVFEALKNQSVDLVFTAHPTQSARRSLLQKN 180

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KD+T +DK+ELDEALQREIQAAFRTDEIRR  PTPQDEMR GMSY HE
Sbjct: 181  ARIRNCLTQLSTKDVTVEDKKELDEALQREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHE 240

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+WKGVP+FLRRVDTALKNIGIN+R+PYN PLI+F SWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 241  TVWKGVPKFLRRVDTALKNIGINQRLPYNVPLIKFCSWMGGDRDGNPRVTPEVTRDVCLL 300

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR--SSRRDAKHYIEFWKQVPPNE 1220
            ++MMA NLY  Q+EDLMFE+SMWRCNDELRARA+E+    +S++  K+YIEFWKQ+PPNE
Sbjct: 301  SRMMAANLYIDQVEDLMFELSMWRCNDELRARAEEVQSTPASKKVTKYYIEFWKQIPPNE 360

Query: 1221 PYRVILGDVRDKLY 1262
            PYRVILG VRDKLY
Sbjct: 361  PYRVILGAVRDKLY 374



>gb:SSP318338_1722549 Saccharum spontaneum mRNA for putative C4
            phosphoenolpyruvate carboxylase (pepc gene), (C4
            PPCSs-1).
          Length = 961

 Score =  561 bits (1445), Expect = e-158
 Identities = 282/374 (75%), Positives = 321/374 (85%), Gaps = 3/374 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLR L P KVSE+  L++YDALL DRFLDILQDLHG +LRE VQECYE+SA+
Sbjct: 4    ERHHSIDAQLRALAPDKVSEE--LIQYDALLADRFLDILQDLHGPSLREFVQECYEVSAD 61

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEV++A+RRR  KLK GD
Sbjct: 62   YEGKKDTSKLGELGTKLTGLAPADAILVASSILHMLNLANLAEEVELAHRRRNSKLKHGD 121

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV  + K+P+EVF+ALKNQ+VDLV TAHPTQS RRSLLQK+
Sbjct: 122  FSDEGSATTESDIEETLKRLV-SLGKTPEEVFEALKNQSVDLVFTAHPTQSARRSLLQKN 180

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KD+T +DK+ELDEALQREIQAAFRTDEIRR  PTPQDEMR GMSY HE
Sbjct: 181  ARIRNCLTQLSAKDVTDEDKKELDEALQREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHE 240

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+WKGVP+FLRRVDTALKNIGINER+PYN PLI+F SWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 241  TVWKGVPKFLRRVDTALKNIGINERLPYNVPLIKFCSWMGGDRDGNPRVTPEVTRDVCLL 300

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR--SSRRDAKHYIEFWKQVPPNE 1220
            ++MMA NLY  Q+EDLMFE+SMWRCNDELRARA+E+    +S++  K+YIEFWKQ+PPNE
Sbjct: 301  SRMMAANLYIDQVEDLMFELSMWRCNDELRARAEEVQSTPASKKVTKYYIEFWKQIPPNE 360

Query: 1221 PYRVILGDVRDKLY 1262
            PYRVILG VRDKLY
Sbjct: 361  PYRVILGAVRDKLY 374



>gb:AP003409_1828980 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1131G08.
          Length = 924

 Score =  560 bits (1444), Expect = e-158
 Identities = 283/378 (74%), Positives = 310/378 (82%), Gaps = 1/378 (0%)
 Frame = +3

Query: 132  MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
            MA    +K  SIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct: 1    MARNAADKGTSIDAQLRILAPKKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC 60

Query: 312  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK 491
            YEL+AEYE +                                          IAYRRR K
Sbjct: 61   YELAAEYESK------------------------------------------IAYRRRIK 78

Query: 492  LKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRS 671
            LKKGDF DENSA TES+ EETLKRLV ++KKSP EVFDALKNQT+DLVLTAHPTQSVRRS
Sbjct: 79   LKKGDFADENSATTESNFEETLKRLVGELKKSPHEVFDALKNQTIDLVLTAHPTQSVRRS 138

Query: 672  LLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM 851
            LLQKH RIR CL +LY KDITPD+KQELDEAL+REIQAAFRTDEIRR PPTPQDEMRAGM
Sbjct: 139  LLQKHGRIRSCLTKLYAKDITPDEKQELDEALKREIQAAFRTDEIRRAPPTPQDEMRAGM 198

Query: 852  SYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 1031
            SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
Sbjct: 199  SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR 258

Query: 1032 DVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRD-AKHYIEFWKQV 1208
            DVCLLA+MMA NLYY+QIEDLMFE+SMWRC+DELR +AD+LHR ++++  KHYIEFWKQV
Sbjct: 259  DVCLLARMMAANLYYAQIEDLMFELSMWRCSDELRVKADQLHRCAKKNTTKHYIEFWKQV 318

Query: 1209 PPNEPYRVILGDVRDKLY 1262
            PP+EPYRVIL +VRDKLY
Sbjct: 319  PPSEPYRVILSNVRDKLY 336



>gb:AY135709_1581780 Saccharum hybrid cultivar putative C4
            phosphoenolpyruvate carboxylase mRNA, complete cds.
          Length = 961

 Score =  560 bits (1442), Expect = e-158
 Identities = 281/374 (75%), Positives = 321/374 (85%), Gaps = 3/374 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLR L PGKVSE+  L++YDALL DRFLDILQDLHG +LRE VQECYE+SA+
Sbjct: 4    ERHHSIDAQLRALAPGKVSEE--LIQYDALLADRFLDILQDLHGPSLREFVQECYEVSAD 61

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEV++A+RRR  KLK GD
Sbjct: 62   YEGKKDTSKLGELGTKLTGLAPADAILVASSILHMLNLANLAEEVELAHRRRNSKLKHGD 121

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV  + K+P+EVF+ALKNQ+VDLV TAHPTQS RRSLLQK+
Sbjct: 122  FSDEGSATTESDIEETLKRLV-SLGKTPEEVFEALKNQSVDLVFTAHPTQSARRSLLQKN 180

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KD+T +DK+ELDEALQREIQAAFRTDEIRR  PTPQDEMR GMSY HE
Sbjct: 181  ARIRNCLTQLSAKDVTVEDKKELDEALQREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHE 240

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+WKGVP+FLRRVDTALKNIGIN+R+PYN PLI+F SWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 241  TVWKGVPKFLRRVDTALKNIGINQRLPYNVPLIKFCSWMGGDRDGNPRVTPEVTRDVCLL 300

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR--SSRRDAKHYIEFWKQVPPNE 1220
            ++M A NLY  Q+EDLMFE+SMWRCNDELRARA+E+    +S++  K+YIEFWKQ+PPNE
Sbjct: 301  SRMTAANLYIDQVEDLMFELSMWRCNDELRARAEEVQSTPASKKVTKYYIEFWKQIPPNE 360

Query: 1221 PYRVILGDVRDKLY 1262
            PYRVILG VRDKLY
Sbjct: 361  PYRVILGAVRDKLY 374



>gb:AP003052_1824492 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBa0016I09.
          Length = 1014

 Score =  557 bits (1436), Expect = e-157
 Identities = 271/369 (73%), Positives = 324/369 (87%), Gaps = 2/369 (0%)
 Frame = +3

Query: 162  SIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGR 341
            SIDA+LR L P KVS DD+LV+Y+ LL+ RFLDIL+DLHG + R+ V++C  LS EY+  
Sbjct: 56   SIDARLRQLAPEKVSADDRLVDYETLLVARFLDILEDLHGGDFRQVVEDCLRLSGEYQSE 115

Query: 342  HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL-KKGDFVDE 518
             DP +L ELG +LTSLD GD+I++A SFSHMLNLANLAEE+Q+ YR++ +  ++GDFVDE
Sbjct: 116  GDPARLGELGGLLTSLDVGDAIMVASSFSHMLNLANLAEEIQMVYRKKAEASRRGDFVDE 175

Query: 519  NSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIR 698
             SA TESDI+ET +RLV  + KSP+EVFDAL++QT+DLVLTAHPTQSVRRSLLQKHA IR
Sbjct: 176  ASAPTESDIDETFQRLVRGLGKSPREVFDALRSQTIDLVLTAHPTQSVRRSLLQKHASIR 235

Query: 699  DCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWK 878
             CL QL  + I+ +++QE+DEALQREI AAF+TDEIRRTPPTPQDEMRAGMSYFH+TIW 
Sbjct: 236  SCLTQLCGEGISDNEEQEIDEALQREILAAFKTDEIRRTPPTPQDEMRAGMSYFHDTIWN 295

Query: 879  GVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMM 1058
            GVP+FLRRVDTALKNIGI+ER+PYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+MM
Sbjct: 296  GVPKFLRRVDTALKNIGIDERLPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMM 355

Query: 1059 ATNLYYSQIEDLMFEMSMWRCNDELRARADELHR-SSRRDAKHYIEFWKQVPPNEPYRVI 1235
            A N+Y+S++ DLMFE+SMWRCNDELRARA+ELHR SSR+ AK+YIEFWK++ P EPYR+I
Sbjct: 356  AANMYFSKMADLMFELSMWRCNDELRARANELHRKSSRKYAKYYIEFWKKISPGEPYRII 415

Query: 1236 LGDVRDKLY 1262
            LGDVRDKLY
Sbjct: 416  LGDVRDKLY 424



>sp|P15804|CAP3_SORBI Phosphoenolpyruvate carboxylase 3 (EC 4.1.1.31)
            (PEPCase 3) (CP46).>pir|S22507|S22507 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) CP46 -
            sorghum>gb:SVPEPC_1723256 Sorghum vulgare mRNA for
            phosphoenolpyruvate involved in C4 photosynthesis (EC
            4.1.1.31).>gb:SVPEPCAA_1723258 S.vulgare PEPC gene.
          Length = 960

 Score =  556 bits (1434), Expect = e-157
 Identities = 280/374 (74%), Positives = 321/374 (85%), Gaps = 3/374 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLR L PGKVSE+  L++YDALL+DRFLDILQDLHG +LRE VQECYE+SA+
Sbjct: 4    ERHHSIDAQLRALAPGKVSEE--LIQYDALLVDRFLDILQDLHGPSLREFVQECYEVSAD 61

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEV++A+RRR  KLK GD
Sbjct: 62   YEGKKDTSKLGELGAKLTGLAPADAILVASSILHMLNLANLAEEVELAHRRRNSKLKHGD 121

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
            F DE SA TESDIEETLKRLV  + K+P EVF+ALKNQ+VDLV TAHPTQS RRSLLQK+
Sbjct: 122  FSDEGSATTESDIEETLKRLV-SLGKTPAEVFEALKNQSVDLVFTAHPTQSARRSLLQKN 180

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KD+T +DK+ELDEAL REIQAAFRTDEIRR  PTPQDEMR GMSY HE
Sbjct: 181  ARIRNCLTQLSAKDVTVEDKKELDEALHREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHE 240

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+W GVP+FLRRVDTALKNIGINER+PY+ PLI+F SWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 241  TVWNGVPKFLRRVDTALKNIGINERLPYDVPLIKFCSWMGGDRDGNPRVTPEVTRDVCLL 300

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR--SSRRDAKHYIEFWKQVPPNE 1220
            ++MMA NLY +Q+EDLMFE+SMWRCNDELRARA+E+    +S++  K+YIEFWKQ+PPNE
Sbjct: 301  SRMMAANLYINQVEDLMFELSMWRCNDELRARAEEVQSTPASKKVTKYYIEFWKQIPPNE 360

Query: 1221 PYRVILGDVRDKLY 1262
            PYRVILG VRDKLY
Sbjct: 361  PYRVILGAVRDKLY 374



>gb:ZMPEPCR_1731963 Maize mRNA for phosphoenolpyruvate carboxylase
            (PEPCase EC 4.1.1.31).
          Length = 935

 Score =  550 bits (1416), Expect = e-155
 Identities = 275/348 (79%), Positives = 304/348 (87%), Gaps = 2/348 (0%)
 Frame = +3

Query: 225  EYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDS 404
            EYDALL+DRFL+ILQDLHG +LRE VQECYE+SA+YEG+ D  KL ELG  LT L P D+
Sbjct: 1    EYDALLVDRFLNILQDLHGPSLREFVQECYEVSADYEGKGDTTKLGELGAKLTGLAPADA 60

Query: 405  IVIAKSFSHMLNLANLAEEVQIAYRRRQ-KLKKGDFVDENSAITESDIEETLKRLVVDMK 581
            I++A S  HMLNLANLAEEVQIA+RRR  KLKKG F DE SA TESDIEETLKRLV ++ 
Sbjct: 61   ILVASSILHMLNLANLAEEVQIAHRRRNSKLKKGGFADEGSATTESDIEETLKRLVSEVG 120

Query: 582  KSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDE 761
            KSP+EVF+ALKNQTVDLV TAHPTQS RRSLLQK+ARIR+CL QL  KDIT DDKQELDE
Sbjct: 121  KSPEEVFEALKNQTVDLVFTAHPTQSARRSLLQKNARIRNCLTQLNAKDITDDDKQELDE 180

Query: 762  ALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINER 941
            ALQREIQAAFRTDEIRR  PTPQDEMR GMSY HET+WKGVP+FLRRVDTALKNIGINER
Sbjct: 181  ALQREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKNIGINER 240

Query: 942  VPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRC 1121
            +PYN  LI+FSSWMGGDRDGNPRVTPEVTRDVCLLA+MMA NLY  QIE+LMFE+SMWRC
Sbjct: 241  LPYNVSLIRFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYIDQIEELMFELSMWRC 300

Query: 1122 NDELRARADELHRSS-RRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            ND++R RA+ELH SS  +  K+YIEFWKQ+PPNEPYRVILG VRDKLY
Sbjct: 301  NDDVRVRAEELHSSSGSKVTKYYIEFWKQIPPNEPYRVILGHVRDKLY 348



>pir|S08216|QYMG phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            sorghum
          Length = 952

 Score =  540 bits (1391), Expect = e-152
 Identities = 274/374 (73%), Positives = 316/374 (84%), Gaps = 3/374 (0%)
 Frame = +3

Query: 150  EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
            E+  SIDAQLR L PGKVSE+  L++YDALL+DRFLDILQDLHG +LRE VQECYE+SA+
Sbjct: 4    ERHHSIDAQLRALAPGKVSEE--LIQYDALLVDRFLDILQDLHGPSLREFVQECYEVSAD 61

Query: 330  YEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRR-RQKLKKGD 506
            YEG+ D  KL ELG  LT L P D+I++A S  HMLNLANLAEEV++A+RR   KLK GD
Sbjct: 62   YEGKKDTSKLGELGAKLTGLAPADAILVASSILHMLNLANLAEEVELAHRRGTSKLKHGD 121

Query: 507  FVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKH 686
               E SA TESDIEETLKRLV  + K+P EVF+ALKNQ+VDLV TAHPTQS RRSLLQK+
Sbjct: 122  ---EASATTESDIEETLKRLV-SLGKTPAEVFEALKNQSVDLVFTAHPTQSARRSLLQKN 177

Query: 687  ARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHE 866
            ARIR+CL QL  KD+T +DK+ELDEAL REIQAAFRTD+ RR  PTPQDEMR GMSY HE
Sbjct: 178  ARIRNCLTQLSAKDVTVEDKKELDEALHREIQAAFRTDDFRRAQPTPQDEMRYGMSYIHE 237

Query: 867  TIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLL 1046
            T+W GVP+F RRVDTALKNIGINER+PY+ PLI+F SWMGGDRDGNPRVTPEVTRDVCLL
Sbjct: 238  TVWNGVPKFFRRVDTALKNIGINERLPYDVPLIKFCSWMGGDRDGNPRVTPEVTRDVCLL 297

Query: 1047 AKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR--SSRRDAKHYIEFWKQVPPNE 1220
            ++MMA NLY +Q+EDLMFE+SMWRCNDELRARA+E+    +S++  K+YIEFWKQ+PPNE
Sbjct: 298  SRMMAANLYINQVEDLMFELSMWRCNDELRARAEEVQSTPASKKVTKYYIEFWKQIPPNE 357

Query: 1221 PYRVILGDVRDKLY 1262
            PYRVILG VRDKLY
Sbjct: 358  PYRVILGAVRDKLY 371



>gb:AB078719_1523751 Nicotiana sylvestris Nsppc2 gene for
            phosphoenolpyruvate carboxylase, partial cds.
          Length = 820

 Score =  452 bits (1164), Expect = e-126
 Identities = 217/234 (92%), Positives = 227/234 (97%)
 Frame = +3

Query: 561  RLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPD 740
            RLVV +KKSPQEVFDALKNQTVDLV TAHPTQS+RRSLLQKHARIR+CLAQLY KDITPD
Sbjct: 1    RLVVALKKSPQEVFDALKNQTVDLVFTAHPTQSIRRSLLQKHARIRNCLAQLYAKDITPD 60

Query: 741  DKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALK 920
            DKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALK
Sbjct: 61   DKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALK 120

Query: 921  NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMF 1100
            NIGINERVPY+APLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+MMA NLYYSQI+DLMF
Sbjct: 121  NIGINERVPYSAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIDDLMF 180

Query: 1101 EMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            EMSMWRCNDELR RADELH SS+RD KHYIEFWKQ+PP+EPYRVILGDVRDKLY
Sbjct: 181  EMSMWRCNDELRVRADELHSSSKRDEKHYIEFWKQIPPSEPYRVILGDVRDKLY 234



>gb:PGE318584_1699976 Paspalidium geminatum partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 396

 Score =  379 bits (972), Expect = e-104
 Identities = 178/214 (83%), Positives = 199/214 (92%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            TV+LV TAHPTQS+RRSLLQKHARIR+CL QLY KDI+ DDK+ELDEALQREIQA FRTD
Sbjct: 1    TVELVFTAHPTQSIRRSLLQKHARIRNCLTQLYAKDISEDDKKELDEALQREIQACFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GMSYFHETIWKGVP+FLRRVDTALKNIGI+ER+PYN PLI+FSSW
Sbjct: 61   EIRRAQPTPQDEMRYGMSYFHETIWKGVPKFLRRVDTALKNIGIDERLPYNVPLIKFSSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGNPRVTPEVTRDVCLLA+MMA N+Y+SQIE+LMFE+SMWRCNDELRARA EL+ 
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLARMMAANMYFSQIEELMFELSMWRCNDELRARAGELYA 180

Query: 1161 SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            SS++ +KHYIEFW+Q+P NEPYRV+LG VRDKLY
Sbjct: 181  SSQKISKHYIEFWRQIPANEPYRVVLGYVRDKLY 214



>gb:PMA318586_1700691 Panicum maximum partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 396

 Score =  373 bits (958), Expect = e-102
 Identities = 177/214 (82%), Positives = 196/214 (91%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            TVDLVLTAHPTQS+RRSLL+KH RIR+CL QLY KDIT DDK+EL+EALQREIQAAFRTD
Sbjct: 1    TVDLVLTAHPTQSLRRSLLKKHTRIRNCLTQLYAKDITEDDKKELEEALQREIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  P PQDEMR GM+Y HETIWKGVP+FLRRVDTALKNIGI+ER+PY+APLI+FSSW
Sbjct: 61   EIRRAQPAPQDEMRYGMNYIHETIWKGVPKFLRRVDTALKNIGIDERLPYDAPLIKFSSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGNPRVTPEVTRDVCLLA+MMA NLY SQIE+LMFE+SMWRCNDELRARADEL  
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLARMMAANLYISQIEELMFELSMWRCNDELRARADELDG 180

Query: 1161 SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            +SR+  KHY EFW+Q+P NEPYRV+L DVRDKLY
Sbjct: 181  ASRKVVKHYTEFWRQIPTNEPYRVVLADVRDKLY 214



>gb:IKO318574_1683120 Ischaemum koleostachys partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 398

 Score =  361 bits (927), Expect = 2e-98
 Identities = 171/216 (79%), Positives = 192/216 (88%), Gaps = 2/216 (0%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            +VDLV TAHPTQS RRSLLQK+ARIR+CL  L  KD+ P+DK+ELDEALQREIQAAFRTD
Sbjct: 1    SVDLVFTAHPTQSARRSLLQKNARIRNCLTLLSAKDVAPEDKKELDEALQREIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GMSY HET+WKGVP+FLRRVDTALKNIGINER+PYN PLI+F SW
Sbjct: 61   EIRRAQPTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKNIGINERLPYNVPLIKFCSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGNPR TPEVTRDVCLL++MMA NLY  Q+EDLMFE+SMWRCN+ELR RA+ELH 
Sbjct: 121  MGGDRDGNPRATPEVTRDVCLLSRMMAANLYIDQVEDLMFELSMWRCNEELRVRAEELHS 180

Query: 1161 --SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              +S++  K+YIEFWKQ+PPNEPYRVILG VRDKLY
Sbjct: 181  TPASKKVTKYYIEFWKQIPPNEPYRVILGAVRDKLY 216



>gb:EAU318576_1676257 Eulalia aurea partial internal mRNA for putative
            phosphoenolpyruvate carboxylase, (pepc gene).
          Length = 398

 Score =  360 bits (925), Expect = 3e-98
 Identities = 174/216 (80%), Positives = 193/216 (89%), Gaps = 2/216 (0%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            +VDLV TAHPTQS RRSLLQK+ARIR+CL QL   DIT DDKQELDEALQREIQAAFRTD
Sbjct: 1    SVDLVFTAHPTQSARRSLLQKNARIRNCLTQLKAPDITEDDKQELDEALQREIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GMSY HET+WKGVP+FLRRVDTALKNIGI ER+PY+ PLI+F SW
Sbjct: 61   EIRRAQPTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKNIGITERLPYDVPLIKFCSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGNPRVTPEVTRDVCLL++MMA NLY  QIEDLMFE+SMWRCNDELRARA+EL +
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLSRMMAANLYIDQIEDLMFELSMWRCNDELRARAEELLK 180

Query: 1161 S--SRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            +  +++  K+YIEFWKQ+PPNEPYRVILG VRDKLY
Sbjct: 181  TPDAKKVTKYYIEFWKQIPPNEPYRVILGAVRDKLY 216



>gb:AMA318588_1819161 Aristida mauritiana partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 381

 Score =  357 bits (917), Expect = 2e-97
 Identities = 173/204 (84%), Positives = 189/204 (92%), Gaps = 1/204 (0%)
 Frame = +3

Query: 654  QSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQD 833
            QSVRRSLLQKHARIR CL QL  KDIT DDK+ELDEALQREIQAAFRTDEIRR  PTPQD
Sbjct: 1    QSVRRSLLQKHARIRSCLTQLDAKDITEDDKKELDEALQREIQAAFRTDEIRRAQPTPQD 60

Query: 834  EMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRV 1013
            EMR GMSYFHETIWKGVP+FLRRVDTALKNIGI+ER PY APLI+FSSWMGGDRDGNPRV
Sbjct: 61   EMRYGMSYFHETIWKGVPKFLRRVDTALKNIGIDERFPYRAPLIKFSSWMGGDRDGNPRV 120

Query: 1014 TPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDA-KHYI 1190
            TP+VTRDV LLA+MMA +LYYSQIEDLMFE+SMWRCNDELRARA+EL+ +S++ A KHYI
Sbjct: 121  TPDVTRDVVLLARMMAADLYYSQIEDLMFELSMWRCNDELRARAEELYGASKKAATKHYI 180

Query: 1191 EFWKQVPPNEPYRVILGDVRDKLY 1262
            EFWKQ+PP+EPYRV+LGDVRDKLY
Sbjct: 181  EFWKQIPPSEPYRVVLGDVRDKLY 204



>gb:EIN318591_1676556 Eleusine indica partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 386

 Score =  357 bits (915), Expect = 4e-97
 Identities = 169/210 (80%), Positives = 190/210 (90%)
 Frame = +3

Query: 633  VLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRR 812
            VLTAHPTQS+RRSLLQKH +IR+CL QLY KDIT D+K+ELDEALQ EIQAAFRTDEIRR
Sbjct: 1    VLTAHPTQSLRRSLLQKHTKIRNCLTQLYAKDITEDEKKELDEALQAEIQAAFRTDEIRR 60

