BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7964
         (877 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF144708_1771987 Pisum sativum Tha4 protein (Tha4) mRNA, comp...   126   5e-28   
gb:AC145379_1744345 Oryza sativa chromosome 3 BAC OSJNBa0010N03 ...   117   2e-25   
gb:AY056276_1563590 Arabidopsis thaliana putative Tha4 protein (...   117   3e-25   
gb:AF145755_1772038 Zea mays THA4 (tha4) mRNA, complete cds; nuc...   115   8e-25   
gb:AF145756_1772039 Zea mays THA9 (tha9) mRNA, complete cds; nuc...   105   9e-22   
gb:AY496565_1609115 Physcomitrella patens chloroplast Tha4-1 mRN...    90   7e-17   
gb:AY496566_1609116 Physcomitrella patens chloroplast Tha4-2 mRN...    89   8e-17   
gb:BX569689_775172 Synechococcus sp. WH8102 complete genome; seg...    84   4e-15   
gb:AP008231_580982 Synechococcus elongatus PCC 6301 DNA, complet...    83   6e-15   
gb:BX572100_799178 Prochlorococcus marinus MIT9313 complete geno...    81   2e-14   
pir|S74990|S74990 hypothetical protein slr1046 - Synechocystis s...    81   2e-14   Synechocystis sp. PCC 6803
gb:BA000039_727169 Thermosynechococcus elongatus BP-1 DNA, compl...    79   2e-13   
pir|AC1912|AC1912 hypothetical protein asl0845 [imported] - Nost...    77   4e-13   Nostoc sp. PCC 7120
gb:AY267647_1314470 Bigelowiella natans Tha4 plastid transport p...    77   6e-13   
gb:AE017161_394740 Prochlorococcus marinus subsp. marinus str. C...    75   2e-12   
gb:BX572091_796000 Prochlorococcus marinus MED4 complete genome;...    70   4e-11   
gb:BX572090_795969 Prochlorococcus marinus MED4 complete genome;...    69   1e-10   
gb:AE017164_395686 Prochlorococcus marinus subsp. marinus str. C...    67   3e-10   
gb:AF237944_1779685 Zea mays HCF106C precursor protein (Hcf106C)...    64   4e-09   
gb:AP008226_577843 Thermus thermophilus HB8 genomic DNA, complet...    64   4e-09   
pir|T01297|T01297 HCF106 protein precursor, chloroplast - maize>...    64   4e-09   Zea mays [maize]
gb:AE017180_398330 Geobacter sulfurreducens PCA, complete genome.      63   7e-09   
gb:AE017301_435658 Thermus thermophilus HB27 section 1 of 7 of t...    62   1e-08   
gb:BA000045_743078 Gloeobacter violaceus PCC 7421 DNA, complete ...    60   4e-08   
gb:CR522870_101466 Desulfotalea psychrophila LSv54 chromosome.         60   4e-08   
gb:AB019226_1514072 Arabidopsis thaliana genomic DNA, chromosome...    59   1e-07   
gb:CR522870_101465 Desulfotalea psychrophila LSv54 chromosome.         58   3e-07   
gb:CR522870_100324 Desulfotalea psychrophila LSv54 chromosome.         57   6e-07   
pir|S77372|S77372 hypothetical protein ssl2823 - Synechocystis s...    57   6e-07   Synechocystis sp. PCC 6803
gb:AF284760_1783095 Pisum sativum HCF106 (HCF106) mRNA, complete...    56   1e-06   
pir|AG2290|AG2290 hypothetical protein asr3878 [imported] - Nost...    56   1e-06   Nostoc sp. PCC 7120
gb:AE017180_401478 Geobacter sulfurreducens PCA, complete genome.      55   1e-06   
gb:AY496567_1609117 Physcomitrella patens chloroplast Hcf106-1 m...    55   2e-06   
gb:BA000045_740786 Gloeobacter violaceus PCC 7421 DNA, complete ...    55   2e-06   
gb:AE012916_287083 Chlorobium tepidum TLS section 137 of 194 of ...    55   2e-06   
gb:AE010411_262833 Methanopyrus kandleri AV19 section 110 of 157...    54   3e-06   
gb:AE017005_377119 Bacillus cereus ATCC 14579 section 8 of 18 of...    54   5e-06   
gb:BA000028_695745 Oceanobacillus iheyensis HTE831 DNA, complete...    53   7e-06   
gb:AE013502_292913 Methanosarcina mazei strain Goe1, section 284...    53   7e-06   
gb:AE017180_399084 Geobacter sulfurreducens PCA, complete genome.      53   9e-06   
pir|D89800|D89800 conserved hypothetical protein SA0335 [importe...    53   9e-06   Staphylococcus aureus subsp. aureus Mu50
gb:AE017333_446203 Bacillus licheniformis DSM 13, complete genom...    52   1e-05   
pir|H83718|H83718 hypothetical protein BH0552 [imported] - Bacil...    52   1e-05   Bacillus halodurans
gb:AE017180_399090 Geobacter sulfurreducens PCA, complete genome.      52   2e-05   
gb:AE017146_390461 Helicobacter hepaticus ATCC 51449 section 3 o...    52   2e-05   
gb:CP000023_874926 Streptococcus thermophilus LMG 18311, complet...    52   2e-05   
gb:AP006840_568421 Symbiobacterium thermophilum DNA, complete ge...    52   2e-05   
gb:AE017312_439295 Desulfovibrio vulgaris subsp. vulgaris str. H...    52   2e-05   
gb:BX842653_825398 Bdellovibrio bacteriovorus complete genome, s...    51   3e-05   
gb:BX571657_777603 Wolinella succinogenes, complete genome; segm...    51   3e-05   
gb:BX569695_777390 Synechococcus sp. WH8102 complete genome; seg...    51   3e-05   
gb:BA000028_696125 Oceanobacillus iheyensis HTE831 DNA, complete...    51   3e-05   
gb:AP006627_563197 Bacillus clausii KSM-K16 DNA, complete genome.      51   3e-05   
gb:AE012908_286985 Chlorobium tepidum TLS section 129 of 194 of ...    51   3e-05   
gb:SCO939109_175308 Streptomyces coelicolor A3(2) complete genom...    51   3e-05   
pir|A84138|A84138 hypothetical protein BH3905 [imported] - Bacil...    51   3e-05   Bacillus halodurans
pir|E75537|E75537 conserved hypothetical protein - Deinococcus r...    51   3e-05   Deinococcus radiodurans
gb:AP006840_569083 Symbiobacterium thermophilum DNA, complete ge...    50   4e-05   
sp|O25088|TATA_HELPY|TATA_HELPY Sec-independent protein translocase protein...    50   4e-05   Helicobacter pylori
gb:AE017313_439618 Desulfovibrio vulgaris subsp. vulgaris str. H...    50   6e-05   
pir|B69787|B69787 hypothetical protein ydiI - Bacillus subtilis>...    50   6e-05   Bacillus subtilis
pir|AF1480|AF1480 conserved hypothetical protein homolog lin0381...    50   7e-05   Listeria innocua
pir|AC1120|AC1120 conserved hypothetical protein homolog lmo0362...    50   7e-05   Listeria monocytogenes
gb:CP000020_870225 Vibrio fischeri ES114 chromosome I, complete ...    49   1e-04   
pir|A69767|A69767 conserved hypothetical protein yczB - Bacillus...    49   1e-04   Bacillus subtilis
sp|Q8DDQ2|TATA_VIBVU|TATA_VIBVU Sec-independent protein translocase protein...    49   1e-04   Vibrio vulnificus
gb:BA000037_721006 Vibrio vulnificus YJ016 DNA, chromosome I, co...    49   2e-04   
gb:AE017333_446523 Bacillus licheniformis DSM 13, complete genom...    49   2e-04   
gb:BX842656_826590 Bdellovibrio bacteriovorus complete genome, s...    48   3e-04   
gb:BA000043_738092 Geobacillus kaustophilus HTA426 DNA, complete...    48   3e-04   
gb:AE016943_363468 Bacteroides thetaiotaomicron VPI-5482, sectio...    48   3e-04   
gb:BA000030_704579 Streptomyces avermitilis MA-4680 genomic DNA,...    47   5e-04   
gb:AE013502_292914 Methanosarcina mazei strain Goe1, section 284...    47   5e-04   
pir|E65188|E65188 hypothetical 11.3 kD protein in udp-rfaH inter...    47   5e-04   Escherichia coli K-12
pir|D86071|D86071 hypothetical protein tatA [imported] - Escheri...    47   5e-04   Escherichia coli [E. coli]
sp|Q9ZMB8|TATA_HELPJ|TATA_HELPJ Sec-independent protein translocase protein...    47   5e-04   Helicobacter pylori
gb:AE017233_412535 Mycobacterium avium subsp. paratuberculosis s...    47   6e-04   
sp|O66478|TAT1_AQUAE|TAT1_AQUAE Sec-independent protein translocase tatA/E-...    47   6e-04   Aquifex aeolicus
gb:AY596297_632008 Haloarcula marismortui ATCC 43049 chromosome ...    46   8e-04   
gb:AP006841_571419 Bacteroides fragilis YCH46 DNA, complete genome.    46   8e-04   
gb:CR555306_106094 Azoarcus sp. EbN1 complete genome.                  46   8e-04   
gb:CP000027_80556 Dehalococcoides ethenogenes 195, complete genome.    45   0.001   
gb:AE011056_268787 Methanosarcina acetivorans str. C2A, section ...    45   0.002   
pir|D84237|D84237 hypothetical protein Vng0801c [imported] - Hal...    45   0.002   Halobacterium salinarum
pir|E87075|E87075 probable secreted protein [imported] - Mycobac...    45   0.002   Mycobacterium leprae
sp|P54079|TATA_MYCLE|TATA_MYCLE Sec-independent protein translocase protein...    45   0.002   Mycobacterium leprae
gb:BX571659_778234 Wolinella succinogenes, complete genome; segm...    45   0.002   
gb:AE017340_458123 Idiomarina loihiensis L2TR, complete genome.        45   0.002   
sp|P57050|TATE_SALTY|TATE_SALTY Sec-independent protein translocase protein...    45   0.002   Salmonella enterica subsp. enterica serovar Typhimurium
gb:BX842652_825061 Bdellovibrio bacteriovorus complete genome, s...    44   0.003   
gb:AE011056_268788 Methanosarcina acetivorans str. C2A, section ...    44   0.003   
pir|AC2786|AC2786 SEC-independent protein translocase protein [i...    44   0.004   Agrobacterium fabrum str. C58
sp|Q8UEQ0|TATB_AGRT5|TATB_AGRT5 Sec-independent protein translocase protein...    44   0.004   Agrobacterium tumefaciens
sp|O65938|TATA_ECOLI|TATA_ECOLI Sec-independent protein translocase protein...    44   0.004   Escherichia coli [E. coli]
gb:AE016777_330479 Pseudomonas putida KT2440 section 4 of 21 of ...    44   0.005   
gb:CR378663_93535 Photobacterium profundum SS9; segment 1/12.          44   0.005   
pir|C69894|C69894 conserved hypothetical protein ynzA - Bacillus...    44   0.005   Bacillus subtilis
sp|Q87TH1|TATA_VIBPA|TATA_VIBPA Sec-independent protein translocase protein...    44   0.005   
gb:BX248357_762520 Corynebacterium diphtheriae gravis NCTC13129,...    43   0.007   
gb:AE017301_435902 Thermus thermophilus HB27 section 1 of 7 of t...    43   0.007   
gb:AE016827_342129 Mannheimia succiniciproducens MBEL55E, comple...    43   0.007   
sp|P57051|TATA_VIBCH|TATA_VIBCH Sec-independent protein translocase protein...    43   0.007   
gb:AE017317_440694 Desulfovibrio vulgaris subsp. vulgaris str. H...    43   0.009   
pir|G69506|G69506 conserved hypothetical protein AF2056 - Archae...    43   0.009   Archaeoglobus fulgidus
sp|P57045|TATA_SALTY|TATA_SALTY Sec-independent protein translocase protein...    43   0.009   Salmonella enterica subsp. enterica serovar Typhimurium
gb:CR767821_116674 Ehrlichia ruminantium strain Welgevonden, com...    42   0.012   
gb:AE000516_22208 Mycobacterium tuberculosis CDC1551, complete g...    42   0.012   
pir|B64145|B64145 hypothetical protein HI0187 - Haemophilus infl...    42   0.012   Haemophilus influenzae
sp|Q9CKD3|TATA_PASMU|TATA_PASMU Sec-independent protein translocase protein...    42   0.012   Pasteurella multocida
sp|Q10703|TATA_MYCTU|TATA_MYCTU Sec-independent protein translocase protein...    42   0.012   Mycobacterium tuberculosis
sp|P57046|TATA_HAEIN|TATA_HAEIN Sec-independent protein translocase protein...    42   0.012   Haemophilus influenzae
gb:AF462068_513620 Rhizobium leguminosarum bv. viciae Sec-indepe...    42   0.020   
gb:AE009826_256177 Pyrobaculum aerophilum strain IM2 section 81 ...    42   0.020   
gb:BX571965_792926 Burkholderia pseudomallei strain K96243, chro...    41   0.027   
gb:AP006840_569646 Symbiobacterium thermophilum DNA, complete ge...    41   0.027   
gb:AE017282_428242 Methylococcus capsulatus str. Bath, complete ...    41   0.027   
pir|C90494|C90494 conserved hypothetical protein [imported] - Su...    41   0.027   Saccharolobus solfataricus
sp|P25895|TATE_ECOLI|TATE_ECOLI Sec-independent protein translocase protein...    41   0.027   Escherichia coli [E. coli]
gb:BA000043_736820 Geobacillus kaustophilus HTA426 DNA, complete...    41   0.035   
gb:BA000036_720779 Corynebacterium glutamicum ATCC 13032 DNA, co...    41   0.035   
gb:BX640422_808162 Bordetella pertussis strain Tohama I, complet...    40   0.059   
gb:BA000035_717380 Corynebacterium efficiens YS-314 DNA, complet...    40   0.059   
gb:BA000035_716403 Corynebacterium efficiens YS-314 DNA, complet...    40   0.059   
gb:AE016792_334396 Pseudomonas putida KT2440 section 19 of 21 of...    40   0.059   
gb:ECOUW85_131386 E. coli genomic sequence of the region from 84...    40   0.059   
gb:ECOLIP_129274 Escherichia coli lipoic acid synthetase (lip) g...    40   0.059   
pir|A82448|A82448 tatA protein VCA0533 [imported] - Vibrio chole...    40   0.059   Vibrio cholerae
pir|S30727|S30727 hypothetical protein o261 - Escherichia coli         40   0.059   Escherichia coli K-12
sp|P57063|TATB_VIBCH|TATB_VIBCH Sec-independent protein translocase protein...    40   0.059   
sp|O66477|TAT2_AQUAE|TAT2_AQUAE Sec-independent protein translocase tatA/E-...    40   0.059   Aquifex aeolicus
gb:BX640436_812508 Bordetella parapertussis strain 12822, comple...    40   0.077   
gb:AE017152_392234 Haemophilus ducreyi strain 35000HP section 2 ...    40   0.077   
gb:AE015852_318513 Shewanella oneidensis MR-1 section 401 of 457...    40   0.077   
gb:CP000031_86690 Silicibacter pomeroyi DSS-3, complete genome.        40   0.077   
pir|B75473|B75473 conserved hypothetical protein - Deinococcus r...    40   0.077   Deinococcus radiodurans
gb:BX294143_768452 Pirellula sp. strain 1 complete genome; segme...    39   0.10    
gb:CP000027_80558 Dehalococcoides ethenogenes 195, complete genome.    39   0.10    
gb:ACU48404_18812 Azotobacter chroococcum ORF1, ORF2, ORF3, ORF4...    39   0.10    
pir|D90193|D90193 conserved hypothetical protein [imported] - Su...    39   0.10    Saccharolobus solfataricus
sp|Q8DDQ3|TATB_VIBVU|TATB_VIBVU Sec-independent protein translocase protein...    39   0.10    Vibrio vulnificus
sp|Q87TH0|TATB_VIBPA|TATB_VIBPA Sec-independent protein translocase protein...    39   0.10    
sp|P72267|TATA_RHOER|TATA_RHOER Sec-independent protein translocase protein...    39   0.10    Rhodococcus erythropolis
gb:AF461118_513422 Ralstonia eutropha strain H16 tat gene cluste...    39   0.13    
gb:AE014291_308323 Brucella suis 1330 chromosome I, complete seq...    39   0.13    
gb:AAM320523_61 Acidianus ambivalens partial ORF1, sdhF gene, sd...    39   0.13    
sp|Q9K0J6|TATB_NEIMB|TATB_NEIMB Sec-independent protein translocase protein...    39   0.13    Neisseria meningitidis serogroup B
sp|Q9JVK1|TATB_NEIMA|TATB_NEIMA Sec-independent protein translocase protein...    39   0.13    
gb:BA000040_733010 Bradyrhizobium japonicum USDA 110 DNA, comple...    39   0.17    
gb:AE016792_334395 Pseudomonas putida KT2440 section 19 of 21 of...    39   0.17    
gb:AY657288_2146298 Synthetic construct Peudomonas aeruginosa cl...    38   0.22    
gb:AP006618_559560 Nocardia farcinica IFM 10152 DNA, complete ge...    38   0.22    
gb:AE011365_272163 Leptospira interrogans serovar lai str. 56601...    38   0.22    
sp|Q9HUB4|TATB_PSEAE|TATB_PSEAE Sec-independent protein translocase protein...    38   0.22    Pseudomonas aeruginosa
sp|Q8NQE4|TATA_CORGL|TATA_CORGL Sec-independent protein translocase protein...    38   0.22    Corynebacterium glutamicum
gb:BA000023_693305 Sulfolobus tokodaii str. 7 DNA, complete genome.    38   0.29    
sp|Q9PFU4|TATB_XYLFA|TATB_XYLFA Sec-independent protein translocase protein...    38   0.29    Xylella fastidiosa
gb:BX936398_834904 Yersinia pseudotuberculosis IP32953 genome, c...    37   0.38    
gb:AE016874_354493 Pseudomonas syringae pv. tomato str. DC3000 s...    37   0.38    
sp|Q8ZAM3|TATB_YERPE|TATB_YERPE Sec-independent protein translocase protein...    37   0.38    Yersinia pestis
sp|P57047|TATB_HAEIN|TATB_HAEIN Sec-independent protein translocase protein...    37   0.38    Haemophilus influenzae
gb:BA000023_691177 Sulfolobus tokodaii str. 7 DNA, complete genome.    37   0.50    
sp|Q8XV90|TATB_RALSO|TATB_RALSO Sec-independent protein translocase protein...    37   0.50    Ralstonia solanacearum
gb:AE017282_428241 Methylococcus capsulatus str. Bath, complete ...    37   0.65    
gb:AE017148_391242 Helicobacter hepaticus ATCC 51449 section 5 o...    37   0.65    
gb:AE016874_354494 Pseudomonas syringae pv. tomato str. DC3000 s...    37   0.65    
gb:SLI292256_183638 Streptomyces lividans putative tatB gene for...    37   0.65    
gb:SCO939117_177440 Streptomyces coelicolor A3(2) complete genom...    37   0.65    
gb:DFR439608_124097 Desulfitobacterium hafniense composite trans...    37   0.65    
gb:CR543861_103471 Acinetobacter sp. ADP1 complete genome.             37   0.65    
gb:CP000027_80557 Dehalococcoides ethenogenes 195, complete genome.    37   0.65    
gb:AE004969_59966 Neisseria gonorrhoeae FA 1090, complete genome.      37   0.65    
sp|Q87B79|TATB_XYLFT|TATB_XYLFT Sec-independent protein translocase protein...    37   0.65    Xylella fastidiosa
sp|Q9FBK8|TATB_STRCO|TATB_STRCO Sec-independent protein translocase protein...    37   0.65    
gb:CP000020_870226 Vibrio fischeri ES114 chromosome I, complete ...    36   0.85    
gb:BX640422_808161 Bordetella pertussis strain Tohama I, complet...    36   0.85    
gb:AF461118_513421 Ralstonia eutropha strain H16 tat gene cluste...    36   0.85    
gb:AE016912_355584 Chromobacterium violaceum ATCC 12472 section ...    36   0.85    
gb:AE013598_298108 Xanthomonas oryzae pv. oryzae KACC10331, comp...    36   0.85    
gb:CR378663_93536 Photobacterium profundum SS9; segment 1/12.          36   0.85    
sp|Q8PEX3|TATB_XANAC|TATB_XANAC Sec-independent protein translocase protein...    36   0.85    Xanthomonas citri
sp|Q8E9R3|TATB_SHEON|TATB_SHEON Sec-independent protein translocase protein...    36   0.85    Shewanella oneidensis
sp|Q9PNB9|TATA_CAMJE|TATA_CAMJE Sec-independent protein translocase protein...    36   0.85    
gb:BX321858_772966 Nitrosomonas europaea ATCC 19718, complete ge...    36   1.1     
gb:BA000030_701000 Streptomyces avermitilis MA-4680 genomic DNA,...    36   1.1     
gb:CR628336_113090 Legionella pneumophila str. Paris complete ge...    36   1.1     
sp|P57800|TATB_PASMU|TATB_PASMU Sec-independent protein translocase protein...    36   1.1     Pasteurella multocida
gb:AE016822_339961 Leifsonia xyli subsp. xyli str. CTCB07, compl...    35   1.5     
gb:AE016777_330480 Pseudomonas putida KT2440 section 4 of 21 of ...    35   1.5     
gb:AE014291_308322 Brucella suis 1330 chromosome I, complete seq...    35   1.5     
gb:LPN276399_141890 Legionella pneumophila tatA gene.                  35   1.5     
sp|Q8YGS4|TATA_BRUME|TATA_BRUME Sec-independent protein translocase protein...    35   1.5     
gb:BX294143_768451 Pirellula sp. strain 1 complete genome; segme...    35   1.9     
gb:AE017256_417957 Wolbachia endosymbiont of Drosophila melanoga...    35   1.9     
gb:AAM320523_62 Acidianus ambivalens partial ORF1, sdhF gene, sd...    35   1.9     
sp|Q92Q24|TATB_RHIME|TATB_RHIME Sec-independent protein translocase protein...    35   1.9     Sinorhizobium meliloti
sp|O25700|TATB_HELPY|TATB_HELPY Sec-independent protein translocase protein...    35   1.9     Helicobacter pylori
sp|Q9PHT7|TATB_CAMJE|TATB_CAMJE Sec-independent protein translocase protein...    35   1.9     
sp|Q8P3H9|TATB_XANCP|TATB_XANCP Sec-independent protein translocase protein...    35   2.5     Xanthomonas campestris pv. campestris
sp|Q9ZM58|TATB_HELPJ|TATB_HELPJ Sec-independent protein translocase protein...    35   2.5     Helicobacter pylori
gb:BX950851_838956 Erwinia carotovora subsp. atroseptica SCRI104...    34   3.2     
gb:BX321858_772967 Nitrosomonas europaea ATCC 19718, complete ge...    34   3.2     
gb:AE017340_456998 Idiomarina loihiensis L2TR, complete genome.        34   3.2     
sp|P57048|TATB_SALTY|TATB_SALTY Sec-independent protein translocase protein...    34   3.2     Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q8Z3C0|TATB_SALTI|TATB_SALTI Sec-independent protein translocase protein...    34   3.2     Salmonella enterica subsp. enterica serovar Typhi
gb:BX640451_817512 Bordetella bronchiseptica strain RB50, comple...    34   4.2     
gb:BX251411_764647 Tropheryma whipplei TW08/27, complete genome;...    34   4.2     
gb:CP000031_86691 Silicibacter pomeroyi DSS-3, complete genome.        34   4.2     
gb:CP000010_866837 Burkholderia mallei ATCC 23344 chromosome 1, ...    33   5.5     
gb:BX572602_802461 Rhodopseudomonas palustris CGA009 complete ge...    33   5.5     
gb:BX571965_792925 Burkholderia pseudomallei strain K96243, chro...    33   5.5     
gb:AE017283_430431 Propionibacterium acnes KPA171202, complete g...    33   5.5     
gb:AE017261_420149 Picrophilus torridus DSM 9790, complete genome.     33   5.5     
gb:AE013146_289557 Thermoanaerobacter tengcongensis MB4, section...    33   5.5     
gb:PST299712_161652 Pseudomonas stutzeri tatA gene, tatB gene an...    33   7.2     
gb:BX897699_827186 Bartonella henselae strain Houston-1, complet...    33   9.4     
gb:AE016912_355585 Chromobacterium violaceum ATCC 12472 section ...    33   9.4     
gb:AE016827_342130 Mannheimia succiniciproducens MBEL55E, comple...    33   9.4     


