BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8012
         (806 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T02602|T02602 vacuolar sorting receptor protein homolog At2g...   519   e-146   Arabidopsis thaliana [mouse-ear cress]
gb:AC079634_1732667 Genomic Sequence for Oryza sativa, Nipponbar...   515   e-145   
gb:AE016959_1021991 Oryza sativa (japonica cultivar-group) chrom...   515   e-145   
pir|T06794|T06794 vacuolar sorting receptor protein BP-80 - gard...   514   e-145   Pisum sativum [garden pea]
gb:ATU79960_1557292 Arabidopsis thaliana vacuolar sorting recept...   506   e-142   
pir|T02604|T02604 probable vacuolar sorting receptor [imported] ...   506   e-142   Arabidopsis thaliana [mouse-ear cress]
gb:AY048289_1561750 Arabidopsis thaliana AT3g52850/F8J2_20 mRNA,...   480   e-134   
pir|T47542|T47542 Spot 3 protein and vacuolar sorting receptor h...   480   e-134   Arabidopsis thaliana [mouse-ear cress]
gb:ATU79959_1557291 Arabidopsis thaliana vacuolar sorting recept...   478   e-134   
pir|T00044|T00044 vacuolar sorting receptor protein homolog PV72...   474   e-133   
gb:AF161719_1773417 Triticum aestivum vacuolar targeting recepto...   474   e-132   
gb:AP005099_1847785 Oryza sativa (japonica cultivar-group) genom...   468   e-131   
pir|F84706|F84706 probable vacuolar sorting receptor [imported] ...   461   e-129   Arabidopsis thaliana [mouse-ear cress]
gb:AB056693_1521665 Vigna mungo VmVSR mRNA for vacuolar sorting ...   442   e-123   
gb:AP003628_1831708 Oryza sativa (japonica cultivar-group) genom...   440   e-122   
gb:AY136303_1581804 Arabidopsis thaliana vacuolar sorting recept...   438   e-122   
pir|T04895|T04895 vacuolar sorting receptor protein homolog F18F...   438   e-122   Arabidopsis thaliana [mouse-ear cress]
pir|G86434|G86434 protein F17F8.23 [imported] - Arabidopsis thal...   430   e-119   Arabidopsis thaliana [mouse-ear cress]
pir|T00476|T00476 probable vacuolar sorting receptor [imported] ...   420   e-116   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00088_1694688 Oryza sativa genomic DNA, chromosome 4, BAC...   407   e-113   
gb:AY017377_1558845 Physcomitrella patens EGF receptor-like prot...   325   6e-88   
gb:AY029172_1559206 Helianthus annuus EGF receptor-like protein ...   226   5e-58   
gb:HAN311314_1681463 Helianthus annuus partial elrs1 gene for pu...   187   2e-46   
gb:HAN311315_1681464 Helianthus annuus partial elrs2 gene for pu...   107   3e-22   
gb:AP001550_1821300 Oryza sativa (japonica cultivar-group) genom...    59   8e-08   
gb:AP003287_1827326 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:BC080278_2107731 Mus musculus cDNA clone MGC:90652 IMAGE:3035...    49   9e-05   
gb:AF209910_1777313 Prunus dulcis vacuolar sorting receptor prot...    49   1e-04   
gb:AY741664_2545837 Danio rerio You (you) mRNA, complete cds.          46   0.001   
gb:AF276425_2061238 Mus musculus EGF-related protein SCUBE1 (Scu...    46   0.001   
gb:AK041590_1166041 Mus musculus 3 days neonate thymus cDNA, RIK...    46   0.001   
gb:BC066066_2105700 Mus musculus cDNA clone MGC:91355 IMAGE:6850...    45   0.001   
gb:HS100N22_1996488 Human DNA sequence from clone RP1-100N22 on ...    45   0.001   
gb:AF525689_1906000 Homo sapiens signal peptide-CUB-EGF-like dom...    45   0.001   
gb:MMU400878_2121209 Mus musculus Ascl3 gene, Cegp1 gene, D7H11o...    44   0.004   
gb:AB121209_1201130 Marsupenaeus japonicus mjTSPa mRNA for throm...    44   0.004   
sp|O88281|EFL3_RAT|EFL3_RAT Multiple EGF-like-domain protein 3 precursor ...    43   0.008   Rattus norvegicus [brown rat]
gb:AB121210_1201131 Marsupenaeus japonicus mjTSPb mRNA for throm...    42   0.014   
gb:AE014188_968246 Plasmodium falciparum 3D7 chromosome 12, comp...    42   0.014   
gb:HSA400877_2004881 Homo sapiens ASCL3 gene, CEGP1 gene, C11orf...    41   0.023   
gb:AK131552_1918075 Homo sapiens cDNA FLJ16792 fis, clone TBAES2...    41   0.023   
gb:AK123039_1915289 Homo sapiens cDNA FLJ41044 fis, clone NT2RP7...    41   0.023   
gb:AX817305_1475874 Sequence 53 from Patent WO02081517.                41   0.030   
gb:AX817303_1475873 Sequence 51 from Patent WO02081517.                41   0.030   
gb:AX817295_1475869 Sequence 43 from Patent WO02081517.                41   0.030   
gb:AB121211_1201132 Marsupenaeus japonicus mjTSPc mRNA for throm...    40   0.040   
pir|S03430|QRRTLD LDL receptor precursor - rat                         40   0.040   
sp|P35952|LDLR_RAT|LDLR_RAT Low-density lipoprotein receptor precursor (L...    40   0.040   Rattus norvegicus [brown rat]
gb:BC019207_2092850 Mus musculus low density lipoprotein recepto...    40   0.067   
gb:AF425607_2065548 Mus musculus low density lipoprotein recepto...    40   0.067   
pir|I48623|QRMSLD LDL receptor precursor - mouse>gb:BC053041_210...    40   0.067   
sp|P35951|LDLR_MOUSE|LDLR_MOUSE Low-density lipoprotein receptor precursor ...    40   0.067   Mus musculus [mouse]
gb:AK092062_1913614 Homo sapiens cDNA FLJ34743 fis, clone MESAN2...    39   0.088   
gb:AX465489_1469112 Sequence 17 from Patent WO0214368.                 39   0.088   
gb:BC079849_2107672 Mus musculus signal peptide, CUB domain, EGF...    39   0.12    
gb:AY639609_2087071 Mus musculus signal peptide, CUB and EGF-lik...    39   0.12    
gb:CEY64G10A_1370862 Caenorhabditis elegans YAC Y64G10A, complet...    39   0.12    
pir|T27283|T27283 hypothetical protein Y64G10A.f - Caenorhabditi...    39   0.12    Caenorhabditis elegans [roundworm]
gb:AF452494_1902489 Homo sapiens CUB and EGF containing protein ...    39   0.15    
gb:AX676240_1473050 Sequence 11 from Patent WO02063009.                39   0.15    
gb:BC052263_1984775 Homo sapiens signal peptide, CUB domain, EGF...    38   0.26    
sp|P35950|LDLR_CRIGR|LDLR_CRIGR Low-density lipoprotein receptor precursor ...    38   0.26    Cricetulus griseus [Chinese hamsters]
gb:BX005301_2567003 Zebrafish DNA sequence from clone CH211-221N...    37   0.33    
gb:BT009890_2151278 Synthetic construct Homo sapiens low density...    37   0.33    
gb:AF217403_1890517 Homo sapiens low density lipoprotein recepto...    37   0.33    
gb:A44513_1449159 Sequence 3 from Patent WO9515379.                    37   0.33    
sp|P01130|LDLR_HUMAN|LDLR_HUMAN Low-density lipoprotein receptor precursor ...    37   0.33    Homo sapiens [man]
gb:AY466854_1951392 Macaca mulatta low density lipoprotein recep...    37   0.44    
gb:AL512413_1928452 Human DNA sequence from clone RP11-168F9 on ...    36   0.75    
gb:AX817299_1475871 Sequence 47 from Patent WO02081517.                36   0.75    
gb:AX817297_1475870 Sequence 45 from Patent WO02081517.                36   0.75    
gb:AC116963_1206849 Dictyostelium discoideum chromosome 2 map 46...    36   0.75    
sp|O75095|EFL3_HUMAN|EFL3_HUMAN Multiple EGF-like-domain protein 3 (Multipl...    36   0.75    Homo sapiens [man]
gb:AF146429_2477131 Danio rerio DeltaC (delC) mRNA, complete cds.      35   1.3     
gb:BC031166_2096989 Mus musculus stabilin 1, mRNA (cDNA clone IM...    35   1.7     
gb:AY007370_2073423 Rattus norvegicus hyaluronan receptor for en...    35   1.7     
gb:AB073317_2047490 Rattus norvegicus LRP13 mRNA for LDL recepto...    35   1.7     
gb:AB011533_2043664 Rattus norvegicus mRNA for MEGF7, partial cds.     35   1.7     
gb:AK096435_1914600 Homo sapiens cDNA FLJ39116 fis, clone NTONG2...    35   1.7     
gb:AB084910_1871989 Homo sapiens LRP10 mRNA for low density lipo...    35   1.7     
gb:AB011540_1864370 Homo sapiens mRNA for MEGF7, partial cds.          35   1.7     
gb:AY348869_1321760 Aedes aegypti lipophorin receptor mRNA, comp...    35   1.7     
gb:AF355595_1264970 Aedes aegypti lipophorin receptor mRNA, comp...    35   1.7     
gb:AE014296_1135180 Drosophila melanogaster chromosome 3L, compl...    35   1.7     
sp|Q8R4Y4|SBN1_MOUSE|SBN1_MOUSE Stabilin 1 precursor (FEEL-1 protein).>gb:A...    35   1.7     Mus musculus [mouse]
sp|Q9QYP1|LRP4_RAT|LRP4_RAT Low-density lipoprotein receptor-related prot...    35   1.7     Rattus norvegicus [brown rat]
sp|O75096|LRP4_HUMAN|LRP4_HUMAN Low-density lipoprotein receptor-related pr...    35   1.7     Homo sapiens [man]
gb:BTA550060_1436766 Bos taurus partial mRNA for putative hyalur...    34   2.8     
gb:AB022426_1408002 Sus scrofa mRNA for FXII, complete cds.            34   2.8     
pir|T08618|T08618 intrinsic factor-B12 receptor CUBILIN precurso...    34   2.8     Rattus norvegicus [brown rat]
pir|S45281|S45281 coagulation factor XIIa (EC 3.4.21.38) precurs...    34   2.8     Bos taurus [bovine]
sp|P98165|LDVR_CHICK|LDVR_CHICK Very low-density lipoprotein receptor precu...    34   2.8     Gallus gallus [bantam]
sp|P98140|FA12_BOVIN|FA12_BOVIN Coagulation factor XII precursor (EC 3.4.21...    34   2.8     Bos taurus [bovine]
gb:BC088911_2565963 Xenopus laevis hypothetical LOC496321, mRNA ...    34   3.7     
gb:AY218841_2519948 Danio rerio clone BUSM1-81J4 brahma protein-...    34   3.7     
sp|P35953|LDVR_RABIT|LDVR_RABIT Very low-density lipoprotein receptor precu...    34   3.7     Oryctolagus cuniculus [domestic rabbit]
gb:RATPATISS_2133338 Rat tissue-type plasminogen activator (t-PA...    33   4.8     
gb:HSU77720_2026132 Human transmembrane protein Jagged mRNA, par...    33   4.8     
gb:HSU61276_2025270 Human transmembrane protein Jagged 1 (HJ1) m...    33   4.8     
gb:AF003837_1875838 Homo sapiens Jagged1 (JAG1) mRNA, complete cds.    33   4.8     
gb:AF118147_1414462 Sus scrofa low density lipoprotein receptor ...    33   4.8     
gb:AF067952_1413422 Sus scrofa low density lipoprotein receptor ...    33   4.8     
gb:AF065990_1413412 Sus scrofa low density lipoprotein receptor ...    33   4.8     
sp|P19637|TPA_RAT|TPA_RAT Tissue-type plasminogen activator precursor (E...    33   4.8     Rattus norvegicus [brown rat]
sp|P78504|JAG1_HUMAN|JAG1_HUMAN Jagged 1 precursor (Jagged1) (hJ1).>gb:AF02...    33   4.8     Homo sapiens [man]
gb:BX883044_2111410 Rattus norvegicus chromosome 20, major histo...    33   6.3     
gb:BC047916_1984060 Homo sapiens signal peptide, CUB domain, EGF...    33   6.3     
gb:AK089330_1175894 Mus musculus B6-derived CD11 +ve dendritic c...    33   6.3     
gb:MUSMVLD_2129310 Mus musculus very low density lipoprotein rec...    33   8.2     
gb:BC013622_2091855 Mus musculus very low density lipoprotein re...    33   8.2     
gb:HUMVLDLRX_2038142 Human very low density lipoprotein receptor...    33   8.2     
gb:HUMVLDLR_2038139 Human very low density lipoprotein receptor ...    33   8.2     
gb:AY466855_1951393 Macaca mulatta very low density lipoprotein ...    33   8.2     
gb:AL450467_1928039 Human DNA sequence from clone RP11-320E16 on...    33   8.2     
gb:AK092381_1913690 Homo sapiens cDNA FLJ35062 fis, clone OCBBF2...    33   8.2     
gb:AY005132_1286031 Plasmodium yoelii merozoite surface protein ...    33   8.2     
gb:AB066246_1197130 Caenorhabditis elegans mRNA for ADT-1, compl...    33   8.2     
pir|T18856|T18856 angiogenesis inhibitor homolog - Caenorhabditi...    33   8.2     Caenorhabditis elegans [roundworm]
pir|I48952|I48952 VLDL receptor precursor, long splice form - mo...    33   8.2     Mus musculus [mouse]
sp|P98166|LDVR_RAT|LDVR_RAT Very low-density lipoprotein receptor precurs...    33   8.2     Rattus norvegicus [brown rat]
sp|P98156|LDVR_MOUSE|LDVR_MOUSE Very low-density lipoprotein receptor precu...    33   8.2     Mus musculus [mouse]
sp|P98155|LDVR_HUMAN|LDVR_HUMAN Very low-density lipoprotein receptor precu...    33   8.2     Homo sapiens [man]


>pir|T02602|T02602 vacuolar sorting receptor protein homolog At2g14740
            - Arabidopsis thaliana>gb:AC004705_1532124 Arabidopsis
            thaliana chromosome 2 clone F26C24 map mi398, complete
            sequence.>gb:AC005398_1532678 Arabidopsis thaliana
            chromosome 2 clone T6B13 map mi398, complete sequence.
          Length = 628

 Score =  519 bits (1336), Expect = e-146
 Identities = 226/268 (84%), Positives = 251/268 (93%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGG+T+F PHYITWYCP AFT+SRQCK QCIN GRYCAPDPEQDFSSGYDGKDVV+ENLR
Sbjct: 226  KGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCAPDPEQDFSSGYDGKDVVVENLR 285

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV+KVA ET KPW+WWDYVTDFQIRCPMKEKKYNKECAD VI SLG+D KK++ CMGD
Sbjct: 286  QLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKECADSVIKSLGIDSKKLDKCMGD 345

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P+AD DNPVLKEEQDAQ+GKGSRGDVTILPTLVVNNRQYRGKLEK AVLKA+C+GFEETT
Sbjct: 346  PDADLDNPVLKEEQDAQVGKGSRGDVTILPTLVVNNRQYRGKLEKSAVLKALCSGFEETT 405