Query: 813  TPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGD 992
              PTPQDEMR GMSYFHETIWKGVP+FLRRVDTALK+IGINER+PYNAPLI+FSSWMGGD
Sbjct: 61   AQPTPQDEMRYGMSYFHETIWKGVPKFLRRVDTALKSIGINERLPYNAPLIKFSSWMGGD 120

Query: 993  RDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRR 1172
            RDGNPRVTP+VTRDVC+LA+M+A NLY +QIED+MFE+SMWRCNDELRA A E H ++R 
Sbjct: 121  RDGNPRVTPDVTRDVCMLARMIAANLYVAQIEDVMFELSMWRCNDELRAEA-EKHLATRE 179

Query: 1173 DAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              KHYIEFW+Q+P  EPYRV+LG VRDKLY
Sbjct: 180  TKKHYIEFWRQIPATEPYRVLLGHVRDKLY 209



>gb:MRE318585_1686973 Melinis repens partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 396

 Score =  356 bits (913), Expect = 6e-97
 Identities = 168/214 (78%), Positives = 193/214 (90%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            TVDLVLTAHPTQS+RRSLL+KH +IR+CL QLY KDI+ DDK+ELDEALQREIQAAFRTD
Sbjct: 1    TVDLVLTAHPTQSLRRSLLKKHTKIRNCLTQLYAKDISEDDKKELDEALQREIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GM+Y HETIWKGVP FLRRVDTALK IGI+ER+PY+ PLI+FSSW
Sbjct: 61   EIRRAQPTPQDEMRYGMNYIHETIWKGVPNFLRRVDTALKKIGIDERLPYDVPLIKFSSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGN RVTPEVTRDVCLLA+MMA NLY SQIE+LMFE+SMWRCNDELRA+A+ELH 
Sbjct: 121  MGGDRDGNLRVTPEVTRDVCLLARMMAANLYISQIEELMFELSMWRCNDELRAKAEELHD 180

Query: 1161 SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            +S++  K+Y EFWK++P NEPYRV+L  VR+KL+
Sbjct: 181  ASKKVVKYYTEFWKEIPINEPYRVVLASVRNKLH 214



>gb:CBA318589_1645650 Chloris barbata partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 395

 Score =  356 bits (913), Expect = 6e-97
 Identities = 172/214 (80%), Positives = 192/214 (89%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            TV+LVLTAHPTQS+RRSLLQKH +IR+CL QLY KDIT D+K+ELDEALQ EI AAFRTD
Sbjct: 1    TVELVLTAHPTQSLRRSLLQKHTKIRNCLTQLYAKDITDDEKKELDEALQAEIHAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR+ PTPQDEMR GMSYFHETIWKGVP+FLRRVDTALK+IGI+ER+PY+ P+I+FSSW
Sbjct: 61   EIRRSQPTPQDEMRYGMSYFHETIWKGVPKFLRRVDTALKSIGISERLPYDVPVIKFSSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGNPRVTPEVTRDVCLLA+MMA NLY S IEDLMFE+SM RCNDELRARADE H 
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLARMMAANLYVSSIEDLMFELSMRRCNDELRARADE-HL 179

Query: 1161 SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            +SR   KHYIEFW+ +P  EPYRV+LG VRDKLY
Sbjct: 180  ASRETKKHYIEFWRAIPATEPYRVLLGYVRDKLY 213



>gb:PPA318587_1701212 Paspalum paniculatum partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 382

 Score =  355 bits (912), Expect = 8e-97
 Identities = 173/206 (83%), Positives = 188/206 (91%)
 Frame = +3

Query: 645  HPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPT 824
            HPTQSVRRSLLQK+A+IR+ L QLY KDIT D+KQELDEALQR+IQAAFRTDEIRRT PT
Sbjct: 1    HPTQSVRRSLLQKNAKIRNSLKQLYAKDITADEKQELDEALQRQIQAAFRTDEIRRTQPT 60

Query: 825  PQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGN 1004
            PQDEMR GMSYFHETIWKGVPRFLRRVDTALK+IGINER+PYNAPLI+FSSWMGGDRDGN
Sbjct: 61   PQDEMRYGMSYFHETIWKGVPRFLRRVDTALKSIGINERLPYNAPLIRFSSWMGGDRDGN 120

Query: 1005 PRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKH 1184
            PRVTPEVTRDV LLA+MMA NLY SQIEDLMFE+SMWRC DELRARA+E +  S +  KH
Sbjct: 121  PRVTPEVTRDVVLLARMMAANLYISQIEDLMFELSMWRCTDELRARAEEWYHVSSKIEKH 180

Query: 1185 YIEFWKQVPPNEPYRVILGDVRDKLY 1262
            YIEFWKQ+P +EPYRVILG VRDKLY
Sbjct: 181  YIEFWKQIPLDEPYRVILGYVRDKLY 206



>gb:HCO318577_1681653 Heteropogon contortus partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 398

 Score =  355 bits (911), Expect = 1e-96
 Identities = 172/216 (79%), Positives = 191/216 (88%), Gaps = 2/216 (0%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            +VDLV TAHPTQS RRSLLQK+ARIR+CL QL  KD TP+DK+ELDEAL REIQAAFRTD
Sbjct: 1    SVDLVFTAHPTQSARRSLLQKNARIRNCLTQLSAKDTTPEDKKELDEALAREIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GMSY HET+WKGVP+FLRRVDTALK+IGINER+PYN PLI+F SW
Sbjct: 61   EIRRAQPTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKDIGINERLPYNVPLIKFCSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADEL-- 1154
            MGGDRDGNPRVTPEVTRDVCLL++MMA NLY  Q+EDLMFE+SMWR N ELRARADEL  
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLSRMMAANLYIDQVEDLMFELSMWRSNAELRARADELLS 180

Query: 1155 HRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              +S++  K+YIEFWKQ+PPNEPYRVILG VRDKLY
Sbjct: 181  TPASKKVTKYYIEFWKQIPPNEPYRVILGAVRDKLY 216



>gb:ETE318590_1677059 Eragrostis tenuifolia partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 396

 Score =  355 bits (910), Expect = 1e-96
 Identities = 168/214 (78%), Positives = 193/214 (90%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            TV+LVLTAHPTQS+RRSLLQKH +IR+ L QLY KDIT D+K+ELDEALQ EIQAAFRTD
Sbjct: 1    TVELVLTAHPTQSLRRSLLQKHTKIRNYLTQLYAKDITEDEKKELDEALQAEIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            E+RR  PTPQDEMR GMSYF E IWKGVP+ LRRVDTALK+IGI+ER+PY+APLI+FSSW
Sbjct: 61   EVRRAQPTPQDEMRYGMSYFQENIWKGVPKSLRRVDTALKSIGIDERLPYDAPLIKFSSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGNPRVTPEVTRDVCLLA+M+A NLY S+IEDLMFE+SMWRCNDELRARADEL  
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLARMIAANLYISEIEDLMFELSMWRCNDELRARADELLS 180

Query: 1161 SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            + ++ +KHYIEFW+ +P  EPYRV+LGD+RDKLY
Sbjct: 181  APKKASKHYIEFWRAIPSTEPYRVLLGDLRDKLY 214



>gb:SVE318575_1723228 Sorghum verticilliflorum partial mRNA for
            putative phosphoenolpyruvate carboxylase (pepc gene).
          Length = 398

 Score =  354 bits (908), Expect = 2e-96
 Identities = 168/216 (77%), Positives = 192/216 (88%), Gaps = 2/216 (0%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            +VDLV TAHP QS RRSLLQK+ARIR+CL QL  KD+T +DK+ELDEAL REIQAAFRTD
Sbjct: 1    SVDLVFTAHPMQSARRSLLQKNARIRNCLTQLSAKDVTVEDKKELDEALHREIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GMSY HET+W GVP+FLRRVDTALKNIGINER+PY+ PLI+F SW
Sbjct: 61   EIRRAQPTPQDEMRYGMSYIHETVWNGVPKFLRRVDTALKNIGINERLPYDVPLIKFCSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            MGGDRDGNPRVTPE+TRDVCLL++MMA NLY +Q+EDLMFE+SMWRCNDELRARA+E+  
Sbjct: 121  MGGDRDGNPRVTPEMTRDVCLLSRMMAANLYINQVEDLMFELSMWRCNDELRARAEEVQS 180

Query: 1161 --SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              +S++  K+YIEFWKQ+PPNEPYRVILG VRDKLY
Sbjct: 181  TPASKKVTKYYIEFWKQIPPNEPYRVILGAVRDKLY 216



>gb:HRU318580_1682106 Hyparrhenia rufa partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 387

 Score =  354 bits (908), Expect = 2e-96
 Identities = 170/210 (80%), Positives = 188/210 (89%), Gaps = 2/210 (0%)
 Frame = +3

Query: 639  TAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTP 818
            TAHPTQS RRSLLQK+ARIR+CL QL  KD TP+DK+ELDEALQREIQAAFRTDEIRR  
Sbjct: 2    TAHPTQSARRSLLQKNARIRNCLTQLSAKDTTPEDKKELDEALQREIQAAFRTDEIRRAQ 61

Query: 819  PTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
            PTPQDEMR GMSY HET+WKGVP+FLRRVDTALKNIGINER+PYN PLI+F SWMGGDRD
Sbjct: 62   PTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKNIGINERLPYNVPLIKFCSWMGGDRD 121

Query: 999  GNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADEL--HRSSRR 1172
            GNPRVTPEVTRDVCLL++MMA NLY  Q+EDLMFE+SMWR N+ELRARADEL    +S++
Sbjct: 122  GNPRVTPEVTRDVCLLSRMMAANLYIDQVEDLMFELSMWRANEELRARADELLSTPASKK 181

Query: 1173 DAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              K+YIEFWKQ+PPNEPYRVILG VRDKLY
Sbjct: 182  VTKYYIEFWKQIPPNEPYRVILGAVRDKLY 211



>gb:VZI318573_1727554 Vetiveria zizanioides partial internal mRNA for
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 398

 Score =  353 bits (907), Expect = 3e-96
 Identities = 171/216 (79%), Positives = 190/216 (87%), Gaps = 2/216 (0%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            + DLV TAHPTQS RRSLLQK+ARIR+CL QL  KDIT DDKQELDEALQREIQAAFRTD
Sbjct: 1    SADLVFTAHPTQSARRSLLQKNARIRNCLTQLKAKDITEDDKQELDEALQREIQAAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GMSY HET+WKGVP+FLRRVDTALKNIGI ER+PY+ PLI+F SW
Sbjct: 61   EIRRAQPTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKNIGIKERLPYSVPLIRFCSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADEL-- 1154
            MGGDRDGNPRVTPEVTRDVCLL++MMA NLY   IEDLMFE+SMWRC+DELRARA+E+  
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLSRMMAANLYIDAIEDLMFELSMWRCDDELRARAEEVLS 180

Query: 1155 HRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              S+++  K+YIEFWKQ+PPNEPYRVIL  VRDKLY
Sbjct: 181  TPSAKKVTKYYIEFWKQIPPNEPYRVILAAVRDKLY 216



>gb:CDA279036_1646024 Cynodon dactylon (L.) Pers. partial mRNA for
            putative C4 phosphoenolpyruvate carboxylase (c4 PEPCase
            gene).
          Length = 390

 Score =  353 bits (907), Expect = 3e-96
 Identities = 168/208 (80%), Positives = 189/208 (90%)
 Frame = +3

Query: 639  TAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTP 818
            TAHPTQS+RRSLLQKH +IR+CL QLY KDIT D+K+ELDEALQ EIQAAFRTDEIRR+ 
Sbjct: 2    TAHPTQSLRRSLLQKHTKIRNCLTQLYAKDITEDEKKELDEALQAEIQAAFRTDEIRRSQ 61

Query: 819  PTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
            PTPQDEMR GMSYFHETIWKGVP+FLRRVDTALK+IGINER+PYNAP+I+FSSWMGGDRD
Sbjct: 62   PTPQDEMRYGMSYFHETIWKGVPKFLRRVDTALKSIGINERLPYNAPVIKFSSWMGGDRD 121

Query: 999  GNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDA 1178
            GNPRVTPEVTRDVCLLA+M+A NLY SQIED+MFE+SMWRCNDELRA A++ H +SR   
Sbjct: 122  GNPRVTPEVTRDVCLLARMIAANLYISQIEDVMFELSMWRCNDELRALAEQ-HLASRETK 180

Query: 1179 KHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            KHYIEFW+ +P  EPYRV+LG VRDKLY
Sbjct: 181  KHYIEFWRAIPATEPYRVLLGYVRDKLY 208



>gb:PPA318578_1701211 Pogonatherum paniceum partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 398

 Score =  350 bits (898), Expect = 3e-95
 Identities = 168/216 (77%), Positives = 190/216 (87%), Gaps = 2/216 (0%)
 Frame = +3

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
            +VDLV TAHPTQS RRSLLQ +ARIR+CL  L  KD TP+DK+ELDEALQREIQ+AFRTD
Sbjct: 1    SVDLVFTAHPTQSARRSLLQNNARIRNCLTLLSAKDTTPEDKKELDEALQREIQSAFRTD 60

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            EIRR  PTPQDEMR GMSY HET+WKGVP+FLRRVDTALKNIGINER+PY+ PLI+F SW
Sbjct: 61   EIRRAQPTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKNIGINERLPYDVPLIKFCSW 120

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADEL-- 1154
            MGGDRDGNPRVTPEVTRDVCLL++MMA NLY  Q+EDLMFE+SMWR N+ELR RA+EL  
Sbjct: 121  MGGDRDGNPRVTPEVTRDVCLLSRMMAANLYIDQVEDLMFELSMWRSNEELRVRAEELLS 180

Query: 1155 HRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              +S++  K+YIEFWKQ+PPNEPYRVILG VRDKLY
Sbjct: 181  TPASKKVTKYYIEFWKQIPPNEPYRVILGAVRDKLY 216



>gb:TQU318581_1725778 Themeda quadrivalvis partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 383

 Score =  347 bits (891), Expect = 2e-94
 Identities = 167/210 (79%), Positives = 186/210 (88%), Gaps = 2/210 (0%)
 Frame = +3

Query: 639  TAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTP 818
            TAHPTQS RRSLLQK+ARIR+CL QL  KD TP+DK+ELDEALQREIQAAFRTDEIRR  
Sbjct: 2    TAHPTQSARRSLLQKNARIRNCLTQLSAKDTTPEDKKELDEALQREIQAAFRTDEIRRAQ 61

Query: 819  PTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
            PTPQDEMR GMSY HET+WKGVP+FLRRVDTALKNIG+NER+PYN PLI+F SWMGGDRD
Sbjct: 62   PTPQDEMRYGMSYIHETVWKGVPKFLRRVDTALKNIGVNERLPYNVPLIKFCSWMGGDRD 121

Query: 999  GNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADEL--HRSSRR 1172
            GNPRVTPEVTRDVCLL++MMA NLY  Q+EDLMFE+SMWR N ELRA+ADEL    +S++
Sbjct: 122  GNPRVTPEVTRDVCLLSRMMAANLYIDQVEDLMFELSMWRSNAELRAKADELLSTPASKK 181

Query: 1173 DAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
              K+YIEFWKQ+P NEPYRVILG VRDKLY
Sbjct: 182  VTKYYIEFWKQIPENEPYRVILGAVRDKLY 211



>gb:CLA318579_1647723 Coix lacryma-jobi partial mRNA for putative
            phosphoenolpyruvate carboxylase (pepc gene).
          Length = 375

 Score =  335 bits (859), Expect = 1e-90
 Identities = 161/202 (79%), Positives = 179/202 (88%), Gaps = 2/202 (0%)
 Frame = +3

Query: 663  RRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMR 842
            RRSLLQK+ARIR+CL QL  KDIT DDK+ELDEALQ  IQAAFRTDEIRR  PTPQDEMR
Sbjct: 1    RRSLLQKNARIRNCLTQLSAKDITADDKKELDEALQIGIQAAFRTDEIRRAQPTPQDEMR 60

Query: 843  AGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPE 1022
             GMSY HET+WKGVP+FLRRVDTALKNIGINER+PYN PLI+F SWMGGDRDGNPRVTPE
Sbjct: 61   YGMSYIHETVWKGVPKFLRRVDTALKNIGINERLPYNVPLIKFCSWMGGDRDGNPRVTPE 120

Query: 1023 VTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR--SSRRDAKHYIEF 1196
            VTRDVCLLA+MMA NLY  Q+E+LMFE+SMWRCN+ELR RA+EL    +S++  K+YIEF
Sbjct: 121  VTRDVCLLARMMAANLYIDQVEELMFELSMWRCNEELRCRAEELQSTPASKKVTKYYIEF 180

Query: 1197 WKQVPPNEPYRVILGDVRDKLY 1262
            WKQ+PPNEPYRVILG VRDKLY
Sbjct: 181  WKQIPPNEPYRVILGAVRDKLY 202



>gb:AB078718_1523750 Nicotiana sylvestris Nsppc1 gene for
            phosphoenolpyruvate carboxylase, partial cds.
          Length = 750

 Score =  318 bits (815), Expect = 1e-85
 Identities = 151/163 (92%), Positives = 157/163 (96%), Gaps = 1/163 (0%)
 Frame = +3

Query: 777  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA 956
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct: 1    IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA 60

Query: 957  PLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELR 1136
            PLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+MMA NLYYSQIEDLMF +SMWRCND+ R
Sbjct: 61   PLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIEDLMFALSMWRCNDDCR 120

Query: 1137 ARADE-LHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
             R+DE LH SSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY
Sbjct: 121  VRSDEVLHSSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 163



>gb:PHA276508_1700045 Pinus halepensis partial mRNA for
            phosphoenolpyruvate carboxylase (ppc1 gene).
          Length = 372

 Score =  300 bits (768), Expect = 4e-80
 Identities = 137/153 (89%), Positives = 150/153 (98%)
 Frame = +3

Query: 804  IRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWM 983
            IRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALK+IGINER+PYNAPLIQFSSWM
Sbjct: 1    IRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKSIGINERMPYNAPLIQFSSWM 60

Query: 984  GGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRS 1163
            GGDRDGNPRVTPEVTRDVCLLA+MMA NLYYSQIEDLMFE+SMWRC+DELRARA +LH +
Sbjct: 61   GGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIEDLMFELSMWRCSDELRARALQLHSA 120

Query: 1164 SRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            S++DAKHYIEFWKQ+PPNEP+RVILGDVRDKLY
Sbjct: 121  SKKDAKHYIEFWKQIPPNEPFRVILGDVRDKLY 153



>gb:AY517644_1610773 Chlamydomonas reinhardtii phosphoenolpyruvate
            carboxylase (Ppc1) mRNA, complete cds.
          Length = 974

 Score =  285 bits (728), Expect = 2e-75
 Identities = 157/353 (44%), Positives = 226/353 (64%), Gaps = 9/353 (2%)
 Frame = +3

Query: 231  DALLLDRFLDILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIV 410
            D+LL   F  IL+  H  NL   V   Y LS  +         E +   ++ L P + I+
Sbjct: 33   DSLLRQVFFSILRH-HHPNLAAKVDVIYALSQAWCTSQSDNDFELMVKYVSDLKPEERIL 91

Query: 411  IAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSP 590
            +A SFSHMLNL NL EEV  +     ++ +   + E  + T  D   +L +L      +P
Sbjct: 92   VASSFSHMLNLHNLTEEVNSS-----QIGRAVRLGEMDSPTR-DTNHSLLKLTTTNGFTP 145

Query: 591  QEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQ 770
            Q+V+D L +QTV+LVLTAHPTQ++R SLL+K+A +R  L  L++K ++  +K E  EA++
Sbjct: 146  QQVYDTLCSQTVELVLTAHPTQALRASLLKKYAIVRRELDTLHSKRMSEYEKIETLEAIR 205

Query: 771  REIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPY 950
              +QAA+RTDEIRR+ PTPQDEMR+G+SYF   I+  VP F RRVDTAL+ +G+  R+P 
Sbjct: 206  AAVQAAWRTDEIRRSKPTPQDEMRSGLSYFSTVIFDVVPVFHRRVDTALEKLGL-PRLPL 264

Query: 951  NAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDE 1130
            +  L +F SWMGGDRDGNP VT E TRDV +LA++ A N+Y+ Q+E LMF++S+WRC+ E
Sbjct: 265  DRALFKFGSWMGGDRDGNPNVTAETTRDVVVLARLEAVNVYFRQVEGLMFDLSIWRCSPE 324

Query: 1131 LRARADELHRSSRRDA---------KHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            ++  A+ L  +  RDA         ++Y++FW  +PP EP+RV+L  +RD+LY
Sbjct: 325  MKELAERLAAAESRDAARVAEERKRRNYVDFWAPIPPTEPFRVVLAHMRDRLY 377



>gb:AY548401_1613164 Australopyrum velutinum voucher D-2873-2878 GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.>gb:AY548402_1613165 Bromus
           tectorum voucher Kellogg s.n. GH phosphoenolpyruvate
           carboxylase (pepC) gene, exons 2 through 4 and partial
           cds.>gb:AY548407_1613170 Elymus elymoides voucher
           PI-531606(3) ID phosphoenolpyruvate carboxylase (pepC)
           gene, exons 2 through 4 and partial
           cds.>gb:AY548410_1613173 Elymus wawawaiensis voucher
           PI-598812(2) ID phosphoenolpyruvate carboxylase (pepC)
           gene, exons 2 through 4 and partial
           cds.>gb:AY548414_1613176 Elymus hystrix voucher
           M.E.Barkworth 97-87 ID phosphoenolpyruvate carboxylase
           (pepC) gene, exons 2 through 4 and partial
           cds.>gb:AY548419_1613180 Hordeum brachyantherum subsp.
           californicum voucher MA-138-1-40 GH phosphoenolpyruvate
           carboxylase (pepC) gene, exons 2 through 4 and partial
           cds.>gb:AY548427_1613187 Pseudoroegneria spicata voucher
           D2844 GH phosphoenolpyruvate carboxylase (pepC) gene,
           exons 2 through 4 and partial cds.>gb:AY548429_1613188
           Secale cereale voucher Kellogg s.n. GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.>gb:AY548430_1613189 Secale
           montanum subsp. montanum voucher T36554 GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 124

 Score =  235 bits (600), Expect = 1e-60
 Identities = 116/124 (93%), Positives = 120/124 (96%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120

Query: 900 RVDT 911
           RVDT
Sbjct: 121 RVDT 124



>gb:AY548413_1613175 Elymus glaucus voucher W6-10215(2) ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 124

 Score =  234 bits (596), Expect = 4e-60
 Identities = 115/124 (92%), Positives = 119/124 (95%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEA QREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEAFQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120

Query: 900 RVDT 911
           RVDT
Sbjct: 121 RVDT 124



>gb:AY548406_1613169 Elymus canadensis voucher PI-578675 ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 124

 Score =  233 bits (595), Expect = 5e-60
 Identities = 115/124 (92%), Positives = 119/124 (95%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEAL REIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEALHREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120

Query: 900 RVDT 911
           RVDT
Sbjct: 121 RVDT 124



>gb:AY548405_1613168 Elymus canadensis voucher PI-531568(2) ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 124

 Score =  232 bits (591), Expect = 1e-59
 Identities = 115/124 (92%), Positives = 119/124 (95%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QL 
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLC 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120

Query: 900 RVDT 911
           RVDT
Sbjct: 121 RVDT 124



>gb:AY548421_1613182 Hordeum marinum voucher PI-304346(1&2) ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 122

 Score =  231 bits (589), Expect = 2e-59
 Identities = 114/122 (93%), Positives = 118/122 (96%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120

Query: 900 RV 905
           RV
Sbjct: 121 RV 122



>gb:AY548399_1613162 Aegilops comosa voucher G-602 GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 124

 Score =  231 bits (588), Expect = 3e-59
 Identities = 114/124 (91%), Positives = 118/124 (95%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           D EETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DXEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEA QREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEAPQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120

Query: 900 RVDT 911
           RVDT
Sbjct: 121 RVDT 124



>gb:AY548415_1613177 Elymus lanceolatus voucher PI-531623 ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 124

 Score =  230 bits (587), Expect = 4e-59
 Identities = 114/124 (91%), Positives = 118/124 (95%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QL 
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLC 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKG P+FLR
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGAPKFLR 120