>gb:AF144708_1771987 Pisum sativum Tha4 protein (Tha4) mRNA,
           complete cds; nuclear gene for chloroplast product.
          Length = 137

 Score =  126 bits (317), Expect = 5e-28
 Identities = 64/105 (60%), Positives = 81/105 (77%)
 Frame = +1

Query: 304 SLGLRTCNVRSNGRKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSF 483
           SL L+   +++   K   CN  FGLGVPELVVIAGV AL+FGPKKLPE+GRSIG+T+KSF
Sbjct: 37  SLLLKKARIKTRTTKGFTCNAFFGLGVPELVVIAGVAALVFGPKKLPEVGRSIGQTVKSF 96

Query: 484 QQAAKEFETELKKEPDSLAQAPSEGVEEINQQEKRDATVSSTKED 618
           QQAAKEFETELKKEP+     P+E +   ++QEK++  VSSTK++
Sbjct: 97  QQAAKEFETELKKEPN-----PTEEISVASEQEKQEIKVSSTKDN 136



>gb:AC145379_1744345 Oryza sativa chromosome 3 BAC OSJNBa0010N03
           genomic sequence, complete sequence.
          Length = 170

 Score =  117 bits (294), Expect = 2e-25
 Identities = 72/160 (45%), Positives = 88/160 (55%), Gaps = 5/160 (3%)
 Frame = +1

Query: 157 SSPGNRYLEMAAIASAVSLSFAPKPTXXXXXXXXXXXXXXXXNPGGLKRSLGLRT---CN 327
           SS  +  L     A+A   + A +                    GGL  ++  RT     
Sbjct: 11  SSSSSSTLARPPCAAAGRAAAAGRARVAAAGMSSRASSFVTGGAGGLAVAVAARTRAGSG 70

Query: 328 VRSNGRKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFE 507
             S G   + C CLFGLGVPELVVIAGV AL+FGPK+LPEIGRSIGKT+KSFQQAAKEFE
Sbjct: 71  AGSRGGGAMGCKCLFGLGVPELVVIAGVAALVFGPKQLPEIGRSIGKTVKSFQQAAKEFE 130

Query: 508 TELKKEPDSLAQAPSEGVEEI--NQQEKRDATVSSTKEDS 621
           TELKKE D     P    E    +  E+++   SS+KE +
Sbjct: 131 TELKKESDDGGDQPPPPTETAVSDGGEEKELEASSSKEST 170



>gb:AY056276_1563590 Arabidopsis thaliana putative Tha4 protein
           (At5g28750) mRNA, complete cds.>gb:AY091429_1574629
           Arabidopsis thaliana putative Tha4 protein (At5g28750)
           mRNA, complete cds.>gb:T32B20_1723994 Arabidopsis
           thaliana BAC T32B20.>gb:AF325006_1786460 Arabidopsis
           thaliana AT5g28750 (AT5g28750/T32B20_40) mRNA, complete
           cds.
          Length = 147

 Score =  117 bits (293), Expect = 3e-25
 Identities = 59/92 (64%), Positives = 70/92 (76%)
 Frame = +1

Query: 343 RKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           RK L CN LFGLGVPEL VIAGV AL+FGPKKLPEIG+SIGKT+KSFQQAAKEFE+ELK 
Sbjct: 55  RKPLTCNALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT 114

Query: 523 EPDSLAQAPSEGVEEINQQEKRDATVSSTKED 618
           EP+      S+      ++EK+    SS+KE+
Sbjct: 115 EPEESVAESSQVATSNKEEEKKTEVSSSSKEN 146



>gb:AF145755_1772038 Zea mays THA4 (tha4) mRNA, complete cds;
           nuclear gene for chloroplast product.
          Length = 170

 Score =  115 bits (289), Expect = 8e-25
 Identities = 63/107 (58%), Positives = 74/107 (69%), Gaps = 1/107 (0%)
 Frame = +1

Query: 304 SLGLRTCNVRSNGRKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSF 483
           S+  R     S G   L C CLFGLGVPEL VIAGV AL+FGPK+LPEIGRSIGKT+KSF
Sbjct: 64  SVAARPRRAGSGGGGALGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRSIGKTVKSF 123

Query: 484 QQAAKEFETELKKEP-DSLAQAPSEGVEEINQQEKRDATVSSTKEDS 621
           QQAAKEFETELKKEP +   Q P      ++  E++    SS+KE +
Sbjct: 124 QQAAKEFETELKKEPGEGGDQPPPATPTAVSGGEEKGLEASSSKESA 170



>gb:AF145756_1772039 Zea mays THA9 (tha9) mRNA, complete cds;
           nuclear gene for chloroplast product.
          Length = 169

 Score =  105 bits (263), Expect = 9e-22
 Identities = 56/90 (62%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +1

Query: 289 GGLKRSLGLRTCNVRSNGRKR---LYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRS 459
           GGL   +       R  G  R   L C CLFGLGVPEL VIAGV AL+FGPK+LPEIGRS
Sbjct: 46  GGLAAVVASVAARPRRAGSGRGDALGCKCLFGLGVPELAVIAGVAALVFGPKQLPEIGRS 105

Query: 460 IGKTLKSFQQAAKEFETELKKEPDSLAQAP 549
           +GKT+KSFQ+AAKEFE+ELKKEP      P
Sbjct: 106 LGKTVKSFQEAAKEFESELKKEPGEGGDQP 135