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CL+ ++E+NECLDNNGGCWQDK+ANITACKDTFRGRVCECPTVDGVQFKGDGYS C
Sbjct: 406  EPAICLSTDVESNECLDNNGGCWQDKSANITACKDTFRGRVCECPTVDGVQFKGDGYSHC 465

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            +PSGPGRC +N+GGCWHE R+G ++SAC
Sbjct: 466  EPSGPGRCTINNGGCWHEERDGHAFSAC 493



>gb:AC079634_1732667 Genomic Sequence for Oryza sativa, Nipponbare
            strain, clone OSJNBa0045C13, from Chromosome 10, complete
            sequence.
          Length = 631

 Score =  515 bits (1327), Expect = e-145
 Identities = 222/268 (82%), Positives = 256/268 (95%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGY++FTPHYITWYCPQAF VS+QCK QCINHGRYCAPDPEQDFS+GY+GKDVV+ENLR
Sbjct: 228  KGGYSQFTPHYITWYCPQAFVVSKQCKSQCINHGRYCAPDPEQDFSTGYEGKDVVVENLR 287

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCVF+VAKE+KKPWIWWDYVTDF IRCPMK+KKYNK+CA+ VI SLGLD+KK++ CMGD
Sbjct: 288  QLCVFQVAKESKKPWIWWDYVTDFHIRCPMKDKKYNKKCAETVIKSLGLDVKKVDKCMGD 347

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            PNAD+D+P+LK EQDAQIGKGSRGDVTILPTLVVNNRQYRGKLE+ AVLKAICAGFEETT
Sbjct: 348  PNADSDHPLLKMEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLERKAVLKAICAGFEETT 407

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EP VCL++E+ETNECL++NGGCWQDK AN+TAC+DTFRGRVCECPT +GVQFKGDGYS+C
Sbjct: 408  EPNVCLSDEMETNECLNDNGGCWQDKAANVTACRDTFRGRVCECPTFNGVQFKGDGYSNC 467

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            +P+GPG+C +NHGGCWHETRNG+++SAC
Sbjct: 468  EPAGPGKCLINHGGCWHETRNGKTFSAC 495



>gb:AE016959_1021991 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC091666_1734870 Oryza sativa
            (japonica cultivar-group) chromosome 10 clone
            OSJNBb0078C13, complete sequence.>gb:AE017080_1751810
            Oryza sativa (japonica cultivar-group) chromosome 10,
            section 34 of 77 of the complete sequence.
          Length = 643

 Score =  515 bits (1327), Expect = e-145
 Identities = 222/268 (82%), Positives = 256/268 (95%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGY++FTPHYITWYCPQAF VS+QCK QCINHGRYCAPDPEQDFS+GY+GKDVV+ENLR
Sbjct: 228  KGGYSQFTPHYITWYCPQAFVVSKQCKSQCINHGRYCAPDPEQDFSTGYEGKDVVVENLR 287

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCVF+VAKE+KKPWIWWDYVTDF IRCPMK+KKYNK+CA+ VI SLGLD+KK++ CMGD
Sbjct: 288  QLCVFQVAKESKKPWIWWDYVTDFHIRCPMKDKKYNKKCAETVIKSLGLDVKKVDKCMGD 347

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            PNAD+D+P+LK EQDAQIGKGSRGDVTILPTLVVNNRQYRGKLE+ AVLKAICAGFEETT
Sbjct: 348  PNADSDHPLLKMEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLERKAVLKAICAGFEETT 407

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EP VCL++E+ETNECL++NGGCWQDK AN+TAC+DTFRGRVCECPT +GVQFKGDGYS+C
Sbjct: 408  EPNVCLSDEMETNECLNDNGGCWQDKAANVTACRDTFRGRVCECPTFNGVQFKGDGYSNC 467

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            +P+GPG+C +NHGGCWHETRNG+++SAC
Sbjct: 468  EPAGPGKCLINHGGCWHETRNGKTFSAC 495



>pir|T06794|T06794 vacuolar sorting receptor protein BP-80 - garden
            pea>gb:PSU79958_1702556 Pisum sativum BP-80 vacuolar
            sorting receptor mRNA, complete cds.
          Length = 623

 Score =  514 bits (1325), Expect = e-145
 Identities = 224/268 (83%), Positives = 252/268 (94%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGYT+FTPHYITWYCP AFT+S+QCK QCINHGRYCAPDPEQDF++GYDGKDVV+ENLR
Sbjct: 221  KGGYTQFTPHYITWYCPHAFTLSKQCKSQCINHGRYCAPDPEQDFNTGYDGKDVVVENLR 280

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCVFKVAKET+K W+WWDYVTDFQIRCPMKEKKYNKECA+ VI SLGLD++KI+ CMGD
Sbjct: 281  QLCVFKVAKETEKSWVWWDYVTDFQIRCPMKEKKYNKECANSVIKSLGLDVEKIDKCMGD 340

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            PNAD +N +LKEEQDAQIGKG+RGDVTILPTLVVNNRQYRGKLEKGAVLKAIC+GFEETT
Sbjct: 341  PNADTENSILKEEQDAQIGKGTRGDVTILPTLVVNNRQYRGKLEKGAVLKAICSGFEETT 400

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            +PAVCL+ ++ETNECL NNGGCWQDKTANI ACKDTFRGRVCECP VDGVQFKGDGY++C
Sbjct: 401  DPAVCLSNDVETNECLTNNGGCWQDKTANIAACKDTFRGRVCECPLVDGVQFKGDGYTTC 460

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            + SG GRCK+N+GGCWH+ RNG ++SAC
Sbjct: 461  EVSGHGRCKINNGGCWHDARNGHAFSAC 488



>gb:ATU79960_1557292 Arabidopsis thaliana vacuolar sorting receptor
            homolog mRNA, complete cds.
          Length = 630

 Score =  506 bits (1303), Expect = e-142
 Identities = 219/268 (81%), Positives = 249/268 (92%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGG+T+F PHYITWYCP AFT+SRQCK QCIN GRYCAPDPEQDFSSGYDGKDVV+ENLR
Sbjct: 228  KGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCAPDPEQDFSSGYDGKDVVVENLR 287

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV+KVA ET KPW+WWDYVTDFQIRCPMKEKKYNK+CA+ VI SLG+D +KI+ CMGD
Sbjct: 288  QLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKDCAESVIKSLGIDSRKIDKCMGD 347

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P+AD DNPVLKEEQDAQ+GKG+RGDVTILPTLVVNNRQYRGKLEK AVLKA+C+GFEE+T
Sbjct: 348  PDADLDNPVLKEEQDAQVGKGTRGDVTILPTLVVNNRQYRGKLEKSAVLKALCSGFEEST 407

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CL+ ++ETNECLDNNGGCWQDK+ANITACKDTFRG+VC CP VDGV+FKGDGYS C
Sbjct: 408  EPAICLSTDMETNECLDNNGGCWQDKSANITACKDTFRGKVCVCPIVDGVRFKGDGYSHC 467

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            +PSGPGRC +N+GGCWHE R+G ++SAC
Sbjct: 468  EPSGPGRCTINNGGCWHEERDGHAFSAC 495



>pir|T02604|T02604 probable vacuolar sorting receptor [imported] -
            Arabidopsis thaliana>gb:AC004705_1532126 Arabidopsis
            thaliana chromosome 2 clone F26C24 map mi398, complete
            sequence.>gb:AC005398_1532680 Arabidopsis thaliana
            chromosome 2 clone T6B13 map mi398, complete
            sequence.>gb:AY062744_1565400 Arabidopsis thaliana
            putative vacuolar sorting receptor (At2g14720; F26C24.14)
            mRNA, complete cds.>gb:BT008390_1639607 Arabidopsis
            thaliana At2g14720 gene, complete cds.
          Length = 628

 Score =  506 bits (1303), Expect = e-142
 Identities = 219/268 (81%), Positives = 249/268 (92%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGG+T+F PHYITWYCP AFT+SRQCK QCIN GRYCAPDPEQDFSSGYDGKDVV+ENLR
Sbjct: 226  KGGFTQFRPHYITWYCPHAFTLSRQCKSQCINKGRYCAPDPEQDFSSGYDGKDVVVENLR 285

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV+KVA ET KPW+WWDYVTDFQIRCPMKEKKYNK+CA+ VI SLG+D +KI+ CMGD
Sbjct: 286  QLCVYKVANETGKPWVWWDYVTDFQIRCPMKEKKYNKDCAESVIKSLGIDSRKIDKCMGD 345

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P+AD DNPVLKEEQDAQ+GKG+RGDVTILPTLVVNNRQYRGKLEK AVLKA+C+GFEE+T
Sbjct: 346  PDADLDNPVLKEEQDAQVGKGTRGDVTILPTLVVNNRQYRGKLEKSAVLKALCSGFEEST 405

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CL+ ++ETNECLDNNGGCWQDK+ANITACKDTFRG+VC CP VDGV+FKGDGYS C
Sbjct: 406  EPAICLSTDMETNECLDNNGGCWQDKSANITACKDTFRGKVCVCPIVDGVRFKGDGYSHC 465

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            +PSGPGRC +N+GGCWHE R+G ++SAC
Sbjct: 466  EPSGPGRCTINNGGCWHEERDGHAFSAC 493



>gb:AY048289_1561750 Arabidopsis thaliana AT3g52850/F8J2_20 mRNA,
            complete cds.
          Length = 623

 Score =  480 bits (1236), Expect = e-134
 Identities = 205/268 (76%), Positives = 241/268 (89%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGG+T+FTPHYITWYCP+AFT+S+QCK QCINHGRYCAPDPEQDF+ GYDGKDVV++NLR
Sbjct: 221  KGGHTQFTPHYITWYCPEAFTLSKQCKSQCINHGRYCAPDPEQDFTKGYDGKDVVVQNLR 280

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            Q CV++V  +T KPW+WWDYVTDF IRCPMKEKKY KECAD +I SLG+DLKK++ C+GD
Sbjct: 281  QACVYRVMNDTGKPWVWWDYVTDFAIRCPMKEKKYTKECADGIIKSLGIDLKKVDKCIGD 340

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P AD +NPVLK EQ++QIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKA+C+GF+E+T
Sbjct: 341  PEADVENPVLKAEQESQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAMCSGFQEST 400

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CL E++ETNECL+NNGGCWQDK ANITAC+DTFRGR+CECPTV GV+F GDGY+ C
Sbjct: 401  EPAICLTEDLETNECLENNGGCWQDKAANITACRDTFRGRLCECPTVQGVKFVGDGYTHC 460

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            K SG   C +N+GGCW E+R G +YSAC
Sbjct: 461  KASGALHCGINNGGCWRESRGGFTYSAC 488



>pir|T47542|T47542 Spot 3 protein and vacuolar sorting receptor
            homolog - Arabidopsis thaliana>gb:ATSPOT3PR_1554168
            A.thaliana mRNA for Spot 3 protein.>gb:ATU86700_1557353
            Arabidopsis thaliana EGF receptor like protein mRNA,
            complete cds.
          Length = 623

 Score =  480 bits (1236), Expect = e-134
 Identities = 205/268 (76%), Positives = 241/268 (89%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGG+T+FTPHYITWYCP+AFT+S+QCK QCINHGRYCAPDPEQDF+ GYDGKDVV++NLR
Sbjct: 221  KGGHTQFTPHYITWYCPEAFTLSKQCKSQCINHGRYCAPDPEQDFTKGYDGKDVVVQNLR 280

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            Q CV++V  +T KPW+WWDYVTDF IRCPMKEKKY KECAD +I SLG+DLKK++ C+GD
Sbjct: 281  QACVYRVMNDTGKPWVWWDYVTDFAIRCPMKEKKYTKECADGIIKSLGIDLKKVDKCIGD 340

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P AD +NPVLK EQ++QIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKA+C+GF+E+T
Sbjct: 341  PEADVENPVLKAEQESQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAMCSGFQEST 400

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CL E++ETNECL+NNGGCWQDK ANITAC+DTFRGR+CECPTV GV+F GDGY+ C
Sbjct: 401  EPAICLTEDLETNECLENNGGCWQDKAANITACRDTFRGRLCECPTVQGVKFVGDGYTHC 460

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            K SG   C +N+GGCW E+R G +YSAC
Sbjct: 461  KASGALHCGINNGGCWRESRGGFTYSAC 488



>gb:ATU79959_1557291 Arabidopsis thaliana vacuolar sorting receptor
            homolog mRNA, complete cds.
          Length = 623

 Score =  478 bits (1231), Expect = e-134
 Identities = 204/268 (76%), Positives = 240/268 (89%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGG+T+FTPHYITWYCP+AFT+S+QCK QCINHGRYCAPDPEQDF+ GYDGKDVV++NLR
Sbjct: 221  KGGHTQFTPHYITWYCPEAFTLSKQCKSQCINHGRYCAPDPEQDFTKGYDGKDVVVQNLR 280

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            Q CV++V  +T KPW+WWDYVTDF IRCPMKEKKY KECAD +I SLG+DLKK++ C+GD
Sbjct: 281  QACVYRVMNDTGKPWVWWDYVTDFAIRCPMKEKKYTKECADGIIKSLGIDLKKVDKCIGD 340

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P AD +NPVLK EQ++QIGKGSRGDVTILP LVVNNRQYRGKLEKGAVLKA+C+GF+E+T
Sbjct: 341  PEADVENPVLKAEQESQIGKGSRGDVTILPALVVNNRQYRGKLEKGAVLKAMCSGFQEST 400

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CL E++ETNECL+NNGGCWQDK ANITAC+DTFRGR+CECPTV GV+F GDGY+ C
Sbjct: 401  EPAICLTEDLETNECLENNGGCWQDKAANITACRDTFRGRLCECPTVQGVKFVGDGYTHC 460

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            K SG   C +N+GGCW E+R G +YSAC
Sbjct: 461  KASGALHCGINNGGCWRESRGGFTYSAC 488



>pir|T00044|T00044 vacuolar sorting receptor protein homolog PV72 -
            cucurbit>gb:AB006809_1510077 Cucurbita cv. Kurokawa
            Amakuri mRNA for PV72, complete cds.
          Length = 624

 Score =  474 bits (1221), Expect = e-133
 Identities = 203/266 (76%), Positives = 239/266 (89%)
 Frame = +1

Query: 7    GYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLRQL 186
            GYT+FTPHYITWYCP AFT+S+QCK QCINHGRYCAPDPEQDFS GYDGKDVV++NLRQ+
Sbjct: 225  GYTQFTPHYITWYCPDAFTLSKQCKTQCINHGRYCAPDPEQDFSKGYDGKDVVVQNLRQI 284

Query: 187  CVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGDPN 366
            C FKVA E+ KPW+WWD+VTDF IRCPMKEKKYN+ECA+EVI S G+DL KI++C+GDP 
Sbjct: 285  CFFKVANESGKPWLWWDFVTDFSIRCPMKEKKYNEECANEVIKSFGIDLNKIKDCIGDPE 344

Query: 367  ADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETTEP 546
            AD +NP+LK EQDAQIG+GSRGDVTILPTLV+NNRQYRGKL+KGAVLK IC+GF+ETTEP
Sbjct: 345  ADVENPILKAEQDAQIGRGSRGDVTILPTLVINNRQYRGKLDKGAVLKGICSGFQETTEP 404