Query: 900 RVDT 911
           RVDT
Sbjct: 121 RVDT 124



>gb:AY548409_1613172 Elymus lanceolatus voucher PI-531623 ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.>gb:AY548420_1613181 Hordeum
           jubatum voucher RJMG106(2) ID phosphoenolpyruvate
           carboxylase (pepC) gene, exons 2 through 4 and partial
           cds.>gb:AY548431_1613190 Taeniatherum caput-medusae
           voucher RJMG189(d) ID phosphoenolpyruvate carboxylase
           (pepC) gene, exons 2 through 4 and partial cds.
          Length = 121

 Score =  229 bits (585), Expect = 7e-59
 Identities = 113/121 (93%), Positives = 117/121 (96%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120

Query: 900 R 902
           R
Sbjct: 121 R 121



>gb:AY548422_1613183 Hordeum murinum voucher Ciho-15683(2) ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 120

 Score =  228 bits (580), Expect = 3e-58
 Identities = 112/120 (93%), Positives = 116/120 (96%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLR
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLR 120



>gb:AY548404_1613167 Elymus californicus voucher M.E.Barkworth s.n.
           UTC phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.>gb:AY548408_1613171 Elymus
           hystrix voucher M.E.Barkworth 97-87 ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 119

 Score =  226 bits (575), Expect = 1e-57
 Identities = 111/119 (93%), Positives = 115/119 (96%)
 Frame = +3

Query: 555 LKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDIT 734
           LKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDIT
Sbjct: 1   LKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDIT 60

Query: 735 PDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDT 911
           PDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDT
Sbjct: 61  PDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDT 119



>gb:AY548426_1613186 Pseudoroegneria spicata voucher PI-610986 ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 120

 Score =  225 bits (574), Expect = 1e-57
 Identities = 111/120 (92%), Positives = 115/120 (95%)
 Frame = +3

Query: 546 EETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNK 725
           EETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+K
Sbjct: 1   EETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSK 60

Query: 726 DITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRV 905
           DITPDDKQELDEALQREIQAAFRTDEIRR  PTPQDEMRAGMSYFHETIWKGVP+FLRRV
Sbjct: 61  DITPDDKQELDEALQREIQAAFRTDEIRRAQPTPQDEMRAGMSYFHETIWKGVPKFLRRV 120



>gb:AY548416_1613178 Elymus wawawaiensis voucher PI-598812(2) ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 119

 Score =  224 bits (571), Expect = 3e-57
 Identities = 110/119 (92%), Positives = 115/119 (96%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMK+SP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKESPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFL 896
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FL
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFL 119



>gb:AY548412_1613174 Elymus elymoides voucher PI-531606(3) ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.>gb:AY548417_1613179
           Eremopyrum orientale voucher H-5555 GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 118

 Score =  224 bits (571), Expect = 3e-57
 Identities = 110/118 (93%), Positives = 114/118 (96%)
 Frame = +3

Query: 558 KRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITP 737
           KRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITP
Sbjct: 1   KRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITP 60

Query: 738 DDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDT 911
           DDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDT
Sbjct: 61  DDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDT 118



>gb:AY548403_1613166 Haynaldia villosa voucher MA-141-46-75 GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 116

 Score =  221 bits (563), Expect = 2e-56
 Identities = 109/116 (93%), Positives = 112/116 (96%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP 887
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVP 116



>gb:AY548425_1613185 Peridictyon sanctum voucher KJ248 GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 117

 Score =  218 bits (556), Expect = 2e-55
 Identities = 108/115 (93%), Positives = 111/115 (96%)
 Frame = +3

Query: 540 DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
           DIEETLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY
Sbjct: 1   DIEETLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLY 60

Query: 720 NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGV 884
           +KDITPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGV
Sbjct: 61  SKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGV 115



>gb:VFA011303_1727074 Vicia faba mRNA for
            phosphoenolpyruvate-carboxylase, pepc2 isoform, partial.
          Length = 704

 Score =  217 bits (553), Expect = 4e-55
 Identities = 100/116 (86%), Positives = 111/116 (95%), Gaps = 2/116 (1%)
 Frame = +3

Query: 921  NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMF 1100
            NIGI+ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+MMA NLYYSQIEDLMF
Sbjct: 1    NIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIEDLMF 60

Query: 1101 EMSMWRCNDELRARADELHRSSRRD--AKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            E+SMWRCNDELR RA+EL+RSS++D  AKHYIEFWK +PPNEPYRV+LG+VRD+LY
Sbjct: 61   ELSMWRCNDELRVRAEELNRSSKKDAVAKHYIEFWKNIPPNEPYRVLLGEVRDRLY 116



>gb:AY548432_1613191 Thinopyrum elongatum voucher RJMG113 ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 119

 Score =  216 bits (551), Expect = 6e-55
 Identities = 106/114 (92%), Positives = 110/114 (96%)
 Frame = +3

Query: 552 TLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDI 731
           TLKRLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDI
Sbjct: 1   TLKRLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDI 60

Query: 732 TPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRF 893
           TPDDKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+F
Sbjct: 61  TPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKF 114



>gb:AY548423_1613184 Hordeum vulgare voucher RJMG107 ID
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 110

 Score =  209 bits (531), Expect = 1e-52
 Identities = 102/110 (92%), Positives = 106/110 (96%)
 Frame = +3

Query: 561 RLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPD 740
           RLV DMKKSP EVFDALKNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPD
Sbjct: 1   RLVFDMKKSPAEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPD 60

Query: 741 DKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPR 890
           DKQELDEALQREIQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+
Sbjct: 61  DKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPK 110



>gb:D26377S1_1674495 Brassica napus PE15-PEPCase gene for
           phosphoenolpyruvate carboxylase, exon 3, complete
           sequence.
          Length = 102

 Score =  202 bits (515), Expect = 9e-51
 Identities = 96/102 (94%), Positives = 99/102 (97%)
 Frame = +3

Query: 693 IRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 872
           IRDCLAQLY KDITPDDKQELDE+LQREIQA FRTDEIRRTPPTPQDEMRAGMSYFHETI
Sbjct: 1   IRDCLAQLYAKDITPDDKQELDESLQREIQARFRTDEIRRTPPTPQDEMRAGMSYFHETI 60

Query: 873 WKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
           W GVP+FLRRVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRD
Sbjct: 61  WNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRD 102



>gb:AP002882_1823608 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0439B06.
          Length = 1035

 Score =  199 bits (506), Expect = 1e-49
 Identities = 112/285 (39%), Positives = 167/285 (58%)
 Frame = +3

Query: 360  EELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITES 539
            ++LG  L ++   DS+ +A++FSH LNL  +A+     Y R +K +       N A    
Sbjct: 71   KQLGAELAAMSLEDSLCLARAFSHHLNLMTIAD----TYHRVRKAR-------NFADLSK 119

Query: 540  DIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLY 719
              ++T  +L+     SP+E++D +  Q V++VLTAHPTQ  RR+L  KH RI   L    
Sbjct: 120  SCDDTFAKLI-QSGVSPEELYDTVCKQEVEIVLTAHPTQINRRTLQYKHLRIAHLLEFNE 178

Query: 720  NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
              D++ +DK+ L E L REI A ++TDE+RR  PTP DE RAG+    +++WK +P +LR
Sbjct: 179  RADLSLEDKEILIEDLVREITAIWQTDELRRHKPTPVDEARAGLHIVEQSLWKAIPHYLR 238

Query: 900  RVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYS 1079
            RV  ALK     + +P     I+F SWMGGDRDGNP VT +VTRDV +L++ MA +LY  
Sbjct: 239  RVSNALKK-NTGKPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTRDVSILSQWMAIDLYIR 297

Query: 1080 QIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPP 1214
            +++ L FE+S+ RC+++L   A+++              W Q  P
Sbjct: 298  ELDTLSFELSINRCSEKLANLANDILLKESASEDQKTNTWNQTGP 342



>gb:D26379S1_1674497 Brassica napus PE105-PEPCase gene for
           phosphoenolpyruvate carboxylase, exon 3, complete
           sequence.
          Length = 102

 Score =  197 bits (500), Expect = 5e-49
 Identities = 94/102 (92%), Positives = 97/102 (95%)
 Frame = +3

Query: 693 IRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 872
           IRDCLAQLY K ITPDDKQ LDE+LQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI
Sbjct: 1   IRDCLAQLYAKSITPDDKQVLDESLQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 60

Query: 873 WKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
           W GVP+FL RVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRD
Sbjct: 61  WNGVPKFLLRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRD 102



>pir|PC2169|PC2169 phosphoenolpyruvate carboxykinase (diphosphate)
           (EC 4.1.1.38), PE105 - rape (fragments)
          Length = 486

 Score =  197 bits (500), Expect = 5e-49
 Identities = 94/102 (92%), Positives = 97/102 (95%)
 Frame = +3

Query: 693 IRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 872
           IRDCLAQLY K ITPDDKQ LDE+LQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI
Sbjct: 1   IRDCLAQLYAKSITPDDKQVLDESLQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 60

Query: 873 WKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
           W GVP+FL RVDTALKNIGI+ERVPYNAPLIQFSSWMGGDRD
Sbjct: 61  WNGVPKFLLRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRD 102



 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 20/24 (83%), Positives = 22/24 (91%)
 Frame = +3

Query: 1191 EFWKQVPPNEPYRVILGDVRDKLY 1262
            +FWK +PP EPYRVILGDVRDKLY
Sbjct: 102  DFWKTIPPTEPYRVILGDVRDKLY 125



>sp|Q88MR4|CAPP_PSEPK Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE016779_330940 Pseudomonas putida
            KT2440 section 6 of 21 of the complete
            genome.>gb:AE015451_946017 Pseudomonas putida KT2440
            complete genome.
          Length = 875

 Score =  191 bits (485), Expect = 3e-47
 Identities = 129/343 (37%), Positives = 183/343 (53%), Gaps = 10/343 (2%)
 Frame = +3

Query: 261  ILQDLHGENLRETVQECYELSAEYEGRHDPKKL-----EELGNVLTSLDPGDSIVIAKSF 425
            +L +L GE +R+   + +    E + RH  K       E+L + L  L   D + +A++F
Sbjct: 14   VLGELLGETIRQQHGDAFLQKIE-DIRHSAKADRRGPGEQLSSTLADLAEEDLLPVARAF 72

Query: 426  SHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFD 605
            +  LNLAN+AE+ Q+  RR          D+        + E L RL     K      D
Sbjct: 73   NQFLNLANMAEQYQLIRRRD--------ADQPEPFEAQVLPELLGRL-----KQAGHSND 119

Query: 606  ALKNQT----VDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQR 773
            AL  Q     + LVLTAHPT+  RR+L+QK+  I   LA   ++D+TP ++Q++ E L+R
Sbjct: 120  ALARQLAKLDIQLVLTAHPTEVARRTLIQKYDAIAGQLAAQDHRDLTPAERQQVRERLRR 179

Query: 774  EIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYN 953
             I  A+ T+EIRRT PTP DE + G +    ++W  +P  LR+VD AL       R+P  
Sbjct: 180  LIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPSHLRKVDKALLE-ATGLRLPLE 238

Query: 954  APLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDEL 1133
            A  I+F+SWMGGDRDGNP VT  VTR+V LLA+ MA +L+   I+ L  E+SM + ND L
Sbjct: 239  AAPIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLFLRDIDALAAELSMQQANDTL 298

Query: 1134 RARADELHRSSRRDAKHYIEFWKQVPPN-EPYRVILGDVRDKL 1259
            R                     KQV  + EPYR +L  +RD+L
Sbjct: 299  R---------------------KQVGDSAEPYRAVLKQLRDRL 320



>gb:AY563043_1615005 Glycine max phosphoenolpyruvate carboxylase
            (PEPC17) mRNA, complete cds.
          Length = 1032

 Score =  187 bits (476), Expect = 3e-46
 Identities = 121/349 (34%), Positives = 189/349 (54%), Gaps = 10/349 (2%)
 Frame = +3

Query: 189  VPGKVSEDDKLVEYD---ALLLDRFLDILQDLHGENLRETVQECYELSAEYEGRHDP--- 350
            + G ++E+     +D    LL +   DILQ   G NL + ++    L+            
Sbjct: 4    ITGDIAEEISFQSFDDDCRLLGNLLNDILQREVGTNLLDKIERTRVLAQSGCNMRQAGIV 63

Query: 351  ---KKLE-ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDE 518
               + LE +L + L+ +   ++  +A++FSH L L  +AE          +++KG     
Sbjct: 64   NMAEMLEKQLASELSKMTLEEAFTLARAFSHYLTLMGIAET-------HHRVRKGG---- 112

Query: 519  NSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIR 698
            N A      ++   +LV      P+E++D +  + V++VLTAHPTQ  RR+L  KH RI 
Sbjct: 113  NMAQIAKSCDDIFNQLVQG-GVPPEELYDTVCKREVEIVLTAHPTQINRRTLQFKHIRIA 171

Query: 699  DCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWK 878
              L      D++ +D++ + E L REI + ++TDE+RR  PTP DE RAG +   +++WK
Sbjct: 172  HLLDYNDRPDLSTEDREMVIEDLVREITSIWQTDELRRQKPTPVDEARAGFNIVEQSLWK 231

Query: 879  GVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMM 1058
             VP +LRRV  ALK     + +P     I+F SWMGGDRDGNP VT +VT+DV LL++ M
Sbjct: 232  AVPHYLRRVSNALKK-HTGKPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTKDVSLLSRWM 290

Query: 1059 ATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQ 1205
            A +LY  +++ L FE+SM +C+D L   A E+  +   + +   E W Q
Sbjct: 291  AIDLYIREVDSLRFELSMNQCSDRLSRLAHEILEAKHENRR---ENWNQ 336



>gb:CR378663_93681 Photobacterium profundum SS9; segment 1/12.
          Length = 892

 Score =  187 bits (476), Expect = 3e-46
 Identities = 114/336 (33%), Positives = 185/336 (55%), Gaps = 4/336 (1%)
 Frame = +3

Query: 264  LQDLHGENLRETVQECYELSAEYEGRHDP---KKLEELGNVLTSLDPGDSIV-IAKSFSH 431
            ++D HGE L + V+   +LS      +D    K ++EL N+     P D ++ +A++FS 
Sbjct: 39   IKDAHGEPLFDKVETIRKLSKSARAGNDSDRAKLIDELQNL-----PDDQLLPVARAFSQ 93

Query: 432  MLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDAL 611
             LNL N+AE+     R  ++            I   D  ++L   +     S  +   A+
Sbjct: 94   FLNLTNIAEQYHTISRHCEE-----------QICSPDSIDSLFGKLNANSISQLDSIQAV 142

Query: 612  KNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAF 791
            ++  ++LVLTAHPT+  RR+++ K  +I  CL+ L   +++  ++Q +++ L++ I  A+
Sbjct: 143  RDLNIELVLTAHPTEIARRTMIHKLVQINKCLSNLELSELSHSERQRVEQRLEQLIAQAW 202

Query: 792  RTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQF 971
             +D IR+  PTP DE + G +    ++W  VP FLR+ D  L    + E++P +A  ++F
Sbjct: 203  HSDVIRKQRPTPLDEAKWGFAVVENSLWHAVPEFLRQFDEKLMR-HLGEKLPLDASPVKF 261

Query: 972  SSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADE 1151
            +SWMGGDRDGNP VT EVTR+V LL++  A +L+   I++L+ E+SM +CND++R  A E
Sbjct: 262  TSWMGGDRDGNPFVTSEVTREVMLLSRWKAADLFLGDIQELVSELSMVKCNDQVRELAGE 321

Query: 1152 LHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             H                    EPYR IL D+R KL
Sbjct: 322  EH--------------------EPYRAILKDLRTKL 337



>sp|Q9HXV3|CAPP_PSEAE Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>pir|H83184|H83184 phosphoenolpyruvate
            carboxylase PA3687 [imported] - Pseudomonas aeruginosa
            (strain PAO1)>gb:AE004788_57923 Pseudomonas aeruginosa
            PAO1, section 349 of 529 of the complete
            genome.>gb:AE004091_972023 Pseudomonas aeruginosa PAO1,
            complete genome.
          Length = 878

 Score =  184 bits (468), Expect = 3e-45
 Identities = 118/344 (34%), Positives = 180/344 (52%), Gaps = 13/344 (3%)
 Frame = +3

Query: 267  QDLH--GENLRETVQECY-----------ELSAEYEGRHDPKKLEELGNVLTSLDPGDSI 407
            +D+H  GE L +T++E Y              A+   R   +  ++L   L  L+  + +
Sbjct: 10   EDVHQLGELLGDTIREQYGPRFLDKIELIRKGAKAARRGSAEGAQQLTATLDGLEEDELL 69

Query: 408  VIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKS 587
             +A++F+  LNLAN+AE+     RRR         +E        +EE L RL  D   +
Sbjct: 70   PVARAFNQFLNLANIAEQYHRIRRRRP--------NEPEPFENLVLEELLGRLK-DAGHA 120

Query: 588  PQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEAL 767
            P ++   L    ++LVLTAHPT+  RR+L+QK+  I   LA   + D+ P+++  + + L
Sbjct: 121  PGQLARQLAGLEIELVLTAHPTEVARRTLIQKYDAITAQLAAKDHADLLPEERSRIQQRL 180

Query: 768  QREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVP 947
            QR +  A+ TDEIR+  PTP DE + G +    ++W+ +P  LR VD  L      ER+P
Sbjct: 181  QRLVAEAWHTDEIRKVRPTPVDEAKWGFAVIEHSLWQALPNVLRHVDEVLLR-STGERLP 239

Query: 948  YNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCND 1127
              A  ++F+SWMGGDRDGNP VT  VTR+V LLA+ MA +LY   I+ L  E+SM + + 
Sbjct: 240  LTAAPLRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLYLRDIDRLAAELSMQQASP 299

Query: 1128 ELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            +L AR  +                      EPYR +L  +R++L
Sbjct: 300  QLLARVGD--------------------SAEPYRALLKQLRERL 323



>gb:AY548400_1613163 Agropyron cristatum voucher C-3-6-10(2) GH
           phosphoenolpyruvate carboxylase (pepC) gene, exons 2
           through 4 and partial cds.
          Length = 95

 Score =  184 bits (467), Expect = 3e-45
 Identities = 89/95 (93%), Positives = 92/95 (96%)
 Frame = +3

Query: 603 DALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQ 782
           DA KNQTVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQREIQ
Sbjct: 1   DAFKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQ 60

Query: 783 AAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP 887
           AAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP
Sbjct: 61  AAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVP 95



>gb:AE016827_342646 Mannheimia succiniciproducens MBEL55E, complete
            genome.
          Length = 880

 Score =  184 bits (467), Expect = 3e-45
 Identities = 116/359 (32%), Positives = 198/359 (55%), Gaps = 6/359 (1%)
 Frame = +3

Query: 201  VSEDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNV 377
            ++E+  ++  +  +L RFL + +Q+  G+++ E ++    LS       D K    L + 
Sbjct: 1    MTEEYLMMRNNINMLGRFLGETIQEAQGDDILELIENIRVLSRNSRSGDD-KARAALLDT 59

Query: 378  LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETL 557
            L+++   + I +A++FS  LNL N+AE+ Q   R  +        D+ SA      E + 
Sbjct: 60   LSTISADNIIPVARAFSQFLNLTNVAEQYQTMSRSHE--------DKVSA------ERST 105

Query: 558  KRLVVDMKK---SPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKD 728
              L   +K+   S +E+   ++   +++VLTAHPT+  RRSL+ K   I  CLAQL + D
Sbjct: 106  AALFARLKEQHVSQEEIIKTVQKLLIEIVLTAHPTEVTRRSLMHKQVEINKCLAQLDHTD 165

Query: 729  ITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRV- 905
            +T ++++ ++  L R I  A+ T+EIR   PTP +E + G +    ++W+G+P F+R++ 
Sbjct: 166  LTAEEQKNIEYKLLRLIAEAWHTNEIRTNRPTPLEEAKWGFAVIENSLWEGLPAFIRKLN 225

Query: 906  DTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQI 1085
            D A+++  +N  +P +   ++FSSWMGGDRDGNP VT ++TR+   LA+  A +L+ + I
Sbjct: 226  DAAVEH--LNYALPVDLTPVRFSSWMGGDRDGNPFVTAKITREALQLARWKAADLFLTDI 283

Query: 1086 EDLMFEMSMWRCNDELRAR-ADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            ++L  E+SM +C  E R +  D L                     EPYRV++ D+R KL
Sbjct: 284  QELCDELSMTQCTAEFREKYGDHL---------------------EPYRVVVKDLRSKL 321



>gb:ATH532903_1552868 Arabidopsis thaliana mRNA for
            phosphoenolpyruvate carboxylase (ppc4 gene).
          Length = 1032

 Score =  182 bits (463), Expect = 1e-44
 Identities = 109/313 (34%), Positives = 175/313 (55%), Gaps = 7/313 (2%)
 Frame = +3

Query: 237  LLLDRFLDILQDLHGENLRETVQECY-----ELSAEYEGRHDPKKL--EELGNVLTSLDP 395
            LL   F D+LQ   G    E V+         L+    G  D   L  ++L + ++ +  
Sbjct: 23   LLGSLFHDVLQREVGNPFMEKVERIRILAQSALNLRMAGIEDTANLLEKQLTSEISKMPL 82

Query: 396  GDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVD 575
             +++ +A++F+H LNL  +A+          ++ K   V + +   +    + L+  +  
Sbjct: 83   EEALTLARTFTHSLNLMGIADT-------HHRMHKVHNVTQLARSCDDIFSQLLQSGI-- 133

Query: 576  MKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQEL 755
               SP E++  +  Q V++VLTAHPTQ  RR+L  KH RI   L      D++ +D++ L
Sbjct: 134  ---SPDELYKTVCKQEVEIVLTAHPTQINRRTLQYKHIRIAHLLEYNTRSDLSVEDRETL 190

Query: 756  DEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGIN 935
             E L REI + ++TDE+RR  PTP DE RAG++   +++WK VP++LRRV  +LK     
Sbjct: 191  IEDLVREITSLWQTDELRRQKPTPVDEARAGLNIVEQSLWKAVPQYLRRVSNSLKKF-TG 249

Query: 936  ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMW 1115
            + +P     ++F SWMGGDRDGNP VT +VT++V LL++ MA +LY  +++ L FE+S  
Sbjct: 250  KPLPLTCTPMKFGSWMGGDRDGNPNVTAKVTKEVSLLSRWMAIDLYIREVDSLRFELSTD 309

Query: 1116 RCNDELRARADEL 1154
            RC+D     AD++
Sbjct: 310  RCSDRFSRLADKI 322



>gb:BX950851_838943 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 879

 Score =  182 bits (462), Expect = 1e-44
 Identities = 109/334 (32%), Positives = 177/334 (52%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            D +++  GEN+ + V+   +LS      ++ K  +EL   L +L   + + +A++FS  L
Sbjct: 21   DTIKEALGENILDKVETIRKLSKSSRAGNE-KHRQELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NL N AE+        +           +A   + +    KRL      S +++ DA+++
Sbjct: 80   NLTNTAEQYHTISPHGE-----------AASNPAQLSSAFKRLKESKDLSERDIRDAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL QL + D+   ++ ++   L++ I  ++ T
Sbjct: 129  LSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERNQVMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  PTP DE + G +    ++W+GVP FLR +D  L+      R+P +A  ++F+S
Sbjct: 189  DEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQ-AFGYRLPVDAVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT EVTR V LL++  A +L+   I+ L+ E+SM  C  EL        
Sbjct: 248  WMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLRDIQVLVSELSMSECTPEL-------- 299

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
                      +E        EPYR I+  +R +L
Sbjct: 300  ----------LELAGGSEVQEPYRAIMKSLRSQL 323



>pir|C96712|C96712 hypothetical protein F14K14.14 [imported] -
            Arabidopsis thaliana>gb:AE005173_894496 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC011914_1537532 Arabidopsis thaliana
            chromosome 1 BAC F14K14 genomic sequence, complete
            sequence.
          Length = 981

 Score =  182 bits (462), Expect = 1e-44
 Identities = 114/337 (33%), Positives = 179/337 (53%), Gaps = 10/337 (2%)
 Frame = +3

