BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8048
         (656 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY093731_1575391 Arabidopsis thaliana AT5g62130/mtg10_150 mRN...   196   9e-52   
pir|H86300|H86300 F19K19.12 protein - Arabidopsis thaliana>gb:AE...   181   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023516 Oryza sativa (japonica cultivar-group) chrom...   161   2e-41   
gb:AY092954_1574908 Arabidopsis thaliana unknown protein (At1g16...   150   9e-39   
gb:AC135422_1742291 Oryza sativa (japonica cultivar-group) chrom...   144   1e-33   
gb:AB016880_1513045 Arabidopsis thaliana genomic DNA, chromosome...   115   1e-27   
gb:BC080100_2561532 Xenopus laevis MGC84367 protein, mRNA (cDNA ...    83   4e-15   
gb:SPAC823_1718374 S.pombe chromosome I cosmid c823.                   82   1e-14   
gb:AB088396_1872135 Homo sapiens CAB2 mRNA for CAB2, complete cds.     79   9e-14   
gb:AX119063_1461589 Sequence 227 from Patent WO0129221.>gb:AY358...    79   9e-14   
gb:AE013599_1130260 Drosophila melanogaster chromosome 2R, compl...    70   4e-11   
gb:AE013599_1130259 Drosophila melanogaster chromosome 2R, compl...    70   4e-11   
gb:CR382137_1670616 Debaryomyces hansenii chromosome E of strain...    66   5e-10   
gb:CR382123_1655553 Kluyveromyces lactis strain NRRL Y-1140 chro...    65   8e-10   
gb:CR382130_1663369 Yarrowia lipolytica chromosome D of strain C...    62   9e-09   
gb:AE016819_1749514 Ashbya gossypii (= Eremothecium gossypii) AT...    62   1e-08   
gb:AX136267_1462012 Sequence 189 from Patent EP1067182.>gb:AK075...    57   3e-07   
gb:CR380959_1654164 Candida glabrata strain CBS138 chromosome M ...    55   8e-07   
gb:CR382137_1670559 Debaryomyces hansenii chromosome E of strain...    55   1e-06   
sp|P25625|YCT4_YEAST|YCT4_YEAST Hypothetical 42.5 kDa protein in TSM1-ARE1 ...    53   5e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017343_1755252 Cryptococcus neoformans var. neoformans JEC2...    52   1e-05   
pir|T33303|T33303 hypothetical protein R01B10.4 - Caenorhabditis...    45   8e-04   Caenorhabditis elegans [roundworm]
gb:OSJN00263_1697612 Oryza sativa genomic DNA, chromosome 4, BAC...    32   7.3     
gb:U97012_1407094 Caenorhabditis elegans cosmid C04E6, complete ...    32   9.5     
gb:AE016941_362912 Bacteroides thetaiotaomicron VPI-5482, sectio...    32   9.5     
pir|T25507|T25507 hypothetical protein C04E6.6 - Caenorhabditis ...    32   9.5     Caenorhabditis elegans [roundworm]


>gb:AY093731_1575391 Arabidopsis thaliana AT5g62130/mtg10_150 mRNA,
           complete cds.>gb:AF410293_1797107 Arabidopsis thaliana
           AT5g62130/mtg10_150 mRNA, complete cds.
          Length = 343

 Score =  196 bits (498), Expect(2) = 9e-52
 Identities = 84/129 (65%), Positives = 103/129 (79%)
 Frame = +3

Query: 219 VLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY 398
           VLL  + S + + L AS+GD+D +YK CV QC+K+GCVG  CFQHC FS+ G  IDGPWY
Sbjct: 8   VLLIIVVSCLVSTLEASEGDSDSLYKSCVDQCQKTGCVGDTCFQHCKFSADGKAIDGPWY 67

Query: 399 LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVAL 578
           +QEPLYL+WKQWDC SDC+Y CM+ REEER++ G +P KY GKWP + VYGIQEPVSVA 
Sbjct: 68  MQEPLYLRWKQWDCQSDCQYECMMTREEERKRNGERPTKYFGKWPLKHVYGIQEPVSVAF 127