Query: 547  AVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKP 726
            A+CL E++ETNECL NNGGCW DK ANI+AC+DTFRGRVCECPTV GV+F GDGY+ C+ 
Sbjct: 405  AICLTEDVETNECLTNNGGCWFDKEANISACRDTFRGRVCECPTVGGVKFVGDGYTHCEA 464

Query: 727  SGPGRCKLNHGGCWHETRNGRSYSAC 804
            SG  RC++N+GGCW  T +G++YSAC
Sbjct: 465  SGALRCEINNGGCWKGTHDGKTYSAC 490



>gb:AF161719_1773417 Triticum aestivum vacuolar targeting receptor
            bp-80 mRNA, complete cds.
          Length = 624

 Score =  474 bits (1219), Expect = e-132
 Identities = 204/266 (76%), Positives = 236/266 (88%)
 Frame = +1

Query: 7    GYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLRQL 186
            GYT+FTPHYITWYCP+AFTVS+QCK QCINHGRYCAPDPEQDFS GYDGKDVV++NL Q+
Sbjct: 221  GYTQFTPHYITWYCPEAFTVSKQCKSQCINHGRYCAPDPEQDFSKGYDGKDVVVQNLHQV 280

Query: 187  CVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGDPN 366
            CVFKVA +T KPW+WWDYV DF IRCPMKEKKY  ECA  VI SLGLD+ KI  C+GDP 
Sbjct: 281  CVFKVANDTGKPWLWWDYVHDFAIRCPMKEKKYTHECASHVIKSLGLDMDKINKCVGDPE 340

Query: 367  ADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETTEP 546
            AD +NP+LK EQDAQIG G RGDVTILPTLVVNNRQYRGKL+KGAVLKAIC+GFEETTEP
Sbjct: 341  ADEENPILKAEQDAQIGHGKRGDVTILPTLVVNNRQYRGKLDKGAVLKAICSGFEETTEP 400

Query: 547  AVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKP 726
            A+CL+E+++TNECL+N+GGCW DK  N+TACKDTFRGRVCECP V GV+F GDGY++C+ 
Sbjct: 401  AICLSEDVQTNECLENHGGCWVDKANNVTACKDTFRGRVCECPIVKGVKFVGDGYTNCEA 460

Query: 727  SGPGRCKLNHGGCWHETRNGRSYSAC 804
            SG GRC++N+GGCW ET+NG++ SAC
Sbjct: 461  SGVGRCEINNGGCWKETKNGKTISAC 486



>gb:AP005099_1847785 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OSJNBa0008J01.>gb:AP005243_1849395 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OJ1205_F02.
          Length = 626

 Score =  468 bits (1203), Expect = e-131
 Identities = 202/268 (75%), Positives = 237/268 (88%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            K GYT+FTPHYITWYCP+AF +S+QC+ QCINHGRYCAPDPEQDF+ GYDGKDVV++NL 
Sbjct: 222  KRGYTQFTPHYITWYCPEAFVLSKQCRSQCINHGRYCAPDPEQDFNIGYDGKDVVLQNLI 281

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            Q+C+FKV  ET KPW+WWDYV DF IRCPMKEKKY +ECA+ VI SLGLDL++I  C+GD
Sbjct: 282  QICLFKVGNETHKPWVWWDYVHDFSIRCPMKEKKYTRECANGVIKSLGLDLERINKCVGD 341

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P AD +NPVLK EQDAQIG+GSRGDVTILPTLVVNN+QYRGKLEK AVLKA+C+GFEETT
Sbjct: 342  PEADEENPVLKAEQDAQIGQGSRGDVTILPTLVVNNKQYRGKLEKSAVLKAVCSGFEETT 401

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EP VCL++EI+TNECL++NGGCWQDKT N TACKDTFRGRVCECP   GV+F GDGY+ C
Sbjct: 402  EPDVCLSQEIQTNECLESNGGCWQDKTNNFTACKDTFRGRVCECPIARGVKFVGDGYTHC 461

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            + SG GRC++N+GGCW ET+NG++ SAC
Sbjct: 462  EASGVGRCQINNGGCWKETKNGKTVSAC 489



>pir|F84706|F84706 probable vacuolar sorting receptor [imported] -
            Arabidopsis thaliana>gb:AC002338_1530485 Arabidopsis
            thaliana chromosome 2 clone T9D9 map m283, complete
            sequence.
          Length = 625

 Score =  461 bits (1186), Expect = e-129
 Identities = 198/268 (73%), Positives = 236/268 (88%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGYT FTPHYITWYCP+AF  SRQCK QCIN GRYCAPDPEQDFS GY+GKDV+I+NLR
Sbjct: 225  KGGYTRFTPHYITWYCPEAFLASRQCKTQCINGGRYCAPDPEQDFSRGYNGKDVIIQNLR 284

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            Q C F+V  E+ KPW+WWDYVTDF IRCPMKE+KYNK+CAD+VI SLG+D+KKI+ C+GD
Sbjct: 285  QACFFRVTNESGKPWLWWDYVTDFAIRCPMKEEKYNKKCADQVIQSLGVDVKKIDKCIGD 344

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
             +A+A+NPVLKEEQ AQ+GKGSRGDVTILPT+V+NNRQYRGKL++ AVLKA+C+GF ETT
Sbjct: 345  IDANAENPVLKEEQVAQVGKGSRGDVTILPTIVINNRQYRGKLQRSAVLKALCSGFRETT 404

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EP +CL E+IETNECL NNGGCW+DKT NITAC+DTFRGRVC+CP V GV+F GDGY+ C
Sbjct: 405  EPPICLTEDIETNECLQNNGGCWEDKTTNITACRDTFRGRVCQCPIVQGVKFLGDGYTHC 464

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            + SG  RC +N+GGCW +T+ G++YSAC
Sbjct: 465  EASGALRCGINNGGCWKQTQMGKTYSAC 492



>gb:AB056693_1521665 Vigna mungo VmVSR mRNA for vacuolar sorting
            receptor, complete cds.
          Length = 619

 Score =  442 bits (1138), Expect = e-123
 Identities = 192/266 (72%), Positives = 232/266 (87%)
 Frame = +1

Query: 7    GYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLRQL 186
            G+T+FTP YITW+CP+AF +S+QCK QCIN+GRYCAPDPEQDFSSGYDGKDVV++NLRQ 
Sbjct: 224  GFTQFTPRYITWFCPEAFLLSKQCKSQCINNGRYCAPDPEQDFSSGYDGKDVVVQNLRQA 283

Query: 187  CVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGDPN 366
            C +KVA E+ KPW WWDYVTDF IRCPMKEKKY +EC+D+VI SLG DLKKI++C+GDP+
Sbjct: 284  CFYKVANESGKPWQWWDYVTDFSIRCPMKEKKYTEECSDQVIKSLGADLKKIKDCIGDPH 343

Query: 367  ADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETTEP 546
            AD +NPVLK EQ+AQIGKG+RGDVTILPTLV+N+RQYRGKL + AVLKAICAGF ETTEP
Sbjct: 344  ADVENPVLKAEQEAQIGKGTRGDVTILPTLVINSRQYRGKLSRPAVLKAICAGFLETTEP 403

Query: 547  AVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKP 726
            +VCL  E+ET+ECL NNGGCW++K++NITAC+DTFRGRVCECP V  V+F GDGY+ C+ 
Sbjct: 404  SVCLTPEMETDECLVNNGGCWKEKSSNITACRDTFRGRVCECPVVQNVKFVGDGYTHCEA 463

Query: 727  SGPGRCKLNHGGCWHETRNGRSYSAC 804
            SG   C  N+GGCW  ++ GR+Y+AC
Sbjct: 464  SGTLSCDFNNGGCWKGSQGGRAYTAC 489



>gb:AP003628_1831708 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0473H04.
          Length = 637

 Score =  440 bits (1132), Expect = e-122
 Identities = 189/268 (70%), Positives = 227/268 (84%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            +GGY  FTPHYITWYCP+AF +++QCK QCINHGRYCAPDPEQDF  GY+GKDVV+ENLR
Sbjct: 236  RGGYALFTPHYITWYCPEAFKLTQQCKSQCINHGRYCAPDPEQDFGEGYEGKDVVVENLR 295

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV +VA ET +PW WWDYV D++IRC MKEKKY+K CA++V+ +LGL L K+  CMGD
Sbjct: 296  QLCVHRVANETGRPWAWWDYVMDYKIRCSMKEKKYSKGCAEDVVKALGLSLDKVLECMGD 355

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P AD DN VL +EQ+ QIG+GSRGDVTILPTLV+NN QYRGKLE+ AVLKA+CAGF+E T
Sbjct: 356  PEADTDNAVLAKEQEDQIGRGSRGDVTILPTLVINNVQYRGKLERTAVLKAVCAGFKEGT 415

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EP VCL+ +IETNECL  NGGCW+D+  N+TACKDTFRGRVCECP V+GVQ++GDGY  C
Sbjct: 416  EPRVCLSNDIETNECLHRNGGCWRDEKTNVTACKDTFRGRVCECPVVNGVQYEGDGYIGC 475

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            K  GPGRC +++GGCW ETR  +++SAC
Sbjct: 476  KAVGPGRCTVDNGGCWSETRGHQTFSAC 503



>gb:AY136303_1581804 Arabidopsis thaliana vacuolar sorting
            receptor-like protein (At4g20110) mRNA, complete
            cds.>gb:BT000395_1634673 Arabidopsis thaliana vacuolar
            sorting receptor-like protein (At4g20110) mRNA, complete
            cds.
          Length = 625

 Score =  438 bits (1127), Expect = e-122
 Identities = 189/268 (70%), Positives = 225/268 (83%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGYT FTPHYITW+CP  F  S  CK QCINHGRYCAPDPE +F  GY+GKDVV+ENLR
Sbjct: 224  KGGYTAFTPHYITWFCPFQFINSPHCKSQCINHGRYCAPDPEDNFREGYEGKDVVLENLR 283

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV +VA E+ +PW+WWDYVTDF  RC MKEKKY+ +CA+ VI SL L ++KI+ C+GD
Sbjct: 284  QLCVHRVANESSRPWVWWDYVTDFHSRCSMKEKKYSIDCAESVIKSLNLPIEKIKKCIGD 343

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P AD +N VL+ EQ +QIG+G+RGDVTILPTLV+NN QYRG+LE+ AVLKAICAGF ET+
Sbjct: 344  PEADTENQVLRTEQVSQIGRGNRGDVTILPTLVINNAQYRGRLERTAVLKAICAGFNETS 403

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CLN  +ETNECL+NNGGCWQD  ANITAC+DTFRGR+CECP V GVQ+KGDGY+SC
Sbjct: 404  EPAICLNTGLETNECLENNGGCWQDTKANITACQDTFRGRLCECPVVKGVQYKGDGYTSC 463

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
             P GP RC +N+GGCW +TRNG ++SAC
Sbjct: 464  TPYGPARCTMNNGGCWSDTRNGLTFSAC 491



>pir|T04895|T04895 vacuolar sorting receptor protein homolog F18F4.210
            - Arabidopsis thaliana>gb:ATCHRIV52_1545849 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            52.>gb:ATF18F4_1549154 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F18F4 (ESSA project).
          Length = 626

 Score =  438 bits (1127), Expect = e-122
 Identities = 189/268 (70%), Positives = 225/268 (83%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGYT FTPHYITW+CP  F  S  CK QCINHGRYCAPDPE +F  GY+GKDVV+ENLR
Sbjct: 224  KGGYTAFTPHYITWFCPFQFINSPHCKSQCINHGRYCAPDPEDNFREGYEGKDVVLENLR 283

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV +VA E+ +PW+WWDYVTDF  RC MKEKKY+ +CA+ VI SL L ++KI+ C+GD
Sbjct: 284  QLCVHRVANESSRPWVWWDYVTDFHSRCSMKEKKYSIDCAESVIKSLNLPIEKIKKCIGD 343

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P AD +N VL+ EQ +QIG+G+RGDVTILPTLV+NN QYRG+LE+ AVLKAICAGF ET+
Sbjct: 344  PEADTENQVLRTEQVSQIGRGNRGDVTILPTLVINNAQYRGRLERTAVLKAICAGFNETS 403

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EPA+CLN  +ETNECL+NNGGCWQD  ANITAC+DTFRGR+CECP V GVQ+KGDGY+SC
Sbjct: 404  EPAICLNTGLETNECLENNGGCWQDTKANITACQDTFRGRLCECPVVKGVQYKGDGYTSC 463

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
             P GP RC +N+GGCW +TRNG ++SAC
Sbjct: 464  TPYGPARCTMNNGGCWSDTRNGLTFSAC 491



>pir|G86434|G86434 protein F17F8.23 [imported] - Arabidopsis
            thaliana>gb:AE005172_891945 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC000107_1530048 Genomic sequence for
            Arabidopsis thaliana BAC F17F8 from chromosome I,
            complete sequence.
          Length = 649

 Score =  430 bits (1105), Expect = e-119
 Identities = 190/295 (64%), Positives = 226/295 (76%), Gaps = 27/295 (9%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGY+ FTPHYITW+CP+ +  S QCK QCIN GRYCAPDPEQDF  GYDGKD+V ENLR
Sbjct: 223  KGGYSLFTPHYITWFCPKDYVSSNQCKSQCINQGRYCAPDPEQDFGDGYDGKDIVFENLR 282

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV KVAKE  + W+WWDYVTDF IRC MKEKKY+KECA+ V+ SLGL L KI+ C+GD
Sbjct: 283  QLCVHKVAKENNRSWVWWDYVTDFHIRCSMKEKKYSKECAERVVESLGLPLDKIKKCIGD 342

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P+A+ +N VLK EQ  Q+G+G RGDVTILPTL+VNN QYRGKLE+ AVLKAIC+GF+E T
Sbjct: 343  PDANVENEVLKAEQALQVGQGDRGDVTILPTLIVNNAQYRGKLERNAVLKAICSGFKERT 402

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACK-------------------------- 642
            EP +CL+ +IETNECL+ NGGCW+DK +N+TACK                          
Sbjct: 403  EPGICLSGDIETNECLEANGGCWEDKKSNVTACKVLRTDELKGLHFYRYLVSFIPKNGFY 462

Query: 643  -DTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKLNHGGCWHETRNGRSYSAC 804
             DTFRGRVCECP V+GVQ+KGDGY+SC+P GP RC +N GGCW ET+ G ++SAC
Sbjct: 463  QDTFRGRVCECPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSETKKGLTFSAC 517



>pir|T00476|T00476 probable vacuolar sorting receptor [imported] -
            Arabidopsis thaliana>gb:AC004238_1531566 Arabidopsis
            thaliana chromosome 2 clone F19I3 map ve016, complete
            sequence.>gb:BT004565_1637599 Arabidopsis thaliana
            At2g34940 gene, complete cds.
          Length = 618

 Score =  420 bits (1080), Expect = e-116
 Identities = 181/268 (67%), Positives = 221/268 (82%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            KGGYT F PHYI+W CP+   +S+QC+ QCIN GRYCA D +Q+F  GY+GKDVV ENLR
Sbjct: 222  KGGYTLFRPHYISWVCPKELLLSKQCRTQCINQGRYCALDTKQEFEDGYNGKDVVYENLR 281