>gb:AY496565_1609115 Physcomitrella patens chloroplast Tha4-1 mRNA,
           complete cds; nuclear gene for chloroplast product.
          Length = 164

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 52/102 (50%), Positives = 64/102 (62%), Gaps = 9/102 (8%)
 Frame = +1

Query: 283 NPGGLKRSLGLRTCNVRSNGRKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSI 462
           N G +      R    R  GR  + C  LFGLGVPEL VIAGV AL+FGPK+LP IG+S+
Sbjct: 58  NDGRILLRTAARPVERRRQGRFEV-CG-LFGLGVPELAVIAGVAALVFGPKQLPAIGKSL 115

Query: 463 GKTLKSFQQAAKEFETELKKEPDS---------LAQAPSEGV 561
           GKT+KSFQ AAKEFE+E+ K  +S         + + P EGV
Sbjct: 116 GKTVKSFQTAAKEFESEISKAKESGEEGQDSTAVGETPKEGV 157



>gb:AY496566_1609116 Physcomitrella patens chloroplast Tha4-2 mRNA,
           complete cds; nuclear gene for chloroplast product.
          Length = 159

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 45/85 (52%), Positives = 61/85 (71%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           LFGLGVPEL VIAGV AL+FGPK+LP+IG+ +G+T+ SFQQAAKEFETE+KK+    +  
Sbjct: 77  LFGLGVPELAVIAGVAALLFGPKQLPQIGKKLGQTVTSFQQAAKEFETEVKKD----SGE 132

Query: 547 PSEGVEEINQQEKRDATVSSTKEDS 621
             E   ++ +  + ++   S  EDS
Sbjct: 133 AQENDVKLEEPRRTESVTPSKPEDS 157



>gb:BX569689_775172 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 77

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 39/75 (52%), Positives = 51/75 (68%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FG+G+PE+ VI  V  L+FGPK+LPE+GR++GKTLK FQ A+KEFE E+ K      Q 
Sbjct: 3   VFGVGLPEMAVIGAVALLVFGPKRLPELGRTLGKTLKGFQSASKEFEREINKAMAEPEQL 62

Query: 547 PSEGVEEINQQEKRD 591
           PS  VE  N +   D
Sbjct: 63  PSSDVEASNAKPSND 77



>gb:AP008231_580982 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 91

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 36/66 (54%), Positives = 50/66 (75%)
 Frame = +1

Query: 370 FGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAP 549
           FG+G+PE++VI  +  L+FGPKKLPEIGRS+GK L+ FQ A++EFE+E+K+E D     P
Sbjct: 4   FGIGLPEMLVILAIALLVFGPKKLPEIGRSLGKALRGFQDASREFESEIKREIDRTPATP 63

Query: 550 SEGVEE 567
           +E   E
Sbjct: 64  AEATVE 69



>gb:BX572100_799178 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 91

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 37/66 (56%), Positives = 51/66 (77%), Gaps = 3/66 (4%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDSL 537
           +FG+G+PE+ VI  +  L+FGPK+LPE GR++GKTLK FQ A+KEFE E+ K   EP+S+
Sbjct: 3   VFGIGLPEMAVIGAIALLVFGPKRLPEFGRTLGKTLKGFQAASKEFEREIHKTMAEPESI 62

Query: 538 AQAPSE 555
            QA +E
Sbjct: 63  EQAATE 68



>pir|S74990|S74990 hypothetical protein slr1046 - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_687809 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 126

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 39/82 (47%), Positives = 61/82 (74%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FG+G+PEL +I  +  L+FGPKKLPE+GRS+GK L+ FQ+A+KEFETELK+E  +L ++
Sbjct: 44  IFGIGLPELGLIFVIALLVFGPKKLPEVGRSLGKALRGFQEASKEFETELKREAQNLEKS 103

Query: 547 PSEGVEEINQQEKRDATVSSTK 612
             +   E+ + +  +++ SS K
Sbjct: 104 -VQIKAELEESKTPESSSSSEK 124



>gb:BA000039_727169 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 77

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 38/74 (51%), Positives = 56/74 (75%), Gaps = 5/74 (6%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK-----EPD 531
           +FG+G+PEL+VI  V  LIFGPKKLPEIGRS+GKT ++F++A++EF+ E+K+     E +
Sbjct: 3   VFGIGLPELIVILVVALLIFGPKKLPEIGRSLGKTKRAFEEASREFQDEIKRQTAALEEE 62

Query: 532 SLAQAPSEGVEEIN 573
             A+A +E   EI+
Sbjct: 63  QQAKAEAESPREIS 76



>pir|AC1912|AC1912 hypothetical protein asl0845 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681836 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 90

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 34/60 (56%), Positives = 48/60 (80%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FG+G+PE+ +I  V  LIFGPKKLPEIGRS+GK ++ FQ+A+ EF++E K+E + L QA
Sbjct: 3   IFGIGLPEMGLIMVVALLIFGPKKLPEIGRSMGKAIRGFQEASNEFQSEFKREAEQLEQA 62



>gb:AY267647_1314470 Bigelowiella natans Tha4 plastid transport
           protein mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 201

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 42/87 (48%), Positives = 53/87 (60%), Gaps = 2/87 (2%)
 Frame = +1

Query: 334 SNGRKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETE 513
           S+  + +  N LFGLG+PELVVI GV ALIFGP KLPE G+ +G T KS   A KEF  E
Sbjct: 113 SSPDREVSVNSLFGLGLPELVVIGGVAALIFGPSKLPEFGKQLGVTAKSLGSAVKEFNEE 172

Query: 514 LKKE--PDSLAQAPSEGVEEINQQEKR 588
           LK E   +    A  + V E  + E++
Sbjct: 173 LKDELKTEEENAAAKDAVSESKKTEEK 199



>gb:AE017161_394740 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030409 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 84

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 36/72 (50%), Positives = 51/72 (70%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FG+G+PE+ VIA +   IFGPKKLP +GR +GKTL+S Q+A+ EFE EL+K     A +
Sbjct: 3   IFGIGLPEIAVIAAIALFIFGPKKLPALGRGLGKTLRSLQKASSEFENELQK-----AVS 57

Query: 547 PSEGVEEINQQE 582
            S+  ++ NQ E
Sbjct: 58  ASDKTDQGNQHE 69



>gb:BX572091_796000 Prochlorococcus marinus MED4 complete genome;
           segment 2/5.
          Length = 63

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 30/52 (57%), Positives = 44/52 (84%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           +FG+G+PE++VI  +  LIFGPK+LP++G++IGKTLK  Q A+KEFE+E+ K
Sbjct: 3   IFGIGLPEIIVILILGLLIFGPKRLPQLGKTIGKTLKGIQTASKEFESEINK 54



>gb:BX572090_795969 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 96

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 35/93 (37%), Positives = 63/93 (67%), Gaps = 10/93 (10%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETEL-----KKEPD 531
           +FG+G+PE+ VI  +  LIFGPKKLPE+G+ +GKTLKS ++A+ EF+ E+     + E +
Sbjct: 3   IFGVGLPEVTVILILALLIFGPKKLPELGKQLGKTLKSLKKASNEFQNEIDQVINEPESE 62

Query: 532 SLAQAP----SEGVEEINQQ-EKRDATVSSTKE 615
           +L ++P    +  ++++ ++ E++D + S   E
Sbjct: 63  NLPKSPQKKFTNDLDQVTKESEEKDLSESDNNE 95



>gb:AE017164_395686 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031355 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 85

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 30/52 (57%), Positives = 42/52 (80%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           +FG+G+PE+ VIA +  +IFGPK+LPE GR IGKT+KS Q+A+ EFE E+ +
Sbjct: 3   IFGVGLPEIAVIAVLGLIIFGPKRLPEFGRMIGKTVKSLQKASLEFEDEVNR 54



>gb:AF237944_1779685 Zea mays HCF106C precursor protein (Hcf106C)
           gene, complete cds; chloroplast gene for chloroplast
           product.>gb:AF237945_1779686 Zea mays HCF106C precursor
           protein (Hcf106C) mRNA, complete cds; chloroplast gene
           for chloroplast product.
          Length = 238

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 31/91 (34%), Positives = 53/91 (58%)
 Frame = +1

Query: 343 RKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           R+ + C  LFG+G PE +VI  V  L+FGPK L E+ R++GKTL++FQ   +E +   ++
Sbjct: 60  RRNVICASLFGVGAPEALVIGVVALLVFGPKGLAEVARNLGKTLRAFQPTIREIQDVSRE 119

Query: 523 EPDSLAQAPSEGVEEINQQEKRDATVSSTKE 615
              +L +    G++E++Q      T  +  +
Sbjct: 120 FRSTLER--EIGIDEVSQSTNYTPTTMNNNQ 148



>gb:AP008226_577843 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 73

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 29/70 (41%), Positives = 48/70 (68%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSE 555
           LG+PE++VI  V  LIFGP+KLPE+GRS+G++++ F++ A+E   EL+K  +   +    
Sbjct: 3   LGMPEILVILLVALLIFGPRKLPELGRSLGQSIREFKRGAQEIREELEKSIEVKDEPKPA 62

Query: 556 GVEEINQQEK 585
            V+E  ++ K
Sbjct: 63  AVQEAKEEPK 72



>pir|T01297|T01297 HCF106 protein precursor, chloroplast -
           maize>gb:AF027808_1762321 Zea mays HCF106 precursor
           protein (Hcf106) mRNA, nuclear gene encoding chloroplast
           protein, complete cds.
          Length = 243

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 32/92 (34%), Positives = 57/92 (61%), Gaps = 1/92 (1%)
 Frame = +1

Query: 343 RKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           R+ + C  LFG+G PE +VI  V  L+FGPK L E+ R++GKTL++FQ   +E +   ++
Sbjct: 62  RRNVICASLFGVGAPEALVIGVVALLVFGPKGLAEVARNLGKTLRAFQPTIRELQDVSRE 121

Query: 523 EPDSLAQAPSEGVEEINQQEK-RDATVSSTKE 615
              +L +    G++E++Q    R  T+++ ++
Sbjct: 122 FRSTLER--EIGIDEVSQSTNYRPTTMNNNQQ 151



>gb:AE017180_398330 Geobacter sulfurreducens PCA, complete genome.
          Length = 111

 Score = 63.2 bits (152), Expect = 7e-09
 Identities = 31/84 (36%), Positives = 51/84 (60%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FG+G+PEL+VI  +  ++ GP+KLP+I RS+GK L  F++A+ +F+  L +E  +L   
Sbjct: 1   MFGIGMPELIVILVIALIVIGPQKLPDIARSLGKGLAEFKRASDDFQRNLAEEVRTL--- 57

Query: 547 PSEGVEEINQQEKRDATVSSTKED 618
                +E  + EK +A     K D
Sbjct: 58  -----DEKEKAEKGEAAAEPVKRD 76



>gb:AE017301_435658 Thermus thermophilus HB27 section 1 of 7 of the
           complete genome.>gb:AE017221_1077636 Thermus
           thermophilus HB27 complete genome.
          Length = 73

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 28/70 (40%), Positives = 47/70 (67%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSE 555
           LG+PE++VI  V  LIFGP+KLPE+GRS+G++++ F++ A+E   EL+K  +   +    
Sbjct: 3   LGMPEILVILLVALLIFGPRKLPELGRSLGQSIREFKRGAQEIREELEKSIEVKDEPKPA 62

Query: 556 GVEEINQQEK 585
             +E  ++ K
Sbjct: 63  AAQEAKEEPK 72



>gb:BA000045_743078 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 94

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 25/53 (47%), Positives = 40/53 (75%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           LFG+G  EL+VI  V  L+FGPKKLPE+ +++GK ++  +  +++FE E+K+E
Sbjct: 3   LFGVGPLELLVIGTVALLVFGPKKLPELAQNVGKVMRGLKDVSRDFEREVKRE 55



>gb:CR522870_101466 Desulfotalea psychrophila LSv54 chromosome.
          Length = 84

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FGLG PEL+VI  +  LIFG KKLP++G S+G+ +KSF+Q   + E   K   D +   
Sbjct: 1   MFGLGAPELIVILVIVILIFGGKKLPKLGSSLGQAMKSFKQGVSDVE---KGSKDIMGDI 57

Query: 547 PSEGVEEINQQEKR 588
           P  GV+E  + +++
Sbjct: 58  P--GVQEATELKEK 69



>gb:AB019226_1514072 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K24M7.>gb:BT005414_1638354 Arabidopsis
           thaliana clone U51172 putative HCF106 protein
           (At5g52440) mRNA, complete cds.>gb:AF139188_1771398
           Arabidopsis thaliana HCF106 mRNA, complete cds; nuclear
           gene for chloroplast product.>gb:AK118733_1816696
           Arabidopsis thaliana At5g52440 mRNA for putative HCF106,
           complete cds, clone: RAFL21-08-G12.
          Length = 260

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 6/78 (7%)
 Frame = +1

Query: 292 GLKRSLGLRTCNVRSNGRKRLYCNC------LFGLGVPELVVIAGVTALIFGPKKLPEIG 453
           GLK  LG+      SN  K+  C        LFG+G PE +VI  V  L+FGPK L E+ 
Sbjct: 56  GLKH-LGISISPKSSNPEKKRRCKSMMIRASLFGVGAPEALVIGVVALLVFGPKGLAEVA 114

Query: 454 RSIGKTLKSFQQAAKEFE 507
           R++GKTL++FQ   +E +
Sbjct: 115 RNLGKTLRTFQPTIRELQ 132



>gb:CR522870_101465 Desulfotalea psychrophila LSv54 chromosome.
          Length = 66

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELK 519
           +FGLG+PEL+VI  +  +IFG  KLPEIG  IGK +K+F++A K  E   K
Sbjct: 1   MFGLGMPELIVILVIIVIIFGAGKLPEIGSGIGKGIKNFKEATKSEEAAKK 51



>gb:CR522870_100324 Desulfotalea psychrophila LSv54 chromosome.
          Length = 158

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 23/65 (35%), Positives = 42/65 (64%)
 Frame = +1

Query: 361 NCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLA 540
           N +FG+G+PE+++I  +  ++ GP KLPE+ RSI K     ++ A+ F+  ++KE + L+
Sbjct: 8   NTMFGIGLPEMILILALALIVVGPDKLPELARSIAKGAMELKKTAEGFKQSIEKEGNPLS 67

Query: 541 QAPSE 555
           +   E
Sbjct: 68  ETKKE 72



>pir|S77372|S77372 hypothetical protein ssl2823 - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_688254 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 75

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 22/41 (53%), Positives = 35/41 (85%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQ 489
           +FGLG PE+++I GV  +IFGPK++PE+G ++GKTL+ F++
Sbjct: 8   MFGLGWPEILLILGVVIIIFGPKRIPELGGALGKTLRGFKE 48



>gb:AF284760_1783095 Pisum sativum HCF106 (HCF106) mRNA, complete
           cds; nuclear gene for chloroplast product.
          Length = 261