Query: 579 SALNLAIQF 605
           SAL+LA+QF
Sbjct: 128 SALDLAMQF 136



 Score = 30.0 bits (66), Expect(2) = 9e-52
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = +1

Query: 610 GWVSFFILINYKLP 651
           GWVS+FIL+ YKLP
Sbjct: 138 GWVSYFILVYYKLP 151



>pir|H86300|H86300 F19K19.12 protein - Arabidopsis
           thaliana>gb:AE005172_890636 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC011808_1537475 Arabidopsis thaliana
           chromosome I BAC F19K19 genomic sequence, complete
           sequence.
          Length = 342

 Score =  181 bits (458), Expect(2) = 6e-48
 Identities = 85/143 (59%), Positives = 97/143 (67%), Gaps = 1/143 (0%)
 Frame = +3

Query: 201 MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP 380
           MA      LF L   +F + NAS GDADP Y+ CV +CE SGCVG  CF  CN SS G  
Sbjct: 1   MAVHYWTALFLLLPCLFCISNASAGDADPDYRTCVSECEISGCVGQLCFPQCNSSSDG-- 58

Query: 381 IDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQE 560
             GPWY+QEPLYL+WK+W C  DCRY CM+ RE ER+ LG  PVKYHGKWPF+RV GIQE
Sbjct: 59  --GPWYIQEPLYLQWKKWGCQGDCRYQCMVNRETERETLGQAPVKYHGKWPFKRVLGIQE 116

Query: 561 PVSVALSALNLAIQF-PWLGILL 626
           P SVA S LNLA+ F  WL   +
Sbjct: 117 PASVAFSVLNLAMHFHGWLSFFI 139



 Score = 32.7 bits (73), Expect(2) = 6e-48
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = +1

Query: 607 HGWVSFFILINYKLP 651
           HGW+SFFI+I YKLP
Sbjct: 132 HGWLSFFIMIYYKLP 146



>gb:AE016959_1023516 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078894_1541585
           Oryza sativa chromosome 10 BAC OSJNBa0096G08 genomic
           sequence, complete sequence.>gb:AE017113_1753335 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           67 of 77 of the complete sequence.
          Length = 347

 Score =  161 bits (408), Expect(2) = 2e-41
 Identities = 69/130 (53%), Positives = 92/130 (70%), Gaps = 1/130 (0%)
 Frame = +3

Query: 240 SSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYL 419
           +++ A L AS+GDADP+Y+ CV +CEK+G +     +HC   +  +P D  WY  EPLYL
Sbjct: 18  AAVVATLGASEGDADPLYRACVDECEKTGSLRETSVRHCQVPTDDHPADKSWYAHEPLYL 77

Query: 420 KWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALSALNLAI 599
           +WK+W+C S+CRYHCM+ RE ER++LGL  VKYHGKWP +R    QEP+S ALSAL+L +
Sbjct: 78  QWKEWNCKSECRYHCMMERESEREQLGLGSVKYHGKWPMKRASVFQEPISAALSALSLLV 137

Query: 600 QF-PWLGILL 626
           QF  WL   L
Sbjct: 138 QFNGWLSFFL 147



 Score = 30.4 bits (67), Expect(2) = 2e-41
 Identities = 10/15 (66%), Positives = 15/15 (100%)
 Frame = +1

Query: 607 HGWVSFFILINYKLP 651
           +GW+SFF+L++YKLP
Sbjct: 140 NGWLSFFLLLSYKLP 154



>gb:AY092954_1574908 Arabidopsis thaliana unknown protein
           (At1g16560) mRNA, complete cds.>gb:AY114550_1578592
           Arabidopsis thaliana unknown protein (At1g16560) mRNA,
           complete cds.
          Length = 156

 Score =  150 bits (378), Expect(2) = 9e-39
 Identities = 68/109 (62%), Positives = 78/109 (71%), Gaps = 1/109 (0%)
 Frame = +3

Query: 303 VQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREE 482
           + +CE SGCVG  CF  CN SS G    GPWY+QEPLYL+WK+W C  DCRY CM+ RE 
Sbjct: 10  ITECEISGCVGQLCFPQCNSSSDG----GPWYIQEPLYLQWKKWGCQGDCRYQCMVNRET 65