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV KVAKE    W+WWDYVTDF IRC MKEKKY++ECA+ ++ SLGL L+KI+ C+GD
Sbjct: 282  QLCVHKVAKEKNTSWVWWDYVTDFNIRCSMKEKKYSRECAETIVESLGLSLEKIKKCIGD 341

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P+AD +N VLK E+  Q+G+ +RG VTI PTL++NN QYRGKLE+ AVLKAIC+GF+E T
Sbjct: 342  PDADVENEVLKAEEAFQLGQENRGIVTIFPTLMINNAQYRGKLERTAVLKAICSGFKERT 401

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EP++CLN +IETNECL  NGGCWQDK +N+TACKDTFRGRVCECP VDGVQ+KGDGY+SC
Sbjct: 402  EPSICLNSDIETNECLIENGGCWQDKRSNVTACKDTFRGRVCECPVVDGVQYKGDGYTSC 461

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            KP GP RC +N+G CW ETR G ++S+C
Sbjct: 462  KPYGPARCSMNNGDCWSETRKGLTFSSC 489



>gb:OSJN00088_1694688 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0085I10, complete
            sequence.>gb:OSJN00255_1697478 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBa0070C17, complete
            sequence.
          Length = 663

 Score =  407 bits (1047), Expect = e-113
 Identities = 174/268 (64%), Positives = 214/268 (79%)
 Frame = +1

Query: 1    KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
            K GY  FTPHYITW+CP AF  + QCK QC+N GRYCAPDP+ D ++GY G+DVV+ENLR
Sbjct: 228  KRGYALFTPHYITWFCPDAFLETTQCKAQCVNRGRYCAPDPDGDLAAGYSGRDVVLENLR 287

Query: 181  QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
            QLCV +VA      W+WWDYV D+ +RC MK   Y + CAD+V  SLGL +  I+ CMGD
Sbjct: 288  QLCVHRVANARNASWLWWDYVADYHLRCSMKGDHYTRRCADDVAKSLGLPMDLIDECMGD 347

Query: 361  PNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETT 540
            P+AD +N VLK EQ  Q+G G+RGDVTILPTLV+NN QYRGKLE  +VLKAICAGF+E+T
Sbjct: 348  PDADVENDVLKTEQIVQVGHGTRGDVTILPTLVINNVQYRGKLESTSVLKAICAGFKEST 407

Query: 541  EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
            EP VCL  E+ET+ECL+NNGGCW+D+  NITACKDTFRGR+C+CP VDGVQ++GDGY+ C
Sbjct: 408  EPDVCLTPEMETDECLNNNGGCWRDEKTNITACKDTFRGRICQCPVVDGVQYQGDGYTHC 467

Query: 721  KPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            K  GPGRC +N+GGCW  TR+G+++SAC
Sbjct: 468  KAVGPGRCAMNNGGCWKGTRDGKTFSAC 495



>gb:AY017377_1558845 Physcomitrella patens EGF receptor-like protein
           (ELP) mRNA, partial cds.
          Length = 360

 Score =  325 bits (833), Expect = 6e-88
 Identities = 142/223 (63%), Positives = 182/223 (81%), Gaps = 2/223 (0%)
 Frame = +1

Query: 142 GYDGKDVVIENLRQLCVFKVAKET--KKPWIWWDYVTDFQIRCPMKEKKYNKECADEVIN 315
           G  GK VV ENLRQLCVFKV  ET  ++PW WWD+VTDFQIRCPM+EKKY   CA+EVI 
Sbjct: 1   GTSGKQVVTENLRQLCVFKVTNETSPRQPWKWWDFVTDFQIRCPMEEKKYGPACAEEVIK 60

Query: 316 SLGLDLKKIENCMGDPNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEK 495
           SL +D++ +  CMG+P+AD +NP+L+ EQDAQ+G+G+RGDVT+LPTL+VN RQYRGKL+K
Sbjct: 61  SLSIDVEAVRKCMGNPDADEENPILRNEQDAQVGQGTRGDVTLLPTLIVNQRQYRGKLDK 120

Query: 496 GAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECP 675
            AVLKAIC+G++E+TEP VCL++ +ETNEC+DNNGGC   K+  +TAC+DTFRGR+C+CP
Sbjct: 121 TAVLKAICSGYQESTEPPVCLSDSVETNECMDNNGGCL--KSGTLTACQDTFRGRICQCP 178

Query: 676 TVDGVQFKGDGYSSCKPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            V GVQ +GDGY+ C+  G GRCK+ +GGCW +T+    YSAC
Sbjct: 179 LVSGVQLEGDGYTHCEVYGSGRCKVLNGGCWEDTKGDIRYSAC 221



>gb:AY029172_1559206 Helianthus annuus EGF receptor-like protein
           mRNA, partial cds.
          Length = 129

 Score =  226 bits (575), Expect = 5e-58
 Identities = 104/127 (81%), Positives = 114/127 (89%)
 Frame = +1

Query: 235 DYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGDPNADADNPVLKEEQDAQI 414
           D+VTDF IRCPMK+KKY KECADEVI SLG+DLKKI+ C+GD  AD DN VLK EQ+ QI
Sbjct: 3   DFVTDFSIRCPMKDKKYTKECADEVIKSLGIDLKKIDECVGDTEADTDNAVLKAEQETQI 62

Query: 415 GKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETTEPAVCLNEEIETNECLDN 594
           GKGSRGDVTILPTLV+NNRQYRGKL K AVLKAIC+GFEETTEPAVCL +EI+TNECLDN
Sbjct: 63  GKGSRGDVTILPTLVINNRQYRGKLAKQAVLKAICSGFEETTEPAVCLTDEIQTNECLDN 122

Query: 595 NGGCWQD 615
           NGGCWQD
Sbjct: 123 NGGCWQD 129



>gb:HAN311314_1681463 Helianthus annuus partial elrs1 gene for
           putative EGF receptor-like protein, exons 1-3.
          Length = 285

 Score =  187 bits (476), Expect = 2e-46
 Identities = 83/138 (60%), Positives = 102/138 (73%)
 Frame = +1

Query: 1   KGGYTEFTPHYITWYCPQAFTVSRQCKQQCINHGRYCAPDPEQDFSSGYDGKDVVIENLR 180
           K G+   TPHYI WYCP+ +T S +CK QCINHGRYCAPDPE+     Y  ++VV++NL 
Sbjct: 149 KMGHAIHTPHYIFWYCPEEYTSSDKCKSQCINHGRYCAPDPEEVLVRVY-WEEVVVQNLI 207

Query: 181 QLCVFKVAKETKKPWIWWDYVTDFQIRCPMKEKKYNKECADEVINSLGLDLKKIENCMGD 360
           Q C +KVA E+ KPW+WWDYVTDF  RC MKE KY++ECA EVI S G+D KKI+ C+GD
Sbjct: 208 QACFYKVANESGKPWLWWDYVTDFSTRCQMKEHKYDQECAHEVIKSFGVDTKKIDECVGD 267

Query: 361 PNADADNPVLKEEQDAQI 414
             AD +N VLK EQ AQ+
Sbjct: 268 TTADTENAVLKAEQHAQV 285



>gb:HAN311315_1681464 Helianthus annuus partial elrs2 gene for
           putative EGF receptor-like protein, exon 1.
          Length = 124

 Score =  107 bits (267), Expect = 3e-22
 Identities = 61/115 (53%), Positives = 74/115 (64%), Gaps = 1/115 (0%)
 Frame = +1

Query: 331 LKKIENCMGDPNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLK 510
           +KKI    G+  ADADN VLK+   A+IGKGS GDVTIL TLV+NNRQ+RGKL+      
Sbjct: 1   VKKINQYFGNTEADADNSVLKK---ARIGKGSCGDVTILLTLVINNRQHRGKLD------ 51

Query: 511 AICAG-FEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
            IC+G FE   EP VCL ++  TNECL NNGGCW  K   +    D  +  VC+C
Sbjct: 52  PICSGFFEGAIEPVVCLIDDTHTNECLKNNGGCWIIKKETLEDI-DRAKKMVCQC 105



>gb:AP001550_1821300 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0431F01.
          Length = 320

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 27/37 (72%), Positives = 31/37 (83%)
 Frame = +1

Query: 376 DNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGK 486
           +N VLK EQ  Q+G G+RGDVTILPTLV+NN QYRGK
Sbjct: 77  ENDVLKTEQIVQVGHGARGDVTILPTLVINNMQYRGK 113



>gb:AP003287_1827326 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0679C12.>gb:AP003611_1831321 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0423B08.
          Length = 209

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 28/65 (43%), Positives = 39/65 (60%)
 Frame = +1

Query: 376 DNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETTEPAVC 555
           +N VLK EQ  Q+  G+RGDVTILPTLV+NN QY           + C G E+ + P   
Sbjct: 129 ENNVLKTEQIVQVRHGARGDVTILPTLVINNVQYNLFCYDYNGEPSECGGVEDESFPDGA 188

Query: 556 LNEEI 570
           ++E++
Sbjct: 189 MDEQL 193



>gb:BC080278_2107731 Mus musculus cDNA clone MGC:90652
           IMAGE:30354974, complete cds.
          Length = 907

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 34/88 (38%), Positives = 43/88 (48%)
 Frame = +1

Query: 520 AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFK 699
           +GF  +     C++   ET  C  NNGGC  D+T     CKDT  G  C CP   G   +
Sbjct: 145 SGFFLSDNQHTCIHRSNET--CAVNNGGC--DRT-----CKDTATGVRCSCPV--GFTLQ 193

Query: 700 GDGYSSCKPSGPGRCKLNHGGCWHETRN 783
            DG  +CK      C +N+GGC H  RN
Sbjct: 194 PDG-KTCKDIN--ECLMNNGGCDHFCRN 218



>gb:AF209910_1777313 Prunus dulcis vacuolar sorting receptor protein
           mRNA, partial cds.
          Length = 159

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 16/24 (66%), Positives = 22/24 (91%)
 Frame = +1

Query: 733 PGRCKLNHGGCWHETRNGRSYSAC 804
           PGRCK+N+GGCWH+ R+G ++SAC
Sbjct: 1   PGRCKVNNGGCWHDARDGHAFSAC 24



 Score = 39.7 bits (91), Expect = 0.067
 Identities = 23/50 (46%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
 Frame = +1

Query: 583 CLDNNGGCWQDKTAN--ITACKDTFRGRV-CECPTVDGVQFKGDGYSSCK 723
           C  NNGGCW D       +AC D   G V C+CP      FKGDG  SC+
Sbjct: 4   CKVNNGGCWHDARDGHAFSACTD--NGEVQCQCPH----GFKGDGVKSCE 47



>gb:AY741664_2545837 Danio rerio You (you) mRNA, complete cds.
          Length = 1010

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 30/67 (44%), Positives = 34/67 (50%)
 Frame = +1

Query: 583 CLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKLNHGG 762
           C  NNGGC  D T     CKDT  G  C CP   G   + DG  SCK      C+L++GG
Sbjct: 269 CAVNNGGC--DST-----CKDTSTGVRCSCPV--GFTLQPDG-KSCKDID--ECELHNGG 316

Query: 763 CWHETRN 783
           C H  RN
Sbjct: 317 CDHYCRN 323



>gb:AF276425_2061238 Mus musculus EGF-related protein SCUBE1
           (Scube1) mRNA, complete cds.
          Length = 961

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 32/72 (44%), Positives = 37/72 (51%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC  D+T     CKDT  G  C CP   G   + DG  +CK      C 
Sbjct: 242 IET--CAVNNGGC--DRT-----CKDTATGVRCSCPV--GFTLQPDG-KTCKDIN--ECL 287

Query: 748 LNHGGCWHETRN 783
           +N+GGC H  RN
Sbjct: 288 MNNGGCDHFCRN 299



>gb:AK041590_1166041 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630023E24
           product:signal peptide, CUB domain, EGF-like 1, full
           insert sequence.
          Length = 992

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 32/72 (44%), Positives = 37/72 (51%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC  D+T     CKDT  G  C CP   G   + DG  +CK      C 
Sbjct: 242 IET--CAVNNGGC--DRT-----CKDTATGVRCSCPV--GFTLQPDG-KTCKDIN--ECL 287

Query: 748 LNHGGCWHETRN 783
           +N+GGC H  RN
Sbjct: 288 MNNGGCDHFCRN 299



>gb:BC066066_2105700 Mus musculus cDNA clone MGC:91355
           IMAGE:6850999, complete cds.
          Length = 1018

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 29/67 (43%), Positives = 34/67 (50%)
 Frame = +1

Query: 583 CLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKLNHGG 762
           C  NNGGC  D+T     CKDT  G  C CP   G   + DG  +CK      C +N+GG
Sbjct: 275 CAVNNGGC--DRT-----CKDTATGVRCSCPV--GFTLQPDG-KTCKDIN--ECLMNNGG 322

Query: 763 CWHETRN 783
           C H  RN
Sbjct: 323 CDHFCRN 329



>gb:HS100N22_1996488 Human DNA sequence from clone RP1-100N22 on
           chromosome 22q13.31-13.33, complete
           sequence.>gb:HS526I14_1998990 Human DNA sequence from
           clone RP3-526I14 on chromosome 22, complete sequence.
          Length = 988

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 32/72 (44%), Positives = 37/72 (51%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC  D+T     CKDT  G  C CP   G   + DG  +CK      C 
Sbjct: 242 IET--CAVNNGGC--DRT-----CKDTATGVRCSCPV--GFTLQPDG-KTCKDIN--ECL 287

Query: 748 LNHGGCWHETRN 783
           +N+GGC H  RN
Sbjct: 288 VNNGGCDHFCRN 299



>gb:AF525689_1906000 Homo sapiens signal peptide-CUB-EGF-like domain
           containing protein 1 (SCUBE1) mRNA, complete cds.
          Length = 988

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 32/72 (44%), Positives = 37/72 (51%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC  D+T     CKDT  G  C CP   G   + DG  +CK      C 
Sbjct: 242 IET--CAVNNGGC--DRT-----CKDTATGVRCSCPV--GFTLQPDG-KTCKDIN--ECL 287

Query: 748 LNHGGCWHETRN 783
           +N+GGC H  RN
Sbjct: 288 VNNGGCDHFCRN 299



>gb:MMU400878_2121209 Mus musculus Ascl3 gene, Cegp1 gene,
           D7H11orf14 gene, D7H11orf15 gene, D7H11orf16 gene and
           C11orf17 gene.
          Length = 997

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 31/98 (31%), Positives = 44/98 (44%)
 Frame = +1

Query: 490 EKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCE 669
           ++G VL+   +      +    +   +    C  NNGGC  D+T     CKDT  G  C 
Sbjct: 253 QEGTVLEGTESNATSVADGDKRVKRRLLMETCAVNNGGC--DRT-----CKDTSTGVHCS 305

Query: 670 CPTVDGVQFKGDGYSSCKPSGPGRCKLNHGGCWHETRN 783
           CPT  G   + DG  +CK      C+  +GGC H  +N
Sbjct: 306 CPT--GFTLQVDG-KTCKDI--DECQTRNGGCNHFCKN 338



 Score = 33.1 bits (74), Expect = 6.3
 Identities = 26/82 (31%), Positives = 34/82 (41%), Gaps = 10/82 (12%)
 Frame = +1