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 27/60 (45%), Positives = 40/60 (66%), Gaps = 7/60 (11%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSF-------QQAAKEFETELKKE 525
           LFG+G PE +VI  V  L+FGPK L E+ R++GKTL+ F       Q  ++EF++ L++E
Sbjct: 89  LFGVGAPEALVIGVVALLVFGPKGLAEVARNLGKTLREFQPTIREIQDVSREFKSTLERE 148



>pir|AG2290|AG2290 hypothetical protein asr3878 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684867 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 93

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 23/44 (52%), Positives = 33/44 (75%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK 498
           +FGLG PE+ +I  V  +IFGPKK+PE+G ++GKTL+ F+   K
Sbjct: 38  MFGLGWPEIAIIVVVAVVIFGPKKIPELGSALGKTLRGFKDELK 81



>gb:AE017180_401478 Geobacter sulfurreducens PCA, complete genome.
          Length = 78

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 24/60 (40%), Positives = 43/60 (71%), Gaps = 5/60 (8%)
 Frame = +1

Query: 364 CLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK-----EFETELKKEP 528
           C+FG G+PEL+VI  +  ++FG  +LPEIG ++GK++++F++A++     E + + K EP
Sbjct: 15  CMFGFGMPELIVILIIVLVVFGAGRLPEIGGALGKSIRNFKKASEGKEEIEIKPQKKDEP 74



>gb:AY496567_1609117 Physcomitrella patens chloroplast Hcf106-1
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 307

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 30/81 (37%), Positives = 46/81 (56%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           L G+G PE +VI  V  L+FGPK L E+ R++GK+L++FQ   KE +    +   +L Q 
Sbjct: 110 LLGVGAPEALVIGVVALLVFGPKGLAEVARTLGKSLRAFQPTIKELQQVSNEFKATLEQ- 168

Query: 547 PSEGVEEINQQEKRDATVSST 609
              G++E+      D   +ST
Sbjct: 169 -EIGLDEMRNPSSYDYPPTST 188



>gb:BA000045_740786 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 72

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 22/44 (50%), Positives = 33/44 (75%)
 Frame = +1

Query: 370 FGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKE 501
           FGLG+PE++VI  +  LIFGPKKLPE+G ++GK ++ F+    +
Sbjct: 3   FGLGLPEILVIGVIALLIFGPKKLPEMGSALGKAIRGFKSGVSD 46



>gb:AE012916_287083 Chlorobium tepidum TLS section 137 of 194 of the
           complete genome.>gb:AE006470_934251 Chlorobium tepidum
           TLS complete genome.
          Length = 67

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 25/55 (45%), Positives = 36/55 (65%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           +FGLG  ELV+I  +  L+FG +KLPE+ + +GK +K F++A  E E E  K  D
Sbjct: 1   MFGLGGQELVLILLIVLLLFGAQKLPELAKGLGKGIKEFKKAQNEIEEEFNKATD 55



>gb:AE010411_262833 Methanopyrus kandleri AV19 section 110 of 157 of
           the complete genome.>gb:AE009439_903614 Methanopyrus
           kandleri AV19, complete genome.
          Length = 66

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 29/73 (39%), Positives = 43/73 (58%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           GLG  EL++I  V  L+FGPKKLPE+ R+IG+ +  +++A +  E EL+ E         
Sbjct: 4   GLGTSELLLILAVILLLFGPKKLPELARAIGEAVGEYRRAQRRVEWELEAE--------- 54

Query: 553 EGVEEINQQEKRD 591
              E   ++EKRD
Sbjct: 55  ---ERRKEKEKRD 64



>gb:AE017005_377119 Bacillus cereus ATCC 14579 section 8 of 18 of
           the complete genome.>gb:AE017031_382361 Bacillus
           anthracis str. Ames section 8 of 18 of the complete
           genome.>gb:AE017225_407478 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017271_423490 Bacillus
           cereus ATCC 10987, section 8 of 18 of the complete
           genome.>gb:AE017334_452209 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_463333 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_852638 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1012066 Bacillus anthracis str. Ames
           complete genome.>gb:AE016877_1017369 Bacillus cereus
           ATCC 14579 complete genome.>gb:AE017194_1061909 Bacillus
           cereus ATCC 10987, complete genome.
          Length = 61

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 25/55 (45%), Positives = 39/55 (70%), Gaps = 5/55 (9%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKE-----FETELKKE 525
           +G P L++I     ++FGPKKLPEIG+++G+TLK F+++ KE     F+ + KKE
Sbjct: 5   IGFPGLILILVAVLILFGPKKLPEIGKALGETLKEFKKSTKELTDDAFQEKEKKE 59



>gb:BA000028_695745 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 72

 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 27/63 (42%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK----EFETELKKEPDSLAQ 543
           +G+P L++I  +  +IFGPKKLPEIG++ G+TL+ F+ +A     E E + KK    L Q
Sbjct: 6   IGIPGLILIIVIALIIFGPKKLPEIGKAAGQTLREFKSSANSMMDEEEQKDKKNEKQLNQ 65

Query: 544 APS 552
           + S
Sbjct: 66  SSS 68



>gb:AE013502_292913 Methanosarcina mazei strain Goe1, section 284 of
           379 of the complete genome.>gb:AE008384_967022
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 101

 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 28/81 (34%), Positives = 43/81 (53%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSE 555
           +G  EL++I GV  L+FG  KLPE+ RS+G ++  F++A KE E  LK+   SL +    
Sbjct: 2   IGTQELIMIFGVIVLLFGAAKLPELARSMGSSVGEFKKAQKESEKSLKEFEKSLTEPAPA 61

Query: 556 GVEEINQQEKRDATVSSTKED 618
             +     EK    +    +D
Sbjct: 62  KTKVQETAEKMGIDIRGKTDD 82



>gb:AE017180_399084 Geobacter sulfurreducens PCA, complete genome.
          Length = 59

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 23/59 (38%), Positives = 43/59 (72%), Gaps = 1/59 (1%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAA-KEFETELKKEPDSLA 540
           +FG G+PE+++I  +  ++FGP KLP++G+S+G ++++F++A+ +E E    KE D  A
Sbjct: 1   MFGFGMPEMIIILVIALVVFGPGKLPQLGQSLGASIRNFKKASLEEPEKITVKEKDEHA 59



>pir|D89800|D89800 conserved hypothetical protein SA0335 [imported]
           - Staphylococcus aureus (strain N315)>gb:CP000046_90589
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000017_676045 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_678741
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.>gb:BA000033_710615 Staphylococcus
           aureus subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_779811 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_782538 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 71

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSE 555
           G   LVVI+ +  +IFGPKKLP+ GR+IG TLK F+ A ++ + E    P   ++   E
Sbjct: 12  GPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQRE 70



>gb:AE017333_446203 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856018 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 70

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 22/44 (50%), Positives = 31/44 (70%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK 498
           L  +G+P L+++  +  +IFGP KLPEIGR+ GKTL  F+ A K
Sbjct: 2   LSNIGIPGLILVLVIALIIFGPSKLPEIGRAFGKTLTEFKSATK 45



>pir|H83718|H83718 hypothetical protein BH0552 [imported] - Bacillus
           halodurans (strain C-125)>gb:AB013375_2178 Bacillus
           halodurans C-125 ydiH, ydiI, ydij, yhcA and yxaA genes,
           complete and partial cds.>gb:BA000004_654498 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 65

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 24/47 (51%), Positives = 32/47 (68%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETE 513
           GLG   +++IA V  LIFGPKKLPE+G++ G TL+ F+ A K    E
Sbjct: 4   GLGAGSILIIALVALLIFGPKKLPELGKAAGNTLREFKNATKGLADE 50



>gb:AE017180_399090 Geobacter sulfurreducens PCA, complete genome.
          Length = 57

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 18/50 (36%), Positives = 37/50 (74%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETEL 516
           +FG G+PE+++I  +  ++ GP KLP++G+++G ++KSF++   E E ++
Sbjct: 1   MFGFGMPEMIIILVIALVVVGPSKLPQLGQALGSSIKSFKKGMNEDEVKV 50



>gb:AE017146_390461 Helicobacter hepaticus ATCC 51449 section 3 of 6
           of the complete genome.>gb:AE017125_1024723 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 82

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 26/80 (32%), Positives = 47/80 (58%)
 Frame = +1

Query: 382 VPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGV 561
           + +L++I  +  L+FG KK+PE+ + +G  +K+F++A KE E + + E ++ +Q      
Sbjct: 6   ITQLLIILLIIVLLFGAKKIPELAKGLGSGIKNFKKAVKEDEEDNQSEENTKSQ------ 59

Query: 562 EEINQQEKRDATVSSTKEDS 621
             I Q E ++  VS T  DS
Sbjct: 60  --IKQSESKNENVSKTHTDS 77



>gb:CP000023_874926 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_876846 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 62

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 24/52 (46%), Positives = 34/52 (65%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           +G P L++I     LIFGPK+LPE+G+SIGK L  F+ A  + + + K E D
Sbjct: 7   IGAPGLIIIVLGALLIFGPKRLPELGQSIGKMLAEFKAAVNKTDHDKKDEED 58



>gb:AP006840_568421 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 67

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 26/54 (48%), Positives = 37/54 (68%), Gaps = 4/54 (7%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK----EFETELKKE 525
           LG  E+++I  V  LIFGPKKLPE+ RS+G++++ F+ A K    E   E+KKE
Sbjct: 4   LGTTEIILILVVALLIFGPKKLPELARSVGESIRGFKDAMKGGLGEDIAEVKKE 57



>gb:AE017312_439295 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 4 of 12 of the complete
           genome.>gb:AE017285_1072456 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 122

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 22/55 (40%), Positives = 36/55 (65%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           +FG+G  EL+VI  V  ++ GPK LP++ R++GK L  F++ + +F+  L  E D
Sbjct: 1   MFGIGSTELLVILVVALIVLGPKSLPQMARTLGKALGEFRRVSTDFQRTLNAEVD 55



>gb:BX842653_825398 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 8/11.
          Length = 81

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 3/75 (4%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE-PDSLAQAPS 552
           LG  E+++I G+  L+FGP KLP +GRS+G++++ F++   E     +KE    + Q P 
Sbjct: 3   LGWTEILLIGGIALLLFGPSKLPNLGRSLGESIRGFKKGLNEDPAADEKEAKQQITQNPQ 62

Query: 553 EGVEEINQQ--EKRD 591
             V E   Q  EK++
Sbjct: 63  RPVNEQQPQTEEKKE 77



>gb:BX571657_777603 Wolinella succinogenes, complete genome; segment
           1/7.
          Length = 80

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 25/72 (34%), Positives = 43/72 (59%)
 Frame = +1

Query: 382 VPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGV 561
           +PEL+VI  +  L+FG KK+P++ + +G  +K+F++A KE       E   ++   SE +
Sbjct: 6   MPELLVILAIVVLLFGAKKIPDLAKGLGSGIKNFKKAMKE------DEESEVSVTKSEKI 59

Query: 562 EEINQQEKRDAT 597
           EE  + EK  +T
Sbjct: 60  EEAPKNEKSAST 71



>gb:BX569695_777390 Synechococcus sp. WH8102 complete genome;
           segment 7/7.
          Length = 67

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = +1

Query: 370 FGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETEL 516
           FGLG PE+++I  +  L+ GP KLP++G+ + K L  F+ A+ EF+ E+
Sbjct: 4   FGLGFPEILIICLIFLLVLGPNKLPKVGKYLAKYLGGFRSASDEFKREI 52



>gb:BA000028_696125 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 57

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 22/50 (44%), Positives = 35/50 (70%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +G P L++I  V  ++FGP KLPEIGR+ G TLK F+ A+++  ++  K+
Sbjct: 6   IGFPGLILILIVALIVFGPNKLPEIGRAFGTTLKEFKNASQDIMSDHNKK 55



>gb:AP006627_563197 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 63

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 24/42 (57%), Positives = 31/42 (73%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK 498
           GL V  +V+IA V  LIFGPKKLPE+G++ G TL+ F+ A K
Sbjct: 3   GLSVGSVVLIALVALLIFGPKKLPELGKAAGSTLREFKNATK 44



>gb:AE012908_286985 Chlorobium tepidum TLS section 129 of 194 of the
           complete genome.>gb:AE006470_934153 Chlorobium tepidum
           TLS complete genome.
          Length = 70

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 25/71 (35%), Positives = 44/71 (61%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSE 555
           +G PEL++I  V  ++FG +K+PE+ R +GK +K F++A  + E+E  K  D +    S+
Sbjct: 3   VGGPELLLILVVILILFGGQKIPELARGLGKGIKEFKKAQADIESEFHKAVDGV----SD 58

Query: 556 GVEEINQQEKR 588
            V++    EK+
Sbjct: 59  TVKQAGSSEKK 69



>gb:SCO939109_175308 Streptomyces coelicolor A3(2) complete genome;
           segment 6/29.>gb:SLI251128_183635 Streptomyces lividans
           tatA gene for twin arginin translocation complex
           component.
          Length = 95

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 25/63 (39%), Positives = 41/63 (65%), Gaps = 1/63 (1%)
 Frame = +1

Query: 367 LFG-LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQ 543
           +FG LG PE+++I  V  L+FG KKLP++ RS+GK+ +  +  AK  ++E K +  + A 
Sbjct: 1   MFGRLGAPEIILILVVIILLFGAKKLPDMARSLGKSARILKSEAKAMKSEAKADDAAPAD 60

Query: 544 APS 552
            P+
Sbjct: 61  PPN 63



>pir|A84138|A84138 hypothetical protein BH3905 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_657851 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 68

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 21/42 (50%), Positives = 31/42 (73%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKE 501
           +G+P L++I  +  +IFGP KLPEIGR+ G TLK F++A  +
Sbjct: 5   IGIPGLILILVIALIIFGPSKLPEIGRAFGTTLKEFKRATSD 46



>pir|E75537|E75537 conserved hypothetical protein - Deinococcus
           radiodurans  (strain R1)>gb:AE001890_40573 Deinococcus
           radiodurans R1 section 27 of 229 of the complete
           chromosome 1.>gb:AE000513_881468 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 117

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 27/76 (35%), Positives = 48/76 (63%), Gaps = 3/76 (3%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETEL---KKEPDSLAQA 546
           LG PE+++I  V  L+FGP+KLPE+G+S+G  L+ F+++ +  + E     ++    A A
Sbjct: 4   LGAPEILIILLVALLVFGPRKLPELGKSLGAGLREFRRSTQGLKEEFDGAMRDAGPAAPA 63

Query: 547 PSEGVEEINQQEKRDA 594
           P++ V+ I  Q + +A
Sbjct: 64  PAQ-VQVIAAQPQVEA 78



>gb:AP006840_569083 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 71

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 21/49 (42%), Positives = 35/49 (71%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           LG  E++VI  V  ++FGP KLPE+GRS+G+ ++ F++A +   TE+ +
Sbjct: 4   LGFTEILVIMIVALVVFGPNKLPELGRSMGQAIREFRKATQSITTEVTR 52