Query: 237  LLLDRFLDILQDLHGENLRETVQECY-----ELSAEYEGRHDPKKL--EELGNVLTSLDP 395
            LL   F D+LQ   G    E V+         L+    G  D   L  ++L + ++ +  
Sbjct: 23   LLGSLFHDVLQREVGNPFMEKVERIRILAQSALNLRMAGIEDTANLLEKQLTSEISKMPL 82

Query: 396  GDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVD 575
             +++ +A++F+H LNL  +A+                    +S + +S I          
Sbjct: 83   EEALTLARTFTHSLNLMGIAD------------------THHSQLLQSGI---------- 114

Query: 576  MKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQEL 755
               SP E++  +  Q V++VLTAHPTQ  RR+L  KH RI   L      D++ +D++ L
Sbjct: 115  ---SPDELYKTVCKQEVEIVLTAHPTQINRRTLQYKHIRIAHLLEYNTRSDLSVEDRETL 171

Query: 756  DEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGIN 935
             E L REI + ++TDE+RR  PTP DE RAG++   +++WK VP++LRRV  +LK     
Sbjct: 172  IEDLVREITSLWQTDELRRQKPTPVDEARAGLNIVEQSLWKAVPQYLRRVSNSLKKF-TG 230

Query: 936  ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMW 1115
            + +P     ++F SWMGGDRDGNP VT +VT++V LL++ MA +LY  +++ L FE+S  
Sbjct: 231  KPLPLTCTPMKFGSWMGGDRDGNPNVTAKVTKEVSLLSRWMAIDLYIREVDSLRFELSTD 290

Query: 1116 RCNDELRARADELHRSSRRDAKH---YIEFWKQVPPN 1217
            RC+D     AD++      +++H    I     +PPN
Sbjct: 291  RCSDRFSRLADKILEKDFGESRHTKFEIATTDYMPPN 327



>sp|P43920|CAPP_HAEIN Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>pir|I64133|I64133 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Haemophilus influenzae
            (strain Rd KW20)>gb:U32836_205294 Haemophilus influenzae
            Rd KW20 section 151 of 163 of the complete
            genome.>gb:L42023_1097843 Haemophilus influenzae Rd KW20
            complete genome.
          Length = 879

 Score =  180 bits (457), Expect = 5e-44
 Identities = 114/342 (33%), Positives = 182/342 (53%), Gaps = 2/342 (0%)
 Frame = +3

Query: 240  LLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIA 416
            +L RFL + + D  GE++ E ++   +LS       D K  + L + L S+   + I +A
Sbjct: 14   MLGRFLGETINDAQGEDILELIENIRKLSRNSRAGDD-KARQALLDTLGSISNENIIPVA 72

Query: 417  KSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQE 596
            ++FS  LNL N+AE+ Q   R     +           +   + E  KRL  +   S +E
Sbjct: 73   RAFSQFLNLTNIAEQYQTISREHSLAQS----------SSQSLSELFKRLK-EQNASVEE 121

Query: 597  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE 776
            V   ++   ++LVLTAHPT++ RRSL+ KH  I  CL++L + D+T  ++  ++  L R 
Sbjct: 122  VHKTVEKLLIELVLTAHPTETTRRSLIHKHIEINKCLSKLEHHDLTEKERNIIERLLLRL 181

Query: 777  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRV-DTALKNIGINERVPYN 953
            I  A+ T+EIR   PTP DE + G +    ++W+ VP FLR++ +TA + +G +  V   
Sbjct: 182  IAEAWHTNEIRTVRPTPFDEAKWGFAMLENSLWQAVPEFLRQLNETAREFLGYDLSVGLK 241

Query: 954  APLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDEL 1133
               ++ SSWMGGDRDGNP VT ++T+ V   A+  A +L+   I  L  E+SM +C+DE 
Sbjct: 242  P--VRISSWMGGDRDGNPFVTAQITKKVLYFARWKAADLFLQDISKLADELSMMKCSDEF 299

Query: 1134 RARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            R +  E          H           EPYR ++ ++R++L
Sbjct: 300  RDKYGE----------HL----------EPYRFVVKNLRNQL 321



>pir|PC2170|PC2170 phosphoenolpyruvate carboxykinase (diphosphate) (EC
            4.1.1.38), PE19 - rape (fragments)
          Length = 369

 Score =  179 bits (455), Expect = 8e-44
 Identities = 90/117 (76%), Positives = 96/117 (82%)
 Frame = +3

Query: 693  IRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 872
            I+DCLAQLY KDITPDDKQELDE+LQREIQAAFRTDEI+R PPT QDEMRA MSYFHE I
Sbjct: 1    IKDCLAQLYTKDITPDDKQELDESLQREIQAAFRTDEIKRMPPTSQDEMRAXMSYFHERI 60

Query: 873  WKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCL 1043
            W GVP+FLRR   ALKNIGI+ERVPYNAPLIQ SSWMGGDRD    + P     V L
Sbjct: 61   WNGVPKFLRR---ALKNIGIDERVPYNAPLIQLSSWMGGDRDFWKTIPPTEPYSVVL 114



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = +3

Query: 1191 EFWKQVPPNEPYRVILGDVRDKLY 1262
            +FWK +PP EPY V+LGDVRD LY
Sbjct: 99   DFWKTIPPTEPYSVVLGDVRDTLY 122



>gb:AE017138_388868 Yersinia pestis biovar Medievalis str. 91001
            section 12 of 16 of the complete
            genome.>gb:AE017042_1145434 Yersinia pestis biovar
            Medievalis str. 91001 complete genome.
          Length = 898

 Score =  179 bits (453), Expect = 1e-43
 Identities = 105/320 (32%), Positives = 177/320 (55%), Gaps = 1/320 (0%)
 Frame = +3

Query: 189  VPGKVSEDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEE 365
            V G ++E    +  +  +L   L D +++  GE++ + V+   +LS      ++  + +E
Sbjct: 17   VRGHMNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEASR-QE 75

Query: 366  LGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDI 545
            L   L +L   + + +A++FS  LNL N AE+                     A +  + 
Sbjct: 76   LLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYH------------SISPHGEAASNPEA 123

Query: 546  EETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNK 725
               L   + D K S Q++  A+ + +++LVLTAHPT+  RR+L+ K   +  CL+QL + 
Sbjct: 124  LAQLFTRLKDKKLSDQDMRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHN 183

Query: 726  DITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRV 905
            D+   ++ ++   L++ +  ++ TDEIR+  P+P DE + G +    ++W+GVP FLR  
Sbjct: 184  DLADYERNKIMRRLRQLVAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLREF 243

Query: 906  DTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQI 1085
            +  L+N  ++ R+P  A  I+F+SWMGGDRDGNP VT E+TR V LL++  AT+L+   I
Sbjct: 244  NEQLEN-SLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDI 302

Query: 1086 EDLMFEMSMWRCNDELRARA 1145
            + L+ E+SM  C  ELR  A
Sbjct: 303  QVLVSELSMSECTPELRELA 322



>gb:AE013630_298641 Yersinia pestis KIM section 30 of 415 of the
            complete genome.>gb:AE009952_928824 Yersinia pestis KIM
            complete genome.
          Length = 898

 Score =  179 bits (453), Expect = 1e-43
 Identities = 105/320 (32%), Positives = 177/320 (55%), Gaps = 1/320 (0%)
 Frame = +3

Query: 189  VPGKVSEDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEE 365
            V G ++E    +  +  +L   L D +++  GE++ + V+   +LS      ++  + +E
Sbjct: 17   VRGHMNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEASR-QE 75

Query: 366  LGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDI 545
            L   L +L   + + +A++FS  LNL N AE+                     A +  + 
Sbjct: 76   LLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYH------------SISPHGEAASNPEA 123

Query: 546  EETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNK 725
               L   + D K S Q++  A+ + +++LVLTAHPT+  RR+L+ K   +  CL+QL + 
Sbjct: 124  LAQLFTRLKDKKLSDQDMRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHN 183

Query: 726  DITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRV 905
            D+   ++ ++   L++ +  ++ TDEIR+  P+P DE + G +    ++W+GVP FLR  
Sbjct: 184  DLADYERNKIMRRLRQLVAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLREF 243

Query: 906  DTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQI 1085
            +  L+N  ++ R+P  A  I+F+SWMGGDRDGNP VT E+TR V LL++  AT+L+   I
Sbjct: 244  NEQLEN-SLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDI 302

Query: 1086 EDLMFEMSMWRCNDELRARA 1145
            + L+ E+SM  C  ELR  A
Sbjct: 303  QVLVSELSMSECTPELRELA 322



>gb:CP000020_872484 Vibrio fischeri ES114 chromosome I, complete
            sequence.
          Length = 876

 Score =  178 bits (452), Expect = 2e-43
 Identities = 109/332 (32%), Positives = 171/332 (51%)
 Frame = +3

Query: 264  LQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNL 443
            ++D HGE L   V+   +LS       D  +   L   + SL       +A++FS  LNL
Sbjct: 23   IRDAHGEELLAKVETIRKLSKTARAGSDEDR-NALIEEIKSLPDDQLTPVARAFSQFLNL 81

Query: 444  ANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQT 623
             N+AE+     R  +           + + E D   TL   +     S  +   A++   
Sbjct: 82   TNMAEQYHTISRHCE-----------AHVCEPDAISTLFSKLSQSNVSKLDTAQAVRELN 130

Query: 624  VDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDE 803
            ++LVLTAHPT+  RR+++ K  +I +CL++L   DI+  ++ + +  L++ I  A+ +D 
Sbjct: 131  IELVLTAHPTEIARRTMINKLVKINECLSKLELGDISFSERDKTERRLEQLIAQAWHSDV 190

Query: 804  IRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWM 983
            IR+  PTP DE + G +    ++W+G+P FLR  D  L+   + E +P +A  +  SSWM
Sbjct: 191  IRQERPTPLDEAKWGFAVVENSLWQGIPEFLREFDQRLEG-HLGEGLPIDARPVHMSSWM 249

Query: 984  GGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRS 1163
            GGDRDGNP VT ++TR+V LL++  A +LY   I +L+ E+SM +C DE+R  A + H  
Sbjct: 250  GGDRDGNPFVTHKITREVMLLSRWKAADLYLKDINELISELSMVKCTDEVRELAGDQH-- 307

Query: 1164 SRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
                              EPYR IL  +R  L
Sbjct: 308  ------------------EPYRAILKQLRTLL 321



>sp|Q8EK30|CAPP_SHEON Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE015475_314698 Shewanella
            oneidensis MR-1 section 24 of 457 of the complete
            genome.>gb:AE014299_950295 Shewanella oneidensis MR-1
            complete genome.
          Length = 881

 Score =  177 bits (450), Expect = 3e-43
 Identities = 112/334 (33%), Positives = 182/334 (54%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            D ++   G++  E V++  +L+ +   R D    E++  +LT+L   + +  AK+F+  L
Sbjct: 21   DTMRTHLGDSFLEKVEQIRKLAKDSR-RGDEAAREQMLELLTALPDEELVPFAKAFNQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLANL+E+     R   +L                +E+ L R++ + +    ++ D LK 
Sbjct: 80   NLANLSEQFHTISRNCDEL----------VCVPDPVEQLLGRML-NGRVDQTKMLDCLKT 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
              +DLVLTAHPT+  RR+L+QK+A I DCLA+  N  ++  ++Q+++  L++ I   + T
Sbjct: 129  LDIDLVLTAHPTEISRRTLIQKYAAIVDCLAEQENNQLSDRERQQINLRLRQLIAQIWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            +EIRR  PTP DE R G+S   E++W  VP FLR+++  ++     +++P +   ++FSS
Sbjct: 189  NEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQE-RTGQQLPIDIAPVRFSS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT +VT++V    +  A  L+   I  L+ E+SM   NDEL+A  +   
Sbjct: 248  WMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLKDIVLLVGELSMEEANDELKAYTNN-- 305

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
                                EPYR +L  +R KL
Sbjct: 306  ------------------SCEPYRFVLRSLRQKL 321



>sp|Q886R9|CAPP_PSESM Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE016861_350940 Pseudomonas syringae
            pv. tomato str. DC3000 section 6 of 21 of the complete
            genome.>gb:AE016853_1036115 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 878

 Score =  177 bits (450), Expect = 3e-43
 Identities = 116/348 (33%), Positives = 184/348 (52%), Gaps = 2/348 (0%)
 Frame = +3

Query: 156  MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEY 332
            MA IDA+LR                D  LL   L + +++  G    + ++   +  A+ 
Sbjct: 1    MADIDARLR---------------EDVHLLGELLGNTIREQRGAEFLDKIERIRK-GAKA 44

Query: 333  EGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFV 512
              R   +  E+L + +  L+  + + +A++F+  LNLAN+AE+ Q+ +RR          
Sbjct: 45   GRRGSAEGAEQLSSSVDGLEDDELLPVARAFNQFLNLANIAEQYQLMHRRD--------- 95

Query: 513  DENSAITESDI-EETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHA 689
            D      ES +  E L RL  +  + P+ +   L    ++LVLTAHPT+  RR+L+QK+ 
Sbjct: 96   DAQPLPFESRVLSELLDRLKAEGHQ-PETLARQLSKLEIELVLTAHPTEVARRTLIQKYD 154

Query: 690  RIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 869
             I   LA L ++D+   ++ ++   LQR I  A+ T+EIRR  PTP DE + G +    +
Sbjct: 155  AIATQLAALDHRDLNSAERAQITSRLQRLIAEAWHTEEIRRIRPTPVDEAKWGFAVIEHS 214

Query: 870  IWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 1049
            +W  +P +LR+ D  L +      +P  +  I+F+SWMGGDRDGNP VT  VTR+V LLA
Sbjct: 215  LWHAIPNYLRKADHVL-HAATGLHLPLESAPIRFASWMGGDRDGNPNVTAAVTREVLLLA 273

Query: 1050 KMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIE 1193
            + MA +LY   +++L  E+SM + +D LRA   +     R + K   E
Sbjct: 274  RWMAADLYLRDVDNLAAELSMQQASDALRASVGDSAEPYRAELKRLRE 321



>gb:TUPPC_1726101 T.usneoides mRNA for phosphoenolpyruvate
            decarboxylase.
          Length = 676

 Score =  177 bits (449), Expect = 4e-43
 Identities = 81/95 (85%), Positives = 89/95 (93%)
 Frame = +3

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNPRVTPEVTRDVCLLA+MMA NLYYSQI+DLMFE+SMWRC+DELRARAD L 
Sbjct: 1    WMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIDDLMFELSMWRCSDELRARADALL 60

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            +S+R+D KHYIEFWKQVP NEPYRVIL DVR+KLY
Sbjct: 61   QSTRKDEKHYIEFWKQVPANEPYRVILDDVRNKLY 95



>gb:BX936398_834753 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 878

 Score =  177 bits (449), Expect = 4e-43
 Identities = 100/296 (33%), Positives = 167/296 (56%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            D +++  GE++ + V+   +LS      ++  + +EL   L +L   + + +A++FS  L
Sbjct: 21   DTIKEALGEHILDRVETIRKLSKSSRAGNEASR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NL N AE+                     A +  +    L   + D K S Q++  A+ +
Sbjct: 80   NLTNTAEQYH------------SISPHGEAASNPEALAQLFTRLKDKKLSDQDMRSAVDD 127

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL+QL + D+   ++ ++   L++ +  ++ T
Sbjct: 128  LSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQLVAQSWHT 187

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP FLR  +  L+N  ++ R+P  A  I+F+S
Sbjct: 188  DEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLEN-SLDYRLPVEAVPIRFTS 246

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARA 1145
            WMGGDRDGNP VT E+TR V LL++  AT+L+   I+ L+ E+SM  C  ELR  A
Sbjct: 247  WMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRELA 302



>sp|Q8ZA84|CAPP_YERPE Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>pir|AE0478|AE0478 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) [imported] - Yersinia pestis
            (strain CO92)>gb:AJ414159_525682 Yersinia pestis strain
            CO92 complete genome; segment 19/20.
          Length = 878

 Score =  177 bits (449), Expect = 4e-43
 Identities = 100/296 (33%), Positives = 167/296 (56%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            D +++  GE++ + V+   +LS      ++  + +EL   L +L   + + +A++FS  L
Sbjct: 21   DTIKEALGEHILDRVETIRKLSKSSRAGNEASR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NL N AE+                     A +  +    L   + D K S Q++  A+ +
Sbjct: 80   NLTNTAEQYH------------SISPHGEAASNPEALAQLFTRLKDKKLSDQDMRSAVDD 127

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL+QL + D+   ++ ++   L++ +  ++ T
Sbjct: 128  LSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQLVAQSWHT 187

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP FLR  +  L+N  ++ R+P  A  I+F+S
Sbjct: 188  DEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLEN-SLDYRLPVEAVPIRFTS 246

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARA 1145
            WMGGDRDGNP VT E+TR V LL++  AT+L+   I+ L+ E+SM  C  ELR  A
Sbjct: 247  WMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRELA 302



>sp|Q83IS7|CAPP_SHIFL Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE005674_73617 Shigella flexneri 2a
            str. 301, complete genome.>gb:AE016990_373186 Shigella
            flexneri 2a str. 2457T section 13 of 16 of the complete
            genome.>gb:AE014073_997936 Shigella flexneri 2a str.
            2457T complete genome.
          Length = 883

 Score =  177 bits (448), Expect = 5e-43
 Identities = 109/334 (32%), Positives = 181/334 (54%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ E V+   +LS      +D  + +EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILERVETIRKLSKSSRAGNDANR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L    + S   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIARTLRKLKNQPELSEDTIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL QL NKDI   ++ +L   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYERNQLMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P     ++F+S
Sbjct: 189  DEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVEFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT ++TR V LL++  AT+L+   I+ L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             +                  EPYR ++ ++R +L
Sbjct: 308  AA------------------EPYRYLMKNLRSRL 323



>sp|Q9CN89|CAPP_PASMU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE006090_215434 Pasteurella
            multocida subsp. multocida str. Pm70 section 57 of 204 of
            the complete genome.>gb:AE004439_1118164 Pasteurella
            multocida subsp. multocida str. Pm70, complete genome.
          Length = 879

 Score =  177 bits (448), Expect = 5e-43
 Identities = 118/344 (34%), Positives = 183/344 (53%), Gaps = 4/344 (1%)
 Frame = +3

Query: 240  LLDRFL-DILQDLHGENLRETVQECYELSAEYEGRH-DPKKLEELGNVLTSLDPGDSIVI 413
            +L RFL + + D  G ++ E ++    LS     RH D +    L N L ++   + I +
Sbjct: 14   MLGRFLGETISDAQGSDILELIENIRVLSRN--SRHGDDQARNALLNTLATISNENIIPV 71

Query: 414  AKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQ 593
            A++FS  LNL N+AE+ Q   R             +   +E  I    KRL    ++ P+
Sbjct: 72   ARAFSQFLNLTNIAEQYQTISRHHH----------DHVASERSISALFKRLKA--QQVPK 119

Query: 594  E-VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQ 770
            E V + ++   ++LVLTAHPT+  RRSL+ KH  I  CL++L + D+T  +++ ++  L 
Sbjct: 120  ENVMETVQKLLIELVLTAHPTEVTRRSLVHKHVEINKCLSKLEHTDLTDAERKAIERRLL 179

Query: 771  REIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDT-ALKNIGINERVP 947
            + I  A+ T+EIR   PTP +E + G +    ++W+ VP FLR ++T A++  G +  V 
Sbjct: 180  QLIAQAWHTNEIRTQRPTPFEEAKWGFAVIENSLWQAVPEFLRHLNTSAVEYFGFHLPVE 239

Query: 948  YNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCND 1127
             N   I+FSSWMGGDRDGNP VT EVTR V  LA+  A +L+ + I+ L  E+S+ +C  
Sbjct: 240  LNP--IRFSSWMGGDRDGNPFVTAEVTRQVLRLARWKAADLFLTDIQALSDELSVVKCTP 297

Query: 1128 ELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            E +A+             H           EPYR ++  +R KL
Sbjct: 298  EFQAKY----------GSHV----------EPYRTVVKALRSKL 321



>gb:CR543861_105357 Acinetobacter sp. ADP1 complete genome.
          Length = 894

 Score =  176 bits (447), Expect = 7e-43
 Identities = 116/359 (32%), Positives = 193/359 (53%), Gaps = 6/359 (1%)
 Frame = +3

Query: 201  VSEDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHD-----PKKLE 362
            + + D  +  D  LL   L + L+   G++L   +++   L+   +G  D      KKLE
Sbjct: 2    IQQIDAPLREDVRLLGNLLGETLKQHAGQDLFNQIEQIRALA---KGARDGQAETEKKLE 58

Query: 363  ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESD 542
            +L      L   + + + ++FS+ LN AN+AE+  +   RR+          N  I    
Sbjct: 59   QL---FLDLKDEEILPLTRAFSYFLNFANIAEQYHVVRSRRRSEFDEQGPPPNPLI---H 112

Query: 543  IEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYN 722
            + E  K+  +  K    ++F  + N +++LVLTAHPT+  RR+L+QK+  I + L++L  
Sbjct: 113  LFEKFKQNQISSK----QLFQQVSNLSIELVLTAHPTEVSRRTLIQKYDDINEGLSKLDQ 168

Query: 723  KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRR 902
            + +TP ++Q++ + L++ I +A++TDEIR+  PTP DE + G +   +T+W  VP+F+R 
Sbjct: 169  QKLTPRERQQVLDDLKQLICSAWQTDEIRQNKPTPLDEAKWGFTTIEQTLWNAVPKFVRE 228

Query: 903  VDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQ 1082
            +DT L +   +  +P +   I+F+SWMGGDRDGNP VT  VT++V  L++  A +LY   
Sbjct: 229  LDT-LVHQHCDAHLPLDISPIRFASWMGGDRDGNPNVTHNVTQEVLWLSRWQAADLYLRD 287

Query: 1083 IEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            IEDL +E+S+  C++EL       H                    EPYR  L   R++L
Sbjct: 288  IEDLRWELSIQACSEELSQTLGRRH-------------------PEPYREYLRSTRERL 327



>gb:AY517643_1610772 Chlamydomonas reinhardtii phosphoenolpyruvate
            carboxylase (Ppc2) mRNA, complete cds.
          Length = 1221

 Score =  176 bits (446), Expect = 9e-43
 Identities = 111/318 (34%), Positives = 170/318 (53%), Gaps = 8/318 (2%)
 Frame = +3

Query: 195  GKVSEDDKLVEYDALLLDRFLD-ILQDLHGENL-------RETVQECYELSAEYEGRHDP 350
            G V +D   +E D  LL   LD  L+   GE +       R   Q    LS + +     
Sbjct: 9    GAVRDDLTPLEDDCKLLGSLLDDCLRVEIGETMFKKIERIRALAQCASNLSIKGDAGASD 68

Query: 351  KKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAI 530
                 L   L +LD  +++ + ++  H LNL+ +AE +    RR +  ++ +        
Sbjct: 69   MLSHRLAEELMNLDMDEAVPLTRACGHYLNLSGIAE-LHHGVRRDRATREPN-------- 119

Query: 531  TESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLA 710
              +  +    RL+ +    P+E++ A+  Q V++VLTAHPTQ  RR+L  KH RI   L 
Sbjct: 120  -PNSCDAVFARLITE-GVDPEELYRAVSEQNVEVVLTAHPTQVNRRTLQYKHTRIAALLQ 177

Query: 711  QLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPR 890
            Q    D+T ++++ +   LQRE+ A ++TDE+RR  PTP DE R G+    +++W  VP+
Sbjct: 178  QHDRSDLTAEERRNMVSELQREVAALWQTDELRRQKPTPLDEARGGLHIVEQSLWAAVPQ 237

Query: 891  FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNL 1070
            ++RR+  ALK       +P  A   +F SWMGGDRDGNP VT +VT  V  LA+ MA +L
Sbjct: 238  YMRRLSAALKK-HTGHDLPLQATPFRFGSWMGGDRDGNPNVTAKVTAHVTALARWMAADL 296