Query: 483 ERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALSALNLAIQF-PWLGILL 626
           ER+ LG  PVKYHGKWPF+RV GIQEP SVA S LNLA+ F  WL   +
Sbjct: 66  ERETLGQAPVKYHGKWPFKRVLGIQEPASVAFSVLNLAMHFHGWLSFFI 114



 Score = 32.7 bits (73), Expect(2) = 9e-39
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = +1

Query: 607 HGWVSFFILINYKLP 651
           HGW+SFFI+I YKLP
Sbjct: 107 HGWLSFFIMIYYKLP 121



>gb:AC135422_1742291 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0043H23, complete
           sequence.>gb:AC146716_1744605 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone B1003C08, complete
           sequence.
          Length = 349

 Score =  144 bits (363), Expect = 1e-33
 Identities = 68/134 (50%), Positives = 87/134 (64%), Gaps = 4/134 (2%)
 Frame = +3

Query: 246 IFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP---IDGPWYLQEPLY 416
           +   ++AS GD DP Y+ CV++C  +G +G     HC   S GN    +   WY QEPLY
Sbjct: 21  VLGSVDASLGDVDPQYRTCVEECHTTGIIGENIISHCQ--SPGNDDASVGSSWYTQEPLY 78

Query: 417 LKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALSALNLA 596
           ++WKQ +C++DCRY+CM+ RE ERQ  GL PVKYHGKWPF RV   QEP+S ALSA+NL 
Sbjct: 79  MQWKQLNCMNDCRYYCMMQREGERQSRGLNPVKYHGKWPFIRVSVFQEPLSAALSAVNLL 138

Query: 597 IQFP-WLGILLHSN 635
           + F  WL   L  N
Sbjct: 139 MHFTGWLSFFLLVN 152



 Score = 32.3 bits (72), Expect = 7.3
 Identities = 11/14 (78%), Positives = 14/14 (100%)
 Frame = +1

Query: 610 GWVSFFILINYKLP 651
           GW+SFF+L+NYKLP
Sbjct: 143 GWLSFFLLVNYKLP 156



>gb:AB016880_1513045 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MTG10.
          Length = 276

 Score =  115 bits (289), Expect(2) = 1e-27
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +3

Query: 399 LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVAL 578
           +QEPLYL+WKQWDC SDC+Y CM+ REEER++ G +P KY GKWP + VYGIQEPVSVA 
Sbjct: 1   MQEPLYLRWKQWDCQSDCQYECMMTREEERKRNGERPTKYFGKWPLKHVYGIQEPVSVAF 60

Query: 579 SALNLAIQF 605
           SAL+LA+QF
Sbjct: 61  SALDLAMQF 69



 Score = 30.0 bits (66), Expect(2) = 1e-27
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = +1

Query: 610 GWVSFFILINYKLP 651
           GWVS+FIL+ YKLP
Sbjct: 71  GWVSYFILVYYKLP 84



>gb:BC080100_2561532 Xenopus laevis MGC84367 protein, mRNA (cDNA
           clone MGC:84367 IMAGE:6958951), complete cds.
          Length = 317

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 43/112 (38%), Positives = 60/112 (53%)
 Frame = +3

Query: 255 VLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQW 434
           V++AS GD +P+Y+ CV  C+++ C G   F+  +F +           Q+PLY++   W
Sbjct: 12  VVSASRGDREPVYRDCVTVCDQNNCTG---FRLRDFRA-----------QQPLYMRLTGW 57

Query: 435 DCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALSALN 590
            CL DCRY CM        K G +  ++HGKWPF R    QEP S   S LN
Sbjct: 58  TCLDDCRYKCMWYTVSLYLKEGHEVPQFHGKWPFSRFLFFQEPASALASFLN 109



>gb:SPAC823_1718374 S.pombe chromosome I cosmid c823.
          Length = 331

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 50/129 (38%), Positives = 66/129 (51%), Gaps = 2/129 (1%)
 Frame = +3

Query: 225 LFALFS--SIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWY 398
           +F LF+  S+F  ++AS GD  P+Y  CV +C ++ C              GNP D    
Sbjct: 9   IFFLFTALSLFRQISASAGDLHPVYVSCVNRCIENKC-------------HGNPSDTS-- 53