>sp|O25088|TATA_HELPY Sec-independent protein translocase protein
           tatA/E homolog.>pir|H64559|H64559 conserved hypothetical
           secreted protein HP0320 - Helicobacter pylori (strain
           26695)>gb:AE000550_24497 Helicobacter pylori 26695
           section 28 of 134 of the complete
           genome.>gb:AE000511_879936 Helicobacter pylori 26695
           complete genome.>gb:AX055150_1458189 Sequence 57 from
           Patent WO0073502.>gb:AX055246_1458237 Sequence 153 from
           Patent WO0073502.
          Length = 79

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 25/62 (40%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSL-AQAPSEGVEEI 570
           V++  V  L+FG KK+PE+ + +G  +K+F++A K+ E E K EP +L AQA    V E 
Sbjct: 11  VIVLLVIVLLFGAKKIPELAKGLGSGIKNFKKAVKDDEEEAKNEPKTLDAQATQTKVHES 70

Query: 571 NQ 576
           ++
Sbjct: 71  SE 72



>gb:AE017313_439618 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 5 of 12 of the complete
           genome.>gb:AE017285_1072779 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 65

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 23/63 (36%), Positives = 39/63 (61%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FG+G  EL+V+  +  L+FG  KLPEIG  +G+ +++F++AA         EPD +   
Sbjct: 1   MFGIGFQELLVVLVLVLLVFGANKLPEIGGGLGRAIRNFKRAA--------SEPDEIDVT 52

Query: 547 PSE 555
           P++
Sbjct: 53  PTD 55



>pir|B69787|B69787 hypothetical protein ydiI - Bacillus
           subtilis>gb:D88802_121172 Bacillus subtilis DNA for
           phoB-rrnE-groESL region, complete
           cds.>gb:BSUB0004_752563 Bacillus subtilis complete
           genome (section 4 of 21): from 611631 to 813719.
          Length = 57

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 3/53 (5%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEF---ETELKKE 525
           +G   L VIA V  +IFGPKKLPE+G++ G TL+ F+ A K     E E KKE
Sbjct: 3   IGPGSLAVIAIVALIIFGPKKLPELGKAAGDTLREFKNATKGLTSDEEEKKKE 55



>pir|AF1480|AF1480 conserved hypothetical protein homolog lin0381
           [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596164_537728 Listeria innocua Clip11262
           complete genome, segment 2/12.
          Length = 59

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +G   + +I G   +IFGPKKLPE+GR+ G TL+ F+ A K    + K+E
Sbjct: 2   IGPGSIALIVGAALVIFGPKKLPELGRAAGDTLREFKNATKGMMDDSKEE 51



>pir|AC1120|AC1120 conserved hypothetical protein homolog lmo0362
           [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591975_534854 Listeria monocytogenes strain
           EGD, complete genome, segment 3/12.
          Length = 59

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +G   + +I G   +IFGPKKLPE+GR+ G TL+ F+ A K    + K+E
Sbjct: 2   IGPGSIALIVGAALVIFGPKKLPELGRAAGDTLREFKNATKGMMDDSKEE 51



>gb:CP000020_870225 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 82

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 6/80 (7%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFE--TELKKE----PDS 534
           G+ + +L++IA +  L+FG KKL  +G  +G  +K F++A  E E   E KK+    P +
Sbjct: 3   GISIWQLLIIAVIIVLLFGTKKLRGVGSDLGSAVKGFKKAISEDEPAKEAKKDADFVPQN 62

Query: 535 LAQAPSEGVEEINQQEKRDA 594
           L +  +E VE+  Q +K  A
Sbjct: 63  LEKKEAETVEKQKQNDKEQA 82



>pir|A69767|A69767 conserved hypothetical protein yczB - Bacillus
           subtilis>gb:BSUB0002_752228 Bacillus subtilis complete
           genome (section 2 of 21): from 213031 to 415798.
          Length = 70

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 34/53 (64%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDS 534
           +G+P L++I  +  +IFGP KLPEIGR+  +TL  F+ A K   +  +KE  S
Sbjct: 5   IGIPGLILIFVIAIIIFGPSKLPEIGRAAKRTLLEFKSATKSLVSGDEKEEKS 57



>sp|Q8DDQ2|TATA_VIBVU Sec-independent protein translocase protein
           tatA/E homolog.>gb:AE016800_335661 Vibrio vulnificus
           CMCP6 chromosome I section 4 of 11 of the complete
           sequence.>gb:AE016795_1045385 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 78

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDSLAQ 543
           G+ + +L++IA +  L+FG KKL  IG  +G  +K F++A  E E+E K    EP SL Q
Sbjct: 3   GISIWQLLIIAVIVVLLFGTKKLRGIGSDLGGAIKGFKKAMNEEESEKKDADFEPKSLEQ 62

Query: 544 APSEGVEEINQQEKR 588
              +   E  + +++
Sbjct: 63  QSKQAATESKKDKEQ 77



>gb:BA000037_721006 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 78

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDSLAQ 543
           G+ + +L++IA +  L+FG KKL  IG  +G  +K F++A  E E+E K    EP SL Q
Sbjct: 3   GISIWQLLIIAVIVVLLFGTKKLRGIGSDLGGAIKGFKKAMNEEESEKKDADFEPKSLEQ 62

Query: 544 APSEGVEEINQQEKR 588
              +   E  + +++
Sbjct: 63  QNKQAATESKKDKEQ 77



>gb:AE017333_446523 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856337 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 59

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK---EFETELKKEPD 531
           +G    ++I  V  LIFGPKKLPE+GR+ G TL+ F+ A K   + +++ KK+ D
Sbjct: 4   IGPGSFILIVVVALLIFGPKKLPELGRAAGNTLREFKNATKGLADDDSDNKKKED 58



>gb:BX842656_826590 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 11/11.
          Length = 118

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 18/53 (33%), Positives = 36/53 (67%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +FGLG+ E++ +A +  ++ GPK+LPE+ R++G+ L   +++      ELK++
Sbjct: 1   MFGLGMSEIIFLAVLALIVIGPKELPELARTLGRFLNELKRSTDSMGDELKQQ 53



>gb:BA000043_738092 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 56

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 21/41 (51%), Positives = 29/41 (70%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK 498
           +G  E+ +I     LIFGPKKLPE+G++ GKTL+ F+ A K
Sbjct: 3   IGFGEIALIVFFALLIFGPKKLPELGQAAGKTLREFKNATK 43



>gb:AE016943_363468 Bacteroides thetaiotaomicron VPI-5482, section
           18 of 21 of the complete genome.>gb:AE015928_989956
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 73

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 23/60 (38%), Positives = 38/60 (63%)
 Frame = +1

Query: 388 ELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEE 567
           E ++IA V  L+FG KK+PE+ R +GK +KSF+    E + E+ K  D +  AP++  ++
Sbjct: 15  EWIIIALVILLLFGGKKIPELMRGLGKGVKSFKDGVNEAKEEINKAKDEI-DAPADSAKK 73



>gb:BA000030_704579 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 94

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query: 367 LFG-LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETE 513
           +FG LG PE+++I  V  L+FG KKLP++ RS+GK+ +  +  AK  ++E
Sbjct: 1   MFGRLGAPEIILILVVIILLFGAKKLPDMARSLGKSARILKSEAKAMKSE 50



>gb:AE013502_292914 Methanosarcina mazei strain Goe1, section 284 of
           379 of the complete genome.>gb:AE008384_967023
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 122

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 22/73 (30%), Positives = 42/73 (57%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSE 555
           +G  EL+ I      +FGP+K+PE+ R++G  +  F++A +  E EL +      +A ++
Sbjct: 2   IGSTELIAIIIAALFLFGPQKIPELARALGGAIGEFKKAQRAAELELNEFDPYTRKAANK 61

Query: 556 GVEEINQQEKRDA 594
             E+   +EK++A
Sbjct: 62  AREKEENKEKKEA 74



>pir|E65188|E65188 hypothetical 11.3 kD protein in udp-rfaH
           intergenic region - Escherichia coli (strain
           K-12)>gb:AE005674_73498 Shigella flexneri 2a str. 301,
           complete genome.>gb:U00096_202821 Escherichia coli K-12
           MG1655 complete genome.>gb:AE016770_328756 Escherichia
           coli CFT073 section 16 of 18 of the complete
           genome.>gb:AE016990_373296 Shigella flexneri 2a str.
           2457T section 13 of 16 of the complete
           genome.>gb:AF067848_475589 Escherichia coli MttA1
           (mttA1), MttA2 (mttA2), MttB (mttB), and MttC (mttC)
           genes, complete cds.>gb:AE014075_959340 Escherichia coli
           CFT073 complete genome.>gb:AE014073_998046 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 103

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 46/78 (58%), Gaps = 3/78 (3%)
 Frame = +1

Query: 364 CLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDS 534
           C+ G+ + +L++IA +  L+FG KKL  IG  +G ++K F++A  + E +  K   + D 
Sbjct: 14  CMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADF 73

Query: 535 LAQAPSEGVEEINQQEKR 588
            A+  ++   + NQ++ +
Sbjct: 74  TAKTIADKQADTNQEQAK 91



>pir|D86071|D86071 hypothetical protein tatA [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>gb:AE005174_69031 Escherichia coli O157:H7
           EDL933, complete genome.
          Length = 103

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 23/78 (29%), Positives = 46/78 (58%), Gaps = 3/78 (3%)
 Frame = +1

Query: 364 CLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDS 534
           C+ G+ + +L++IA +  L+FG KKL  IG  +G ++K F++A  + E +  K   + D 
Sbjct: 14  CMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADF 73

Query: 535 LAQAPSEGVEEINQQEKR 588
            A+  ++   + NQ++ +
Sbjct: 74  TAKTIADKQADTNQEQAK 91



>sp|Q9ZMB8|TATA_HELPJ Sec-independent protein translocase protein
           tatA/E homolog.>pir|A71948|A71948 hypothetical protein
           jhp0303 - Helicobacter pylori (strain
           J99)>gb:AE001467_35296 Helicobacter pylori, strain J99
           section 28 of 132 of the complete
           genome.>gb:AE001439_884066 Helicobacter pylori, strain
           J99 complete genome.
          Length = 79

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 1/62 (1%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSL-AQAPSEGVEEI 570
           V++  V  L+FG KK+PE+ + +G  +K+F++A K+ E E K E  +L AQA    V E 
Sbjct: 11  VIVLLVIVLLFGAKKIPELAKGLGSGIKNFKKAVKDDEEEAKNELKTLDAQATQTKVHET 70

Query: 571 NQ 576
           ++
Sbjct: 71  SE 72



>gb:AE017233_412535 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 7 of 16 of the complete
           genome.>gb:AE016958_1055939 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 93

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 24/65 (36%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
 Frame = +1

Query: 397 VIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSL-AQAPSEGVEEIN 573
           ++A V  L+FG KKLP+  RS+GK+++ F+   +E ++E K E  +L AQ+ S       
Sbjct: 11  ILAVVVILLFGAKKLPDAARSLGKSMRIFKSELREMQSENKTETSALGAQSESSAANPTP 70

Query: 574 QQEKR 588
            Q +R
Sbjct: 71  VQSQR 75



>sp|O66478|TAT1_AQUAE Sec-independent protein translocase
           tatA/E-like protein 1.>pir|C70306|C70306 conserved
           hypothetical protein aq_064c - Aquifex
           aeolicus>gb:AE000672_25829 Aquifex aeolicus VF5 section
           4 of 109 of the complete genome.>gb:AE000657_976360
           Aquifex aeolicus VF5 complete genome.
          Length = 77

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 24/74 (32%), Positives = 45/74 (60%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+ + EL++I  V  L+FG  +LPE GR++G+ +++F++A    ETE+K+      +   
Sbjct: 5   GISMTELIIILAVILLLFGAGRLPEAGRALGEGIRNFRKALSG-ETEVKEVKAEDVKTEE 63

Query: 553 EGVEEINQQEKRDA 594
              E+  ++EK +A
Sbjct: 64  RKEEKKEEKEKVEA 77



>gb:AY596297_632008 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 90

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 28/87 (32%), Positives = 44/87 (50%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEG 558
           G  E++VI  +  L+FG  K+P++ RS G+ +  FQ+  +E E EL++  D  A      
Sbjct: 14  GTTEMMVILLIAVLLFGANKIPKLARSTGEAMGEFQKGREEVEQELEEMRDGGA------ 67

Query: 559 VEEINQQEKRDATVSSTKEDS*TATAT 639
                  E  DA+   + E + TAT T
Sbjct: 68  ------AEGTDASTVDSAESTETATET 88



>gb:AP006841_571419 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 75

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 24/68 (35%), Positives = 39/68 (57%)
 Frame = +1

Query: 388 ELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEE 567
           E ++I  V  L+FG KK+PE+ R +GK +KSF++   E + E+ K          E ++E
Sbjct: 15  EWIIILLVILLLFGGKKIPELMRGLGKGVKSFKEGVNEAKEEINK--------AKEEIDE 66

Query: 568 INQQEKRD 591
              +EK+D
Sbjct: 67  PENKEKKD 74



>gb:CR555306_106094 Azoarcus sp. EbN1 complete genome.
          Length = 147

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 19/53 (35%), Positives = 35/53 (66%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F  G  EL+VIA VT ++ GP++LP++ R+ G  L   Q+   + ++++K+E
Sbjct: 1   MFDFGFSELIVIAVVTLIVVGPERLPKVARTAGHLLGRLQRYVSDVKSDIKRE 53



>gb:CP000027_80556 Dehalococcoides ethenogenes 195, complete genome.
          Length = 96

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDS 534
           G+G  E++++  V  LIFGP K+PE  R IG+ + SF++   E   +  +  D+
Sbjct: 5   GIGFGEIIIVLIVATLIFGPGKIPEFARQIGQFVNSFRKVTSEMTRDFTRAIDA 58



>gb:AE011056_268787 Methanosarcina acetivorans str. C2A, section 401
           of 534 of the complete genome.>gb:AE010299_909346
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 121

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/65 (38%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQ--APS 552
           G  EL+ I  +  L+FG  KLPE+ RS+G ++  F++A +E E  LK    SL +   P 
Sbjct: 23  GPMELMFIFAIAILLFGASKLPELARSMGSSVGEFKKAQRESEQNLKDFEKSLKEPITPK 82

Query: 553 EGVEE 567
             V+E
Sbjct: 83  TKVQE 87



>pir|D84237|D84237 hypothetical protein Vng0801c [imported] -
           Halobacterium sp. NRC-1>gb:AE005022_62424 Halobacterium
           sp. NRC-1 section 53 of 170 of the complete
           genome.>gb:AE004437_887343 Halobacterium sp. NRC-1
           complete genome.
          Length = 96

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 4/84 (4%)
 Frame = +1

Query: 367 LFGLGVP---ELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK-EPDS 534
           LF  G+P   E+ V+  +  L+FG  K+P++ RS G+ +  FQ+  +E E EL++ + +S
Sbjct: 7   LFIGGLPGGMEMAVVLLIAILLFGANKIPKLARSSGEAIGEFQKGREEVEQELQEIKSES 66