Query: 1071 YYSQIEDLMFEMSMWRCN 1124
            Y  +I+ L FE+SM +C+
Sbjct: 297  YLREIDTLRFELSMNQCS 314



>pir|B86087|B86087 phosphoenolpyruvate carboxylase [imported] -
            Escherichia coli (strain O157:H7, substrain
            EDL933)>gb:AE005174_69157 Escherichia coli O157:H7
            EDL933, complete genome.
          Length = 883

 Score =  176 bits (445), Expect = 1e-42
 Identities = 109/334 (32%), Positives = 180/334 (53%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ E V+   +LS      +D  + +EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILERVETIRKLSKSSRAGNDANR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L    + S   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIARTLRKLKNQPELSEDTIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL QL NKDI   +  +L   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P     ++F+S
Sbjct: 189  DEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVEFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT ++TR V LL++  AT+L+   I+ L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             +                  EPYR ++ ++R +L
Sbjct: 308  AA------------------EPYRYLMKNLRSRL 323



>sp|P00864|CAPP_ECOLI Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>pir|A01083|QYEC phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Escherichia coli (strain
            K-12)>gb:ECOUW89_131499 E. coli chromosomal region from
            89.2 to 92.8 minutes.>gb:ECPPCG_132256 E.coli ppc gene
            for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).>gb:U00096_202931 Escherichia coli K-12 MG1655
            complete genome.>gb:AX189049_1463553 Sequence 250 from
            Patent WO0148209.
          Length = 883

 Score =  176 bits (445), Expect = 1e-42
 Identities = 109/334 (32%), Positives = 180/334 (53%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ E V+   +LS      +D  + +EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILERVETIRKLSKSSRAGNDANR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L    + S   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIARTLRKLKNQPELSEDTIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL QL NKDI   +  +L   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P     ++F+S
Sbjct: 189  DEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVEFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT ++TR V LL++  AT+L+   I+ L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             +                  EPYR ++ ++R +L
Sbjct: 308  AA------------------EPYRYLMKNLRSRL 323



>sp|Q8FB98|CAPP_ECOL6 Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE016770_328881 Escherichia coli
            CFT073 section 16 of 18 of the complete
            genome.>gb:AE014075_959465 Escherichia coli CFT073
            complete genome.
          Length = 883

 Score =  176 bits (445), Expect = 1e-42
 Identities = 109/334 (32%), Positives = 180/334 (53%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ E V+   +LS      +D  + +EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILERVETIRKLSKSSRAGNDANR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L    + S   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIARTLRKLKNQPELSEDTIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL QL NKDI   +  +L   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P     ++F+S
Sbjct: 189  DEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVEFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT ++TR V LL++  AT+L+   I+ L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             +                  EPYR ++ ++R +L
Sbjct: 308  AA------------------EPYRYLMKNLRSRL 323



>sp|Q8X743|CAPP_ECO57 Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>pir|E91239|E91239 phosphoenolpyruvate
            carboxylase [imported] - Escherichia coli (strain
            O157:H7, substrain RIMD 0509952)>gb:BA000007_662897
            Escherichia coli O157:H7 DNA, complete genome.
          Length = 883

 Score =  176 bits (445), Expect = 1e-42
 Identities = 109/334 (32%), Positives = 180/334 (53%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ E V+   +LS      +D  + +EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILERVETIRKLSKSSRAGNDANR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L    + S   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIARTLRKLKNQPELSEDTIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   +  CL QL NKDI   +  +L   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEHNQLMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P     ++F+S
Sbjct: 189  DEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVEFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT ++TR V LL++  AT+L+   I+ L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVEATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             +                  EPYR ++ ++R +L
Sbjct: 308  AA------------------EPYRYLMKNLRSRL 323



>pir|D82049|D82049 phosphoenolpyruvate carboxylase VC2646 [imported] -
            Vibrio cholerae (strain N16961 serogroup
            O1)>gb:AE004331_53017 Vibrio cholerae O1 biovar eltor
            str. N16961 chromosome I, section 239 of 251 of the
            complete chromosome.>gb:AE003852_1053791 Vibrio cholerae
            O1 biovar eltor str. N16961 chromosome I, complete
            chromosome.
          Length = 887

 Score =  174 bits (442), Expect = 3e-42
 Identities = 97/283 (34%), Positives = 157/283 (55%)
 Frame = +3

Query: 411  IAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSP 590
            +A++F+  LNL N+AE+     R  +           S + E D   +L   +     S 
Sbjct: 82   VARAFNQFLNLTNIAEQYHTISRHCE-----------SHVNELDAIGSLFAKLAQKSVSK 130

Query: 591  QEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQ 770
             +   A+++  ++LVLTAHPT+  RR+++ K  +I +CL++L   D++P ++ + +  L+
Sbjct: 131  FDTAQAIRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSPKERHKTERRLE 190

Query: 771  REIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPY 950
            + I  ++ +D IR+  PTP DE + G +    ++W  VP FLR +D  +K+  + E +P 
Sbjct: 191  QLIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWHAVPEFLRELDEQVKSY-LGEGLPI 249

Query: 951  NAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDE 1130
            +A  + FSSWMGGDRDGNP VT  +TR+V LL++  A +LY + I +L+ E+SM +CN+ 
Sbjct: 250  DARPVHFSSWMGGDRDGNPFVTHTITREVLLLSRWKAADLYLTDINELVSELSMTKCNEA 309

Query: 1131 LRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            +RA A E H                    EPYR IL  +R  L
Sbjct: 310  VRALAGEEH--------------------EPYRAILKPIRSLL 332



>sp|Q9KNT4|CAPP_VIBCH Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).
          Length = 876

 Score =  174 bits (442), Expect = 3e-42
 Identities = 97/283 (34%), Positives = 157/283 (55%)
 Frame = +3

Query: 411  IAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSP 590
            +A++F+  LNL N+AE+     R  +           S + E D   +L   +     S 
Sbjct: 71   VARAFNQFLNLTNIAEQYHTISRHCE-----------SHVNELDAIGSLFAKLAQKSVSK 119

Query: 591  QEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQ 770
             +   A+++  ++LVLTAHPT+  RR+++ K  +I +CL++L   D++P ++ + +  L+
Sbjct: 120  FDTAQAIRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSPKERHKTERRLE 179

Query: 771  REIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPY 950
            + I  ++ +D IR+  PTP DE + G +    ++W  VP FLR +D  +K+  + E +P 
Sbjct: 180  QLIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWHAVPEFLRELDEQVKSY-LGEGLPI 238

Query: 951  NAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDE 1130
            +A  + FSSWMGGDRDGNP VT  +TR+V LL++  A +LY + I +L+ E+SM +CN+ 
Sbjct: 239  DARPVHFSSWMGGDRDGNPFVTHTITREVLLLSRWKAADLYLTDINELVSELSMTKCNEA 298

Query: 1131 LRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            +RA A E H                    EPYR IL  +R  L
Sbjct: 299  VRALAGEEH--------------------EPYRAILKPIRSLL 321



>gb:BA000037_723830 Vibrio vulnificus YJ016 DNA, chromosome I,
            complete sequence.
          Length = 888

 Score =  174 bits (440), Expect = 4e-42
 Identities = 105/332 (31%), Positives = 175/332 (52%)
 Frame = +3

Query: 264  LQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNL 443
            +Q+ HG+ + E V+   +LS      +   +   L   + SL       +A++F+  LNL
Sbjct: 34   IQEAHGDEILEKVETIRKLSKSARAGNQADR-NNLIEEIKSLPDEQLTPVARAFNQFLNL 92

Query: 444  ANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQT 623
             N+AE+     R             ++ + E D   TL   +     +  +   A++   
Sbjct: 93   TNIAEQYHTISRHC-----------DAHVCEPDAINTLFAKLGQNGINKLDTAQAIRELN 141

Query: 624  VDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDE 803
            ++LVLTAHPT+  RR+++ K  +I +CL++L   D++  ++ + ++ L++ I  ++ +D 
Sbjct: 142  IELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSYKERHKTEKRLEQLIAQSWHSDV 201

Query: 804  IRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWM 983
            IR+  PTP DE + G +    ++W+ VP FLR +D  LK+  +++ +P +A  + FSSWM
Sbjct: 202  IRKQRPTPLDEAKWGFAVVENSLWEAVPDFLRELDEKLKDY-LDQGLPIDARPVHFSSWM 260

Query: 984  GGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRS 1163
            GGDRDGNP VT  VTR+V LL++  A +LY   I +L+ E+SM +CND +R  A E    
Sbjct: 261  GGDRDGNPFVTHTVTREVLLLSRWKAADLYLKDINELISELSMTKCNDTVRQLAGE---- 316

Query: 1164 SRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
                             +EPYR IL  +R  L
Sbjct: 317  ---------------DEHEPYRAILKQLRTLL 333



>sp|Q7MH68|CAPP_VIBVY Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).
          Length = 877

 Score =  174 bits (440), Expect = 4e-42
 Identities = 105/332 (31%), Positives = 175/332 (52%)
 Frame = +3

Query: 264  LQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNL 443
            +Q+ HG+ + E V+   +LS      +   +   L   + SL       +A++F+  LNL
Sbjct: 23   IQEAHGDEILEKVETIRKLSKSARAGNQADR-NNLIEEIKSLPDEQLTPVARAFNQFLNL 81

Query: 444  ANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQT 623
             N+AE+     R             ++ + E D   TL   +     +  +   A++   
Sbjct: 82   TNIAEQYHTISRHC-----------DAHVCEPDAINTLFAKLGQNGINKLDTAQAIRELN 130

Query: 624  VDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDE 803
            ++LVLTAHPT+  RR+++ K  +I +CL++L   D++  ++ + ++ L++ I  ++ +D 
Sbjct: 131  IELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSYKERHKTEKRLEQLIAQSWHSDV 190

Query: 804  IRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWM 983
            IR+  PTP DE + G +    ++W+ VP FLR +D  LK+  +++ +P +A  + FSSWM
Sbjct: 191  IRKQRPTPLDEAKWGFAVVENSLWEAVPDFLRELDEKLKDY-LDQGLPIDARPVHFSSWM 249

Query: 984  GGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRS 1163
            GGDRDGNP VT  VTR+V LL++  A +LY   I +L+ E+SM +CND +R  A E    
Sbjct: 250  GGDRDGNPFVTHTVTREVLLLSRWKAADLYLKDINELISELSMTKCNDTVRQLAGE---- 305

Query: 1164 SRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
                             +EPYR IL  +R  L
Sbjct: 306  ---------------DEHEPYRAILKQLRTLL 322



>sp|Q8DCN2|CAPP_VIBVU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE016801_336071 Vibrio vulnificus
            CMCP6 chromosome I section 5 of 11 of the complete
            sequence.>gb:AE016795_1045795 Vibrio vulnificus CMCP6
            chromosome I complete sequence.
          Length = 877

 Score =  174 bits (440), Expect = 4e-42
 Identities = 105/332 (31%), Positives = 175/332 (52%)
 Frame = +3

Query: 264  LQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNL 443
            +Q+ HG+ + E V+   +LS      +   +   L   + SL       +A++F+  LNL
Sbjct: 23   IQEAHGDEILEKVETIRKLSKSARAGNQADR-NNLIEEIKSLPDEQLTPVARAFNQFLNL 81

Query: 444  ANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQT 623
             N+AE+     R             ++ + E D   TL   +     +  +   A++   
Sbjct: 82   TNIAEQYHTISRHC-----------DAHVCEPDAINTLFAKLGQNGINKLDTAQAIRELN 130

Query: 624  VDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDE 803
            ++LVLTAHPT+  RR+++ K  +I +CL++L   D++  ++ + ++ L++ I  ++ +D 
Sbjct: 131  IELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSYKERHKTEKRLEQLIAQSWHSDV 190

Query: 804  IRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWM 983
            IR+  PTP DE + G +    ++W+ VP FLR +D  LK+  +++ +P +A  + FSSWM
Sbjct: 191  IRKQRPTPLDEAKWGFAVVENSLWEAVPDFLRELDEKLKDY-LDQGLPIDARPVHFSSWM 249

Query: 984  GGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRS 1163
            GGDRDGNP VT  VTR+V LL++  A +LY   I +L+ E+SM +CND +R  A E    
Sbjct: 250  GGDRDGNPFVTHTVTREVLLLSRWKAADLYLKDINELISELSMTKCNDTVRQLAGE---- 305

Query: 1164 SRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
                             +EPYR IL  +R  L
Sbjct: 306  ---------------DEHEPYRAILKQLRTLL 322



>gb:BA000031_708221 Vibrio parahaemolyticus RIMD 2210633 DNA,
            chromosome 1, complete sequence.
          Length = 888

 Score =  172 bits (437), Expect = 1e-41
 Identities = 105/329 (31%), Positives = 175/329 (53%)
 Frame = +3

Query: 264  LQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNL 443
            ++D HGE + E V+   +LS   +  +   + E L   +  L       + ++F+  LNL
Sbjct: 34   IRDAHGEEIFEKVETIRKLSKSAQAGNQADR-ESLIEEIKHLPDEQLTPVTRAFNQFLNL 92

Query: 444  ANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQT 623
             N+AE+     R  ++            I E D   +L   +V    S  +   A+++  
Sbjct: 93   TNIAEQYHTISRHCEE-----------HICEPDAINSLFSKLVQNDVSKLDTAQAVRDLN 141

Query: 624  VDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDE 803
            ++LVLTAHPT+  RR+++ K  +I +CL++L   D++  ++++ +  L++ I  ++ +D 
Sbjct: 142  IELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSSKERKKTERRLEQLIAQSWHSDV 201

Query: 804  IRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWM 983
            IR+  PTP DE + G +    ++W+ VP FLR ++  LK+  + E +P +A  + FSSWM
Sbjct: 202  IRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLKSY-LGEGLPIDARPVHFSSWM 260

Query: 984  GGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRS 1163
            GGDRDGNP VT  VTR+V LL++  A +LY + I +L+ E+SM   ND++R  A E    
Sbjct: 261  GGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVSNDQVRELAGE---- 316

Query: 1164 SRRDAKHYIEFWKQVPPNEPYRVILGDVR 1250
                             +EPYR IL  +R
Sbjct: 317  ---------------DQHEPYRAILKQLR 330



>sp|Q87L54|CAPP_VIBPA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).
          Length = 877

 Score =  172 bits (437), Expect = 1e-41
 Identities = 105/329 (31%), Positives = 175/329 (53%)
 Frame = +3

Query: 264  LQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNL 443
            ++D HGE + E V+   +LS   +  +   + E L   +  L       + ++F+  LNL
Sbjct: 23   IRDAHGEEIFEKVETIRKLSKSAQAGNQADR-ESLIEEIKHLPDEQLTPVTRAFNQFLNL 81

Query: 444  ANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQT 623
             N+AE+     R  ++            I E D   +L   +V    S  +   A+++  
Sbjct: 82   TNIAEQYHTISRHCEE-----------HICEPDAINSLFSKLVQNDVSKLDTAQAVRDLN 130

Query: 624  VDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDE 803
            ++LVLTAHPT+  RR+++ K  +I +CL++L   D++  ++++ +  L++ I  ++ +D 
Sbjct: 131  IELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSSKERKKTERRLEQLIAQSWHSDV 190

Query: 804  IRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWM 983
            IR+  PTP DE + G +    ++W+ VP FLR ++  LK+  + E +P +A  + FSSWM
Sbjct: 191  IRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLKSY-LGEGLPIDARPVHFSSWM 249

Query: 984  GGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRS 1163
            GGDRDGNP VT  VTR+V LL++  A +LY + I +L+ E+SM   ND++R  A E    
Sbjct: 250  GGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVSNDQVRELAGE---- 305

Query: 1164 SRRDAKHYIEFWKQVPPNEPYRVILGDVR 1250
                             +EPYR IL  +R
Sbjct: 306  ---------------DQHEPYRAILKQLR 319



>gb:PNPPC_1700913 P.nudum mRNA for phosphoenolpyruvate decarboxylase.
          Length = 669

 Score =  171 bits (434), Expect = 2e-41
 Identities = 75/95 (78%), Positives = 91/95 (95%)
 Frame = +3

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNPRVTPEVTRDVCLLA+++A+NLY+S+IEDLMFE+SMWRC+DELRAR +EL 
Sbjct: 1    WMGGDRDGNPRVTPEVTRDVCLLARLIASNLYFSRIEDLMFELSMWRCSDELRARVNELV 60

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
             SSR+DAK+Y+EFWKQ+PPNEP+RV+LG VRD+LY
Sbjct: 61   FSSRKDAKYYMEFWKQIPPNEPFRVVLGHVRDRLY 95



>sp|Q8Z307|CAPP_SALTI Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>pir|AD0936|AD0936 phosphoenolpyruvate
            carboxylase [imported] - Salmonella enterica subsp.
            enterica serovar Typhi (strain CT18)>gb:AE016845_347469
            Salmonella enterica subsp. enterica serovar Typhi Ty2,
            section 12 of 16 of the complete
            genome.>gb:AL627279_543804 Salmonella enterica serovar
            Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 15/20.>gb:AE014613_984801 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.
          Length = 883

 Score =  169 bits (429), Expect = 8e-41
 Identities = 107/334 (32%), Positives = 179/334 (53%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ + V+   +LS      ++  + +EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILDRVETIRKLSKSSRAGNEANR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L      +   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIAHTLRKLKNQPDLNDATIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   I +CL QL N DI   ++ ++   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P +   ++F+S
Sbjct: 189  DEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVDFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT E+TR V LL++  AT+L+   I  L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             S                  EPYR ++  +R +L
Sbjct: 308  AS------------------EPYRYLMKKLRARL 323



>sp|Q8ZKM0|CAPP_SALTY Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE008892_245731 Salmonella
            typhimurium LT2, section 196 of 220 of the complete
            genome.>gb:AE006468_1002813 Salmonella typhimurium LT2,
            complete genome.
          Length = 883

 Score =  168 bits (426), Expect = 2e-40
 Identities = 106/334 (31%), Positives = 179/334 (53%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ + V+   +LS      ++  + +EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILDRVETIRKLSKSSRAGNEANR-QELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L      +   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIARTLRKLKNQPDLNDATIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   I +CL QL N DI   ++ ++   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P +   ++F+S
Sbjct: 189  DEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVDFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT ++TR V LL++  AT+L+   I  L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             S                  EPYR ++  +R +L
Sbjct: 308  AS------------------EPYRYLMKKLRARL 323



>gb:CP000026_78604 Salmonella enterica subsp. enterica serovar
            Paratypi A str. ATCC 9150.
          Length = 883

 Score =  167 bits (424), Expect = 3e-40
 Identities = 106/334 (31%), Positives = 178/334 (53%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            + ++D  GE++ + V+   +LS      ++  +  EL   L +L   + + +A++FS  L
Sbjct: 21   ETIKDALGEHILDRVETIRKLSKSSRAGNEANR-RELLTTLQNLSNDELLPVARAFSQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
            NLAN AE+            KG+     +A     I  TL++L      +   +  A+++
Sbjct: 80   NLANTAEQYHSIS------PKGE-----AASNPEVIARTLRKLKNQPDLNDATIKKAVES 128

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
             +++LVLTAHPT+  RR+L+ K   I +CL QL N DI   ++ ++   L++ I  ++ T
Sbjct: 129  LSLELVLTAHPTEITRRTLIHKMGEINNCLKQLDNTDIADYERHQVMRRLRQLIAQSWHT 188

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            DEIR+  P+P DE + G +    ++W+GVP +LR ++  L+   +  ++P +   ++F+S
Sbjct: 189  DEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEE-NLGYKLPVDFVPVRFTS 247

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELH 1157
            WMGGDRDGNP VT ++TR V LL++  AT+L+   I  L+ E+SM     EL A   E  
Sbjct: 248  WMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIHVLVSELSMVDATPELLALVGEEG 307

Query: 1158 RSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
             S                  EPYR ++  +R +L
Sbjct: 308  AS------------------EPYRYLMKKLRARL 323



>gb:AY046371_1561581 Gaertnera aphanodioica clone 1
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AY046372_1561582 Gaertnera
            aphanodioica clone 2 phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial
            cds.>gb:AY046375_1561585 Gaertnera cuneifolia clone 2
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AY046376_1561586 Gaertnera
            cuneifolia clone 1 phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial
            cds.>gb:AY046377_1561587 Gaertnera junghuhniana clone 1
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AY046378_1561588 Gaertnera
            junghuhniana clone 2 phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial
            cds.>gb:AY046379_1561589 Gaertnera lowryi clone 1
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AF333848_1787351 Gaertnera
            aphanodioica phosphoenolpyruvate carboxylase (PepC-Large)
            gene, exons 4 and 5 and partial cds.>gb:AF333849_1787352
            Gaertnera belemutensis phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial
            cds.>gb:AF333852_1787355 Gaertnera cuneifolia
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AF333854_1787357 Gaertnera
            edentata phosphoenolpyruvate carboxylase (PepC-Large)
            gene, exons 4 and 5 and partial cds.>gb:AF333856_1787359
            Gaertnera globigera phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial
            cds.>gb:AF333857_1787360 Gaertnera hispida
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AF333859_1787362 Gaertnera
            junghuhniana phosphoenolpyruvate carboxylase (PepC-Large)
            gene, exons 4 and 5 and partial cds.>gb:AF333860_1787363
            Gaertnera longifolia phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial
            cds.>gb:AF333862_1787365 Gaertnera macrostipula
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AF333865_1787368 Gaertnera
            pauciflora phosphoenolpyruvate carboxylase (PepC-Large)
            gene, exons 4 and 5 and partial cds.>gb:AF333866_1787369
            Gaertnera psychotrioides phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial
            cds.>gb:AF333867_1787370 Gaertnera oblanceolata
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.>gb:AF333871_1787374 Gaertnera
            viminea phosphoenolpyruvate carboxylase (PepC-Large)
            gene, exons 4 and 5 and partial cds.>gb:AF333874_1787377
            Morinda royoc phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  166 bits (421), Expect = 7e-40
 Identities = 77/80 (96%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY046346_1561556 Gaertnera cuneifolia clone 2 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046369_1561579 Morinda royoc clone 2
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046370_1561580 Morinda
            royoc clone 1 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  166 bits (421), Expect = 7e-40
 Identities = 77/80 (96%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKN+GINERVPYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNMGINERVPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY046333_1561543 Gaertnera globigera clone 1 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046334_1561544 Gaertnera globigera clone 2
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046335_1561545 Gaertnera
            inflexa clone 2 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046337_1561547 Gaertnera longifolia clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046338_1561548 Gaertnera
            acuminata clone 1 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046339_1561549 Gaertnera acuminata clone 2
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046340_1561550 Gaertnera
            longifolia clone 3 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046341_1561551 Gaertnera lowryi clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046343_1561553 Gaertnera
            macrostipula clone 1 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046344_1561554 Gaertnera brevipedicellata clone
            1 phosphoenolpyruvate carboxylase (PepC-Small) gene,
            exons 4 and 5 and partial cds.>gb:AY046345_1561555
            Gaertnera brevipedicellata clone 2 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046347_1561557 Gaertnera cuneifolia clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046348_1561558 Gaertnera
            drakeana clone 2 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046349_1561559 Gaertnera drakeana clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046350_1561560 Gaertnera
            vaginans clone 1 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046352_1561562 Gaertnera vaginans clone 3
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046353_1561563 Gaertnera
            viminea clone 2 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046354_1561564 Gaertnera viminea clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046355_1561565 Gaertnera
            schizocalyx clone 1 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046356_1561566 Gaertnera walkeri clone 2
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046358_1561568 Gaertnera
            fractiflexa clone 2 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046359_1561569 Gaertnera walkeri clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046360_1561570 Gaertnera
            ternifolia clone 2 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046361_1561571 Gaertnera ternifolia clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046362_1561572 Gaertnera
            psychotrioides clone 1 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046365_1561575 Gaertnera junghuhniana clone 1
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY046367_1561577 Gaertnera
            schizocalyx clone 2 phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AY046368_1561578 Gaertnera psychotrioides clone 2
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AY185548_1588074 Gaertnera
            capitulata phosphoenolpyruvate carboxylase PepC-small
            gene, exons 4 and 5 and partial cds.>gb:AF333875_1787378
            Gaertnera acuminata phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AF333876_1787379 Gaertnera aphanodioica
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AF333877_1787380 Gaertnera
            belemutensis phosphoenolpyruvate carboxylase (PepC-Small)
            gene, exons 4 and 5 and partial cds.>gb:AF333878_1787381
            Gaertnera brevipedicellata phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AF333879_1787382 Gaertnera cooperi
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AF333881_1787384 Gaertnera
            drakeana phosphoenolpyruvate carboxylase (PepC-Small)
            gene, exons 4 and 5 and partial cds.>gb:AF333884_1787387
            Gaertnera globigera phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AF333885_1787388 Gaertnera hispida
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AF333888_1787391 Gaertnera
            longifolia phosphoenolpyruvate carboxylase (PepC-Small)
            gene, exons 4 and 5 and partial cds.>gb:AF333893_1787396
            Gaertnera pauciflora phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AF333894_1787397 Gaertnera psychotrioides
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AF333895_1787398 Gaertnera
            oblanceolata phosphoenolpyruvate carboxylase (PepC-Small)
            gene, exons 4 and 5 and partial cds.>gb:AF333898_1787401
            Gaertnera schizocalyx phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AF333899_1787402 Gaertnera ternifolia
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AF333900_1787403 Gaertnera
            vaginans phosphoenolpyruvate carboxylase (PepC-Small)
            gene, exons 4 and 5 and partial cds.>gb:AF333901_1787404
            Gaertnera viminea phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AF333902_1787405 Gaertnera walkeri
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AF333905_1787408 Pagamea
            guianensis phosphoenolpyruvate carboxylase (PepC-Small)
            gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  166 bits (421), Expect = 7e-40
 Identities = 77/80 (96%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY046363_1561573 Gaertnera longifolia clone 3 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  166 bits (420), Expect = 9e-40
 Identities = 76/80 (95%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPL+QFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLVQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333904_1787407 Morinda royoc phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  166 bits (419), Expect = 1e-39
 Identities = 77/80 (96%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKN GINERVPYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNXGINERVPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:F24J5_1677991 Arabidopsis thaliana chromosome 1 BAC F24J5
            sequence, complete sequence.
          Length = 980

