BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8002
         (802 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY062210_1565005 Oryza sativa chitin-inducible gibberellin-re...    60   4e-08   
gb:AE016959_1022186 Oryza sativa (japonica cultivar-group) chrom...    60   4e-08   
gb:AB023039_1515421 Arabidopsis thaliana genomic DNA, chromosome...    52   2e-05   
gb:BT001076_1635331 Arabidopsis thaliana At4g17230/dl4650c mRNA,...    51   3e-05   
gb:BT000883_1635138 Arabidopsis thaliana clone C105359 putative ...    43   0.006   
gb:AY039611_1560324 Arabidopsis thaliana F17J6.12/F17J6.12 mRNA,...    43   0.006   
gb:AY034929_1559714 Arabidopsis thaliana putative scarecrow prot...    43   0.006   
pir|E96542|E96542 scarecrow-like protein [imported] - Arabidopsi...    43   0.006   Arabidopsis thaliana [mouse-ear cress]
gb:PFMAL4P3_1394791 Plasmodium falciparum MAL4P3.                      34   3.7     
pir|E86347|E86347 scarecrow-like 1 protein F24J8.8 - Arabidopsis...    33   4.8     Arabidopsis thaliana [mouse-ear cress]
gb:AK050055_1169102 Mus musculus adult male liver tumor cDNA, RI...    33   6.2     
gb:AE013563_293403 Methanosarcina mazei strain Goe1, section 345...    33   6.2     
pir|C86823|C86823 GTP-binding protein Obg [imported] - Lactococc...    33   8.1     Lactococcus lactis subsp. lactis


>gb:AY062210_1565005 Oryza sativa chitin-inducible
           gibberellin-responsive protein (GIGR2) mRNA, complete
           cds.>gb:AP003747_1832797 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1127_E01.
          Length = 544

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 1/113 (0%)
 Frame = +2

Query: 467 SSKNGSHARCNSSSTVTFSPY-GSPMLQQEFQSYPLDLLHQSPETKYSSPISVSSVTDDM 643
           SS+     R +S S+ +F+   GSP+ Q++  S   D           SP+  S VT+D 
Sbjct: 74  SSEGAGCMRHDSPSSQSFTTRSGSPLSQEDSHSDSTD----------GSPVGASCVTEDP 123

Query: 644 SDFRHKLKELESVMLGPDSDVPECYELTLPSTIAPPELDSWREMMEGIPVGDL 802
           +D + KLK+LE+VMLGPDS++    E ++ + ++  E + W  MM GIP G+L
Sbjct: 124 NDLKQKLKDLEAVMLGPDSEIVNSLENSVANQLS-LEPEKWVRMM-GIPRGNL 174



>gb:AE016959_1022186 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC113335_1738958
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OJ1003C07,
           from chromosome 10, complete
           sequence.>gb:AE017084_1752005 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 38 of 77 of the
           complete sequence.
          Length = 524

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 51/148 (34%), Positives = 79/148 (53%), Gaps = 13/148 (8%)
 Frame = +2

Query: 398 QLSHSSSDNGGSYLIQA--------YSDRELSSKNGSHARCNSSSTVTFSPY-GSPMLQQ 550
           Q +H +S + GS  I +        Y   E SS NG+H   +S+S+ + SP  GSP+   
Sbjct: 23  QDAHYASSDDGSQKIGSSPQAFEAPYCTLESSSANGAHPAHSSASSHSISPISGSPLSHH 82

Query: 551 EFQSYPLDLLHQSPETKYSSPISVSSVTDDMSDFRHKLKELESVMLGPDSDV----PECY 718
           +  S          +  Y+SP S S VT+ ++D + KL+ELE+ +LGP+ D+    PE  
Sbjct: 83  DSHS----------DHTYNSPPSASCVTE-ITDLQIKLRELENAILGPELDIAYDSPE-- 129

Query: 719 ELTLPSTIAPPELDSWREMMEGIPVGDL 802
               P+ +A PE  +WR+++ GI  GDL
Sbjct: 130 SALQPNIMATPE--NWRQLL-GINTGDL 154



>gb:AB023039_1515421 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIF21.>gb:AF153443_1772841 Arabidopsis thaliana
           phytochrome A signal transduction 1 protein (PAT1) mRNA,
           complete cds.
          Length = 490

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 5/65 (7%)
 Frame = +2

Query: 623 SSVTDDMSDFRHKLKELESVMLGPDS-----DVPECYELTLPSTIAPPELDSWREMMEGI 787
           S VTD+++DF+HK++E+E+VM+GPDS     D  + ++ T     A  E++ WR  +E I
Sbjct: 60  SCVTDELNDFKHKIREIETVMMGPDSLDLLVDCTDSFDST-----ASQEINGWRSTLEAI 114

Query: 788 PVGDL 802
              DL
Sbjct: 115 SRRDL 119



>gb:BT001076_1635331 Arabidopsis thaliana At4g17230/dl4650c mRNA,
           complete cds.>gb:AF419570_1798432 Arabidopsis thaliana
           AT4g17230/dl4650c mRNA, complete cds.
          Length = 529