Query: 535 LAQAPSEGVEEINQQEKRDATVSS 606
              A ++   +       DAT S+
Sbjct: 67  APDASADATADTTSDTTTDATSSA 90



>pir|E87075|E87075 probable secreted protein [imported] -
           Mycobacterium leprae>gb:MLEPRTN5_147133 Mycobacterium
           leprae strain TN complete genome; segment 5/10.
          Length = 95

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           VV+  V  L+FG KKLP+  RS+GK+++ F+   +E +TE + +  +L + P +    + 
Sbjct: 17  VVLVVVVVLLFGAKKLPDAARSLGKSMRIFKSELREMQTENQAQASAL-ETPMQNPTVV- 74

Query: 574 QQEKRDATVSSTKED 618
            Q +R     ST++D
Sbjct: 75  -QSQRVVPPWSTEQD 88



>sp|P54079|TATA_MYCLE Sec-independent protein translocase protein
           tatA/E homolog.>pir|S72850|S72850 hypothetical protein
           B2126_C1_182 - Mycobacterium leprae>gb:MLCB2533_145000
           Mycobacterium leprae cosmid B2533.>gb:U00017_198898
           Mycobacterium leprae cosmid B2126.
          Length = 88

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           VV+  V  L+FG KKLP+  RS+GK+++ F+   +E +TE + +  +L + P +    + 
Sbjct: 10  VVLVVVVVLLFGAKKLPDAARSLGKSMRIFKSELREMQTENQAQASAL-ETPMQNPTVV- 67

Query: 574 QQEKRDATVSSTKED 618
            Q +R     ST++D
Sbjct: 68  -QSQRVVPPWSTEQD 81



>gb:BX571659_778234 Wolinella succinogenes, complete genome; segment
           3/7.
          Length = 175

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 23/84 (27%), Positives = 47/84 (55%), Gaps = 9/84 (10%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFE---------TELK 519
           +FG+G  E++++A V  +  GP KLP+    I K  ++F++   E +         +E+K
Sbjct: 30  MFGMGFAEIILVAVVAIIFLGPDKLPQAMVDIAKFFRAFKKTIAEAKDSLDREISISEIK 89

Query: 520 KEPDSLAQAPSEGVEEINQQEKRD 591
           +E  S  ++  EG ++++++ K D
Sbjct: 90  QEALSYKKSLEEGTQKLSKEIKLD 113



>gb:AE017340_458123 Idiomarina loihiensis L2TR, complete genome.
          Length = 116

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 6/80 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETEL------KKEP 528
           +F +G  EL++IA V  L+ GP++LP   R   +TL S +Q +++ + EL      K+  
Sbjct: 1   MFDIGFWELLLIAIVGLLVLGPERLPSAIRGFQRTLSSIKQYSQKVQNELDHELRIKELH 60

Query: 529 DSLAQAPSEGVEEINQQEKR 588
           + L QA S+ +E ++ + +R
Sbjct: 61  EHLRQAESQDLENLSPELQR 80



>sp|P57050|TATE_SALTY Sec-independent protein translocase protein
           tatE.>pir|AC0580|AC0580 sec-independent protein
           translocase protein TatE [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain
           CT18)>gb:CP000026_76880 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008725_242355 Salmonella typhimurium LT2,
           section 33 of 220 of the complete
           genome.>gb:AE016841_346294 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 8 of 16 of the
           complete genome.>gb:AL627267_540954 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 3/20.>gb:AE014613_983626 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_999437 Salmonella typhimurium LT2,
           complete genome.
          Length = 67

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/57 (33%), Positives = 35/57 (61%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           + + +L+V+A +  L+FG KKL  +G  +G  +K F++A  + +  +KK+ D   QA
Sbjct: 4   ISITKLLVVAALVVLLFGTKKLRTLGGDLGTAIKGFKKAMNDEDAGVKKDVDGSVQA 60



>gb:BX842652_825061 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 7/11.
          Length = 79

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 19/72 (26%), Positives = 42/72 (58%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEI 570
           ++++A +  + FGP +LP++G+S+GK ++ F+Q   E + + K   D+  Q   +  + +
Sbjct: 9   ILLLAVIFLIFFGPSRLPQLGQSMGKAIRGFKQGLNEIDVDAKDIHDN-QQVSHQNKQSM 67

Query: 571 NQQEKRDATVSS 606
            Q +K+    +S
Sbjct: 68  GQTQKQGENQNS 79



>gb:AE011056_268788 Methanosarcina acetivorans str. C2A, section 401
           of 534 of the complete genome.>gb:AE010299_909347
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 115

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 4/86 (4%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQ---- 543
           +G  EL+ I G    +FGP KLPE+ RS+G  +  F++A +  E EL    DS  +    
Sbjct: 2   IGSLELLAILGAALFLFGPTKLPELARSLGGAVGEFKKAQRAAELELTTF-DSYTRRTEG 60

Query: 544 APSEGVEEINQQEKRDATVSSTKEDS 621
           A +   EE  ++E  D    +  + S
Sbjct: 61  ATAGAKEEATKKETEDLNTKTGADQS 86



>pir|AC2786|AC2786 SEC-independent protein translocase protein
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>pir|E97565|E97565 hypothetical protein
           AGR_C_3133 [imported] - Agrobacterium tumefaciens
           (strain C58, Cereon)>gb:AE008092_233418 Agrobacterium
           tumefaciens str. C58 circular chromosome, section 150 of
           254 of the complete sequence.>gb:AE009127_248732
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 153 of 256 of the complete
           sequence.>gb:AE007869_1083087 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1086575 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 247

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 23/67 (34%), Positives = 40/67 (59%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +F +G  EL+VIA V  ++ GPK LP + R+ GKT+   ++ A +F T+     ++L +A
Sbjct: 2   MFDIGWSELLVIAVVLIVVVGPKDLPPMIRAFGKTMAGLRKMAGDFRTQF---DEALKEA 58

Query: 547 PSEGVEE 567
             + V +
Sbjct: 59  DMDDVRQ 65



>sp|Q8UEQ0|TATB_AGRT5 Sec-independent protein translocase protein
           tatB homolog.
          Length = 246

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 23/67 (34%), Positives = 40/67 (59%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +F +G  EL+VIA V  ++ GPK LP + R+ GKT+   ++ A +F T+     ++L +A
Sbjct: 1   MFDIGWSELLVIAVVLIVVVGPKDLPPMIRAFGKTMAGLRKMAGDFRTQF---DEALKEA 57

Query: 547 PSEGVEE 567
             + V +
Sbjct: 58  DMDDVRQ 64



>sp|O65938|TATA_ECOLI Sec-independent protein translocase protein
           tatA.>pir|F91224|F91224 Sec-independent protein
           translocase [imported] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>gb:ECO5830_127857
           Escherichia coli tatABCD operon.>gb:BA000007_662778
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 89

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 22/75 (29%), Positives = 44/75 (58%), Gaps = 3/75 (4%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDSLAQ 543
           G+ + +L++IA +  L+FG KKL  IG  +G ++K F++A  + E +  K   + D  A+
Sbjct: 3   GISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAK 62

Query: 544 APSEGVEEINQQEKR 588
             ++   + NQ++ +
Sbjct: 63  TIADKQADTNQEQAK 77



>gb:AE016777_330479 Pseudomonas putida KT2440 section 4 of 21 of the
           complete genome.>gb:AE015451_945556 Pseudomonas putida
           KT2440 complete genome.
          Length = 96

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 22/69 (31%), Positives = 43/69 (62%), Gaps = 2/69 (2%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD--SLA 540
           +F +G  EL++I  V  L+ GP++LP   R++G+ L   ++A     T++++E +  +L 
Sbjct: 1   MFEVGFSELLLIGVVALLVLGPERLPVAARTLGRGLGQARRAMHALRTQVEREIEMPNLD 60

Query: 541 QAPSEGVEE 567
           QAP + +E+
Sbjct: 61  QAPLQRLEQ 69



>gb:CR378663_93535 Photobacterium profundum SS9; segment 1/12.
          Length = 87

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 23/82 (28%), Positives = 48/82 (58%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+ + +L++IA +  L+FG KKL  +G  +G  +K F++A  + E  +KK+ ++ A A  
Sbjct: 3   GISIWQLLIIALIIVLLFGTKKLRSLGGDLGSAVKGFKKAIGDEELTVKKD-NTEADADF 61

Query: 553 EGVEEINQQEKRDATVSSTKED 618
           E      ++++ +  V  +++D
Sbjct: 62  EQKTLSKEEQQSEDPVQKSQKD 83



>pir|C69894|C69894 conserved hypothetical protein ynzA - Bacillus
           subtilis>gb:BSUB0010_753736 Bacillus subtilis complete
           genome (section 10 of 21): from 1807106 to 2014934.
          Length = 62

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           L   +++VI  V  L+FGP KLP +GR+ GK L  F+QA      +++K
Sbjct: 3   LSFTKILVILFVGFLVFGPDKLPALGRAAGKALSEFKQATSGLTQDIRK 51



>sp|Q87TH1|TATA_VIBPA Sec-independent protein translocase protein
           tatA/E homolog.>gb:BA000031_705558 Vibrio
           parahaemolyticus RIMD 2210633 DNA, chromosome 1,
           complete sequence.
          Length = 81

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 25/81 (30%), Positives = 46/81 (56%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+ V +L++IA +  L+FG KKL  IG  +G  +K F++A  + E   K E D+  +  S
Sbjct: 3   GISVWQLLIIAVIVVLLFGTKKLRGIGGDLGSAVKGFKKAMSD-EDSAKNEKDADFEPKS 61

Query: 553 EGVEEINQQEKRDATVSSTKE 615
                + +Q++++A   + K+
Sbjct: 62  -----LEKQQQKEAAPETKKD 77



>gb:BX248357_762520 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 4/8.
          Length = 88

 Score = 43.1 bits (100), Expect = 0.007
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 8/80 (10%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFET------ELKKEPDSL 537
           LG  E+++I  +  L+FG KKLP+  RS+G++++ F+   KE         E +++    
Sbjct: 3   LGPTEILLILVIVVLLFGAKKLPDAARSLGRSMRIFKSEVKEMSNDDQRYEEQQQQRQIA 62

Query: 538 AQAPSEGVE--EINQQEKRD 591
           AQA  + V   EI Q +  D
Sbjct: 63  AQAQQQVVNPVEIPQPQPTD 82



>gb:AE017301_435902 Thermus thermophilus HB27 section 1 of 7 of the
           complete genome.>gb:AP008226_578085 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1077880
           Thermus thermophilus HB27 complete genome.
          Length = 53

 Score = 43.1 bits (100), Expect = 0.007
 Identities = 21/51 (41%), Positives = 33/51 (64%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEP 528
           LG  E+++I  +  L+FG KKLPE+ R IG+  + F++  +  E E K+EP
Sbjct: 3   LGPMEIILILLIVLLLFGAKKLPELARGIGQAAREFRKGIQ--EEEKKEEP 51



>gb:AE016827_342129 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 75

 Score = 43.1 bits (100), Expect = 0.007
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 4/72 (5%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFE---TELKK-EPDSLA 540
           G+ + +L++I  +  L+FG KKL  +G  +G+++K F++A  E E    E K    D  A
Sbjct: 3   GISIWQLLIIVAIIVLLFGTKKLRTLGTDLGESVKGFKKAMNEDEPKDAEFKSLNKDESA 62

Query: 541 QAPSEGVEEINQ 576
            A SE V++  Q
Sbjct: 63  TAGSEKVKDKEQ 74



>sp|P57051|TATA_VIBCH Sec-independent protein translocase protein
           tatA/E homolog.>pir|G82366|G82366 tatA protein VC0086
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004099_50494 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 7 of 251 of the
           complete chromosome.>gb:AE003852_1051268 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 82

 Score = 43.1 bits (100), Expect = 0.007
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+ + +L++IA +  L+FG KKL  IG  +G  +K F++A  E      +E +S A    
Sbjct: 3   GISIWQLLIIAVIVVLLFGTKKLRGIGSDLGSAVKGFKKAMSE------EESNSAANQKD 56

Query: 553 EGVEEINQQEKRDATVSSTKED 618
              E  N ++ +    +  K+D
Sbjct: 57  ADFETKNLEQAKTNASAEVKKD 78



>gb:AE017317_440694 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 9 of 12 of the complete
           genome.>gb:AE017285_1073855 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 68

 Score = 42.7 bits (99), Expect = 0.009
 Identities = 21/57 (36%), Positives = 37/57 (64%), Gaps = 1/57 (1%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAA-KEFETELKKEPDSLAQAPSEG 558
           L+VI  +   +FGPK LP +G++IGK+L  F+++  +E E ++  +P    + PS+G
Sbjct: 11  LLVILVIALFVFGPKNLPGLGKTIGKSLNEFKRSLNEEDEVDISAQP---GKKPSDG 64



>pir|G69506|G69506 conserved hypothetical protein AF2056 -
           Archaeoglobus fulgidus>gb:AE000961_29858 Archaeoglobus
           fulgidus DSM 4304 section 146 of 172 of the complete
           genome.>gb:AE000782_975932 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 113

 Score = 42.7 bits (99), Expect = 0.009
 Identities = 19/48 (39%), Positives = 33/48 (68%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           G  E ++I  +  ++FG  KLPE+ RS+G+++  F++A KE E EL++
Sbjct: 12  GGQEWLLILLIIFVLFGASKLPEVARSLGRSMGEFKKAQKEAEMELRQ 59



>sp|P57045|TATA_SALTY Sec-independent protein translocase protein
           tatA.>pir|AI0915|AI0915 sec-independent protein
           translocase protein [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:CP000026_78474 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:STYSTMD1_195034 Salmonella typhimurium fragment
           STMD1.>gb:AE008885_245590 Salmonella typhimurium LT2,
           section 189 of 220 of the complete
           genome.>gb:AE016845_347308 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 12 of 16 of the
           complete genome.>gb:AL627278_543641 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 14/20.>gb:AE014613_984640 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1002672 Salmonella typhimurium LT2,
           complete genome.
          Length = 84

 Score = 42.7 bits (99), Expect = 0.009
 Identities = 21/81 (25%), Positives = 44/81 (54%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+ + +L+++A +  L+FG KKL  IG  +G ++K F++A  + + +  K     A   +
Sbjct: 3   GISIWQLLIVAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDDAKQDKTSQD-ADFTA 61

Query: 553 EGVEEINQQEKRDATVSSTKE 615
           + + +   + K++   S  KE
Sbjct: 62  KSIADKQGEAKKEDAKSQDKE 82



>gb:CR767821_116674 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925677_117584 Ehrlichia
           ruminantium str. Gardel, complete
           genome.>gb:CR925678_118539 Ehrlichia ruminantium str.
           Welgevonden, complete genome.
          Length = 93

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 20/52 (38%), Positives = 32/52 (61%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           +FG+G+ E+VVI  V  L+  PKKLP + +++G   + F +  +E    LKK
Sbjct: 1   MFGIGISEIVVIILVACLVIDPKKLPFLAKNLGFYYRKFIEIKEEIFHYLKK 52



>gb:AE000516_22208 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 115

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 18/43 (41%), Positives = 29/43 (67%)
 Frame = +1