 Score =  166 bits (419), Expect = 1e-39
 Identities = 107/327 (32%), Positives = 168/327 (51%), Gaps = 21/327 (6%)
 Frame = +3

Query: 237  LLLDRFLDILQDLHGENLRETVQECY-----ELSAEYEGRHDPKKL--EELGNVLTSLDP 395
            LL   F D+LQ   G    E V+         L+    G  D   L  ++L + ++ +  
Sbjct: 23   LLGSLFHDVLQREVGNPFMEKVERIRILAQSALNLRMAGIEDTANLLEKQLTSEISKMPL 82

Query: 396  GDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVD 575
             +++ +A++F+H LNL  +A+                    +S + +S I          
Sbjct: 83   EEALTLARTFTHSLNLMGIAD------------------THHSQLLQSGI---------- 114

Query: 576  MKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQEL 755
               SP E++  +  Q V++VLTAHPTQ  RR+L  KH RI   L      D++ +D++ L
Sbjct: 115  ---SPDELYKTVCKQEVEIVLTAHPTQINRRTLQYKHIRIAHLLEYNTRSDLSVEDRETL 171

Query: 756  DEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGIN 935
             E L REI + ++TDE+RR  PTP DE RAG++   +++WK VP++LRRV  +LK     
Sbjct: 172  IEDLVREITSLWQTDELRRQKPTPVDEARAGLNIVEQSLWKAVPQYLRRVSNSLKKF-TG 230

Query: 936  ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT--------------RDVCLLAKMMATNLY 1073
            + +P     ++F SWMGGDRDGNP VT +V+                + LL++ MA +LY
Sbjct: 231  KPLPLTCTPMKFGSWMGGDRDGNPNVTAKVSLLIFYDLNSKPTGHERISLLSRWMAIDLY 290

Query: 1074 YSQIEDLMFEMSMWRCNDELRARADEL 1154
              +++ L FE+S  RC+D     AD++
Sbjct: 291  IREVDSLRFELSTDRCSDRFSRLADKI 317



>gb:AY046374_1561584 Gaertnera brevipedicellata clone 1
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.
          Length = 81

 Score =  166 bits (419), Expect = 1e-39
 Identities = 77/80 (96%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            +PRVTPEVTRDVCLLA+MMA
Sbjct: 61   DPRVTPEVTRDVCLLARMMA 80



>gb:AF333892_1787395 Gaertnera paniculata phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  165 bits (418), Expect = 2e-39
 Identities = 76/80 (95%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGM+YFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMNYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY185551_1588076 Gaertnera longevaginalis phosphoenolpyruvate
            carboxylase PepC-small gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  165 bits (418), Expect = 2e-39
 Identities = 76/80 (95%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            +PRVTPEVTRDVCLLA+MMA
Sbjct: 61   BPRVTPEVTRDVCLLARMMA 80



>gb:AY046351_1561561 Gaertnera vaginans clone 2 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  165 bits (418), Expect = 2e-39
 Identities = 76/80 (95%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NP+VTPEVTRDVCLLA+MMA
Sbjct: 61   NPKVTPEVTRDVCLLARMMA 80



>gb:AY046373_1561583 Gaertnera brevipedicellata clone 2
            phosphoenolpyruvate carboxylase (PepC-Large) gene, exons
            4 and 5 and partial cds.
          Length = 81

 Score =  165 bits (417), Expect = 2e-39
 Identities = 77/80 (96%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWM GDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMDGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY046357_1561567 Gaertnera fractiflexa clone 1 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  165 bits (417), Expect = 2e-39
 Identities = 76/80 (95%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+P+NAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPFNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333863_1787366 Gaertnera madagascariensis phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (416), Expect = 3e-39
 Identities = 76/80 (95%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPY+AP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYDAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333858_1787361 Gaertnera inflexa phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  164 bits (416), Expect = 3e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKG P+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGXPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY046366_1561576 Gaertnera junghuhniana clone 2
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.
          Length = 81

 Score =  164 bits (416), Expect = 3e-39
 Identities = 75/80 (93%), Positives = 80/80 (100%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPL+QFSSW+GGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLVQFSSWIGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333890_1787393 Gaertnera macrostipula phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (415), Expect = 4e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVT DVCLLA+MMA
Sbjct: 61   NPRVTPEVTXDVCLLARMMA 80



>gb:AF333889_1787392 Gaertnera lowryi phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  164 bits (415), Expect = 4e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLR VDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRXVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333869_1787372 Gaertnera schizocalyx phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (415), Expect = 4e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTAL NIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALXNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333861_1787364 Gaertnera lowryi phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  164 bits (415), Expect = 4e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFH TIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHXTIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333847_1787350 Gaertnera acuminata phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (415), Expect = 4e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSY HETIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYLHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333880_1787383 Gaertnera cuneifolia phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (414), Expect = 5e-39
 Identities = 76/80 (95%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKN GINER PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNXGINERXPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333850_1787353 Gaertnera brevipedicellata phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (414), Expect = 5e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWM GDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMXGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            +PRVTPEVTRDVCLLA+MMA
Sbjct: 61   BPRVTPEVTRDVCLLARMMA 80



>gb:AY185545_1588072 Gaertnera arenaria phosphoenolpyruvate
            carboxylase PepC-small gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (414), Expect = 5e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKG P+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGGPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY185544_1588071 Gaertnera arenaria phosphoenolpyruvate
            carboxylase PepC-large gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (414), Expect = 5e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRA MSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAXMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY046380_1561590 Gaertnera lowryi clone 2 phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  164 bits (414), Expect = 5e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFH TIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHGTIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY046342_1561552 Gaertnera macrostipula clone 2
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.
          Length = 81

 Score =  164 bits (414), Expect = 5e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVT DVCLLA+MMA
Sbjct: 61   NPRVTPEVTGDVCLLARMMA 80



>gb:AY046336_1561546 Gaertnera inflexa clone 1 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.>gb:AF333886_1787389 Gaertnera inflexa
            phosphoenolpyruvate carboxylase (PepC-Small) gene, exons
            4 and 5 and partial cds.>gb:AF333891_1787394 Gaertnera
            madagascariensis phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  164 bits (414), Expect = 5e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDR G
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRXG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333883_1787386 Gaertnera fractiflexa phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  163 bits (413), Expect = 6e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+P NAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPXNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:FPPPCBX23_1679181 F.pringlei ppcB gene (exons 2 and 3).
          Length = 92

 Score =  163 bits (413), Expect = 6e-39
 Identities = 84/97 (86%), Positives = 90/97 (92%)
 Frame = +3

Query: 132 MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC 311
           MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE     VQEC
Sbjct: 1   MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGE-----VQEC 55

Query: 312 YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKS 422
           YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVIAK+
Sbjct: 56  YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVIAKA 92



>gb:AY046364_1561574 Gaertnera lowryi clone 2 phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  163 bits (413), Expect = 6e-39
 Identities = 76/80 (95%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLR VDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRCVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333903_1787406 Morinda citrifolia phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  163 bits (412), Expect = 8e-39
 Identities = 75/80 (93%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKN+GINERVPYN PLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNMGINERVPYNVPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEV RDVCLLA+MMA
Sbjct: 61   NPRVTPEVARDVCLLARMMA 80



>gb:AF333870_1787373 Gaertnera ternifolia phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  163 bits (412), Expect = 8e-39
 Identities = 75/80 (93%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMR GMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRXGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPR TPEVTRDVCLLA+MMA
Sbjct: 61   NPRXTPEVTRDVCLLARMMA 80



>gb:AF333897_1787400 Gaertnera schatzii phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  162 bits (411), Expect = 1e-38
 Identities = 75/80 (93%), Positives = 79/80 (98%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIG +ER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGXDERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333887_1787390 Gaertnera junghuhniana phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  162 bits (410), Expect = 1e-38
 Identities = 75/80 (93%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNAPL QFSSW GGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNAPLXQFSSWXGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>sp|Q7MAX5|CAPP_PHOLL Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:BX571874_789601 Photorhabdus
            luminescens subsp. laumondii TTO1 complete genome;
            segment 16/17.
          Length = 878

 Score =  162 bits (410), Expect = 1e-38
 Identities = 100/313 (31%), Positives = 172/313 (54%), Gaps = 5/313 (1%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            D +++  GE++ + V+   +LS      ++  + ++L + L +L   + + +A++F+  L
Sbjct: 21   DTIKEALGEDILDKVETIRKLSKSSRAGNEAHR-QQLLSTLQNLSNNELLPVARAFNQFL 79

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVV---DMKKSPQEVFDA 608
            NL N+AE+        +          ++ +  + +   LK       D+KK+  E+   
Sbjct: 80   NLTNVAEQYHSISPHGEAA--------SNPVALAKLFTRLKEKNFNNGDLKKAVNEL--- 128

Query: 609  LKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAA 788
                +++LVLTAHPT+  RR+L+ K   +  CL+QL + D+   ++  +   L++ +  +
Sbjct: 129  ----SIELVLTAHPTEIARRTLIHKLVAVNTCLSQLDHDDLADYERNNIMRRLRQLVAQS 184

Query: 789  FRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQ 968
            + TDEIR+  PTP DE + G +    ++W+GVP FLR  +  L+   I+  +P  A  ++
Sbjct: 185  WHTDEIRKIRPTPIDEAKWGFAMVENSLWEGVPAFLREFNEQLEE-SIDYSLPVEAVPVR 243

Query: 969  FSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELR--AR 1142
            F+SWMGGDRDGNP VT EVTR V LL++  A +L+   I+ L+ E+SM  C  E+R  A 
Sbjct: 244  FTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLKDIQVLVSELSMSECTPEVRKLAG 303

Query: 1143 ADELHRSSRRDAK 1181
             DE+    R  AK
Sbjct: 304  GDEILEPYREIAK 316



>gb:AF333873_1787376 Morinda citrifolia phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  162 bits (409), Expect = 2e-38
 Identities = 75/80 (93%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHET WKGVP+ LRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETXWKGVPKXLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333868_1787371 Gaertnera schatzii phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  162 bits (409), Expect = 2e-38
 Identities = 75/80 (93%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIG  ERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGXXERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333855_1787358 Gaertnera fractiflexa phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  162 bits (409), Expect = 2e-38
 Identities = 75/80 (93%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAP+I FSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIXFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTP VTRDVCLLA+MMA
Sbjct: 61   NPRVTPXVTRDVCLLARMMA 80



>gb:AF333864_1787367 Gaertnera paniculata phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  161 bits (407), Expect = 3e-38
 Identities = 76/80 (95%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETI KG P+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIGKGAPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333882_1787385 Gaertnera edentata phosphoenolpyruvate
            carboxylase (PepC-Small) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  159 bits (403), Expect = 9e-38
 Identities = 75/80 (93%), Positives = 78/80 (97%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHET  KGVP+FLRRVDTALKNIGINER+PYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHETXXKGVPKFLRRVDTALKNIGINERLPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333872_1787375 Gaertnera walkeri phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  159 bits (403), Expect = 9e-38
 Identities = 75/80 (93%), Positives = 77/80 (96%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFHETIWKGVP FLRRVDTALKNIGINERVP NAP+IQFSSWM GDRDG
Sbjct: 1    TPQDEMRAGMSYFHETIWKGVPXFLRRVDTALKNIGINERVPXNAPVIQFSSWMXGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AF333853_1787356 Gaertnera drakeana phosphoenolpyruvate
            carboxylase (PepC-Large) gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  159 bits (403), Expect = 9e-38
 Identities = 74/80 (92%), Positives = 77/80 (96%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQD MRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDXMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NP VTPEVT DVCLLA+MMA
Sbjct: 61   NPXVTPEVTXDVCLLARMMA 80



>gb:AF333896_1787399 Gaertnera rosea phosphoenolpyruvate carboxylase
            (PepC-Small) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  159 bits (401), Expect = 1e-37
 Identities = 74/80 (92%), Positives = 77/80 (96%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYF ETIWKGVP+FLRRVDTALKNIGINER+PYNAPL QFSSW GGDRDG
Sbjct: 1    TPQDEMRAGMSYFXETIWKGVPKFLRRVDTALKNIGINERLPYNAPLXQFSSWXGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY185550_1588075 Gaertnera longevaginalis phosphoenolpyruvate
            carboxylase PepC-large gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  156 bits (394), Expect = 1e-36
 Identities = 73/80 (91%), Positives = 75/80 (93%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDE RAGMSY HETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG
Sbjct: 1    TPQDETRAGMSYXHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
             PRV PEVTRDVCL A+MMA
Sbjct: 61   TPRVPPEVTRDVCLXARMMA 80



>gb:AF333851_1787354 Gaertnera cooperi phosphoenolpyruvate carboxylase
            (PepC-Large) gene, exons 4 and 5 and partial cds.
          Length = 81

 Score =  155 bits (391), Expect = 2e-36
 Identities = 72/80 (90%), Positives = 75/80 (93%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQD MRAGMSYFHETIWKG P+FLRRVDTALKNIGINERVPYN  +IQ SSWMGGDRDG
Sbjct: 1    TPQDXMRAGMSYFHETIWKGAPKFLRRVDTALKNIGINERVPYNGXVIQXSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMMA 1061
            NPRVTPEVTRDVCLLA+MMA
Sbjct: 61   NPRVTPEVTRDVCLLARMMA 80



>gb:AY185547_1588073 Gaertnera capitulata phosphoenolpyruvate
            carboxylase PepC-large gene, exons 4 and 5 and partial
            cds.
          Length = 81

 Score =  152 bits (385), Expect = 1e-35
 Identities = 72/79 (91%), Positives = 74/79 (93%)
 Frame = +3

Query: 822  TPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDG 1001
            TPQDEMRAGMSYFH TI  GVP+FLRRVDTALKNIGINERVPYNAP+IQFSSWMGGDRDG
Sbjct: 1    TPQDEMRAGMSYFHXTIGXGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDG 60

Query: 1002 NPRVTPEVTRDVCLLAKMM 1058
            NPRVTPE TRDVCLLA MM
Sbjct: 61   NPRVTPEATRDVCLLAXMM 79



>gb:AE014187_938712 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014820_1227788 Plasmodium falciparum 3D7
            chromosome 14 section 5 of 13 of the complete sequence.
          Length = 1148

 Score =  152 bits (385), Expect = 1e-35
 Identities = 109/354 (30%), Positives = 177/354 (50%), Gaps = 11/354 (3%)
 Frame = +3

Query: 111  SGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEY------DALLLDRFL-DILQ 269
            SG + + +   N E     D +L+ L+ GK+ E    V++      D   LD  L D+L+
Sbjct: 12   SGTEDDHV--NNAETGGKEDEKLKFLIEGKMIEKKGCVDFIKPLKDDIKALDFLLFDMLK 69

Query: 270  DLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLAN 449
            D    NL E +   ++LS  Y    +      L N + +L       I  +F HM  ++N
Sbjct: 70   DNLPNNLFEILCTIHDLSETYSENPNDDNFLSLKNCIYNLKDEYLGTIVNAFGHMCVISN 129

Query: 450  LAEEVQIAYR-RRQKLKKGDFVDENSAITESDIEETLK---RLVVDMKKSPQEVFDALKN 617
             AE    A+R RR+K     F+  +       + ETLK    +++       ++++ L N
Sbjct: 130  FAEW---AHRGRRRKAFDKSFIPNDKIY--GSVNETLKGTFNILIQNGFQLNDIYEQLCN 184

Query: 618  QTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRT 797
            QT++ VLT HPTQ++R SLL+ + R+ + L +L N D     K+ L + L+  + ++++T
Sbjct: 185  QTIEFVLTTHPTQAIRTSLLKNYIRLGELLLKLDNTDKELYKKKLLYDNLKTNLLSSWKT 244

Query: 798  DEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSS 977
            D IRR  PTP DE  + +      I+  +P  +R +D  L    +   V  N+ +  FSS
Sbjct: 245  DVIRRIKPTPIDEAISLVDIVENCIFYRIPNIIRYIDNVLFEYNL-PPVKLNSKVCIFSS 303

Query: 978  WMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRA 1139
            W GGDRDGNP V PE T+ VC + K+    L+   IE L+ ++++  C    R+
Sbjct: 304  WAGGDRDGNPFVLPETTKYVCYMNKIRGCELFIPMIEILIRDLTLHHCTQHFRS 357



>gb:AY458648_620069 Uncultured bacterium 581 clone EBAC000-69B03
            genomic sequence.
          Length = 873

 Score =  149 bits (375), Expect = 2e-34
 Identities = 103/305 (33%), Positives = 150/305 (49%)
 Frame = +3

Query: 345  DPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENS 524
            D    E L  +LT L+    + +A++FSH LNLAN+AE         Q     D+     
Sbjct: 51   DDDDQEALRALLTQLNEKQILDVARAFSHFLNLANIAE---------QHHTLADYSQSLF 101

Query: 525  AITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDC 704
            + T S +E   ++L+ D + +   +   LKN ++DLVLTAHPT+  RR+L+ KH  I DC
Sbjct: 102  SATAS-LESAFQQLLKDHEHN--RLNTVLKNLSIDLVLTAHPTEITRRTLIHKHGEINDC 158

Query: 705  LAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGV 884
            L +L   +       +    L+  I   + T+E R   PTP DE R   +    ++W  V
Sbjct: 159  LTRLEILNDKAAASSKDHSRLKELISQIWHTEEFRSDRPTPIDEARWAFAVIENSLWDAV 218

Query: 885  PRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMAT 1064
            P+FLR VD   +   +    P  +P I+ SSW+GGDRDGNP VT +VTR+V LLA+  A 
Sbjct: 219  PQFLRVVDDICERYALPIPPPNWSP-IRISSWIGGDRDGNPNVTAKVTREVLLLAQWQAC 277

Query: 1065 NLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGD 1244
             L  + I  L  E+S+   +  L    +                       EPYR +L  
Sbjct: 278  TLLENDIATLYEELSVTTASTTLEEATE--------------------GALEPYRFLLKP 317

Query: 1245 VRDKL 1259
            +RD+L
Sbjct: 318  LRDRL 322



>gb:AE008919_246236 Uncultured proteobacterium BAC EBAC000-65D09
            complete sequence.
          Length = 873

 Score =  149 bits (375), Expect = 2e-34
 Identities = 103/305 (33%), Positives = 150/305 (49%)
 Frame = +3

Query: 345  DPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENS 524
            D    E L  +LT L+    + +A++FSH LNLAN+AE         Q     D+     
Sbjct: 51   DDDDQEALRALLTQLNEKQILDVARAFSHFLNLANIAE---------QHHTLADYSQSLF 101

Query: 525  AITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDC 704
            + T S +E   ++L+ D + +   +   LKN ++DLVLTAHPT+  RR+L+ KH  I DC
Sbjct: 102  SATAS-LESAFQQLLNDHEHN--RLNTVLKNLSIDLVLTAHPTEITRRTLIHKHGEINDC 158

Query: 705  LAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGV 884
            L +L   +       +    L+  I   + T+E R   PTP DE R   +    ++W  V
Sbjct: 159  LTRLEILNDKAAASSKDHSRLKELISQIWHTEEFRSDRPTPIDEARWAFAVIENSLWDAV 218

Query: 885  PRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMAT 1064
            P+FLR VD   +   +    P  +P I+ SSW+GGDRDGNP VT +VTR+V LLA+  A 
Sbjct: 219  PQFLRVVDDICERYALPIPPPNWSP-IRISSWIGGDRDGNPNVTAKVTREVLLLAQWQAC 277

Query: 1065 NLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGD 1244
             L  + I  L  E+S+   +  L    +                       EPYR +L  
Sbjct: 278  TLLENDIATLYEELSVTTASTTLEGATE--------------------GALEPYRFLLKP 317

Query: 1245 VRDKL 1259
            +RD+L
Sbjct: 318  LRDRL 322



>pir|PC2167|PC2167 phosphoenolpyruvate carboxykinase (diphosphate)
           (EC 4.1.1.38), PE3 - rape (fragments)
          Length = 453

 Score =  141 bits (356), Expect = 2e-32
 Identities = 74/90 (82%), Positives = 75/90 (83%)
 Frame = +3

Query: 693 IRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 872
           IRDCL QLY KDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI
Sbjct: 1   IRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI 60

Query: 873 WKGVPRFLRRVDTALKNIGINERVPYNAPL 962
           WKGVP+FLR      K I  NE  PY A L
Sbjct: 61  WKGVPKFLR----FWKQIPSNE--PYRAIL 84



 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 25/46 (54%), Positives = 31/46 (67%)
 Frame = +3

Query: 1125 DELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKLY 1262
            DE+RA     H +  +    ++ FWKQ+P NEPYR ILGDVRDKLY
Sbjct: 47   DEMRAGMSYFHETIWKGVPKFLRFWKQIPSNEPYRAILGDVRDKLY 92



>sp|Q59757|CAPP_RHOMR Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:ROPEPC_166559 R.obamensis PEPC gene.
          Length = 936

 Score =  132 bits (332), Expect = 1e-29
 Identities = 89/324 (27%), Positives = 159/324 (49%), Gaps = 3/324 (0%)
 Frame = +3

Query: 219  LVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPG 398
            L E+  LL      ++Q++ G  + E V+    L  +    + P+  E+    + S    
Sbjct: 18   LSEHVNLLGGLLGQVIQEMAGPEMLELVETLRRLCKQAAQENRPEFREQAYTRIHSATYD 77

Query: 399  DSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDM 578
            + + + ++++   +L N AE+ +I    R++ ++        +  E    E++   ++ +
Sbjct: 78   ELLWLLRAYTAFFHLVNQAEQQEIIRINRERAQQ--------STPERPRPESIDEAILAL 129

Query: 579  KKSPQ---EVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQ 749
            K+  +   +V   L+   +   +TAHPT++ RRS+L K   I   L+Q     +TP++++
Sbjct: 130  KQQGRTLDDVLTLLERLDIQPTVTAHPTEARRRSILYKQQHIAQMLSQQRRCQLTPEEQE 189

Query: 750  ELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIG 929
             L   L  +I     T E+R   PT +DE+  G+ +   TIW+ VPR    V  AL+   
Sbjct: 190  TLLLDLHNQITLLLGTAEVREERPTVRDEVEQGLYFIQSTIWEAVPRIYEDVRRALRRY- 248