Query: 399 LQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVAL 578
            + PL LK  +WDC S+C Y C +  E       L   +YHGKW F RV+GIQE  SV  
Sbjct: 54  -KLPLDLKLFRWDCGSNCGYECEITAENYFAAHNLPSQQYHGKWYFIRVFGIQELFSVFF 112

Query: 579 SALNLAIQF 605
           S LN  I +
Sbjct: 113 SMLNFMIHY 121



>gb:AB088396_1872135 Homo sapiens CAB2 mRNA for CAB2, complete cds.
          Length = 319

 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 46/126 (36%), Positives = 61/126 (48%)
 Frame = +3

Query: 213 RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP 392
           RLVLL    +   A+ + S GD +P+Y+ CV QCE+  C G     H  F S        
Sbjct: 7   RLVLL----AGAAALASGSQGDREPVYRDCVLQCEEQNCSG-GALNH--FRS-------- 51

Query: 393 WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSV 572
              ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R    QEP S 
Sbjct: 52  ---RQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASA 108

Query: 573 ALSALN 590
             S LN
Sbjct: 109 VASFLN 114



>gb:AX119063_1461589 Sequence 227 from Patent
           WO0129221.>gb:AY358437_1947316 Homo sapiens clone
           DNA59619 AGLA546 (UNQ546) mRNA, complete
           cds.>gb:BC010652_1972740 Homo sapiens per1-like domain
           containing 1, mRNA (cDNA clone MGC:9753 IMAGE:3855206),
           complete cds.
          Length = 320

 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 46/126 (36%), Positives = 61/126 (48%)
 Frame = +3

Query: 213 RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP 392
           RLVLL    +   A+ + S GD +P+Y+ CV QCE+  C G     H  F S        
Sbjct: 7   RLVLL----AGAAALASGSQGDREPVYRDCVLQCEEQNCSG-GALNH--FRS-------- 51

Query: 393 WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSV 572
              ++P+Y+    W C  DC+Y CM        + G K  ++HGKWPF R    QEP S 
Sbjct: 52  ---RQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWPFSRFLFFQEPASA 108

Query: 573 ALSALN 590
             S LN
Sbjct: 109 VASFLN 114



>gb:AE013599_1130260 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003790_1224629 Drosophila melanogaster
           chromosome 2R, section 7 of 74 of the complete sequence.
          Length = 326

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 2/135 (1%)
 Frame = +3

Query: 201 MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP 380
           M+ R L  +  L  ++     AS+GD    +  C Q CE++ C           S+ G  
Sbjct: 1   MSSRSLSAIVLLLGALVTACLASNGDRTQFFHNCRQNCERTNC-----------SADGLE 49

Query: 381 ID--GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGI 554
           I      + Q+ ++ +  QW C  +C+Y CM        + G    +++GKWPF R+ G+
Sbjct: 50  IQEQAVKFYQQSVFDRLFQWSCADECQYGCMWRTVFAFFERGWPIPQFYGKWPFLRLLGM 109

Query: 555 QEPVSVALSALNLAI 599
           QEP SV  S LN  +
Sbjct: 110 QEPASVIFSCLNFVV 124



>gb:AE013599_1130259 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003790_1224628 Drosophila melanogaster
           chromosome 2R, section 7 of 74 of the complete
           sequence.>gb:AY069668_1294398 Drosophila melanogaster
           LD44494 full length cDNA.
          Length = 330

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 40/135 (29%), Positives = 63/135 (46%), Gaps = 2/135 (1%)
 Frame = +3

Query: 201 MAPRRLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNP 380
           M+ R L  +  L  ++     AS+GD    +  C Q CE++ C           S+ G  
Sbjct: 1   MSSRSLSAIVLLLGALVTACLASNGDRTQFFHNCRQNCERTNC-----------SADGLE 49

Query: 381 ID--GPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGI 554
           I      + Q+ ++ +  QW C  +C+Y CM        + G    +++GKWPF R+ G+
Sbjct: 50  IQEQAVKFYQQSVFDRLFQWSCADECQYGCMWRTVFAFFERGWPIPQFYGKWPFLRLLGM 109