Query: 397 VIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           ++A V  ++FG KKLP+  RS+GK+L+ F+   +E + E K E
Sbjct: 43  ILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAE 85



>pir|B64145|B64145 hypothetical protein HI0187 - Haemophilus
           influenzae (strain Rd KW20)
          Length = 109

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFE 507
           +FGL   +L+++  V  LIFG KKL   G  +G  +K F++A KE E
Sbjct: 21  MFGLSPAQLIILLVVILLIFGTKKLRNAGSDLGAAVKGFKKAMKEDE 67



>sp|Q9CKD3|TATA_PASMU Sec-independent protein translocase protein
           tatA/E homolog.>gb:AE006205_216577 Pasteurella multocida
           subsp. multocida str. Pm70 section 172 of 204 of the
           complete genome.>gb:AE004439_1119307 Pasteurella
           multocida subsp. multocida str. Pm70, complete genome.
          Length = 76

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 5/73 (6%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAA----KEFETELKK-EPDSL 537
           G+ + +L++I  +  L+FG KKL  +G  +G+++K F++A     KE + E K    DS 
Sbjct: 3   GISITQLLIIVAIVVLLFGTKKLRTLGSDLGESVKGFKKAMADDNKEKDAEFKSLSDDSE 62

Query: 538 AQAPSEGVEEINQ 576
             A +E  ++  Q
Sbjct: 63  TTAKTEKAKDKEQ 75



>sp|Q10703|TATA_MYCTU Sec-independent protein translocase protein
           tatA/E homolog.>pir|A70768|A70768 hypothetical protein
           Rv2094c - Mycobacterium tuberculosis  (strain
           H37RV)>gb:BX248341_759477 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           8/14.>gb:BX842578_820170 Mycobacterium tuberculosis
           H37Rv complete genome; segment 7/13.
          Length = 83

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 18/43 (41%), Positives = 29/43 (67%)
 Frame = +1

Query: 397 VIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           ++A V  ++FG KKLP+  RS+GK+L+ F+   +E + E K E
Sbjct: 11  ILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAE 53



>sp|P57046|TATA_HAEIN Sec-independent protein translocase protein
           tatA/E homolog.
          Length = 89

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFE 507
           +FGL   +L+++  V  LIFG KKL   G  +G  +K F++A KE E
Sbjct: 1   MFGLSPAQLIILLVVILLIFGTKKLRNAGSDLGAAVKGFKKAMKEDE 47



>gb:AF462068_513620 Rhizobium leguminosarum bv. viciae
           Sec-independent protein translocase TatA (tatA),
           Sec-independent protein translocase TatB (tatB), and
           Sec-independent translocase TatC (tatC) genes, complete
           cds; seryl-tRNA synthetase (serS) gene, partial cds; and
           unknown gene.
          Length = 203

 Score = 41.6 bits (96), Expect = 0.020
 Identities = 25/83 (30%), Positives = 45/83 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +F +G  EL+VIA V  ++ GPK LP + R+ GK  +  ++ A EF  +     ++L +A
Sbjct: 1   MFDIGWTELLVIAVVLIVVVGPKDLPPMLRAFGKMTQRARKVAGEFRAQF---DEALREA 57

Query: 547 PSEGVEEINQQEKRDATVSSTKE 615
             + V +     ++   V+S +E
Sbjct: 58  ELDDVRQTISDAQKLNPVNSLRE 80



>gb:AE009826_256177 Pyrobaculum aerophilum strain IM2 section 81 of
           201 of the complete genome.>gb:AE009441_898803
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 98

 Score = 41.6 bits (96), Expect = 0.020
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 5/55 (9%)
 Frame = +1

Query: 376 LGVPE--LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAA---KEFETELKKE 525
           +GV E  L++IA V  LI+GP KLP + R +G+ ++ F++AA   +E + E KKE
Sbjct: 5   VGVQEMILILIALVIILIWGPSKLPALARGMGEAIREFRRAASGVEEHKREEKKE 59



>gb:BX571965_792926 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_866838
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 77

 Score = 41.2 bits (95), Expect = 0.027
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           GL +   +++  + AL+FG KKL  IG  +G  +K F+   KE E      P    Q P 
Sbjct: 3   GLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEA-----PADAQQLPR 57

Query: 553 EGVEEINQQEKRDATVSS 606
            G   +   + +DA  SS
Sbjct: 58  SGSVNV---DAKDAARSS 72



>gb:AP006840_569646 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 60

 Score = 41.2 bits (95), Expect = 0.027
 Identities = 19/46 (41%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = +1

Query: 367 LFG-LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKE 501
           +FG LG  E+++I  V  L+FG  KLP++ R +G ++K F++A K+
Sbjct: 1   MFGRLGTMEILLIVLVILLLFGGAKLPQLARGLGDSIKEFRKAVKQ 46



>gb:AE017282_428242 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 70

 Score = 41.2 bits (95), Expect = 0.027
 Identities = 25/71 (35%), Positives = 41/71 (57%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+GV EL+++  +  ++FG K+L  IG  +G  +KSF+QA  E E     +P        
Sbjct: 2   GIGVWELLLLFLIVLVVFGTKRLRNIGGDLGGAIKSFRQAMSENE----DKPSEGGARTL 57

Query: 553 EGVEEINQQEK 585
           EG E ++++EK
Sbjct: 58  EG-EVVDKKEK 67



>pir|C90494|C90494 conserved hypothetical protein [imported] -
           Sulfolobus solfataricus>gb:AE006901_223825 Sulfolobus
           solfataricus P2 section 260 of 272 of the complete
           genome.>gb:AE006641_1109673 Sulfolobus solfataricus P2,
           complete genome.
          Length = 91

 Score = 41.2 bits (95), Expect = 0.027
 Identities = 17/66 (25%), Positives = 37/66 (56%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEI 570
           ++++  +  L FG  K+PE+ R++G+++  F++   E E E+++   S      E  E +
Sbjct: 9   IIILVVIAVLFFGSSKMPELFRALGRSMGEFKKGQLEAEMEMQQMMSSNVVEKGERSESV 68

Query: 571 NQQEKR 588
            + EK+
Sbjct: 69  EELEKK 74



>sp|P25895|TATE_ECOLI Sec-independent protein translocase protein
           tatE.>pir|JN0256|JN0256 Sec-independent protein
           translocase ybeC [similarity] - Escherichia coli (strain
           K-12)>pir|E85562|E85562 Sec-independent protein
           translocase ybeC [similarity] - Escherichia coli (strain
           O157:H7, substrain EDL933)>pir|A90712|A90712
           Sec-independent protein translocase [imported] -
           Escherichia coli (strain O157:H7, substrain RIMD
           0509952)>gb:AE005174_64894 Escherichia coli O157:H7
           EDL933, complete genome.>gb:AE005674_70236 Shigella
           flexneri 2a str. 301, complete genome.>gb:D90703_121324
           Escherichia coli K12 genomic DNA. (14.0 - 14.4
           min).>gb:ECU82598_134730 Escherichia coli genomic
           sequence of minutes 9 to 12.>gb:U00096_199721
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE016757_324759 Escherichia coli CFT073
           section 3 of 18 of the complete
           genome.>gb:AE016980_370608 Shigella flexneri 2a str.
           2457T section 3 of 16 of the complete
           genome.>gb:BA000007_658677 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_955343 Escherichia coli
           CFT073 complete genome.>gb:AE014073_995358 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 67

 Score = 41.2 bits (95), Expect = 0.027
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           + + +L+V+A +  L+FG KKL  +G  +G  +K F++A  + +   KK  D   QA
Sbjct: 4   ISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMNDDDAAAKKGADVDLQA 60



>gb:BA000043_736820 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 50

 Score = 40.8 bits (94), Expect = 0.035
 Identities = 19/47 (40%), Positives = 32/47 (68%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           L+++A +  L+FG KKLPE+GRS G++L+ F+ A K    + + + D
Sbjct: 4   LLLVAAIL-LLFGTKKLPELGRSFGQSLREFKDATKGLADDEETKTD 49



>gb:BA000036_720779 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927157_834595 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 10/10.
          Length = 60

 Score = 40.8 bits (94), Expect = 0.035
 Identities = 16/51 (31%), Positives = 32/51 (62%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           G  +L+++A V  ++FG  KLP++ RS+G++++ F+   KE   +  +  D
Sbjct: 5   GPAQLLIVALVVIVLFGSNKLPDVARSVGRSMRIFKSEIKEMNKDQIESSD 55



>gb:BX640422_808162 Bordetella pertussis strain Tohama I, complete
           genome; segment 12/12.
          Length = 147

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK--EPDSLA 540
           +F +   EL+VI  +  ++ GP++LP++ R+IG  L   Q+   + ++++++  E D L 
Sbjct: 1   MFDVSFTELMVIGVIALVVIGPERLPKVARTIGHLLGRAQRYVNDVKSDIRREIELDELR 60

Query: 541 QAPSEGVEEINQQEKRDATVSSTKEDS 621
           +  +E  E     +        T  DS
Sbjct: 61  KFKNEMDETARSMQTSLRETEDTLRDS 87



>gb:BA000035_717380 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 56

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 16/45 (35%), Positives = 30/45 (66%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETE 513
           G  +L++IA V  ++FG  KLP++ RS+G++L+ F+   +E   +
Sbjct: 5   GPAQLLIIALVVLVLFGSSKLPDVARSLGRSLRIFKSEIRELNRD 49



>gb:BA000035_716403 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 103

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 17/46 (36%), Positives = 30/46 (65%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETE 513
           LG  E+ +I  +  ++FG KKLP+  RSIG++++ F+   KE + +
Sbjct: 3   LGPWEIAIIVLLIIVLFGAKKLPDAARSIGRSMRIFKSEVKEMQKD 48



>gb:AE016792_334396 Pseudomonas putida KT2440 section 19 of 21 of
           the complete genome.>gb:AE015451_949473 Pseudomonas
           putida KT2440 complete genome.
          Length = 125

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRS----IGKTLKSFQQAAKEFETELKKEPDS 534
           +FG+   EL+++  V  L+ GP++LP   R+    IG+  +SF     E E E+  + D 
Sbjct: 1   MFGMSFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNSIKMEVEREIGAD-DI 59

Query: 535 LAQAPSEGVEEINQQEKR 588
             Q  +E + ++ ++ KR
Sbjct: 60  RRQLHNEHILQMEEEAKR 77



>gb:ECOUW85_131386 E. coli genomic sequence of the region from 84.5
           to 86.5 minutes.
          Length = 261

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
 Frame = +1

Query: 397 VIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDSLAQAPSEGVEE 567
           +IA +  L+FG KKL  IG  +G ++K F++A  + E +  K   + D  A+  ++   +
Sbjct: 10  IIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQAD 69

Query: 568 INQQEKRDATVSST 609
            NQ++ +    ++T
Sbjct: 70  TNQEQAKTEDANAT 83



>gb:ECOLIP_129274 Escherichia coli lipoic acid synthetase (lip)
           gene, complete cds.
          Length = 67

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           + + +L+V+A +  L+FG KKL  +G  +G  +K F++A  + +   KK  D   QA
Sbjct: 4   ISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMIDDDAAAKKGADVDLQA 60



>pir|A82448|A82448 tatA protein VCA0533 [imported] - Vibrio cholerae
           (strain N16961 serogroup O1)>gb:AE004384_53666 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome II,
           section 41 of 93 of the complete
           chromosome.>gb:AE003853_1050612 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome II, complete
           chromosome.
          Length = 78

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 17/42 (40%), Positives = 28/42 (66%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAK 498
           G+ V +L+++  + AL+FG KKL  IG   G  ++SFQ+A +
Sbjct: 3   GISVGKLLILGCIVALVFGTKKLRTIGEDAGYAIRSFQKALR 44



>pir|S30727|S30727 hypothetical protein o261 - Escherichia coli
          Length = 261

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
 Frame = +1

Query: 397 VIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK---EPDSLAQAPSEGVEE 567
           +IA +  L+FG KKL  IG  +G ++K F++A  + E +  K   + D  A+  ++   +
Sbjct: 10  IIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQAD 69

Query: 568 INQQEKRDATVSST 609
            NQ++ +    ++T
Sbjct: 70  TNQEQAKTEDANAT 83



>sp|P57063|TATB_VIBCH Sec-independent protein translocase protein
           tatB homolog.>pir|H82366|H82366 conserved hypothetical
           protein VC0087 [imported] - Vibrio cholerae (strain
           N16961 serogroup O1)>gb:AE004099_50495 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, section 7 of
           251 of the complete chromosome.>gb:AE003852_1051269
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, complete chromosome.
          Length = 133

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 6/89 (6%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  ELV+IA V  ++ GP++LP   RS+ K + + +  A   + EL  E       
Sbjct: 1   MFDIGFWELVLIAIVALVVLGPERLPHAIRSVAKFVSAAKSMANSVKDELAHELKVQELQ 60

Query: 529 DSLAQAPSEGVEEINQQEKRDATVSSTKE 615
           ++L +A   G++ ++ + ++  +V S K+
Sbjct: 61  ENLRKAEQMGMQNLSPELQK--SVESLKQ 87



>sp|O66477|TAT2_AQUAE Sec-independent protein translocase
           tatA/E-like protein 2.>pir|B70306|B70306 conserved
           hypothetical protein aq_064b - Aquifex
           aeolicus>gb:AE000672_25828 Aquifex aeolicus VF5 section
           4 of 109 of the complete genome.>gb:AE000657_976359
           Aquifex aeolicus VF5 complete genome.
          Length = 59

 Score = 40.0 bits (92), Expect = 0.059
 Identities = 18/46 (39%), Positives = 31/46 (67%)
 Frame = +1

Query: 388 ELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +L++I  V  +IFG  KLPE+G+ +G+ +++F++A    E E  KE
Sbjct: 8   QLILILLVILVIFGASKLPEVGKGLGEGIRNFKKALSGEEEEKGKE 53



>gb:BX640436_812508 Bordetella parapertussis strain 12822, complete
           genome; segment 14/14.
          Length = 151

 Score = 39.7 bits (91), Expect = 0.077
 Identities = 15/53 (28%), Positives = 34/53 (64%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F +   EL+VI  +  ++ GP++LP++ R+IG  L   Q+   + ++++++E
Sbjct: 1   MFDVSFTELMVIGVIALVVIGPERLPKVARTIGHLLGRAQRYVNDVKSDIRRE 53



>gb:AE017152_392234 Haemophilus ducreyi strain 35000HP section 2 of
           6 of the complete genome.>gb:AE017143_1026496
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 74

 Score = 39.7 bits (91), Expect = 0.077
 Identities = 18/71 (25%), Positives = 41/71 (57%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+ + +L++I  +  L+FG KKL  +G  +G+++K F++A  E +++        A+  +
Sbjct: 3   GISIWQLLIIVAIIVLLFGTKKLRTLGTDLGESVKGFKKAMAEDKSQDANFDKVEAKEST 62

Query: 553 EGVEEINQQEK 585
              E+  ++E+
Sbjct: 63  STTEKTKEKEQ 73



>gb:AE015852_318513 Shewanella oneidensis MR-1 section 401 of 457 of
           the complete genome.>gb:AE014299_954110 Shewanella
           oneidensis MR-1 complete genome.
          Length = 88