Query: 930  INERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMS 1109
                V +  P +++ SW+G DRDGNP VTPE+TR   L  + +A   Y  ++  L   +S
Sbjct: 249  YGADVDFR-PFLRYRSWIGSDRDGNPYVTPEITRWTALTQRRLALQRYMEELRQLRRRLS 307

Query: 1110 MWRCNDELRARADELHRSSRRDAK 1181
            +   +D   A  +EL RS  RDA+
Sbjct: 308  L---SDRYVAPPEELRRSLARDAR 328



>gb:AB078720_1523752 Nicotiana sylvestris Nsppc3 gene for
            phosphoenolpyruvate carboxylase, partial cds.
          Length = 657

 Score =  132 bits (331), Expect = 2e-29
 Identities = 59/70 (84%), Positives = 65/70 (92%)
 Frame = +3

Query: 1053 MMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRV 1232
            MMA NLYYSQIE+LMFE+SMWRCND+LR RA EL+RSSRRD KHYIEFWK +PP+EPYRV
Sbjct: 1    MMAANLYYSQIEELMFELSMWRCNDDLRVRAAELYRSSRRDTKHYIEFWKTIPPSEPYRV 60

Query: 1233 ILGDVRDKLY 1262
            ILGDVRDKLY
Sbjct: 61   ILGDVRDKLY 70



>sp|Q82WS3|CAPP_NITEU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:BX321858_772917 Nitrosomonas
            europaea ATCC 19718, complete genome; segment 3/10.
          Length = 933

 Score =  129 bits (325), Expect = 1e-28
 Identities = 85/304 (27%), Positives = 152/304 (50%), Gaps = 1/304 (0%)
 Frame = +3

Query: 204  SEDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVL 380
            +E D  +  D  LL R L D +++L GE +   V+   + S  +    D     EL  +L
Sbjct: 17   NEKDYPLREDIRLLGRMLGDTIRELEGETMFNLVETIRQTSVRFRRDQDEAAEHELDTIL 76

Query: 381  TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLK 560
              L   ++I + ++FS+   L+N+AE++    RRR  L+ G      S   +  +   L+
Sbjct: 77   NHLSHKETIAVVRAFSYFSLLSNIAEDLHHNRRRRAHLRAG------SPPQDGSVTLALQ 130

Query: 561  RLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPD 740
            R VV      +++ +   +  +  VLTAHPT+  RRS+L    +I+  L +     +TP+
Sbjct: 131  R-VVKKGIDAEQLQNFFASALISPVLTAHPTEVQRRSILDYQLKIQRLLKERDRTQLTPN 189

Query: 741  DKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALK 920
            + +  +E L+  IQ  ++T  +R    T QDE+  G+ Y+H T  + +P    +++  L+
Sbjct: 190  EMRHNEEDLRSAIQTLWQTRVLRSVRLTVQDEIENGLIYYHYTFLRQIPYIYAKLEDILE 249

Query: 921  NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMF 1100
               +++  P  A  ++  SW+GGDRDGNP VT ++          +  + Y S++E +  
Sbjct: 250  R-HMDKAAPRIASFLRIGSWIGGDRDGNPFVTHQIMLHAAERHSALILDFYISEVERIGQ 308

Query: 1101 EMSM 1112
             MS+
Sbjct: 309  TMSL 312



>gb:AB008541_1510532 Glycine max mRNA for phosphoenolpyruvate
            carboxylase, partial cds, clone:GmPEPC15.
          Length = 65

 Score =  128 bits (322), Expect = 2e-28
 Identities = 60/64 (93%), Positives = 62/64 (96%)
 Frame = +3

Query: 921  NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMF 1100
            NIGI ERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA+MMA NLYYSQIEDLMF
Sbjct: 2    NIGIKERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIEDLMF 61

Query: 1101 EMSM 1112
            E+SM
Sbjct: 62   ELSM 65



>sp|Q7U4M0|CAPP_SYNPX Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:BX569694_776949 Synechococcus sp.
            WH8102 complete genome; segment 6/7.
          Length = 1010

 Score =  124 bits (310), Expect = 5e-27
 Identities = 99/370 (26%), Positives = 173/370 (46%), Gaps = 30/370 (8%)
 Frame = +3

Query: 240  LLDRFLDILQDLHGENLR--------ETVQECYELS--AEYEGRHDPKKLEELGNVLTSL 389
            LL   L++++DL    LR        E +    +LS     EGR      E +  ++ S+
Sbjct: 38   LLQHRLELVEDLWQTVLRSECPPEQSERLLRLKQLSDPVALEGRDGESSSEAIVELIRSM 97

Query: 390  DPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAI------------- 530
            D  ++I  A++FS    L N+ E+          L+     D+ +A              
Sbjct: 98   DLSEAIAAARAFSLYFQLINILEQRIEEDSYLDSLRPSRSQDDETAAPFDPFAPPLASQT 157

Query: 531  ---TESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRD 701
               T  ++ E L+R+ V     P +V   L+   + LV TAHPT+ VR ++  K  ++  
Sbjct: 158  DPATFGEVFERLRRMNVP----PAQVETLLRELDIRLVFTAHPTEIVRHTVRHKQRKVAS 213

Query: 702  CLAQLYNKDITPD-DKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWK 878
             L +L ++   P  D++EL   L+ EI+  +RTDE+ +  PT  DE+ + + YF + +++
Sbjct: 214  LLQRLQSEPALPRYDEEELRRQLEEEIRLWWRTDELHQFKPTVLDEVDSTLHYFQQVLFE 273

Query: 879  GVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMM 1058
             +P+  RR+ ++L     + + P  A    F SW+G DRDGNP VTPE+T       + +
Sbjct: 274  AMPQLRRRLVSSLSRHYPDVQFP-QASFCTFGSWVGSDRDGNPSVTPEITWRTACYQRQL 332

Query: 1059 ATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPN---EPYR 1229
               LY   ++ L  ++S+   + +    A  L  S   D   + E +++       EPYR
Sbjct: 333  MLELYIGSVQSLRNQLSI---SMQWSQVAPPLLESLEMDRLRFPEIYERRAARYRLEPYR 389

Query: 1230 VILGDVRDKL 1259
            + L  + ++L
Sbjct: 390  LKLSYILERL 399



>sp|Q7V9U4|CAPP_PROMA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE017166_396185 Prochlorococcus
            marinus subsp. marinus str. CCMP1375 section 6 of 6 of
            the complete genome.>gb:AE017126_1031854 Prochlorococcus
            marinus subsp. marinus str. CCMP1375 complete genome.
          Length = 1001

 Score =  122 bits (307), Expect = 1e-26
 Identities = 102/384 (26%), Positives = 180/384 (46%), Gaps = 27/384 (7%)
 Frame = +3

Query: 189  VPGKVSEDDKLVEY-DALLLDRFLDILQDLHGENLR-----ETVQECYEL-----SAEYE 335
            VP +      L ++    LL + L++++DL    +R     E V+    L     S+   
Sbjct: 16   VPDRKESSQILADHMSGRLLQKRLELVEDLWETVVRSECPLEQVERLLRLKQLSNSSGIV 75

Query: 336  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVD 515
            G     ++ E+  ++  +D  ++I  A++FS    L N+ E+        + + +G    
Sbjct: 76   GEEQTNQINEIVELIKEMDLAEAISAARAFSLYFQLVNILEQRIEEDSYLESISRGQEEK 135

Query: 516  ENSAI--------------TESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPT 653
             N++I              T S++ + L+RL V     P ++ + L+   + LV TAHPT
Sbjct: 136  INTSIDPFAPPLASQTAPATFSELFDRLRRLNVP----PGQLEELLREMDIRLVFTAHPT 191

Query: 654  QSVRRSLLQKHARIRDCLAQLYNKDI-TPDDKQELDEALQREIQAAFRTDEIRRTPPTPQ 830
            + VR ++  K  R+   L QL + ++ +  ++  L   L+ EI+  +RTDE+ +  PT  
Sbjct: 192  EIVRHTVRHKQRRVASLLQQLQSDEVFSLSERDNLRLQLEEEIRLWWRTDELHQFKPTVL 251

Query: 831  DEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPR 1010
            DE+   + YF + ++  +P+  RR+ +AL     +  VP  A    F SW+G DRDGNP 
Sbjct: 252  DEVDYALHYFQQVLFDAMPQLRRRICSALSQSYPDIDVPQEA-FCTFGSWVGSDRDGNPS 310

Query: 1011 VTPEVT-RDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHY 1187
            VTPE+T R  C   K+M  + Y   +++L  ++S+     ++  +  E     R    H 
Sbjct: 311  VTPEITWRTACYQRKLM-LDRYMHSVQELRNQLSISMQWSQVSTQLLESLEMDRVRFPHI 369

Query: 1188 IEFWKQVPPNEPYRVILGDVRDKL 1259
             E        EPYR+ L    ++L
Sbjct: 370  YEERAARYRLEPYRLKLSYTLERL 393



>sp|Q89R17|CAPP_BRAJA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:BA000040_731215 Bradyrhizobium
            japonicum USDA 110 DNA, complete genome.
          Length = 932

 Score =  122 bits (305), Expect = 2e-26
 Identities = 92/356 (25%), Positives = 165/356 (46%), Gaps = 5/356 (1%)
 Frame = +3

Query: 207  EDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLT 383
            E D  +  D  LL R L D ++D  G +L + V+   + S  +    D     EL  +L 
Sbjct: 25   EADARLRDDIRLLGRILGDTVRDQEGADLFDLVERIRQTSIRFHRDEDRLARRELEQILD 84

Query: 384  SLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKR 563
            S+   +++ I ++FS+  +LAN+AE+      R+ + +    +  +  + ++        
Sbjct: 85   SMSTSETVRIVRAFSYFSHLANIAEDQNNI--RQMRARTAAKIGGSGVLADTLAHAKAAG 142

Query: 564  LVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDD 743
            +       P  + +  K   V  VLTAHPT+  R+S + +   +   L +     +T D+
Sbjct: 143  I------GPDALRNFFKTALVSPVLTAHPTEVRRKSTMDREMEVASLLDRRERVALTEDE 196

Query: 744  KQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKN 923
                DE L+RE+   ++T+ +RRT  T  DE+  G+S++  T  + VPR +  ++  L+ 
Sbjct: 197  AAASDEQLRREVLTLWQTNLLRRTKLTVLDEVANGLSFYDYTFLREVPRLVNVLEDRLEE 256

Query: 924  IGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFE 1103
             G ++     A  ++  SW+GGDRDGNP VT +V R    L        Y +++  L  E
Sbjct: 257  DG-DQAASELASFLRMGSWIGGDRDGNPFVTADVMRGTLRLQSSRVMQFYLNELHVLGSE 315

Query: 1104 MS----MWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            +S    +   ++ELR  A+    +S   +             EPYR+ +  +  +L
Sbjct: 316  LSIAAHLADVSEELRTLAERSPDTSPHRS------------GEPYRLAVSGIYARL 359



>sp|Q7UZT0|CAPP_PROMP Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:BX572094_797201 Prochlorococcus
            marinus MED4 complete genome; segment 5/5.
          Length = 989

 Score =  120 bits (302), Expect = 5e-26
 Identities = 98/370 (26%), Positives = 181/370 (48%), Gaps = 17/370 (4%)
 Frame = +3

Query: 201  VSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE-GRHDPKKLE-ELGN 374
            +S +D L +  AL+ D +  +L++   ++    + +  ELS   +   + PK  + E+ +
Sbjct: 15   ISNNDPLDKNRALIEDLWESVLREECPDDQANRLIQLKELSYSNKVEEYSPKNFKTEIVD 74

Query: 375  VLTSLDPGDSIVIAKSFSHMLNLANLAEEV-----QIAYRRRQKLKKG-DFVD------- 515
            ++ S+D  +SI  A++FS    L N+ E+       I     Q +KK  D +D       
Sbjct: 75   IVNSMDLAESISAARAFSLYFQLVNILEQRVEEDRYIQSFTNQNVKKSHDNLDPFAPALA 134

Query: 516  -ENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHAR 692
             +N+ +T  ++   L+RL V     P ++ + L+   + LV TAHPT+ VR ++  K  R
Sbjct: 135  RQNAPVTFKELFFRLRRLNVP----PGKLEELLQEMDIRLVFTAHPTEIVRHTIRHKQTR 190

Query: 693  IRDCLAQLY-NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHET 869
            + + L ++   K +T +D + L   L+ EI+  +RTDE+ +  P+  DE+   + YF + 
Sbjct: 191  VANLLQKIQVEKFLTIEDIKSLKIQLKEEIRLWWRTDELHQFKPSVIDEVDYALHYFQQV 250

Query: 870  IWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLA 1049
            ++  +P+   R+ +AL     + ++P  +    F SW+G DRDGNP VTPE+T       
Sbjct: 251  LFDAMPQLRGRISSALTENYPDVQMPTES-FCTFGSWVGSDRDGNPSVTPEITWRTACYQ 309

Query: 1050 KMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYR 1229
            + +    Y     +L  ++S+     ++ +   E   + R       E       +EPYR
Sbjct: 310  RQLMLERYIKATSNLRDQLSVSMQWSQVSSSLLESLETDRVKFPEIYEARATRYRSEPYR 369

Query: 1230 VILGDVRDKL 1259
            + L  + +KL
Sbjct: 370  LKLSYILEKL 379



>sp|Q9RNU9|CAPP_STRCO Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:SCO939115_176800 Streptomyces
            coelicolor A3(2) complete genome; segment
            12/29.>gb:AF160253_484360 Streptomyces coelicolor
            phosphoenolpyruvate carboxylase (ppc) gene, complete
            cds.>gb:AF177946_485811 Streptomyces coelicolor A3(2)
            phosphoenolpyruvate carboxylase (ppc) gene, complete cds.
          Length = 911

 Score =  118 bits (296), Expect = 2e-25
 Identities = 104/356 (29%), Positives = 160/356 (44%), Gaps = 4/356 (1%)
 Frame = +3

Query: 204  SEDDKLVEYDALLLDRFLDILQDLHGENL-RETVQECYELSAEYEGRHDPKKLEELGNVL 380
            S DD+     +  L   +  L DL GE L R+   E  EL  E   R   +  E    +L
Sbjct: 3    SADDQTTTTTSSELRADIRRLGDLLGETLVRQEGPELLEL-VEKVRRLTREDGEAAAELL 61

Query: 381  TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLK 560
               +   +  + ++FS   +LAN+ E+V           +G  +    A     +  T  
Sbjct: 62   RGTELETAAKLVRAFSTYFHLANVTEQVH----------RGRELGAKRAAEGGLLARTAD 111

Query: 561  RLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPD 740
            RL       P+ + + ++N  V  V TAHPT++ RRS+L K  RI    A L +  +   
Sbjct: 112  RL---KDADPEHLRETVRNLNVRPVFTAHPTEAARRSVLNKLRRI----AALLDTPVNES 164

Query: 741  DKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALK 920
            D++ LD  L   I   ++TDE+R   P P DE R  + Y  E     V   L  +   L+
Sbjct: 165  DRRRLDTRLAENIDLVWQTDELRVVRPEPADEARNAIYYLDELHLGAVGDVLEDLTAELE 224

Query: 921  NIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMF 1100
              G+  ++P +   + F +W+GGDRDGNP VTP+VT DV +L      N     I++L  
Sbjct: 225  RAGV--KLPDDTRPLTFGTWIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRG 282

Query: 1101 EMSMWRCNDELRARADELHRSSRRDAKHYIEF---WKQVPPNEPYRVILGDVRDKL 1259
             +S    +       +EL  S + D +   E    +K++   EPYR+    +R KL
Sbjct: 283  FLSN---SIRYAGATEELLASLQADLERLPEISPRYKRLNAEEPYRLKATCIRQKL 335



>sp|Q7P206|CAPP_CHRVO Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AE016910_355016 Chromobacterium
            violaceum ATCC 12472 section 1 of 16 of the complete
            genome.>gb:AE016825_1040170 Chromobacterium violaceum
            ATCC 12472 complete genome.
          Length = 898

 Score =  115 bits (287), Expect = 2e-24
 Identities = 103/356 (28%), Positives = 160/356 (44%), Gaps = 3/356 (0%)
 Frame = +3

Query: 201  VSEDDK--LVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGN 374
            +SE DK   +  D   LDR   +L ++ GE     V    +  A   G       +E  +
Sbjct: 1    MSEHDKDLPLRADLACLDR---LLSEVVGEQEGAVVSGAVQAIALRRG-------DERSH 50

Query: 375  VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEET 554
             L  L P  +  + ++      L N+AE++    RRR     G      SA  +  +   
Sbjct: 51   PLPQLAPEAAASLLRACGLYAQLFNIAEDLHHNRRRRAHQLAG------SAPQQGSLPRA 104

Query: 555  LKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDIT 734
            L+RL  D   S   +   L +  V  +LTAHPT+  R+S+L  H  +R  L+QL   D+T
Sbjct: 105  LQRLRQD-GVSFHALHQLLSHAKVGAILTAHPTEVQRQSVLDGHRAVRRFLSQLNAADLT 163

Query: 735  PDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTA 914
            P++++ L+  L+R I A ++T EIR    T +DE+  G++Y     ++ +P   RR++  
Sbjct: 164  PEEREALEAKLKRAILALWQTSEIRHFKMTVRDEITNGVAYHPLAFFEALPALYRRLERE 223

Query: 915  LKNI-GINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIED 1091
            +  + G   R+P     I+  SW+GGDRDGNP V   + R         A   Y  +++ 
Sbjct: 224  IGQLWGEEARLP---SFIRVGSWIGGDRDGNPNVDAGLLRHAVTRQSQQAFEYYLQELKS 280

Query: 1092 LMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            L  E+S+     E  A    L   S   A    E        EPYR  L  ++ KL
Sbjct: 281  LYRELSLSSRLVEAGAEVLALAEQSPDQAVSRGE--------EPYRRALATMQGKL 328



>gb:ZMPEPC5A_1731961 Maize MRNA for phosphoenolpyruvate carboxylase
           5'-end (pM500, pM541, pM499).
          Length = 83

 Score =  114 bits (285), Expect = 4e-24
 Identities = 57/73 (78%), Positives = 64/73 (87%)
 Frame = +3

Query: 150 EKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAE 329
           EK  SIDAQLR LVPGKVSEDDKL+EYDALL+DRFL+ILQDLHG +LRE VQECYE+SA+
Sbjct: 11  EKHHSIDAQLRQLVPGKVSEDDKLIEYDALLVDRFLNILQDLHGPSLREFVQECYEVSAD 70

Query: 330 YEGRHDPKKLEEL 368
           YEG+ D  KL EL
Sbjct: 71  YEGKGDTTKLGEL 83



>sp|Q93MH3|CAPP_CORCT Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AF406314_507851 Corynebacterium
            crenatum phosphoenolpyruvate carboxylase (ppc) gene,
            complete cds.
          Length = 919

 Score =  114 bits (284), Expect = 6e-24
 Identities = 96/350 (27%), Positives = 159/350 (45%), Gaps = 7/350 (2%)
 Frame = +3

Query: 231  DALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSI 407
            D   L R L +++ +  G+ + E V++    S  ++      +++ L  V   + P  + 
Sbjct: 8    DIRFLGRILGEVIAEQEGQEVYELVEQARLTS--FDIAKGNAEMDSLVQVFDGITPAKAT 65

Query: 408  VIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKS 587
             IA++FSH   LANLAE++     R Q L  GD         +S ++ T  +L  +    
Sbjct: 66   PIARAFSHFALLANLAEDLHDEELREQALDAGD------TPPDSTLDATWLKLN-EGNVG 118

Query: 588  PQEVFDALKNQTVDLVLTAHPTQSVRRSL------LQKHARIRDCLAQLYNKDITPDDKQ 749
             + V D L+N  V  VLTAHPT++ RR++      +  H R R  L        T     
Sbjct: 119  AEAVADVLRNAEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLD 178

Query: 750  ELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIG 929
            E+++ ++R I   ++T  IR   P  +DE+  G+ Y+  ++ + +PR  R V   L+   
Sbjct: 179  EIEKNIRRRITILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRE-R 237

Query: 930  INERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMS 1109
              E VP   P+++  SW+GGD DGNP VT          A       Y  Q+  L  E+S
Sbjct: 238  FGEDVPLK-PVVKPGSWIGGDHDGNPYVTAGTVEYSTRRAAETVLKYYARQLHSLEHELS 296

Query: 1110 MWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDKL 1259
            +    +E+  +  EL  +   D    ++        EPYR  +  VR ++
Sbjct: 297  LSDRMNEVTPQLLELADAGHNDVPSRVD--------EPYRRAVHGVRGRI 338



>gb:AB115089_13996 Corynebacterium glutamicum ppc gene for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 920

 Score =  113 bits (282), Expect = 9e-24
 Identities = 100/352 (28%), Positives = 162/352 (46%), Gaps = 9/352 (2%)
 Frame = +3

Query: 231  DALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSI 407
            D   L R L +++ +  G+ + E V++    S  ++      +++ L  V   + P  + 
Sbjct: 8    DIRFLGRILGEVIAEQEGQEVYELVEQARLTS--FDIAKGNAEMDSLVQVFDGITPAKAT 65

Query: 408  VIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKS 587
             IA++FSH   LANLAE++     R Q L  GD         +S ++ T  +L  +    
Sbjct: 66   PIARAFSHFALLANLAEDLHDEELREQALDAGD------TPPDSTLDATWLKLN-EGNVG 118

Query: 588  PQEVFDALKNQTVDLVLTAHPTQSVRRSL------LQKHARIRDCLAQLYNKDITPDDKQ 749
             + V D L+N  V  VLTAHPT++ RR++      +  H R R  L        T     
Sbjct: 119  AEAVADVLRNAEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLD 178

Query: 750  ELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIG 929
            E+++ ++R I   ++T  IR   P  +DE+  G+ Y+  ++ + +PR  R V   L+   
Sbjct: 179  EIEKNIRRRITILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRE-R 237

Query: 930  INERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMS 1109
              E VP   P+++  SW+GGD DGNP VT E        A       Y  Q+  L  E+S
Sbjct: 238  FGEDVPLK-PVVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELS 296

Query: 1110 MWRCNDELRARADELHRSSRRDAKHYIEFWKQVPP--NEPYRVILGDVRDKL 1259
            +   +D +     +L   +  DA H       VP   +EPYR  +  VR ++
Sbjct: 297  L---SDRMNKVTPQL--LALADAGH-----NDVPSRVDEPYRRAVHGVRGRI 338



>gb:D89668_121217 Rhodopseudomonas palustris gene for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 936

 Score =  112 bits (281), Expect = 1e-23
 Identities = 86/306 (28%), Positives = 143/306 (46%), Gaps = 4/306 (1%)
 Frame = +3

Query: 207  EDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLT 383
            E +  +  D  LL R L D +++  G+ + + V+   + S  +    D     EL  +L 
Sbjct: 24   EAETRLRNDIRLLGRILGDTVREQEGQTVFDLVENIRQTSIRFHRDDDKTARAELEAILD 83

Query: 384  SLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKR 563
             +   D++ I ++FS+  +LAN+AE+     + R     G      SA     + +TL  
Sbjct: 84   GMSIPDTMRIVRAFSYFSHLANIAEDQNNIRQMRAGSTAG------SAPRAGLLAKTLAH 137

Query: 564  LVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDD 743
               +   S  E+        V  VLTAHPT+  R+S + +  +I   L Q     +T D+
Sbjct: 138  ARQE-GISAAELRKFFATALVSPVLTAHPTEVRRKSTMDREMQIASLLDQRDRVQLTADE 196

Query: 744  KQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKN 923
              + +E L+R ++  ++T+ +RRT  T  DE+  G+S++  T  + VPR    ++  L +
Sbjct: 197  WADNEERLRRAVETLWKTNLLRRTKLTVLDEVTNGLSFYDYTFLREVPRLHSALEDRLAD 256

Query: 924  IGINERVPYNAPLIQF---SSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDL 1094
                E V  +  L  F    SW+GGDRDGNP VT EV      L        Y  ++ +L
Sbjct: 257  AAKAEGVNSDGELASFLRMGSWIGGDRDGNPFVTAEVLHGTLKLQSTRVLRYYLDELHEL 316