Query: 555 QEPVSVALSALNLAI 599
           QEP SV  S LN  +
Sbjct: 110 QEPASVIFSCLNFVV 124



>gb:CR382137_1670616 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 395

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 44/142 (30%), Positives = 63/142 (44%), Gaps = 13/142 (9%)
 Frame = +3

Query: 213 RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVG--VKCFQHCNFSSGGNPID 386
           R+  +   F      +  S GD   +++ C  QCE+  C       FQ       G+  D
Sbjct: 5   RITYVLVYFQLFIGCIICSPGDDLYMFQECRYQCEQIICHKRPYHIFQRMILDELGS--D 62

Query: 387 GPWYLQE-----------PLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWP 533
           G + +             PL+LK   WDC+ +C Y C     +ER K   +  ++HGKWP
Sbjct: 63  GEYEIHAYNENWEFSSLLPLHLKLLGWDCVLNCDYECQRIVTKERCKNNQEICQFHGKWP 122

Query: 534 FQRVYGIQEPVSVALSALNLAI 599
           F RV+GIQE  SV  S  N  +
Sbjct: 123 FLRVFGIQEFASVIFSIGNYMV 144



>gb:CR382123_1655553 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 344

 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 41/123 (33%), Positives = 53/123 (43%), Gaps = 3/123 (2%)
 Frame = +3

Query: 231 ALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNF---SSGGNPIDGPWYL 401
           A  S    V  AS GD  P +  CV+ CE          +HC         NP     + 
Sbjct: 9   ACLSFFVYVSLASPGDRLPEFSDCVRACE--------VVRHCTDRFEEDSFNPFINEQFS 60

Query: 402 QEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALS 581
           +  L  K   WDC SDC Y C      +R++      ++HGKWPF+RV G+QE  S   S
Sbjct: 61  EPALVYKALLWDCTSDCDYQCQQKITLDREERNEDIYQFHGKWPFKRVLGMQEFYSTIFS 120

Query: 582 ALN 590
             N
Sbjct: 121 ICN 123



>gb:CR382130_1663369 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 313

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 39/124 (31%), Positives = 50/124 (40%)
 Frame = +3

Query: 264 ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPLYLKWKQWDCL 443
           AS GD  P ++ CV  C +  C   K                      PL  +   WDC 
Sbjct: 16  ASVGDRSPDFRNCVTNCIRHTCQTQKYVP-------------------PLMHRLLLWDCP 56

Query: 444 SDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALSALNLAIQFPWLGIL 623
            +C Y C       R   G + V++HGKWPF R +GIQE  SV  S  N    +    +L
Sbjct: 57  QECDYRCQQIITFARLNQGQEIVQFHGKWPFFRFFGIQELASVVFSLANFVPHYRGWLML 116

Query: 624 LHSN 635
            H N
Sbjct: 117 KHLN 120



>gb:AE016819_1749514 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 365

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 34/98 (34%), Positives = 47/98 (47%), Gaps = 4/98 (4%)
 Frame = +3

Query: 309 QCEKSGCVGVKCFQHCNFSSGGNPIDGPW----YLQEPLYLKWKQWDCLSDCRYHCMLAR 476
           +C +   V   C QH     G  P D P+    ++  P   +   WDC +DC Y C  A 
Sbjct: 39  ECNRVCRVRRGCEQHGG--EGAFPDDSPFAAYTFVDTPAAYRALLWDCSADCDYQCQQAI 96

Query: 477 EEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALSALN 590
             +R   G  PV++HGKWPF R+ G+QE  +   S  N
Sbjct: 97  THQRLLAGEPPVQFHGKWPFVRMLGMQEFFASLFSVAN 134



>gb:AX136267_1462012 Sequence 189 from Patent
           EP1067182.>gb:AK075474_1913128 Homo sapiens cDNA
           PSEC0168 fis, clone PLACE1011146.
          Length = 269

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 35/105 (33%), Positives = 50/105 (47%)
 Frame = +3

Query: 213 RLVLLFALFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGP 392
           RLVLL    +   A+ + S GD +P+Y+ CV QCE+  C G     H  F S        
Sbjct: 7   RLVLL----AGAAALASGSQGDREPVYRDCVLQCEEQNCSG-GALNH--FRS-------- 51