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = +2

Query: 362 EAYCVPQFQILDQLSHSSSDNGGSYLIQAYSDRELSSKNGSHARCNSSSTVTFSPYGSPM 541
           + YC PQFQ  D    S   +  ++        E S+ +GS    +S S V+ +   SP 
Sbjct: 19  QVYCSPQFQAKDNKGFSDIPSKENFFTL-----ESSTASGSLPSYDSPS-VSITSGQSPF 72

Query: 542 LQQEFQSYPLDLLHQSPETKYSSPIS-VSSVTDDMSDFRHKLKELESVMLGPDSDVPE 712
             Q  QS   DL H SP+  Y SP+S VSS+  D +  + K++ELE  +L  D+ V E
Sbjct: 73  SPQGSQSCISDL-HHSPDNVYGSPLSGVSSLAYDEAGVKSKIRELEVSLLSGDTKVEE 129



>gb:BT000883_1635138 Arabidopsis thaliana clone C105359 putative
           scarecrow protein (At1g50600) mRNA, complete cds.
          Length = 597

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
 Frame = +2

Query: 446 AYSDRELSSKNGSHA----RCNSSSTVTFSPYGSPMLQQEFQSYPLDLLHQSPETKYSSP 613
           +Y   E SS   SH     + NSSST +FS   SP+ Q    +      H SPE   +SP
Sbjct: 106 SYCTLESSSGTKSHPCLNNKNNSSSTTSFSSNESPISQANNNNLSRFNNH-SPEENNNSP 164

Query: 614 ISVSSVTD-DMSDFRHKLKELESVMLGPDSD 703
           +S SS T+ + ++    LK+LE+ M+ PD D
Sbjct: 165 LSGSSATNTNETELSLMLKDLETAMMEPDVD 195



>gb:AY039611_1560324 Arabidopsis thaliana F17J6.12/F17J6.12 mRNA,
           complete cds.
          Length = 526

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
 Frame = +2

Query: 446 AYSDRELSSKNGSHA----RCNSSSTVTFSPYGSPMLQQEFQSYPLDLLHQSPETKYSSP 613
           +Y   E SS   SH     + NSSST +FS   SP+ Q    +      H SPE   +SP
Sbjct: 35  SYCTLESSSGTKSHPCLNNKNNSSSTTSFSSNESPISQANNNNLSRFNNH-SPEENNNSP 93

Query: 614 ISVSSVTD-DMSDFRHKLKELESVMLGPDSD 703
           +S SS T+ + ++    LK+LE+ M+ PD D
Sbjct: 94  LSGSSATNTNETELSLMLKDLETAMMEPDVD 124



>gb:AY034929_1559714 Arabidopsis thaliana putative scarecrow protein
           (At1g50600) mRNA, partial cds.
          Length = 587

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
 Frame = +2

Query: 446 AYSDRELSSKNGSHA----RCNSSSTVTFSPYGSPMLQQEFQSYPLDLLHQSPETKYSSP 613
           +Y   E SS   SH     + NSSST +FS   SP+ Q    +      H SPE   +SP
Sbjct: 96  SYCTLESSSGTKSHPCLNNKNNSSSTTSFSSNESPISQANNNNLSRFNNH-SPEENNNSP 154

Query: 614 ISVSSVTD-DMSDFRHKLKELESVMLGPDSD 703
           +S SS T+ + ++    LK+LE+ M+ PD D
Sbjct: 155 LSGSSATNTNETELSLMLKDLETAMMEPDVD 185



>pir|E96542|E96542 scarecrow-like protein [imported] - Arabidopsis
           thaliana>gb:AE005173_892977 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC012561_1537695 Arabidopsis thaliana
           chromosome I BAC F11F12 genomic sequence, complete
           sequence.>gb:AC079279_1732404 Arabidopsis thaliana
           chromosome 1 BAC F17J6 genomic sequence, complete
           sequence.
          Length = 526

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 34/91 (37%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
 Frame = +2

Query: 446 AYSDRELSSKNGSHA----RCNSSSTVTFSPYGSPMLQQEFQSYPLDLLHQSPETKYSSP 613
           +Y   E SS   SH     + NSSST +FS   SP+ Q    +      H SPE   +SP
Sbjct: 35  SYCTLESSSGTKSHPCLNNKNNSSSTTSFSSNESPISQANNNNLSRFNNH-SPEENNNSP 93

Query: 614 ISVSSVTD-DMSDFRHKLKELESVMLGPDSD 703
           +S SS T+ + ++    LK+LE+ M+ PD D
Sbjct: 94  LSGSSATNTNETELSLMLKDLETAMMEPDVD 124



>gb:PFMAL4P3_1394791 Plasmodium falciparum MAL4P3.
          Length = 1339

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 5/64 (7%)
 Frame = +2

Query: 401 LSHSSSDNGGSYLIQAYSDRELSSKNGSHARCNSSSTVTFSPYG-----SPMLQQEFQSY 565
           L+H+  D   S  I +Y D   +S N SH+ C+SSS  +F  Y         +   F+  
Sbjct: 632 LNHNQVDPSTSLSISSYEDT--TSSNSSHSNCSSSSVSSFMSYDKNKEKKSCIWMVFEYV 689