Query: 571 ETNECLDNNGGCWQDKTANITACKDTFRGRVCEC--------PTVDGVQFKGDGYSSCKP 726
           +TNEC  NNGGC Q        C +T     C+C           D V+ KG   +S  P
Sbjct: 401 DTNECSVNNGGCQQ-------VCINTVGSYECQCHPGFKLHWNKKDCVEVKGFPPTSMTP 453

Query: 727 SGPGRCKLNHGG--CWHETRNG 786
                C  + GG  C+   R+G
Sbjct: 454 RVSLHCGKSGGGDRCFLRCRSG 475



>gb:AB121209_1201130 Marsupenaeus japonicus mjTSPa mRNA for
           thrombospondin, complete cds.
          Length = 1114

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 32/82 (39%), Positives = 43/82 (52%)
 Frame = +1

Query: 520 AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFK 699
           AGF  T +  VC     + +ECL NNGGC  D+ AN   C++   GRVC+C       F 
Sbjct: 427 AGF--TGDGLVCK----DVDECLVNNGGC--DRNAN---CQNVPGGRVCKC----RAGFT 471

Query: 700 GDGYSSCKPSGPGRCKLNHGGC 765
           GDG +    S    C +++GGC
Sbjct: 472 GDGLAC---SDVDECLVSNGGC 490



 Score = 42.0 bits (97), Expect = 0.014
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +1

Query: 496 GAVLKAIC-AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           G V+   C AG+  T +   C     + +ECL NNGGC  D  AN   C++   GRVC+C
Sbjct: 336 GTVVTCTCKAGY--TGDGLTCT----DIDECLVNNGGC--DGNAN---CQNVPGGRVCKC 384

Query: 673 PTVDGVQFKGDGYSSCKPSGPGRCKLNHGGC 765
                  F GDG +    S    C +++GGC
Sbjct: 385 ----RAGFTGDGLAC---SDVDECLVSNGGC 408



>sp|O88281|EFL3_RAT Multiple EGF-like-domain protein 3 precursor
           (Multiple epidermal growth factor-like domains
           6).>pir|T13954|T13954 MEGF6 protein -
           rat>gb:AB011532_2043663 Rattus norvegicus mRNA for
           MEGF6, complete cds.
          Length = 1574

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/89 (31%), Positives = 40/89 (44%)
 Frame = +1

Query: 517 CAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQF 696
           C G+ +      CL++    +EC   NGGC          C +T  G  C CP   G Q 
Sbjct: 108 CPGWSQKPGQEGCLSD---VDECASANGGCEGP-------CCNTVGGFYCRCPP--GYQL 155

Query: 697 KGDGYSSCKPSGPGRCKLNHGGCWHETRN 783
           +GDG  +C+      C+ ++GGC H   N
Sbjct: 156 QGDG-KTCQDVD--ECRAHNGGCQHRCVN 181



>gb:AB121210_1201131 Marsupenaeus japonicus mjTSPb mRNA for
           thrombospondin, complete cds.
          Length = 1032

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +1

Query: 496 GAVLKAIC-AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           G V+   C AG+  T +   C     + +ECL NNGGC  D  AN   C++   GRVC+C
Sbjct: 336 GTVVTCTCKAGY--TGDGLTCT----DIDECLVNNGGC--DGNAN---CQNVPGGRVCKC 384

Query: 673 PTVDGVQFKGDGYSSCKPSGPGRCKLNHGGC 765
                  F GDG +    S    C +++GGC
Sbjct: 385 ----RAGFTGDGLAC---SDVDECLVSNGGC 408



>gb:AE014188_968246 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014851_1229638 Plasmodium
           falciparum 3D7 chromosome 12, section 8 of 9 of the
           complete sequence.
          Length = 442

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 35/175 (20%), Positives = 76/175 (43%), Gaps = 7/175 (4%)
 Frame = +1

Query: 91  INHGRYCAPDPEQDFSSGYDGKDVVIENLRQLCVFKVAKETKKPWIWWDYVTDFQIRCPM 270
           I    YC   P  D+ +    ++VV + +R LC++++             + D +     
Sbjct: 251 IRDSSYCISKP--DYMNSNVVREVVEQQVRSLCIYELT-----------LIDDIKSDIVQ 297

Query: 271 KEKKYN---KECADEVINSLGLDLKKIENCMGDPNADADNPVLKEEQDAQIGKGSRGDVT 441
            +  +N   K+C+D+++N L + +K +++C  +        ++K +              
Sbjct: 298 TDPDFNDLTKKCSDKILNILNVSVKDVDHCFLNNFHTYMKNMIKSK-------------F 344

Query: 442 ILPTLVVNNRQYRGKLEKGAVLKAICAGFEETTEPAVC----LNEEIETNECLDN 594
            + ++ +N++ Y+ KL K   +K IC+ F+    P  C     NE I+ +   +N
Sbjct: 345 YVYSITINDKTYKIKLNKDISIKLICSAFKNM--PKRCKDYLFNELIDADYVREN 397



>gb:HSA400877_2004881 Homo sapiens ASCL3 gene, CEGP1 gene, C11orf14
           gene, C11orf15 gene, C11orf16 gene and C11orf17 gene.
          Length = 999

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +1

Query: 583 CLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKLNHGG 762
           C  NNGGC  D+T     CKDT  G  C CP    +Q  G    +CK      C+  +GG
Sbjct: 286 CAVNNGGC--DRT-----CKDTSTGVHCSCPVGFTLQLDG---KTCKDI--DECQTRNGG 333

Query: 763 CWHETRN 783
           C H  +N
Sbjct: 334 CDHFCKN 340



>gb:AK131552_1918075 Homo sapiens cDNA FLJ16792 fis, clone
           TBAES2007379, moderately similar to Homo sapiens signal
           peptide, CUB domain, EGF-like 2 (SCUBE2).
          Length = 682

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +1

Query: 583 CLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKLNHGG 762
           C  NNGGC  D+T     CKDT  G  C CP    +Q  G    +CK      C+  +GG
Sbjct: 286 CAVNNGGC--DRT-----CKDTSTGVHCSCPVGFTLQLDG---KTCKDI--DECQTRNGG 333

Query: 763 CWHETRN 783
           C H  +N
Sbjct: 334 CDHFCKN 340



>gb:AK123039_1915289 Homo sapiens cDNA FLJ41044 fis, clone
           NT2RP7000466, highly similar to Mus musculus CUB domain
           and EGF-like repeat containing 1 (Cegf1).
          Length = 971

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 26/67 (38%), Positives = 32/67 (47%)
 Frame = +1

Query: 583 CLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKLNHGG 762
           C  NNGGC  D+T     CKDT  G  C CP    +Q  G    +CK      C+  +GG
Sbjct: 286 CAVNNGGC--DRT-----CKDTSTGVHCSCPVGFTLQLDG---KTCKDI--DECQTRNGG 333

Query: 763 CWHETRN 783
           C H  +N
Sbjct: 334 CDHFCKN 340



>gb:AX817305_1475874 Sequence 53 from Patent WO02081517.
          Length = 1577

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 27/89 (30%), Positives = 40/89 (44%)
 Frame = +1

Query: 517 CAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQF 696
           C G+ +  +   CL++     EC + NGGC          C+DT  G  C  P     Q 
Sbjct: 111 CRGWMQQPDEEGCLSD---VGECANANGGC-------AGRCRDTVGGFYCRWPP-PSHQL 159

Query: 697 KGDGYSSCKPSGPGRCKLNHGGCWHETRN 783
           +GDG  +C+      C+ ++GGC H   N
Sbjct: 160 QGDG-ETCQ--DVDECRTHNGGCQHRCVN 185



 Score = 36.2 bits (82), Expect = 0.75
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 481 GKLEKGAVLKAIC-AGFEETTEPAVCLNEEIE-TNECLDNNGGCWQDKTANITACKDTFR 654
           G L      K +C AG+E   +   C   E+E  N C  NNGGC          C  T  
Sbjct: 305 GCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSH-------GCSHTSA 357

Query: 655 GRVCECP 675
           G +C CP
Sbjct: 358 GPLCTCP 364



>gb:AX817303_1475873 Sequence 51 from Patent WO02081517.
          Length = 1403

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 27/89 (30%), Positives = 40/89 (44%)
 Frame = +1

Query: 517 CAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQF 696
           C G+ +  +   CL++     EC + NGGC          C+DT  G  C  P     Q 
Sbjct: 107 CRGWMQQPDEEGCLSD---VGECANANGGC-------AGRCRDTVGGFYCRWPP-PSHQL 155

Query: 697 KGDGYSSCKPSGPGRCKLNHGGCWHETRN 783
           +GDG  +C+      C+ ++GGC H   N
Sbjct: 156 QGDG-ETCQ--DVDECRTHNGGCQHRCVN 181



 Score = 36.2 bits (82), Expect = 0.75
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 481 GKLEKGAVLKAIC-AGFEETTEPAVCLNEEIE-TNECLDNNGGCWQDKTANITACKDTFR 654
           G L      K +C AG+E   +   C   E+E  N C  NNGGC          C  T  
Sbjct: 301 GCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSH-------GCSHTSA 353

Query: 655 GRVCECP 675
           G +C CP
Sbjct: 354 GPLCTCP 360



>gb:AX817295_1475869 Sequence 43 from Patent WO02081517.
          Length = 1404

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 27/89 (30%), Positives = 40/89 (44%)
 Frame = +1

Query: 517 CAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQF 696
           C G+ +  +   CL++     EC + NGGC          C+DT  G  C  P     Q 
Sbjct: 107 CRGWMQQPDEEGCLSD---VGECANANGGC-------AGRCRDTVGGFYCRWPP-PSHQL 155

Query: 697 KGDGYSSCKPSGPGRCKLNHGGCWHETRN 783
           +GDG  +C+      C+ ++GGC H   N
Sbjct: 156 QGDG-ETCQ--DVDECRTHNGGCQHRCVN 181



 Score = 36.2 bits (82), Expect = 0.75
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 481 GKLEKGAVLKAIC-AGFEETTEPAVCLNEEIE-TNECLDNNGGCWQDKTANITACKDTFR 654
           G L      K +C AG+E   +   C   E+E  N C  NNGGC          C  T  
Sbjct: 301 GCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSH-------GCSHTSA 353

Query: 655 GRVCECP 675
           G +C CP
Sbjct: 354 GPLCTCP 360



>gb:AB121211_1201132 Marsupenaeus japonicus mjTSPc mRNA for
           thrombospondin, complete cds.
          Length = 991

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 34/91 (37%), Positives = 44/91 (48%), Gaps = 1/91 (1%)
 Frame = +1

Query: 496 GAVLKAIC-AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           G V+   C AG+  T +   C     + +ECL NNGGC  D  AN   C++   GRVC+C
Sbjct: 336 GTVVTCTCKAGY--TGDGLTCT----DIDECLVNNGGC--DGNAN---CQNVPGGRVCKC 384

Query: 673 PTVDGVQFKGDGYSSCKPSGPGRCKLNHGGC 765
                  F GDG   CK      C + +GGC
Sbjct: 385 ----RAGFTGDGL-VCK--DVDECLVGNGGC 408



>pir|S03430|QRRTLD LDL receptor precursor - rat
          Length = 879

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPT----VDGVQ 693
           +E +TNECLDNNGGC          CKD   G  C CP+    VDG Q
Sbjct: 312 KECKTNECLDNNGGCSH-------ICKDLKIGYECLCPSGFRLVDGHQ 352



>sp|P35952|LDLR_RAT Low-density lipoprotein receptor precursor (LDL
           receptor).>gb:RNLDLR_2135171 Rat mRNA for LDL-receptor.
          Length = 879

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPT----VDGVQ 693
           +E +TNECLDNNGGC          CKD   G  C CP+    VDG Q
Sbjct: 312 KECKTNECLDNNGGCSH-------ICKDLKIGYECLCPSGFRLVDGHQ 352



>gb:BC019207_2092850 Mus musculus low density lipoprotein receptor,
           mRNA (cDNA clone MGC:29127 IMAGE:5052599), complete cds.
          Length = 862

 Score = 39.7 bits (91), Expect = 0.067
 Identities = 19/39 (48%), Positives = 22/39 (56%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPT 678
           +E +TNECLDNNGGC          CKD   G  C CP+
Sbjct: 312 KECKTNECLDNNGGCSH-------ICKDLKIGSECLCPS 343



>gb:AF425607_2065548 Mus musculus low density lipoprotein receptor
           mRNA, complete cds.
          Length = 862

 Score = 39.7 bits (91), Expect = 0.067
 Identities = 19/39 (48%), Positives = 22/39 (56%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPT 678
           +E +TNECLDNNGGC          CKD   G  C CP+
Sbjct: 312 KECKTNECLDNNGGCSH-------ICKDLKIGSECLCPS 343



>pir|I48623|QRMSLD LDL receptor precursor -
           mouse>gb:BC053041_2101405 Mus musculus low density
           lipoprotein receptor, mRNA (cDNA clone MGC:62289
           IMAGE:5704871), complete cds.>gb:MMLDLREC_2116267 Mus
           musculus mRNA for low density lipoprotein receptor
           precursor.
          Length = 862

 Score = 39.7 bits (91), Expect = 0.067
 Identities = 19/39 (48%), Positives = 22/39 (56%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPT 678
           +E +TNECLDNNGGC          CKD   G  C CP+
Sbjct: 312 KECKTNECLDNNGGCSH-------ICKDLKIGSECLCPS 343



>sp|P35951|LDLR_MOUSE Low-density lipoprotein receptor precursor
           (LDL receptor).>gb:MMLDLRMR_2116268 M.musculus Ldlr mRNA
           encoding low density lipoprotein receptor.
          Length = 864

 Score = 39.7 bits (91), Expect = 0.067
 Identities = 19/39 (48%), Positives = 22/39 (56%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPT 678
           +E +TNECLDNNGGC          CKD   G  C CP+
Sbjct: 312 KECKTNECLDNNGGCSH-------ICKDLKIGSECLCPS 343



>gb:AK092062_1913614 Homo sapiens cDNA FLJ34743 fis, clone
           MESAN2009019, moderately similar to CEGP1 protein.
          Length = 880

 Score = 39.3 bits (90), Expect = 0.088
 Identities = 25/74 (33%), Positives = 32/74 (43%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGR 741
           + +    C  NNGGC        + C D   G  C CP   G   + D   +CK      
Sbjct: 120 QAVSNETCAVNNGGC-------DSKCHDAATGVHCTCPV--GFMLQPDR-KTCKDID--E 167

Query: 742 CKLNHGGCWHETRN 783
           C+LN+GGC H  RN
Sbjct: 168 CRLNNGGCDHICRN 181



>gb:AX465489_1469112 Sequence 17 from Patent WO0214368.
          Length = 1006

 Score = 39.3 bits (90), Expect = 0.088
 Identities = 25/74 (33%), Positives = 32/74 (43%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGR 741
           + +    C  NNGGC        + C D   G  C CP   G   + D   +CK      
Sbjct: 284 QAVSNETCAVNNGGC-------DSKCHDAATGVHCTCPV--GFMLQPDR-KTCKDID--E 331