Query: 1095 MFEMSM 1112
              E+S+
Sbjct: 317  GSELSL 322



>gb:CR555306_106020 Azoarcus sp. EbN1 complete genome.
          Length = 990

 Score =  112 bits (281), Expect = 1e-23
 Identities = 87/308 (28%), Positives = 138/308 (44%), Gaps = 6/308 (1%)
 Frame = +3

Query: 207  EDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLT 383
            + D  +  D  LL R L D ++D HGE     ++   + S  +    D     EL  +L 
Sbjct: 78   DKDAPLREDIRLLGRVLGDTVRDQHGEAAFALIERIRQTSVRFRRDDDNAARLELEGILD 137

Query: 384  SLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKR 563
            +L    +I + ++FS+  +L+N+AE+     R R  L  G      SA  E  +   L R
Sbjct: 138  ALSREQTIEVVRAFSYFSHLSNIAEDQHHIRRSRAHLIAG------SAPREGSVAHALVR 191

Query: 564  LVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDD 743
             +      P  +        +  VLTAHPT+  R+S+L     I   L       +TP++
Sbjct: 192  ALAS-GLPPARLAAFFDTALISPVLTAHPTEVQRKSILNCETDIAHLLDARDRMTLTPEE 250

Query: 744  KQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKN 923
            +QE DEAL+R +   ++T  +R    +  DE+  G+SYF  T  + +P     ++  L +
Sbjct: 251  RQESDEALRRTVLTLWQTRMLRPAKLSVVDEVANGLSYFDATFLRELPHLYANLEDQLVS 310

Query: 924  IGINERVPYNAPL-----IQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIE 1088
                 R P  A L     +Q  SW+GGDRDGNP VT +V      +        Y  ++ 
Sbjct: 311  -----RDPALAGLELPAFLQVGSWIGGDRDGNPFVTADVLERTLAMQAGAVLGFYLDELH 365

Query: 1089 DLMFEMSM 1112
             L   +S+
Sbjct: 366  ALGARLSL 373



>sp|Q82HE3|CAPP_STRAW Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:BA000030_701453 Streptomyces
            avermitilis MA-4680 genomic DNA, complete genome.
          Length = 910

 Score =  112 bits (281), Expect = 1e-23
 Identities = 101/336 (30%), Positives = 149/336 (44%), Gaps = 4/336 (1%)
 Frame = +3

Query: 264  LQDLHGENL-RETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLN 440
            L DL GE L R+   E  +L  E   R   +  E    +L   +   +  + ++FS   +
Sbjct: 22   LGDLLGETLVRQEGPELLDL-VEKVRRLTREDGEAAAELLRGTELETAAKLVRAFSTYFH 80

Query: 441  LANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKNQ 620
            LAN+ E+V      R K           A     +  T  RL       P+ +   +KN 
Sbjct: 81   LANVTEQVHRGRELRTK----------RAAEGGLLARTADRL---KDADPEHLRATVKNL 127

Query: 621  TVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQREIQAAFRTD 800
             V  V TAHPT++ RRS+L K  RI    A L    +   D++  D  L   I   ++TD
Sbjct: 128  NVRPVFTAHPTEAARRSVLNKLRRI----AALLETPVIEADRRRYDTRLAENIDLVWQTD 183

Query: 801  EIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSW 980
            E+R   P P DE R  + Y  E     V   L  +   L+ +G+  ++P +   + F +W
Sbjct: 184  ELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGV--QLPDDTRPLTFGTW 241

Query: 981  MGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRARADELHR 1160
            +GGDRDGNP VTPEVT DV +L      N     I++L   +S    +       +EL  
Sbjct: 242  IGGDRDGNPNVTPEVTWDVLILQHEHGINDALELIDELRGFLSN---SIRYTGATEELLT 298

Query: 1161 SSRRDAKHYIEF---WKQVPPNEPYRVILGDVRDKL 1259
            S   D +   E    +K++   EPYR+    +R KL
Sbjct: 299  SLGTDLERLPEISPRYKRLNAEEPYRLKATCIRQKL 334



>sp|Q8RQL3|CAPP_COREF Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:AB083298_10477 Corynebacterium
            efficiens ppc gene for phosphoenolpyruvate carboxylase,
            complete cds.>gb:BA000035_716486 Corynebacterium
            efficiens YS-314 DNA, complete genome.
          Length = 919

 Score =  112 bits (281), Expect = 1e-23
 Identities = 102/361 (28%), Positives = 166/361 (45%), Gaps = 12/361 (3%)
 Frame = +3

Query: 213  DKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEY-EGRHDPKKLEELGNVLTS 386
            ++L+  D   L R L +++ +  G ++ E V+     S +  +GR +   ++ L  V   
Sbjct: 2    NELLRDDIRYLGRILGEVISEQEGHHVFELVERARRTSFDIAKGRAE---MDSLVEVFAG 58

Query: 387  LDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRL 566
            +DP D+  +A++F+H   LANLAE++  A +R Q L  G+         +S +E T  +L
Sbjct: 59   IDPEDATPVARAFTHFALLANLAEDLHDAAQREQALNSGE------PAPDSTLEATWVKL 112

Query: 567  VVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLL--QKHARI----RDCLAQLYNKD 728
              D      EV   ++N  V  VLTAHPT++ RR++   QKH       R  L  L    
Sbjct: 113  -DDAGVGSGEVAAVIRNALVAPVLTAHPTETRRRTVFDAQKHITALMEERHLLLALPTHA 171

Query: 729  ITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVD 908
             T     +++  ++R I   ++T  IR   P  +DE+  G+ Y+  ++   +PR    V 
Sbjct: 172  RTQSKLDDIERNIRRRITILWQTALIRVARPRIEDEVEVGLRYYKLSLLAEIPRINHDVT 231

Query: 909  TALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIE 1088
              L        +P  A +++  SW+GGD DGNP VT E        A       Y  Q+ 
Sbjct: 232  VELAR-RFGGDIPTTA-MVRPGSWIGGDHDGNPFVTAETVTYATHRAAETVLKYYVKQLH 289

Query: 1089 DLMFEMS----MWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYRVILGDVRDK 1256
             L  E+S    M   +DELR  AD    + + D    ++        EPYR  +  +R +
Sbjct: 290  ALEHELSLSDRMNVISDELRVLAD----AGQNDMPSRVD--------EPYRRAIHGMRGR 337

Query: 1257 L 1259
            +
Sbjct: 338  M 338



>gb:AX064983_1459405 Sequence 109 from Patent WO0100844.
          Length = 924

 Score =  112 bits (279), Expect = 2e-23
 Identities = 104/362 (28%), Positives = 167/362 (46%), Gaps = 14/362 (3%)
 Frame = +3

Query: 216  KLVEYDALLLD-RFL-----DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNV 377
            K+V  D L  D RFL     +++ +  G+ + E V++    S  ++      +++ L  V
Sbjct: 3    KVVMTDFLRDDIRFLGQILGEVIAEQEGQEVYELVEQARLTS--FDIAKGNAEMDSLVQV 60

Query: 378  LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETL 557
               + P  +  IA++FSH   LANLAE++     R Q L  GD         +S ++ T 
Sbjct: 61   FDGITPAKATPIARAFSHFALLANLAEDLYDEELREQALDAGD------TPPDSTLDATW 114

Query: 558  KRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSL------LQKHARIRDCLAQLY 719
             +L  +     + V D L+N  V  VLTAHPT++ RR++      +  H R R  L    
Sbjct: 115  LKLN-EGNVGAEAVADVLRNAEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAE 173

Query: 720  NKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLR 899
                T     E+++ ++R I   ++T  IR   P  +DE+  G+ Y+  ++ + +PR  R
Sbjct: 174  PTARTQSKLDEIEKNIRRRITILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINR 233

Query: 900  RVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYS 1079
             V   L+     E VP   P+++  SW+GGD DGNP VT E        A       Y  
Sbjct: 234  DVAVELRE-RFGEGVPLK-PVVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYAR 291

Query: 1080 QIEDLMFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPP--NEPYRVILGDVRD 1253
            Q+  L  E+S+   +D +     +L   +  DA H       VP   +EPYR  +  VR 
Sbjct: 292  QLHSLEHELSL---SDRMNKVTPQL--LALADAGH-----NDVPSRVDEPYRRAVHGVRG 341

Query: 1254 KL 1259
            ++
Sbjct: 342  RI 343



>gb:BA000036_719312 Corynebacterium glutamicum ATCC 13032 DNA,
            complete genome.>gb:BX927152_833162 Corynebacterium
            glutamicum ATCC 13032, IS fingerprint type 4-5, complete
            genome; segment 5/10.>gb:CORPEPC_850597 C.glutamicum
            phosphoenolpyruvate carboxylase gene, complete
            cds.>gb:A09073_1447208 C.glutamicum ppg gene for
            phosphoenol pyruvate carboxylase.
          Length = 919

 Score =  111 bits (278), Expect = 3e-23
 Identities = 96/342 (28%), Positives = 158/342 (46%), Gaps = 8/342 (2%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            +++ +  G+ + E V++    S  ++      +++ L  V   + P  +  IA++FSH  
Sbjct: 18   EVIAEQEGQEVYELVEQARLTS--FDIAKGNAEMDSLVQVFDGITPAKATPIARAFSHFA 75

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
             LANLAE++     R Q L  GD         +S ++ T  +L  +     + V D L+N
Sbjct: 76   LLANLAEDLYDEELREQALDAGD------TPPDSTLDATWLKLN-EGNVGAEAVADVLRN 128

Query: 618  QTVDLVLTAHPTQSVRRSL------LQKHARIRDCLAQLYNKDITPDDKQELDEALQREI 779
              V  VLTAHPT++ RR++      +  H R R  L        T     E+++ ++R I
Sbjct: 129  AEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLDEIEKNIRRRI 188

Query: 780  QAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAP 959
               ++T  IR   P  +DE+  G+ Y+  ++ + +PR  R V   L+     E VP   P
Sbjct: 189  TILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRE-RFGEGVPLK-P 246

Query: 960  LIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRA 1139
            +++  SW+GGD DGNP VT E        A       Y  Q+  L  E+S+   +D +  
Sbjct: 247  VVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELSL---SDRMNK 303

Query: 1140 RADELHRSSRRDAKHYIEFWKQVPP--NEPYRVILGDVRDKL 1259
               +L   +  DA H       VP   +EPYR  +  VR ++
Sbjct: 304  VTPQL--LALADAGH-----NDVPSRVDEPYRRAVHGVRGRI 338



>gb:AE017301_435900 Thermus thermophilus HB27 section 1 of 7 of the
            complete genome.>gb:AP008226_578083 Thermus thermophilus
            HB8 genomic DNA, complete genome.>gb:AE017221_1077878
            Thermus thermophilus HB27 complete genome.
          Length = 858

 Score =  111 bits (278), Expect = 3e-23
 Identities = 92/331 (27%), Positives = 158/331 (47%), Gaps = 8/331 (2%)
 Frame = +3

Query: 219  LVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDP 395
            L++ +  LL R L + ++ L GE     V+E   L A+   + D    E L   +  L  
Sbjct: 8    LLKAEVDLLGRLLGEAIRTLSGERFFALVEEVRAL-AKARRQGDEAAGEALLARVEGLST 66

Query: 396  GDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVD 575
             ++  + ++F+H  +L NLAEE     R R ++ +   +   +   ES   E    L   
Sbjct: 67   EEAEALVRAFTHYFHLVNLAEE-----RHRVRVNR---LRAQAETLESPRPEGFLALAKA 118

Query: 576  MKK---SPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDK 746
            +K+   S +E    L    + L  TAHPT++ RR+L            +   +++   D+
Sbjct: 119  LKERGLSLEEAEAHLNRLELLLTFTAHPTETRRRTLRHH--------LEALQRELEAGDR 170

Query: 747  QELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNI 926
                E L   +   + T+E+R+  PT +DE++ G+ Y   T+W+ VPR +  ++ AL+ +
Sbjct: 171  ----ERLAARVALLYGTEEVRKARPTVEDEIKGGLYYLPTTLWEAVPRVVAGLEAALERV 226

Query: 927  GINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEM 1106
                R    +P ++F SW+GGDRDGNP VTPEVT      A+ +A   +   +EDL+ ++
Sbjct: 227  -YGRRPRLKSP-VRFRSWIGGDRDGNPFVTPEVTAFAGRYAREVARRRFLEALEDLVRDL 284

Query: 1107 SMWRCN----DELRARADELHRSSRRDAKHY 1187
            S+         E+R R + + R      + Y
Sbjct: 285  SLAEARVPVPREVRERGEGVERFMGEPYRRY 315



>pir|S05512|QYFKG phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            Corynebacterium glutamicum>gb:CGPPC_846188
            Corynebacterium glutamicum phosphoenolpyruvate
            carboxylase gene (EC 4.1.1.31).
          Length = 919

 Score =  111 bits (278), Expect = 3e-23
 Identities = 96/342 (28%), Positives = 158/342 (46%), Gaps = 8/342 (2%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            +++ +  G+ + E V++    S  ++      +++ L  V   + P  +  IA++FSH  
Sbjct: 18   EVIAEQEGQEVYELVEQARLTS--FDIAKGNAEMDSLVQVFDGITPAKATPIARAFSHFA 75

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
             LANLAE++     R Q L  GD         +S ++ T  +L  +     + V D L+N
Sbjct: 76   LLANLAEDLYDEELREQALDAGD------TPPDSTLDATWLKLN-EGNVGAEAVADVLRN 128

Query: 618  QTVDLVLTAHPTQSVRRSL------LQKHARIRDCLAQLYNKDITPDDKQELDEALQREI 779
              V  VLTAHPT++ RR++      +  H R R  L        T     E+++ ++R I
Sbjct: 129  AEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLDEIEKNIRRRI 188

Query: 780  QAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAP 959
               ++T  IR   P  +DE+  G+ Y+  ++ + +PR  R V   L+     E VP   P
Sbjct: 189  TILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRE-RFGEGVPLK-P 246

Query: 960  LIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRA 1139
            +++  SW+GGD DGNP VT E        A       Y  Q+  L  E+S+   +D +  
Sbjct: 247  VVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELSL---SDRMNK 303

Query: 1140 RADELHRSSRRDAKHYIEFWKQVPP--NEPYRVILGDVRDKL 1259
               +L   +  DA H       VP   +EPYR  +  VR ++
Sbjct: 304  VTPQL--LALADAGH-----NDVPSRVDEPYRRAVHGVRGRI 338



>sp|O32483|CAPP_RHOPA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>gb:BX572598_801385 Rhodopseudomonas
            palustris CGA009 complete genome; segment 6/16.
          Length = 936

 Score =  111 bits (278), Expect = 3e-23
 Identities = 85/306 (27%), Positives = 142/306 (46%), Gaps = 4/306 (1%)
 Frame = +3

Query: 207  EDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLT 383
            E +  +  D  LL R L D +++  G+++ + V+   + S  +    D     EL  +L 
Sbjct: 24   EAETRLRNDIRLLGRILGDTVREQEGQSVFDLVENIRQTSIRFHRDDDKTARAELAAILD 83

Query: 384  SLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKR 563
             +   D++ I ++FS+  +LAN+AE+     + R     G      SA     + +TL  
Sbjct: 84   GMSIQDTMRIVRAFSYFSHLANIAEDQNNIRQMRAGSTAG------SAPRAGLLAKTLAH 137

Query: 564  LVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDD 743
               +   S  E+        V  VLTAHPT+  R+S + +  +I   L Q     +T D+
Sbjct: 138  ARQE-GISAAELRKFFATALVSPVLTAHPTEVRRKSTMDREMQIAGLLDQRDRVQLTADE 196

Query: 744  KQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKN 923
              + +E L+R ++  ++T+ +RRT  T  DE+  G+S++  T  + VPR    ++  L +
Sbjct: 197  WTDNEERLRRAVETLWKTNLLRRTKLTVLDEVTNGLSFYDYTFLREVPRLHSALEDRLAD 256

Query: 924  IGINERVPYNAPLIQF---SSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDL 1094
                E       L  F    SW+GGDRDGNP VT EV      L        Y  ++ +L
Sbjct: 257  AAKAEGANAEGELASFLRMGSWIGGDRDGNPFVTAEVLHGTLKLQSTRVLRYYLEELHEL 316

Query: 1095 MFEMSM 1112
              E+S+
Sbjct: 317  GSELSL 322



>sp|P12880|CAPP_CORGL Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).
          Length = 918

 Score =  111 bits (278), Expect = 3e-23
 Identities = 96/342 (28%), Positives = 158/342 (46%), Gaps = 8/342 (2%)
 Frame = +3

Query: 258  DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHML 437
            +++ +  G+ + E V++    S  ++      +++ L  V   + P  +  IA++FSH  
Sbjct: 17   EVIAEQEGQEVYELVEQARLTS--FDIAKGNAEMDSLVQVFDGITPAKATPIARAFSHFA 74

Query: 438  NLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKKSPQEVFDALKN 617
             LANLAE++     R Q L  GD         +S ++ T  +L  +     + V D L+N
Sbjct: 75   LLANLAEDLYDEELREQALDAGD------TPPDSTLDATWLKLN-EGNVGAEAVADVLRN 127

Query: 618  QTVDLVLTAHPTQSVRRSL------LQKHARIRDCLAQLYNKDITPDDKQELDEALQREI 779
              V  VLTAHPT++ RR++      +  H R R  L        T     E+++ ++R I
Sbjct: 128  AEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLDEIEKNIRRRI 187

Query: 780  QAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAP 959
               ++T  IR   P  +DE+  G+ Y+  ++ + +PR  R V   L+     E VP   P
Sbjct: 188  TILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRE-RFGEGVPLK-P 245

Query: 960  LIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMSMWRCNDELRA 1139
            +++  SW+GGD DGNP VT E        A       Y  Q+  L  E+S+   +D +  
Sbjct: 246  VVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELSL---SDRMNK 302

Query: 1140 RADELHRSSRRDAKHYIEFWKQVPP--NEPYRVILGDVRDKL 1259
               +L   +  DA H       VP   +EPYR  +  VR ++
Sbjct: 303  VTPQL--LALADAGH-----NDVPSRVDEPYRRAVHGVRGRI 337



>gb:AF378606_1793405 Moringa drouhardii phosphoenolpyruvate
           carboxylase gene, intron 4 and partial
           cds.>gb:AF378607_1793406 Moringa drouhardii
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.>gb:AF378608_1793407 Moringa hildebrandtii
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.>gb:AF378609_1793408 Moringa hildebrandtii
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.>gb:AF378611_1793409 Moringa stenopetala
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.>gb:AF378618_1793414 Moringa rivae
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.>gb:AF378619_1793415 Moringa longituba
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.>gb:AF378620_1793416 Moringa longituba
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.>gb:AF378621_1793417 Moringa ruspoliana
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.
          Length = 51

 Score =  110 bits (276), Expect = 5e-23
 Identities = 50/51 (98%), Positives = 51/51 (100%)
 Frame = +3

Query: 846 GMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
           GMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD
Sbjct: 1   GMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 51



>sp|P51060|CAPP_THES7 Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase) (PEPC).>pir|JC4169|JC4169 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Thermus sp.>gb:TBAPPC_197387
            Thermus sp. (Themophilic bacterium) ppc gene for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 857

 Score =  110 bits (275), Expect = 6e-23
 Identities = 91/345 (26%), Positives = 163/345 (47%), Gaps = 2/345 (0%)
 Frame = +3

Query: 201  VSEDDKLVEYDALLLDRFL-DILQDLHGENLRETVQECYELS-AEYEGRHDPKKLEELGN 374
            +S+  + ++ +  LL R L + ++ + GE     V+E   LS A  +G  D    E L  
Sbjct: 1    MSDPFEALKAEVDLLGRLLGEAIRKVSGERFFALVEEVRLLSKARRQG--DGAAAEVLSQ 58

Query: 375  VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEET 554
             +  +   +   + ++F+H  +L NLAEE     R R ++ +     E       +    
Sbjct: 59   RVERMPVEEMEALVRAFTHYFHLVNLAEE-----RHRVRVNRLRTEGETLENPRPEGFLA 113

Query: 555  LKRLVVDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDIT 734
            L + + +   S +E    L    + L  TAHPT++ RR+L     R+++        ++ 
Sbjct: 114  LAKALKERGLSLEEAEAHLNRLALLLTFTAHPTETRRRTLRHHLERLQE--------ELE 165

Query: 735  PDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTA 914
              D+    E L   +   + T+E+R+  P+ +DE++ G+ Y   T+W+ +P+ +  ++ A
Sbjct: 166  GGDR----ERLLARVVLLYATEEVRKARPSVEDEIKGGLYYLPTTLWRAIPKVVEGLEAA 221

Query: 915  LKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDL 1094
            L+ +   +R    +P ++F SWMGGDRDGNP VTPEVT      A+ +A   Y  ++E L
Sbjct: 222  LERV-YGKRPHLRSP-VRFRSWMGGDRDGNPYVTPEVTAFAGRYAREVAKGRYLEELEAL 279

Query: 1095 MFEMSMWRCNDELRARADELHRSSRRDAKHYIEFWKQVPPNEPYR 1229
            + ++S+     E R    +  R      + +        P EPYR
Sbjct: 280  VRDLSL----SEARIPVPKEVREGGEGVERF--------PGEPYR 312



>pir|F75415|F75415 phosphoenolpyruvate carboxylase - Deinococcus
            radiodurans  (strain R1)>gb:AE001975_41552 Deinococcus
            radiodurans R1 section 112 of 229 of the complete
            chromosome 1.>gb:AE000513_882447 Deinococcus radiodurans
            R1 complete chromosome 1.
          Length = 829

 Score =  109 bits (273), Expect = 1e-22
 Identities = 90/297 (30%), Positives = 141/297 (47%), Gaps = 4/297 (1%)
 Frame = +3

Query: 231  DALLLDRFL-DILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSI 407
            D   L R L  +L++  GE     V++   L  E     DP +L  L   L SL   D+ 
Sbjct: 6    DVNRLGRILGQVLKEQEGEAFFNLVEQTRTLVREVRAGGDPAQLNAL---LGSLSENDAS 62

Query: 408  VIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDIEETLKRLVVDMKK- 584
             +A++F+    L N+AEE    Y R + L+    V   S          L + + D+++ 
Sbjct: 63   NLARAFTWYFQLVNIAEE----YERVRVLQSRSGVRSQS----------LAQALADLREQ 108

Query: 585  --SPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELD 758
              S ++V + L    ++L  TAHPT+  RR++      I   L  L         ++   
Sbjct: 109  GLSAEDVENLLARVNLELTFTAHPTEMRRRTVRSHLEHIARELPDL--------GRESAQ 160

Query: 759  EALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINE 938
            E +   ++A +RT E+RR  PT  DE++ G++Y   TI + +P+  R +  A +     E
Sbjct: 161  ERVAAHVEALWRTPELRRLKPTVLDEVKGGLNYI-STIAQALPKLERDLSDAFQATYGRE 219

Query: 939  RVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLAKMMATNLYYSQIEDLMFEMS 1109
               +  PL +FSSWMGGDRDGNP VTPE TR+   L +  A  L  + +     ++S
Sbjct: 220  TAAH-VPL-RFSSWMGGDRDGNPFVTPEATREALQLHRERARELLLAALRQAYTDLS 274



>gb:AF378613_1793410 Moringa concanensis phosphoenolpyruvate
           carboxylase gene, intron 4 and partial
           cds.>gb:AF378614_1793411 Moringa oleifera
           phosphoenolpyruvate carboxylase gene, intron 4 and
           partial cds.
          Length = 51

 Score =  109 bits (272), Expect = 1e-22
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +3

Query: 846 GMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRD 998
           GMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNAPLIQFSSWMGGDRD
Sbjct: 1   GMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNAPLIQFSSWMGGDRD 51


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,400,370,945
Number of Sequences: 1806583
Number of extensions: 30988994
Number of successful extensions: 88228
Number of sequences better than 10.0: 373
Number of HSP's better than 10.0 without gapping: 82473
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87848
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 103277206662
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)