Query: 566 PLDL 577
           P DL
Sbjct: 690 PFDL 693



>pir|E86347|E86347 scarecrow-like 1 protein F24J8.8 - Arabidopsis
           thaliana>gb:AE005172_891096 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC015447_1537999 Arabidopsis thaliana
           chromosome I BAC F24J8 genomic sequence, complete
           sequence.>gb:AY045833_1561345 Arabidopsis thaliana
           putative scarecrow 1 protein (At1g21450) mRNA, complete
           cds.>gb:AY084492_1569581 Arabidopsis thaliana clone
           109490 mRNA, complete sequence.>gb:AY096626_1576166
           Arabidopsis thaliana unknown protein (At1g21450) mRNA,
           complete cds.>gb:AF210731_1777377 Arabidopsis thaliana
           scarecrow-like 1 (SCL1) mRNA, complete cds.
          Length = 593

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 32/101 (31%), Positives = 45/101 (44%), Gaps = 11/101 (10%)
 Frame = +2

Query: 434 YLIQAYSDRELSSKNGSHARCNSSSTVTFSPYGS-PML--QQEFQSYPLD--------LL 580
           Y + + +D  +    GS A  +S  ++   PY S P+L    EFQ  PLD        LL
Sbjct: 73  YFLDSPTDEFVQHPIGSGASVSSFGSLDSFPYQSRPVLGCSMEFQ-LPLDSTSTSSTRLL 131

Query: 581 HQSPETKYSSPISVSSVTDDMSDFRHKLKELESVMLGPDSD 703
                  YS  + V    DD    R K++ELE  +LG + D
Sbjct: 132 GDYQAVSYSPSMDVVEEFDD-EQMRSKIQELERALLGDEDD 171



>gb:AK050055_1169102 Mus musculus adult male liver tumor cDNA, RIKEN
           full-length enriched library, clone:C730009A15
           product:hypothetical protein, full insert sequence.
          Length = 102

 Score = 33.1 bits (74), Expect = 6.2
 Identities = 25/67 (37%), Positives = 29/67 (43%), Gaps = 7/67 (10%)
 Frame = -3

Query: 542 TWDFHTVRK*RLTMSCNEHDCHFSRTIPDQNKPG--SSSCPRCHCYCGSAGLK-----FE 384
           T  F+T R  R +MSC +  C F R     +  G    S P CH    SAGL      FE
Sbjct: 10  TGQFYTQRGCRDSMSCGKGPCVFERAQGGCHSIGCQPGSHPVCHSEASSAGLYGSWVCFE 69

Query: 383 TEAHSRP 363
            E H  P
Sbjct: 70  IEIHFSP 76



>gb:AE013563_293403 Methanosarcina mazei strain Goe1, section 345 of
           379 of the complete genome.>gb:AE008384_967512
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 1489

 Score = 33.1 bits (74), Expect = 6.2
 Identities = 25/117 (21%), Positives = 51/117 (43%), Gaps = 10/117 (8%)
 Frame = +2

Query: 326 GMSNTLCFQQKAEAYCVPQF-----QILDQLSHSSSDNGGSYLIQAYSDRELSSKNGSHA 490
           G  N+  + Q   A+    F     + L+ +S  ++D+G  Y +  Y+D      N    
Sbjct: 333 GWVNSFGYAQNTSAWAANLFTAEENETLNAVSFYTTDSGAGYDVYIYTDPVSGPLNPEGL 392

Query: 491 RCNSSSTVTFSPYGSPMLQQEF-----QSYPLDLLHQSPETKYSSPISVSSVTDDMS 646
             + + T T++ Y +  L QE      Q++ + L   +P+  Y  P+++    ++ S
Sbjct: 393 EASENGTFTYAGYHTVRLDQEVPLTEGQNFSVVLRLNAPD--YGYPVALECPVEEYS 447



>pir|C86823|C86823 GTP-binding protein Obg [imported] - Lactococcus
           lactis subsp. lactis (strain IL1403)>gb:AE006389_218489
           Lactococcus lactis subsp. lactis IL1403 section 151 of
           218 of the complete genome.>gb:AE005176_1095562
           Lactococcus lactis subsp. lactis IL1403, complete
           genome.
          Length = 437

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 16/62 (25%), Positives = 36/62 (58%)
 Frame = +2

Query: 542 LQQEFQSYPLDLLHQSPETKYSSPISVSSVTDDMSDFRHKLKELESVMLGPDSDVPECYE 721
           +  E +SY L L+ + P+   ++ + +    + +++F+ KL    +  LGPD ++PE +E
Sbjct: 263 INDELESYNLRLMER-PQIIVANKMDMPEAAERLAEFKEKL----AADLGPDKEMPEIFE 317

Query: 722 LT 727
           ++
Sbjct: 318 VS 319


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 791,447,600
Number of Sequences: 1806583
Number of extensions: 15921067
Number of successful extensions: 44875
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 42017
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44576
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 52058138256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)