Query: 742 CKLNHGGCWHETRN 783
           C+LN+GGC H  RN
Sbjct: 332 CRLNNGGCDHICRN 345



>gb:BC079849_2107672 Mus musculus signal peptide, CUB domain,
           EGF-like 3, mRNA (cDNA clone IMAGE:5705946), partial
           cds.
          Length = 827

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/72 (38%), Positives = 33/72 (45%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC        + C D   G  C CP   G   + D   +CK      C+
Sbjct: 153 IET--CAVNNGGC-------DSKCHDAATGVHCSCPV--GFMLQPDR-KTCKDID--ECR 198

Query: 748 LNHGGCWHETRN 783
           LN+GGC H  RN
Sbjct: 199 LNNGGCDHICRN 210



>gb:AY639609_2087071 Mus musculus signal peptide, CUB and EGF-like
           domain containing protein 3 (SCUBE3) mRNA, complete cds.
          Length = 993

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/72 (38%), Positives = 33/72 (45%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC        + C D   G  C CP   G   + D   +CK      C+
Sbjct: 237 IET--CAVNNGGC-------DSKCHDAATGVHCSCPV--GFMLQPDR-KTCKDID--ECR 282

Query: 748 LNHGGCWHETRN 783
           LN+GGC H  RN
Sbjct: 283 LNNGGCDHICRN 294



>gb:CEY64G10A_1370862 Caenorhabditis elegans YAC Y64G10A, complete
           sequence.>gb:CEY67A10A_1370906 Caenorhabditis elegans
           YAC Y67A10A, complete sequence.
          Length = 1664

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 23/78 (29%), Positives = 33/78 (42%)
 Frame = +1

Query: 571 ETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKL 750
           + +EC  NNGGC Q        C +   G +C C    G +   DG+S         C +
Sbjct: 418 DISECSSNNGGCEQ-------ICSNQEGGYMCSCE--PGFELSEDGHSC---HDMNECLI 465

Query: 751 NHGGCWHETRNGRSYSAC 804
           N+GGC    +N +    C
Sbjct: 466 NNGGCAQLCKNRKGSRRC 483



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 22/67 (32%), Positives = 33/67 (49%)
 Frame = +1

Query: 565 EIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRC 744
           + + NEC+ NNGGC  +       C +T     C C    G +  GDG ++C  S    C
Sbjct: 114 QYDANECMANNGGCEHE-------CVNTIGTYYCRC--WPGFELSGDG-NTC--SDIDEC 161

Query: 745 KLNHGGC 765
            +++GGC
Sbjct: 162 AVSNGGC 168



 Score = 32.7 bits (73), Expect = 8.2
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%)
 Frame = +1

Query: 523 GFEETTEPAVCLNEE----IETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           G+  + EP   L+E+     + NECL NNGGC Q        CK+    R C+C
Sbjct: 439 GYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQ-------LCKNRKGSRRCQC 485



>pir|T27283|T27283 hypothetical protein Y64G10A.f - Caenorhabditis
           elegans
          Length = 1620

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 23/78 (29%), Positives = 33/78 (42%)
 Frame = +1

Query: 571 ETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKL 750
           + +EC  NNGGC Q        C +   G +C C    G +   DG+S         C +
Sbjct: 466 DISECSSNNGGCEQ-------ICSNQEGGYMCSCE--PGFELSEDGHSC---HDMNECLI 513

Query: 751 NHGGCWHETRNGRSYSAC 804
           N+GGC    +N +    C
Sbjct: 514 NNGGCAQLCKNRKGSRRC 531



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 22/67 (32%), Positives = 33/67 (49%)
 Frame = +1

Query: 565 EIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRC 744
           + + NEC+ NNGGC  +       C +T     C C    G +  GDG ++C  S    C
Sbjct: 114 QYDANECMANNGGCEHE-------CVNTIGTYYCRC--WPGFELSGDG-NTC--SDIDEC 161

Query: 745 KLNHGGC 765
            +++GGC
Sbjct: 162 AVSNGGC 168



 Score = 35.8 bits (81), Expect = 0.97
 Identities = 26/87 (29%), Positives = 41/87 (47%)
 Frame = +1

Query: 523 GFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKG 702
           GFE + +   C     + +EC  +NGGC  D+      C ++  G  C+CP+   +    
Sbjct: 145 GFELSGDGNTCS----DIDECAVSNGGC-SDR------CVNSPGGFRCDCPS--DLYLHA 191

Query: 703 DGYSSCKPSGPGRCKLNHGGCWHETRN 783
           DG +  K +    C  ++GGC HE  N
Sbjct: 192 DGRTCGKVTS---CSTDNGGCEHECEN 215



 Score = 32.7 bits (73), Expect = 8.2
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%)
 Frame = +1

Query: 523 GFEETTEPAVCLNEE----IETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           G+  + EP   L+E+     + NECL NNGGC Q        CK+    R C+C
Sbjct: 487 GYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQ-------LCKNRKGSRRCQC 533



>gb:AF452494_1902489 Homo sapiens CUB and EGF containing protein
           (CEGF3) mRNA, complete cds.>gb:AY639608_1957824 Homo
           sapiens signal peptide, CUB and EGF-like domain
           containing protein 3 (SCUBE3) mRNA, complete
           cds.>gb:HS329A5_1998075 Human DNA sequence from clone
           RP3-329A5 on chromosome 6p21.1-21.33 Contains the gene
           for a novel EGF-like and CUB domain protein similar to
           mouse CUB domain EGF-like signal peptide 1 (Scube1) and
           mouse and human CEGP1, the ZNF76 gene for zinc finger
           protein 76 (expressed in testis), the DEF6 gene for
           differentially expressed in FDCP 6 homolog (mouse), a
           ribosomal protein L35A (RPL35A) pseudogene and three CpG
           islands, complete sequence.
          Length = 993

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 28/72 (38%), Positives = 33/72 (45%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC        + C D   G  C CP   G   + D   +CK      C+
Sbjct: 237 IET--CAVNNGGC-------DSKCHDAATGVHCTCPV--GFMLQPDR-KTCKDID--ECR 282

Query: 748 LNHGGCWHETRN 783
           LN+GGC H  RN
Sbjct: 283 LNNGGCDHICRN 294



>gb:AX676240_1473050 Sequence 11 from Patent WO02063009.
          Length = 897

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 28/72 (38%), Positives = 33/72 (45%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC        + C D   G  C CP   G   + D   +CK      C+
Sbjct: 244 IET--CAVNNGGC-------DSKCHDAATGVHCTCPV--GFMLQPDR-KTCKDID--ECR 289

Query: 748 LNHGGCWHETRN 783
           LN+GGC H  RN
Sbjct: 290 LNNGGCDHICRN 301



>gb:BC052263_1984775 Homo sapiens signal peptide, CUB domain,
           EGF-like 3, mRNA (cDNA clone MGC:59874 IMAGE:6379512),
           complete cds.
          Length = 992

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 28/72 (38%), Positives = 33/72 (45%)
 Frame = +1

Query: 568 IETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           IET  C  NNGGC        + C D   G  C CP   G   + D   +CK      C+
Sbjct: 236 IET--CAVNNGGC-------DSKCHDAAIGVHCTCPV--GFMLQPDR-KTCKDID--ECR 281

Query: 748 LNHGGCWHETRN 783
           LN+GGC H  RN
Sbjct: 282 LNNGGCDHICRN 293



>sp|P35950|LDLR_CRIGR Low-density lipoprotein receptor precursor
           (LDL receptor).>pir|A48908|QRHYLD LDL receptor precursor
           - Chinese hamster>gb:CRULDLRA_2112042 Hamster low
           density lipoprotein receptor (LDLR) gene, complete cds.
          Length = 854

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 18/38 (47%), Positives = 20/38 (52%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECP 675
           ++  TNECLDNNGGC          CKD   G  C CP
Sbjct: 312 KDCRTNECLDNNGGCSH-------VCKDLKIGYECLCP 342



>gb:BX005301_2567003 Zebrafish DNA sequence from clone CH211-221N20
           in linkage group 20 Contains the gene for a novel notch
           family protein, seven novel genes and seven CpG islands,
           complete sequence.
          Length = 372

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 28/95 (29%), Positives = 38/95 (40%)
 Frame = +1

Query: 520 AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFK 699
           AG+  T +   C     + +EC+ +N  C Q        C +T    +C C    G Q  
Sbjct: 28  AGYTITADLHNCT----DVDECVSSNDRCEQ-------TCTNTAGSFLCSCRR--GFQLH 74

Query: 700 GDGYSSCKPSGPGRCKLNHGGCWHETRNGRSYSAC 804
            DG+S         CKL +GGC HE  N      C
Sbjct: 75  IDGHSCVDID---ECKLQNGGCSHECTNTEGGHQC 106



 Score = 33.5 bits (75), Expect = 4.8
 Identities = 24/82 (29%), Positives = 36/82 (43%)
 Frame = +1

Query: 520 AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFK 699
           AG+E + +   C    I+ +EC+  NGGC Q        C +   G  C C    G + +
Sbjct: 152 AGWELSADQRTC----IDVDECVSVNGGCEQ-------VCVNHAGGFNCSCRA--GFELR 198

Query: 700 GDGYSSCKPSGPGRCKLNHGGC 765
            D  + C+P     C+ N G C
Sbjct: 199 KDHPTKCQPLCDPACQ-NSGVC 219



>gb:BT009890_2151278 Synthetic construct Homo sapiens low density
           lipoprotein receptor (familial hypercholesterolemia)
           mRNA, partial cds.
          Length = 861

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQ 693
           +E  TNECLDNNGGC          C D   G  C CP  DG Q
Sbjct: 311 KECGTNECLDNNGGCSH-------VCNDLKIGYECLCP--DGFQ 345



>gb:AF217403_1890517 Homo sapiens low density lipoprotein receptor
           (LDLR) gene, partial cds.
          Length = 837

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQ 693
           +E  TNECLDNNGGC          C D   G  C CP  DG Q
Sbjct: 288 KECGTNECLDNNGGCSH-------VCNDLKIGYECLCP--DGFQ 322



>gb:A44513_1449159 Sequence 3 from Patent WO9515379.
          Length = 924

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQ 693
           +E  TNECLDNNGGC          C D   G  C CP  DG Q
Sbjct: 375 KECGTNECLDNNGGCSH-------VCNDLKIGYECLCP--DGFQ 409



>sp|P01130|LDLR_HUMAN Low-density lipoprotein receptor precursor
           (LDL receptor).>pir|A01383|QRHULD LDL receptor precursor
           - human>gb:AY114155_1936501 Homo sapiens low density
           lipoprotein receptor (LDLR) mRNA, complete
           cds.>gb:AY324609_1943912 Homo sapiens low density
           lipoprotein receptor (familial hypercholesterolemia)
           (LDLR) gene, complete cds.>gb:BC014514_1974658 Homo
           sapiens low density lipoprotein receptor (familial
           hypercholesterolemia), mRNA (cDNA clone MGC:654
           IMAGE:3542845), complete cds.>gb:BT007361_1990799 Homo
           sapiens low density lipoprotein receptor (familial
           hypercholesterolemia) mRNA, complete
           cds.>gb:HUMLDLR18_2034041 Human low density lipoprotein
           receptor gene, exon 18.
          Length = 860

 Score = 37.4 bits (85), Expect = 0.33
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQ 693
           +E  TNECLDNNGGC          C D   G  C CP  DG Q
Sbjct: 311 KECGTNECLDNNGGCSH-------VCNDLKIGYECLCP--DGFQ 345



>gb:AY466854_1951392 Macaca mulatta low density lipoprotein receptor
           (LDLR) mRNA, complete cds.
          Length = 853

 Score = 37.0 bits (84), Expect = 0.44
 Identities = 21/44 (47%), Positives = 22/44 (50%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQ 693
           +E  TNECLDNNGGC          C D   G  C CP  DG Q
Sbjct: 304 KECGTNECLDNNGGCSH-------ICNDLKIGYECLCP--DGFQ 338



>gb:AL512413_1928452 Human DNA sequence from clone RP11-168F9 on
           chromosome 1 Contains the ARHGEF16 gene for Rho guanine
           exchange factor (GEF) 16 and the 3' end of the EGFL3
           gene for EGF-like-domain multiple 3, complete
           sequence.>gb:AL513320_1928803 Human DNA sequence from
           clone RP11-46F15 on chromosome 1 Contains the 5' end of
           the EGFL3 gene for EGF-like-domain multiple 3, a novel
           gene, the gene for a novel protein (FLJ39108, FLJ21756
           and FLJ21811), the 3' end of the WDR8 gene for WD repeat
           domain 8 and five CpG islands, complete sequence.
          Length = 1229

 Score = 36.2 bits (82), Expect = 0.75
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 481 GKLEKGAVLKAIC-AGFEETTEPAVCLNEEIE-TNECLDNNGGCWQDKTANITACKDTFR 654
           G L      K +C AG+E   +   C   E+E  N C  NNGGC          C  T  
Sbjct: 194 GCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSH-------GCSHTSA 246

Query: 655 GRVCECP 675
           G +C CP
Sbjct: 247 GPLCTCP 253



>gb:AX817299_1475871 Sequence 47 from Patent WO02081517.
          Length = 1450

 Score = 36.2 bits (82), Expect = 0.75
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 481 GKLEKGAVLKAIC-AGFEETTEPAVCLNEEIE-TNECLDNNGGCWQDKTANITACKDTFR 654
           G L      K +C AG+E   +   C   E+E  N C  NNGGC          C  T  
Sbjct: 295 GCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSH-------GCSHTSA 347

Query: 655 GRVCECP 675
           G +C CP
Sbjct: 348 GPLCTCP 354



>gb:AX817297_1475870 Sequence 45 from Patent WO02081517.
          Length = 1398

 Score = 36.2 bits (82), Expect = 0.75
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 481 GKLEKGAVLKAIC-AGFEETTEPAVCLNEEIE-TNECLDNNGGCWQDKTANITACKDTFR 654
           G L      K +C AG+E   +   C   E+E  N C  NNGGC          C  T  
Sbjct: 295 GCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSH-------GCSHTSA 347

Query: 655 GRVCECP 675
           G +C CP
Sbjct: 348 GPLCTCP 354



>gb:AC116963_1206849 Dictyostelium discoideum chromosome 2 map
           4657875-4914984 strain AX4, complete sequence.
          Length = 1289

 Score = 36.2 bits (82), Expect = 0.75
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 5/98 (5%)
 Frame = +1

Query: 526 FEETTEPAVCLNEEI--ETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFK 699
           FE + +P   LN     + NEC   +  C+ +     T+C++T    +C CP++DG    
Sbjct: 614 FECSCDPGYNLNGLSCDDINECETQDNKCFGE----FTSCQNTVGSYLCVCPSIDGFSNN 669

Query: 700 G---DGYSSCKPSGPGRCKLNHGGCWHETRNGRSYSAC 804
           G   +    C       C LN      E RNG     C
Sbjct: 670 GTYCEDIDECSSKELNECGLN---TVCENRNGSYICQC 704



>sp|O75095|EFL3_HUMAN Multiple EGF-like-domain protein 3 (Multiple
           epidermal growth factor- like domains 6)
           (Fragment).>gb:AB011539_1864369 Homo sapiens mRNA for
           MEGF6 protein (KIAA0815), partial cds.
          Length = 1246

 Score = 36.2 bits (82), Expect = 0.75
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = +1