Query: 393 WYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGK 527
              ++P+Y+    W C  DC+Y CM        + G K  ++HGK
Sbjct: 52  ---RQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGK 93



>gb:CR380959_1654164 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 368

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 40/132 (30%), Positives = 57/132 (43%), Gaps = 13/132 (9%)
 Frame = +3

Query: 249 FAVLNA---SDGDADPIYKVCVQQCEKSG-CVG---------VKCFQHCNFSSGGNPIDG 389
           F + NA   S GD    +  C+  CE    C G            F + NF S    IDG
Sbjct: 10  FVLANAVVGSPGDQLDEFIDCICACEYDRKCAGSGINYIDPNTNEFHNVNFVS---MIDG 66

Query: 390 PWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVS 569
                  +  K   WDC+S+C Y C      +R +   K +++HGKWPF+++ G QE  +
Sbjct: 67  RKTFLSSMVSKATFWDCMSECDYECQQIITYDRIRKNKKILQFHGKWPFKKIMGFQEFFA 126

Query: 570 VALSALNLAIQF 605
              S  N   Q+
Sbjct: 127 SIFSIGNFIPQY 138



>gb:CR382137_1670559 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 399

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 41/148 (27%), Positives = 59/148 (39%), Gaps = 34/148 (22%)
 Frame = +3

Query: 264 ASDGDADPIYKVCVQQCEK-SGCVGVKCFQHC------------------------NFSS 368
           AS+GD  P ++ C+ QCEK   C      +H                         + +S
Sbjct: 15  ASEGDRLPGFQDCLLQCEKLMDCNHAAILEHIEAQQQQAEEDIEPVAQPMKPPHKRDVNS 74

Query: 369 GGNPIDGPWYLQEPLY----LKWK-----QWDCLSDCRYHCMLAREEERQKLGLKPVKYH 521
                + P YL +       L W      QWDC+ DC Y C      +R+  GL  V+++
Sbjct: 75  INEREELPQYLLKDFKGNYRLSWITRTVFQWDCMLDCDYKCQQFVTNQRELSGLPMVQFY 134

Query: 522 GKWPFQRVYGIQEPVSVALSALNLAIQF 605
           GKWPF R+ G+ E +    S  N    F
Sbjct: 135 GKWPFTRILGMTEVMLTLFSIGNYYTNF 162



>sp|P25625|YCT4_YEAST Hypothetical 42.5 kDa protein in TSM1-ARE1
           intergenic region.>pir|S19457|S19457 probable membrane
           protein YCR044c - yeast (Saccharomyces
           cerevisiae)>gb:SCCHRIII_1706889 S.cerevisiae chromosome
           III complete DNA sequence.
          Length = 357

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 27/61 (44%), Positives = 31/61 (50%)
 Frame = +3

Query: 408 PLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGIQEPVSVALSAL 587
           PLY K   WDC+SDC Y C       R     +  ++HGKWPF RV G QE  S   S  
Sbjct: 65  PLYSKLLFWDCISDCDYQCQHIITRWRIDEEEEIYQFHGKWPFLRVLGTQEFFSTIFSIG 124

Query: 588 N 590
           N
Sbjct: 125 N 125



>gb:AE017343_1755252 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 414

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 1/135 (0%)
 Frame = +3

Query: 198 PMAPRRLVLLFALFSSIFAVLN-ASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGG 374
           P++  RL +   + S I      AS GD +P ++ C++ C  + C               
Sbjct: 2   PISFSRLAIALGIASIILLPFAYASSGDRNPTFQHCLRGCAATYC--------------- 46

Query: 375 NPIDGPWYLQEPLYLKWKQWDCLSDCRYHCMLAREEERQKLGLKPVKYHGKWPFQRVYGI 554
           +P   P       YL+   W C  +C YHC  +  ++    G +  +++GKW F R+   
Sbjct: 47  DPSQPPI----AFYLRLFGWTCAENCAYHCSHSFTDKIGP-GSRYHQFYGKWAFYRLGPF 101