Query: 481 GKLEKGAVLKAIC-AGFEETTEPAVCLNEEIE-TNECLDNNGGCWQDKTANITACKDTFR 654
           G L      K +C AG+E   +   C   E+E  N C  NNGGC          C  T  
Sbjct: 211 GCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSH-------GCSHTSA 263

Query: 655 GRVCECP 675
           G +C CP
Sbjct: 264 GPLCTCP 270



>gb:AF146429_2477131 Danio rerio DeltaC (delC) mRNA, complete cds.
          Length = 664

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 29/74 (39%), Positives = 34/74 (45%), Gaps = 7/74 (9%)
 Frame = +1

Query: 559 NEEIETNECLDN---NGGCWQDKTANIT-ACKDTFRGRVCECPTV---DGVQFKGDGYSS 717
           N EIETNEC  N   NGG   D+  + T  C   F G+ CE   +   DG  F G G   
Sbjct: 301 NCEIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNG-GTCM 359

Query: 718 CKPSGPGRCKLNHG 759
            K SG   C+   G
Sbjct: 360 EKGSGSYSCRCPPG 373



>gb:BC031166_2096989 Mus musculus stabilin 1, mRNA (cDNA clone
           IMAGE:4983573), partial cds.
          Length = 1238

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/65 (36%), Positives = 30/65 (46%)
 Frame = +1

Query: 571 ETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKL 750
           E N CL +NGGC          C  T   +V  C   +G  + GDG  +CK   P  C  
Sbjct: 165 EINSCLVHNGGCHVH-----AECIPTGPQQV-SCSCREG--YSGDGIQTCKLLDP--CSQ 214

Query: 751 NHGGC 765
           N+GGC
Sbjct: 215 NNGGC 219



>gb:AY007370_2073423 Rattus norvegicus hyaluronan receptor for
            endocytosis HARE precursor, mRNA, partial cds.
          Length = 1431

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 14/74 (18%)
 Frame = +1

Query: 583  CLDNNGGCW------QDKTANITACKDTFRGRVCEC----PTVDGVQFKGDGYSSCKPSG 732
            C  NNGGC       Q  T    +CK  ++G    C    P  DGV      +++C+ +G
Sbjct: 951  CKQNNGGCAKVAKCSQKGTQVSCSCKKGYKGDGYSCIEIDPCADGVNGGCHEHATCRMTG 1010

Query: 733  PGR----CKLNHGG 762
            PG+    CK ++ G
Sbjct: 1011 PGKHKCECKSHYVG 1024



 Score = 33.5 bits (75), Expect = 4.8
 Identities = 42/148 (28%), Positives = 58/148 (39%), Gaps = 8/148 (5%)
 Frame = +1

Query: 346 NCMGDPNADADNPVLKEEQDAQIGKGSRGDVTILPTLVVNNRQYRGKLEKGAVLKA---- 513
           NC+ DP+  A           +   G RG+ T+   +        G   K    +     
Sbjct: 309 NCLLDPDGKAS---------CKCAAGFRGNGTVCTAINACETSNGGCSTKADCKRTTPGN 359

Query: 514 ---IC-AGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTV 681
              +C AG+  T +  VCL    E N CL+N+GGC  D+ A  T         VC C   
Sbjct: 360 RVCVCKAGY--TGDGIVCL----EINPCLENHGGC--DRNAECTQTGP--NQAVCNCLP- 408

Query: 682 DGVQFKGDGYSSCKPSGPGRCKLNHGGC 765
              ++ GDG   C  S    C  N+GGC
Sbjct: 409 ---KYTGDG-KVC--SLINVCLTNNGGC 430



>gb:AB073317_2047490 Rattus norvegicus LRP13 mRNA for LDL
            receptor-related protein 13, complete cds.
          Length = 1905

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 577  NECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPS 729
            N+C   NGGC          C     G  C CPT  G+Q KGDG  +C PS
Sbjct: 1311 NKCGSRNGGCSH-------LCLPRPSGFSCACPT--GIQLKGDG-KTCDPS 1351



>gb:AB011533_2043664 Rattus norvegicus mRNA for MEGF7, partial cds.
          Length = 1298

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 577 NECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPS 729
           N+C   NGGC          C     G  C CPT  G+Q KGDG  +C PS
Sbjct: 704 NKCGSRNGGCSH-------LCLPRPSGFSCACPT--GIQLKGDG-KTCDPS 744



>gb:AK096435_1914600 Homo sapiens cDNA FLJ39116 fis, clone
           NTONG2006301, highly similar to Mus musculus EF-9
           mRNA.>gb:AY013707_1934291 Homo sapiens LZP (LZP) mRNA,
           complete cds.>gb:AY358339_1947218 Homo sapiens clone
           DNA68883 PPFL826 (UNQ826) mRNA, complete cds.
          Length = 545

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/85 (34%), Positives = 39/85 (45%), Gaps = 4/85 (4%)
 Frame = +1

Query: 529 EETTEPAVCLNEEIET----NECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQF 696
           E T  P   L  + +T    NEC  NNGGC  +   N+   K+++R   CEC    G   
Sbjct: 164 ECTCAPGTVLGPDRQTCFDENECEQNNGGC-SEICVNL---KNSYR---CECGV--GRVL 214

Query: 697 KGDGYSSCKPSGPGRCKLNHGGCWH 771
           + DG +     G   C  N+GGC H
Sbjct: 215 RSDGKTCEDVEG---CHNNNGGCSH 236



>gb:AB084910_1871989 Homo sapiens LRP10 mRNA for low density
            lipoprotein receptor-related protein 10, complete cds.
          Length = 1905

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 577  NECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPS 729
            N+C   NGGC          C     G  C CPT  G+Q KGDG  +C PS
Sbjct: 1311 NKCGSRNGGCSH-------LCLPRPSGFSCACPT--GIQLKGDG-KTCDPS 1351



>gb:AB011540_1864370 Homo sapiens mRNA for MEGF7, partial cds.
          Length = 1576

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 577  NECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPS 729
            N+C   NGGC          C     G  C CPT  G+Q KGDG  +C PS
Sbjct: 982  NKCGSRNGGCSH-------LCLPRPSGFSCACPT--GIQLKGDG-KTCDPS 1022



>gb:AY348869_1321760 Aedes aegypti lipophorin receptor mRNA,
           complete cds; alternatively spliced.
          Length = 891

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 23/62 (37%), Positives = 29/62 (46%)
 Frame = +1

Query: 487 LEKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVC 666
           L K    K  C  F++  EP    N++   NECL+NNGGC          C DT  G  C
Sbjct: 305 LSKVCDKKPDCPEFQD--EP----NDKCGKNECLENNGGCSH-------LCVDTPAGFYC 351

Query: 667 EC 672
           +C
Sbjct: 352 DC 353



>gb:AF355595_1264970 Aedes aegypti lipophorin receptor mRNA,
           complete cds.
          Length = 1156

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 23/62 (37%), Positives = 29/62 (46%)
 Frame = +1

Query: 487 LEKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVC 666
           L K    K  C  F++  EP    N++   NECL+NNGGC          C DT  G  C
Sbjct: 399 LSKVCDKKPDCPEFQD--EP----NDKCGKNECLENNGGCSH-------LCVDTPAGFYC 445

Query: 667 EC 672
           +C
Sbjct: 446 DC 447



>gb:AE014296_1135180 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1135181 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003558_1215503
           Drosophila melanogaster chromosome 3L, section 27 of 83
           of the complete sequence.>gb:AE003558_1215504 Drosophila
           melanogaster chromosome 3L, section 27 of 83 of the
           complete sequence.
          Length = 1577

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 30/81 (37%), Positives = 35/81 (43%)
 Frame = +1

Query: 541 EPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSC 720
           E   CL E    N C  NN GC Q        C  T RG VC C   +G +   DG  SC
Sbjct: 545 EEYTCLAE----NLCEVNNNGCEQ-------ICL-TARGGVCACR--EGFRLSADG-KSC 589

Query: 721 KPSGPGRCKLNHGGCWHETRN 783
           +      C +N+GGC    RN
Sbjct: 590 EDVD--ECLVNNGGCQQVCRN 608



>sp|Q8R4Y4|SBN1_MOUSE Stabilin 1 precursor (FEEL-1
            protein).>gb:AF290914_2061718 Mus musculus stabilin-1
            mRNA, complete cds.
          Length = 2571

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/65 (36%), Positives = 30/65 (46%)
 Frame = +1

Query: 571  ETNECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKL 750
            E N CL +NGGC          C  T   +V  C   +G  + GDG  +CK   P  C  
Sbjct: 1498 EINSCLVHNGGCHVH-----AECIPTGPQQV-SCSCREG--YSGDGIQTCKLLDP--CSQ 1547

Query: 751  NHGGC 765
            N+GGC
Sbjct: 1548 NNGGC 1552



>sp|Q9QYP1|LRP4_RAT Low-density lipoprotein receptor-related protein 4
            precursor (Multiple epidermal growth factor-like domains
            7).
          Length = 1905

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 577  NECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPS 729
            N+C   NGGC          C     G  C CPT  G+Q KGDG  +C PS
Sbjct: 1311 NKCGSRNGGCSH-------LCLPRPSGFSCACPT--GIQLKGDG-KTCDPS 1351



>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein
            4 precursor (Multiple epidermal growth factor-like
            domains 7).
          Length = 1950

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 577  NECLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCKPS 729
            N+C   NGGC          C     G  C CPT  G+Q KGDG  +C PS
Sbjct: 1356 NKCGSRNGGCSH-------LCLPRPSGFSCACPT--GIQLKGDG-KTCDPS 1396



>gb:BTA550060_1436766 Bos taurus partial mRNA for putative
           hyaluronan receptor for endocytosis (hare gene).
          Length = 500

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 14/74 (18%)
 Frame = +1

Query: 583 CLDNNGGCW------QDKTANITACKDTFRGRVCEC----PTVDGVQFKGDGYSSCKPSG 732
           C  NNGGC       Q  T    +C+  ++G    C    P  DG+  +   +++CK +G
Sbjct: 318 CKQNNGGCAKVAKCSQKGTKVSCSCQKGYQGDGHSCTAIDPCADGLNGRCHEHATCKMTG 377

Query: 733 PGR----CKLNHGG 762
           PG+    CK ++ G
Sbjct: 378 PGKHKCECKSHYVG 391



>gb:AB022426_1408002 Sus scrofa mRNA for FXII, complete cds.
          Length = 616

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 6/79 (7%)
 Frame = +1

Query: 484 KLEKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRV 663
           + E   V K  C G +   +P    ++   TN CL N G C Q +   +  C   + GR+
Sbjct: 152 RFEPAGVSKCQCKGPKAQCKPVA--SQVCSTNPCL-NGGSCLQTEGHRLCRCPTGYAGRL 208

Query: 664 CE------CPTVDGVQFKG 702
           C+      C +  G+ ++G
Sbjct: 209 CDVDLKERCYSDRGLSYRG 227



>pir|T08618|T08618 intrinsic factor-B12 receptor CUBILIN precursor -
           rat>gb:AF022247_2051161 Rattus norvegicus intrinsic
           factor-B12 receptor precursor (CUBILIN) mRNA, complete
           cds.
          Length = 3623

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 26/69 (37%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +1

Query: 571 ETNECLDNNGGCWQDKTANITACKDTFRGRVC-ECPTVDGVQFKGDGYSSCKPSGPGRCK 747
           + NEC  NNGGC Q   A +  C +T     C  CP      F GDG   C P     C 
Sbjct: 302 DINECEINNGGCSQ---APLVPCLNTPGSFSCGNCP----AGFSGDG-RVCTP--VDICS 351

Query: 748 LNHGGCWHE 774
           +++GGC  E
Sbjct: 352 IHNGGCHPE 360



>pir|S45281|S45281 coagulation factor XIIa (EC 3.4.21.38) precursor
           - bovine  (fragment)
          Length = 593

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 19/62 (30%), Positives = 29/62 (46%)
 Frame = +1

Query: 484 KLEKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRV 663
           +LE   V+K  C G     +P    ++   TN CL N   C Q +   +  C  +F GR+
Sbjct: 142 RLEPAGVVKCQCKGPNAQCKPLA--SQVCRTNPCL-NGDSCLQAEGHRLCRCAPSFAGRL 198

Query: 664 CE 669
           C+
Sbjct: 199 CD 200



>sp|P98165|LDVR_CHICK Very low-density lipoprotein receptor
           precursor (VLDL receptor) (Vitellogenin receptor) (VTG
           receptor).>pir|S51789|S51789 VLDL receptor precursor -
           chicken>gb:A44511_1449158 Sequence 1 from Patent
           WO9515379.>gb:SSVLDLRCR_2580335 G.gallus
           VLDL/vitellogenin receptor.
          Length = 863

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECP 675
           +E   NECL NNGGC          C+D   G  C+CP
Sbjct: 371 KECNINECLVNNGGCSH-------ICRDLVIGYECDCP 401



>sp|P98140|FA12_BOVIN Coagulation factor XII precursor (EC
           3.4.21.38) (Hageman factor) (HAF)
           (Fragment).>gb:S70164_1444387 Hageman factor=blood
           coagulation factor XII [cattle, liver, mRNA Partial,
           1950 nt].
          Length = 593

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 19/62 (30%), Positives = 29/62 (46%)
 Frame = +1

Query: 484 KLEKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRV 663
           +LE   V+K  C G     +P    ++   TN CL N   C Q +   +  C  +F GR+
Sbjct: 142 RLEPAGVVKCQCKGPNAQCKPLA--SQVCRTNPCL-NGDSCLQAEGHRLCRCAPSFAGRL 198

Query: 664 CE 669
           C+
Sbjct: 199 CD 200



>gb:BC088911_2565963 Xenopus laevis hypothetical LOC496321, mRNA
           (cDNA clone IMAGE:6323364), partial cds.
          Length = 590

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = -3

Query: 135 KILFRIRSTISPVINALLLALSAYCKCLRTIPSYIVRCE 19
           KILFR RS I  V    L+ +  YCK L  +P+YI +C+
Sbjct: 79  KILFR-RSHIRDVAVRRLIPIDEYCKALIRLPAYISQCD 116



>gb:AY218841_2519948 Danio rerio clone BUSM1-81J4 brahma
           protein-like protein 1 (brg1) and low density
           lipoprotein receptor (ldlr) genes, complete cds.
          Length = 911

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 17/38 (44%), Positives = 19/38 (50%)
 Frame = +1

Query: 565 EIETNECLDNNGGCWQDKTANITACKDTFRGRVCECPT 678
           E ++NECL NNGGC          C D   G  C CPT
Sbjct: 308 ECDSNECLYNNGGCSH-------ICNDLKIGYECLCPT 338



>sp|P35953|LDVR_RABIT Very low-density lipoprotein receptor
           precursor (VLDL receptor).>pir|A46286|QRRBVD VLDL
           receptor precursor - rabbit>gb:RABVLDLR_1444189
           Oryctolagus cuniculus mRNA for very low density
           lipoprotein receptor, complete cds.
          Length = 873

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 16/37 (43%), Positives = 19/37 (51%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD+  G  C+C
Sbjct: 353 KECHVNECLVNNGGCSH-------ICKDSVIGYECDC 382



>gb:RATPATISS_2133338 Rat tissue-type plasminogen activator (t-PA)
           mRNA, complete cds.
          Length = 559

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 17/53 (32%), Positives = 24/53 (45%)
 Frame = -3

Query: 804 TSRITTSISSFMPTASMIQFASAWSTWLARTVAISFELHTINRGAFADSSPEC 646
           T   TTS +S +P  SMI     ++ W A + A+    H   R    D+ P C
Sbjct: 224 THSFTTSKASCLPWNSMILIGKTYTAWRANSQALGLGRHNYCRNPDGDAKPWC 276



>gb:HSU77720_2026132 Human transmembrane protein Jagged mRNA, partial
            cds.
          Length = 1214

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 27/105 (25%), Positives = 40/105 (38%), Gaps = 13/105 (12%)
 Frame = +1

Query: 490  EKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCE 669
            ++G   K +C G  E T   +  N     N C  N G C  +  +    CK+ + G +C 
Sbjct: 709  DEGDAFKCMCPGGWEGTTCNIARNSSCLPNPC-HNGGTCVVNGESFTCVCKEGWEGPICA 767

Query: 670  CPTVD---------GVQFKGDGYSSCKPSGPG----RCKLNHGGC 765
              T D         G    GD +  C+   PG     C++N   C
Sbjct: 768  QNTNDCSPHPCYNSGTCVDGDNWYRCE-CAPGFAGPDCRININEC 811



>gb:HSU61276_2025270 Human transmembrane protein Jagged 1 (HJ1) mRNA,
            complete cds.
          Length = 1218

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 27/105 (25%), Positives = 40/105 (38%), Gaps = 13/105 (12%)
 Frame = +1

Query: 490  EKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCE 669
            ++G   K +C G  E T   +  N     N C  N G C  +  +    CK+ + G +C 
Sbjct: 722  DEGDAFKCMCPGGWEGTTCNIARNSSCLPNPC-HNGGTCVVNGESFTCVCKEGWEGPICA 780

Query: 670  CPTVD---------GVQFKGDGYSSCKPSGPG----RCKLNHGGC 765
              T D         G    GD +  C+   PG     C++N   C
Sbjct: 781  QNTNDCSPHPCYNSGTCVDGDNWYRCE-CAPGFAGPDCRININEC 824



>gb:AF003837_1875838 Homo sapiens Jagged1 (JAG1) mRNA, complete cds.
          Length = 1218

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 27/105 (25%), Positives = 40/105 (38%), Gaps = 13/105 (12%)
 Frame = +1

Query: 490  EKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCE 669
            ++G   K +C G  E T   +  N     N C  N G C  +  +    CK+ + G +C 
Sbjct: 722  DEGDAFKCMCPGGWEGTTCNIARNSSCLPNPC-HNGGTCVVNGESFTCVCKEGWEGPICA 780

Query: 670  CPTVD---------GVQFKGDGYSSCKPSGPG----RCKLNHGGC 765
              T D         G    GD +  C+   PG     C++N   C
Sbjct: 781  QNTNDCSPHPCYNSGTCVDGDNWYRCE-CAPGFAGPDCRININEC 824



>gb:AF118147_1414462 Sus scrofa low density lipoprotein receptor
           (LDLR) mRNA, partial cds.
          Length = 782

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 17/38 (44%), Positives = 18/38 (47%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECP 675
           +E  TNECLDN GGC          C D   G  C CP
Sbjct: 263 KECGTNECLDNKGGCSH-------ICNDLKIGYECLCP 293



>gb:AF067952_1413422 Sus scrofa low density lipoprotein receptor
           (LDLR) mRNA, LDLR-r allele, partial cds.
          Length = 801

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 17/38 (44%), Positives = 18/38 (47%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECP 675
           +E  TNECLDN GGC          C D   G  C CP
Sbjct: 282 KECGTNECLDNKGGCSH-------ICNDLKIGYECLCP 312



>gb:AF065990_1413412 Sus scrofa low density lipoprotein receptor
           (LDLR) mRNA, LDLR-N allele, partial cds.
          Length = 801

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 17/38 (44%), Positives = 18/38 (47%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCECP 675
           +E  TNECLDN GGC          C D   G  C CP
Sbjct: 282 KECGTNECLDNKGGCSH-------ICNDLKIGYECLCP 312



>sp|P19637|TPA_RAT Tissue-type plasminogen activator precursor (EC
           3.4.21.68) (tPA) (t- PA) (t-plasminogen
           activator).>pir|A35029|A35029 t-plasminogen activator
           (EC 3.4.21.68) precursor - rat>gb:A19618_1447862
           Mammalian cell line JMI-229 mRNA for
           tPA.>gb:BC061565_2104547 Rattus norvegicus plasminogen
           activator, tissue, mRNA (cDNA clone MGC:72909
           IMAGE:6920438), complete cds.>gb:RATTPA14_2134123 Rat
           tissue-type plasminogen activator (tPA) gene, exon 14.
          Length = 559

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 17/53 (32%), Positives = 24/53 (45%)
 Frame = -3

Query: 804 TSRITTSISSFMPTASMIQFASAWSTWLARTVAISFELHTINRGAFADSSPEC 646
           T   TTS +S +P  SMI     ++ W A + A+    H   R    D+ P C
Sbjct: 224 THSFTTSKASCLPWNSMILIGKTYTAWRANSQALGLGRHNYCRNPDGDAKPWC 276



>sp|P78504|JAG1_HUMAN Jagged 1 precursor (Jagged1)
            (hJ1).>gb:AF028593_1877494 Homo sapiens transmembrane
            protein Jagged 1 (HJ1) mRNA, complete
            cds.>gb:HS1099D15_1996733 Human DNA sequence from clone
            RP5-1099D15 on chromosome 20 Contains the 3' end of a
            novel gene, the JAG1 gene encoding Jagged 1 (involved in
            Alagille syndrome), a pseudogene aimilar to DNAJ protein,
            a CpG island, ESTs, STSs and GSSs, complete
            sequence.>gb:HSU73936_2025949 Homo sapiens Jagged 1 (HJ1)
            mRNA, complete cds.
          Length = 1218

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 27/105 (25%), Positives = 40/105 (38%), Gaps = 13/105 (12%)
 Frame = +1

Query: 490  EKGAVLKAICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCE 669
            ++G   K +C G  E T   +  N     N C  N G C  +  +    CK+ + G +C 
Sbjct: 722  DEGDAFKCMCPGGWEGTTCNIARNSSCLPNPC-HNGGTCVVNGESFTCVCKEGWEGPICA 780

Query: 670  CPTVD---------GVQFKGDGYSSCKPSGPG----RCKLNHGGC 765
              T D         G    GD +  C+   PG     C++N   C
Sbjct: 781  QNTNDCSPHPCYNSGTCVDGDNWYRCE-CAPGFAGPDCRININEC 824



>gb:BX883044_2111410 Rattus norvegicus chromosome 20, major
           histocompatibility complex, assembled from 40 BACs,
           strain Brown Norway (BN/ssNHsd), RT1n haplotype; segment
           3/11.
          Length = 1961

 Score = 33.1 bits (74), Expect = 6.3
 Identities = 29/102 (28%), Positives = 37/102 (36%), Gaps = 8/102 (7%)
 Frame = +1

Query: 484 KLEKGAVLKAICAGF-------EETTEPAVCLNEEIETN-ECLDNNGGCWQDKTANITAC 639
           KL KGA L   C          E  T   +CL     T   C  N   C +++  N   C
Sbjct: 229 KLRKGACLPGTCLNGGTCQLVPEGDTTFHLCLCPPGFTGLNCEMNPDDCVRNQCQNGATC 288

Query: 640 KDTFRGRVCECPTVDGVQFKGDGYSSCKPSGPGRCKLNHGGC 765
           +D      C CP         +    C+  GP RC+ N G C
Sbjct: 289 QDGLGTYTCLCPKTWKGWDCSEDIDECEAQGPPRCR-NGGTC 329



>gb:BC047916_1984060 Homo sapiens signal peptide, CUB domain,
           EGF-like 1, mRNA (cDNA clone IMAGE:6189117), complete
           cds.
          Length = 347

 Score = 33.1 bits (74), Expect = 6.3
 Identities = 21/47 (44%), Positives = 24/47 (51%)
 Frame = +1

Query: 583 CLDNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFKGDGYSSCK 723
           C  NNGGC  D+T     CKDT  G  C CP   G   + DG  +CK
Sbjct: 275 CAVNNGGC--DRT-----CKDTATGVRCSCPV--GFTLQPDG-KTCK 311



>gb:AK089330_1175894 Mus musculus B6-derived CD11 +ve dendritic
           cells cDNA, RIKEN full-length enriched library,
           clone:F730007E04 product:similar to BA541N10.2 (NOVEL
           PROTEIN (ORTHOLOG OF MOUSE FISH PROTEIN)) (FRAGMENT)
           [Homo sapiens], full insert sequence.
          Length = 471

 Score = 33.1 bits (74), Expect = 6.3
 Identities = 18/39 (46%), Positives = 23/39 (58%)
 Frame = -3

Query: 135 KILFRIRSTISPVINALLLALSAYCKCLRTIPSYIVRCE 19
           KILFR RS I  V    L+ +  YCK L  +P YI +C+
Sbjct: 79  KILFR-RSHIRDVAVKRLIPIDEYCKALIQLPPYISQCD 116



>gb:MUSMVLD_2129310 Mus musculus very low density lipoprotein
           receptor (VLDLR), complete cds.
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>gb:BC013622_2091855 Mus musculus very low density lipoprotein
           receptor, mRNA (cDNA clone MGC:11509 IMAGE:3968213),
           complete cds.
          Length = 845

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>gb:HUMVLDLRX_2038142 Human very low density lipoprotein receptor,
           complete cds.
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>gb:HUMVLDLR_2038139 Human very low density lipoprotein receptor
           mRNA, complete cds.
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>gb:AY466855_1951393 Macaca mulatta very low density lipoprotein
           receptor mRNA, complete cds.
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>gb:AL450467_1928039 Human DNA sequence from clone RP11-320E16 on
           chromosome 9 Contains the 5' end of a novel gene
           (FLJ35024), the VLDLR gene for very low density
           lipoprotein receptor and a CpG island, complete
           sequence.>gb:HUMVLDLRB_2038141 Homo sapiens mRNA for
           very low density lipoprotein receptor, complete cds.
          Length = 845

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>gb:AK092381_1913690 Homo sapiens cDNA FLJ35062 fis, clone
           OCBBF2019195, highly similar to VERY LOW-DENSITY
           LIPOPROTEIN RECEPTOR PRECURSOR.>gb:AL450467_1928040
           Human DNA sequence from clone RP11-320E16 on chromosome
           9 Contains the 5' end of a novel gene (FLJ35024), the
           VLDLR gene for very low density lipoprotein receptor and
           a CpG island, complete sequence.
          Length = 752

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 232 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 261



>gb:AY005132_1286031 Plasmodium yoelii merozoite surface protein
           precursor (pag-2) mRNA, complete
           cds.>gb:AY864847_1354356 Plasmodium yoelii merozoite
           surface protein 8 (msp-8) gene, complete cds.
          Length = 409

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 24/63 (38%), Positives = 28/63 (44%), Gaps = 8/63 (12%)
 Frame = +1

Query: 544 PAVCLNEEIETNECL--------DNNGGCWQDKTANITACKDTFRGRVCECPTVDGVQFK 699
           P    NEE E  ECL        +NNGGC  D  AN    +D     +CEC      +F 
Sbjct: 329 PGFSKNEESENLECLINESTSCENNNGGC--DVNANCILLEDKI---MCECNN----KFN 379

Query: 700 GDG 708
           GDG
Sbjct: 380 GDG 382



>gb:AB066246_1197130 Caenorhabditis elegans mRNA for ADT-1, complete
            cds.>gb:CEC02B4_1359927 Caenorhabditis elegans cosmid
            C02B4, complete sequence.>gb:CET07C5_1367405
            Caenorhabditis elegans cosmid T07C5, complete sequence.
          Length = 1461

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 4/88 (4%)
 Frame = +1

Query: 511  AICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC----PT 678
            A C+G+     P  C+ + + ++E +D     W   +     C++  R R   C    P+
Sbjct: 1241 AYCSGYSFDQRP--CVMDNVCSDEKVDGGWTDWTAWSECTDYCRNGHRSRTRFCANPKPS 1298

Query: 679  VDGVQFKGDGYSSCKPSGPGRCKLNHGG 762
              G Q  G  +       P RC L  GG
Sbjct: 1299 QGGAQCTGSDFELNPCFDPARCHLRDGG 1326



>pir|T18856|T18856 angiogenesis inhibitor homolog - Caenorhabditis
            elegans
          Length = 1444

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 22/88 (25%), Positives = 35/88 (39%), Gaps = 4/88 (4%)
 Frame = +1

Query: 511  AICAGFEETTEPAVCLNEEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC----PT 678
            A C+G+     P  C+ + + ++E +D     W   +     C++  R R   C    P+
Sbjct: 1224 AYCSGYSFDQRP--CVMDNVCSDEKVDGGWTDWTAWSECTDYCRNGHRSRTRFCANPKPS 1281

Query: 679  VDGVQFKGDGYSSCKPSGPGRCKLNHGG 762
              G Q  G  +       P RC L  GG
Sbjct: 1282 QGGAQCTGSDFELNPCFDPARCHLRDGG 1309



>pir|I48952|I48952 VLDL receptor precursor, long splice form -
           mouse>gb:MMU06670_2118089 Mus musculus very low density
           lipoprotein receptor mRNA, complete cds.
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>sp|P98166|LDVR_RAT Very low-density lipoprotein receptor precursor
           (VLDL receptor).>gb:RATVLDLR_2134236 Rat very low
           density lipoprotein receptor (VLDLR) mRNA, complete cds.
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>sp|P98156|LDVR_MOUSE Very low-density lipoprotein receptor
           precursor (VLDL receptor).
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382



>sp|P98155|LDVR_HUMAN Very low-density lipoprotein receptor
           precursor (VLDL receptor).>pir|A49729|A49729 VLDL
           receptor precursor, long splice form -
           human>gb:AL450467_1928038 Human DNA sequence from clone
           RP11-320E16 on chromosome 9 Contains the 5' end of a
           novel gene (FLJ35024), the VLDLR gene for very low
           density lipoprotein receptor and a CpG island, complete
           sequence.>gb:D16495S19_1994595 Homo sapiens gene for
           very low density lipoprotein receptor, complete cds and
           exon 19.>gb:HUMVLDLRA_2038140 Homo sapiens mRNA for very
           low density lipoprotein receptor, complete
           cds.>gb:S73849_2041361 very low density lipoprotein
           receptor [human, heart, mRNA, 3355 nt].
          Length = 873

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 16/37 (43%), Positives = 18/37 (48%)
 Frame = +1

Query: 562 EEIETNECLDNNGGCWQDKTANITACKDTFRGRVCEC 672
           +E   NECL NNGGC          CKD   G  C+C
Sbjct: 353 KECHINECLVNNGGCSH-------ICKDLVIGYECDC 382


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 921,288,418
Number of Sequences: 1806583
Number of extensions: 21376661
Number of successful extensions: 55085
Number of sequences better than 10.0: 122
Number of HSP's better than 10.0 without gapping: 50125
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54945
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 52781167954
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)