Query: 555 QEPVSVALSALNLAI 599
           QEP S+ +S  NL +
Sbjct: 102 QEPFSIIMSLGNLLV 116



>pir|T33303|T33303 hypothetical protein R01B10.4 - Caenorhabditis
           elegans>gb:AF068718_1238373 Caenorhabditis elegans
           cosmid R01B10, complete sequence.
          Length = 320

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 39/126 (30%), Positives = 50/126 (39%), Gaps = 6/126 (4%)
 Frame = +3

Query: 234 LFSSIFAVLNASDGDADPIYKVCVQQCEKSGCVGVKCFQHCNFSSGGNPIDGPWYLQEPL 413
           L  + F  L AS GD    Y+ C Q C            +C+   G              
Sbjct: 10  LLITCFVQLEASPGDRSIWYQECTQVCISK--------YNCSTKFGT------------- 48

Query: 414 YLKWKQWDCLSDCRYHCMLAREEE-RQKLGLKPVKYHGKWPFQRV-----YGIQEPVSVA 575
            L W + DC   CRY CM           G+ P ++HGKWPF  +     + IQEP S+ 
Sbjct: 49  -LDWARGDCFW-CRYDCMWDTIGHFDSNFGVVP-QFHGKWPFLAIPLPFGFIIQEPASMI 105

Query: 576 LSALNL 593
            S LNL
Sbjct: 106 FSLLNL 111



>gb:OSJN00263_1697612 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0083D01, complete sequence.
          Length = 1161

 Score = 32.3 bits (72), Expect = 7.3
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = -2

Query: 256 TAKIE-EKRAKSRTKRRGAIGASTVQEADGEESQKAKISSAFYSVNGEKRRNLAMASLTD 80
           T K+  ++R    +     IG S++QE +  E  K+K +S     NG+  R +++ +  D
Sbjct: 203 TTKVNRQERITDSSSIEQVIGTSSIQEMEANEKVKSKDTSKGNKDNGQSGRTISLDTKKD 262

Query: 79  ELPLKYKE 56
            + LKYK+
Sbjct: 263 -VNLKYKD 269



>gb:U97012_1407094 Caenorhabditis elegans cosmid C04E6, complete
           sequence.
          Length = 588

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 26/78 (33%), Positives = 34/78 (43%)
 Frame = -1

Query: 254 CKNRRKKSEEQNQTTRCHRCEHCTGGRWRRKSKG*NFERFLQCQRRKKAKSRYGIID**A 75
           CK  RK SEE     +   C+ C+  R + K KG +    +   RRK +KS     D   
Sbjct: 283 CKMCRKLSEEDESEEKEMACDLCSKSRRKGKKKGKSLRDGMVGGRRKSSKSSEDSDDHDD 342

Query: 74  SIEI*RESVQIGEFGGYE 21
           S+E        GE GG E
Sbjct: 343 SME--------GEGGGTE 352



>gb:AE016941_362912 Bacteroides thetaiotaomicron VPI-5482, section
           16 of 21 of the complete genome.>gb:AE015928_989400
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 529

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = -2

Query: 133 YSVNGEKRRNLAMASLTDELPLKYKERVCRLVSSADMKSIEDVS 2
           Y  NGEK R+LAMA      P+K K    R++     + I+ ++
Sbjct: 480 YKTNGEKERSLAMAEAVISKPMKIKTTTIRMMKREMEREIQKMN 523



>pir|T25507|T25507 hypothetical protein C04E6.6 - Caenorhabditis
           elegans
          Length = 518

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 26/78 (33%), Positives = 34/78 (43%)
 Frame = -1

Query: 254 CKNRRKKSEEQNQTTRCHRCEHCTGGRWRRKSKG*NFERFLQCQRRKKAKSRYGIID**A 75
           CK  RK SEE     +   C+ C+  R + K KG +    +   RRK +KS     D   
Sbjct: 232 CKMCRKLSEEDESEEKEMACDLCSKSRRKGKKKGKSLRDGMVGGRRKSSKSSEDSDDHDD 291

Query: 74  SIEI*RESVQIGEFGGYE 21
           S+E        GE GG E
Sbjct: 292 SME--------GEGGGTE 301


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 674,212,536
Number of Sequences: 1806583
Number of extensions: 13400680
Number of successful extensions: 40620
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 39165
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40590
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 35782545470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)