 Score = 39.7 bits (91), Expect = 0.077
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPS 552
           G+ + +L++IA +  L+FG KKL  +G  +G  +K F+ A    E + K   D+ A  P 
Sbjct: 3   GISIWQLLIIALIVVLLFGTKKLRSLGGDLGGAVKGFKNAMSS-EEDKKALEDAEAAKPV 61

Query: 553 EGVEEINQ----QEKRDATVSSTKEDS 621
           +  + +      Q+  +    S KE +
Sbjct: 62  QTAQTVQSAQPTQQATEKKPESNKEQA 88



>gb:CP000031_86690 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 152

 Score = 39.7 bits (91), Expect = 0.077
 Identities = 22/70 (31%), Positives = 38/70 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +F LG  EL+VI  V  ++ GPK LP + R++G+ +   +  A+EF   +    D     
Sbjct: 1   MFDLGWSELLVIGVVALIVVGPKDLPVLFRNVGRWVGKARGLAREFSRAMNDAAD----- 55

Query: 547 PSEGVEEINQ 576
              GV++I++
Sbjct: 56  -EAGVKDISK 64



>pir|B75473|B75473 conserved hypothetical protein - Deinococcus
           radiodurans  (strain R1)>gb:AE001935_41081 Deinococcus
           radiodurans R1 section 72 of 229 of the complete
           chromosome 1.>gb:AE000513_881976 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 132

 Score = 39.7 bits (91), Expect = 0.077
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +1

Query: 334 SNGRKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKE 501
           S  R   +      LG  E+++I  V AL+FG KKLPE+ + +G+ ++ F+   K+
Sbjct: 15  SRFRSHFFWRNSMSLGPFEIILILVVIALLFGAKKLPELMKGMGQGIREFKNEVKD 70



>gb:BX294143_768452 Pirellula sp. strain 1 complete genome; segment
           11/24.
          Length = 91

 Score = 39.3 bits (90), Expect = 0.10
 Identities = 19/62 (30%), Positives = 35/62 (56%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FGL   EL VI  +  ++FG   LPE+ R  G T   F+++ ++ + + ++  D  ++A
Sbjct: 1   MFGLSPFELAVIGVIAVVLFG-GNLPEVARKFGSTYSQFRRSLQDVQQQFRQVQDEASRA 59

Query: 547 PS 552
            S
Sbjct: 60  MS 61



>gb:CP000027_80558 Dehalococcoides ethenogenes 195, complete genome.
          Length = 65

 Score = 39.3 bits (90), Expect = 0.10
 Identities = 18/61 (29%), Positives = 41/61 (67%), Gaps = 4/61 (6%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAA----KEFETELKKEPDSLAQ 543
           +G  E+++I  +  ++FG  KLP++G +IGK +++F++A+    ++ E E K+E  ++ +
Sbjct: 4   IGPMEILIIVLLVVVVFGIGKLPQVGDAIGKGIRNFRKASSGEEEKEEVETKEETKTIEK 63

Query: 544 A 546
           +
Sbjct: 64  S 64



>gb:ACU48404_18812 Azotobacter chroococcum ORF1, ORF2, ORF3, ORF4,
           and ORF5 H2-dependent respiration genes, complete cds.
          Length = 192

 Score = 39.3 bits (90), Expect = 0.10
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 3/89 (3%)
 Frame = +1

Query: 331 RSNGRKRLYCNCLFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFET 510
           R  G++RL    +F +G  EL+++  V  L+ GP++LP   R  G  +   +++    +T
Sbjct: 71  RGTGQERL---SMFDIGFSELLLVGLVALLVLGPERLPVAARMAGLWIGRLKRSFNTLKT 127

Query: 511 ELKKE---PDSLAQAPSEGVEEINQQEKR 588
           E+++E    +   Q  +E + E+ ++ K+
Sbjct: 128 EVEREIGADEIRRQLHNERILELEREMKQ 156



>pir|D90193|D90193 conserved hypothetical protein [imported] -
           Sulfolobus solfataricus>gb:AE006680_221401 Sulfolobus
           solfataricus P2 section 39 of 272 of the complete
           genome.>gb:AE006641_1107249 Sulfolobus solfataricus P2,
           complete genome.
          Length = 112

 Score = 39.3 bits (90), Expect = 0.10
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 2/78 (2%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEI 570
           ++++  +  L FG  K+PE+ RS+G+ +  F++   E E EL++      Q P    ++ 
Sbjct: 27  IIILVVIAVLFFGASKIPELFRSMGRAVGEFKKGRVEAEMELQQMQAQNLQQPLVQQQQP 86

Query: 571 NQQ--EKRDATVSSTKED 618
           N Q  EK+ A +    E+
Sbjct: 87  NVQDLEKQIAELQKQLEE 104



>sp|Q8DDQ3|TATB_VIBVU Sec-independent protein translocase protein
           tatB homolog.>gb:AE016800_335660 Vibrio vulnificus CMCP6
           chromosome I section 4 of 11 of the complete
           sequence.>gb:BA000037_721007 Vibrio vulnificus YJ016
           DNA, chromosome I, complete
           sequence.>gb:AE016795_1045384 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 130

 Score = 39.3 bits (90), Expect = 0.10
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 6/89 (6%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  ELV+I  V  ++ GP++LP   RS+ + + + +  A   + EL  E       
Sbjct: 1   MFDIGFWELVLIFVVGLVVLGPERLPHAIRSVARFVSAAKSMANSVKDELAHELKVQELQ 60

Query: 529 DSLAQAPSEGVEEINQQEKRDATVSSTKE 615
           ++L +A   G+EE++   K  A+V   K+
Sbjct: 61  ENLRKAEQMGMEELSPDLK--ASVEQLKQ 87



>sp|Q87TH0|TATB_VIBPA Sec-independent protein translocase protein
           tatB homolog.>gb:BA000031_705559 Vibrio parahaemolyticus
           RIMD 2210633 DNA, chromosome 1, complete sequence.
          Length = 132

 Score = 39.3 bits (90), Expect = 0.10
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 6/79 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  ELV+I+ V  ++ GP++LP   RS+ + + + +  A   + EL  E       
Sbjct: 1   MFDIGFWELVLISVVGLVVLGPERLPHAIRSVSRFIGAAKNMANSVKDELSHELKVQELQ 60

Query: 529 DSLAQAPSEGVEEINQQEK 585
           ++L +A   G+E+++ + K
Sbjct: 61  ENLRKAEQMGMEDLSPELK 79



>sp|P72267|TATA_RHOER Sec-independent protein translocase protein
           tatA/E homolog.>gb:REZ82004_163489 R.erythropolis DNA,
           20S proteasome structural genes region (6583 bp).
          Length = 98

 Score = 39.3 bits (90), Expect = 0.10
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +1

Query: 397 VIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAP 549
           ++A V  ++FG KKLP+  R +G++L+ F+   KE + +      +   AP
Sbjct: 11  IVALVVVILFGSKKLPDAARGLGRSLRIFKSEVKEMQNDNSTPAPTAQSAP 61



>gb:AF461118_513422 Ralstonia eutropha strain H16 tat gene cluster,
           complete sequence.
          Length = 170

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 14/53 (26%), Positives = 32/53 (60%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +  LG+ +L +I  V  ++ GP++LP++ R++G  +   Q+   + + E+ +E
Sbjct: 1   MIDLGISKLALIGAVALIVIGPERLPKVARTVGALVGRAQRYINDVKAEVSRE 53



>gb:AE014291_308323 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 203

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 22/68 (32%), Positives = 37/68 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +F +   EL++IA V  ++ GPK LP++ R+ GK     +  A EF  +     ++L +A
Sbjct: 11  MFDIAWSELLIIAIVMIVVVGPKDLPKMLRAFGKATARMRTTANEFRHQFN---EALKEA 67

Query: 547 PSEGVEEI 570
             E V+ I
Sbjct: 68  ELEDVKTI 75



>gb:AAM320523_61 Acidianus ambivalens partial ORF1, sdhF gene, sdhE
           gene, sdhB gene, ORF2, tatC gene, tatB gene, tatA gene,
           hydS gene, isp1 gene, isp2 gene, hydL gene, hyd1 gene,
           hyd2 gene, hypD gene, hypC gene, hypD gene, hyp1 gene,
           hyp2 gene, hoxM gene and nanT gene.
          Length = 112

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 19/64 (29%), Positives = 36/64 (56%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEI 570
           LV++     L+ G K +    R++GKT++ F++   EF+TEL +E +   + P     EI
Sbjct: 9   LVLVLIAILLLSGQKDVAGTVRNLGKTIEEFKKRQNEFKTELLRELNETNEIPKSIAREI 68

Query: 571 NQQE 582
           + ++
Sbjct: 69  SSED 72



>sp|Q9K0J6|TATB_NEIMB Sec-independent protein translocase protein
           tatB homolog.>pir|E81181|E81181 hypothetical protein
           NMB0600 [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002415_46059 Neisseria meningitidis
           serogroup B strain MC58 section 57 of 206 of the
           complete genome.>gb:AE002098_896172 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 228

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 4/57 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQ----AAKEFETELKKE 525
           +F  G+ ELV +  +  ++ GP++LPE  R+ G+ +   Q+      +EF+T+++ E
Sbjct: 1   MFDFGLGELVFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVGSVKQEFDTQIELE 57



>sp|Q9JVK1|TATB_NEIMA Sec-independent protein translocase protein
           tatB homolog.>pir|D81925|D81925 probable sec-independent
           protein translocase component NMA0804 [imported] -
           Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA3Z2491_153743 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 3/7.
          Length = 228

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 4/57 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQ----AAKEFETELKKE 525
           +F  G+ ELV +  +  ++ GP++LPE  R+ G+ +   Q+      +EF+T+++ E
Sbjct: 1   MFDFGLGELVFVGIIALIVLGPERLPEAARTAGRLIGRLQRFVGSVKQEFDTQIELE 57



>gb:BA000040_733010 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 175

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 12/74 (16%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFE------------T 510
           +F +G  ELV+I  V  +  GPK+LP + R +G+ +   ++ A EF+             
Sbjct: 1   MFDIGWSELVLIGVVALIAIGPKELPGVLRMVGQWMGKARKMAAEFQGQFQEAMREAEMA 60

Query: 511 ELKKEPDSLAQAPS 552
           +LKK  D + +A S
Sbjct: 61  DLKKSFDEVKEAAS 74



>gb:AE016792_334395 Pseudomonas putida KT2440 section 19 of 21 of
           the complete genome.>gb:AE015451_949472 Pseudomonas
           putida KT2440 complete genome.
          Length = 90

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQ 543
           +V+  V  L+FG KKL   G  +G+++K F++A  E ET+  ++    AQ
Sbjct: 10  IVLLVVVVLVFGTKKLKNFGSDLGESIKGFRKAMNEEETKPAEQTPPPAQ 59



>gb:AY657288_2146298 Synthetic construct Peudomonas aeruginosa clone
           FLH043301.01F PA5069 gene, partial cds.
          Length = 142

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 4/87 (4%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRS----IGKTLKSFQQAAKEFETELKKEPDS 534
           +FG+   EL+++  V  L+ GP++LP   R+    IG+  +SF    +E E E+      
Sbjct: 1   MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNTIKQEVEREI------ 54

Query: 535 LAQAPSEGVEEINQQEKRDATVSSTKE 615
                  G +EI +Q   +  +S  +E
Sbjct: 55  -------GADEIRRQLHNEHILSMERE 74



>gb:AP006618_559560 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 87

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 10/78 (12%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGV--- 561
           L++IA +  ++FG K+LP+  R +G++L+ F+    + + E  +   +  Q P++ +   
Sbjct: 10  LLIIALLFVVLFGAKRLPDAARGLGRSLRIFKSEVNQMQHETPQANAAPVQQPAQQLPPA 69

Query: 562 -------EEINQQEKRDA 594
                  + +NQ E++ A
Sbjct: 70  QPAQAPAQPVNQAEQKSA 87



>gb:AE011365_272163 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 174 of 397 of the complete
           sequence.>gb:AE017294_434165 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 8 of 14 of the complete
           sequence.>gb:AE010300_1005562 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1067176 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 90

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +1

Query: 367 LFG-LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQ 543
           +FG LG  E+++I  +  L+FG K+LP + + +G  ++SF++              SL  
Sbjct: 12  VFGSLGWTEILLILFIALLLFGGKRLPSLAKDLGDGIRSFRK--------------SLTG 57

Query: 544 APSEGVEEINQQEKRDATVSSTK 612
              +  ++I+Q+++R      TK
Sbjct: 58  ESDDSSQQISQEQERSVPKEETK 80



>sp|Q9HUB4|TATB_PSEAE Sec-independent protein translocase protein
           tatB homolog.>pir|H83011|H83011 translocation protein
           TatB PA5069 [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004920_59301 Pseudomonas aeruginosa PAO1,
           section 481 of 529 of the complete
           genome.>gb:AE004091_973401 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 141

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 4/87 (4%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRS----IGKTLKSFQQAAKEFETELKKEPDS 534
           +FG+   EL+++  V  L+ GP++LP   R+    IG+  +SF    +E E E+      
Sbjct: 1   MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNTIKQEVEREI------ 54

Query: 535 LAQAPSEGVEEINQQEKRDATVSSTKE 615
                  G +EI +Q   +  +S  +E
Sbjct: 55  -------GADEIRRQLHNEHILSMERE 74



>sp|Q8NQE4|TATA_CORGL Sec-independent protein translocase protein
           tatA/E homolog.>gb:BA000036_719218 Corynebacterium
           glutamicum ATCC 13032 DNA, complete
           genome.>gb:BX927152_833068 Corynebacterium glutamicum
           ATCC 13032, IS fingerprint type 4-5, complete genome;
           segment 5/10.
          Length = 105

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETE 513
           LG  E+ +I  +  ++FG KKLP+  RSIG++++ F+   KE   +
Sbjct: 3   LGPWEIGIIVLLIIVLFGAKKLPDAARSIGRSMRIFKSEVKEMNKD 48



>gb:BA000023_693305 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 93

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 5/67 (7%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAP-----SEG 558
           +++  V  L FG  KLPE+ RS+G+    F++   E E EL +    L+Q       ++ 
Sbjct: 13  ILLIVVILLFFGASKLPEVFRSLGRATGEFKKGQLEAELELAQMQQQLSQQNKSDELAKK 72

Query: 559 VEEINQQ 579
           +EE+ +Q
Sbjct: 73  IEELQKQ 79



>sp|Q9PFU4|TATB_XYLFA Sec-independent protein translocase protein
           tatB homolog.>pir|A82791|A82791 hypothetical protein
           XF0563 [imported] - Xylella fastidiosa  (strain
           9a5c)>gb:AE003903_48202 Xylella fastidiosa 9a5c, section
           49 of 229 of the complete genome.>gb:AE003849_1115412
           Xylella fastidiosa 9a5c, complete genome.
          Length = 140

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +F +G  EL++IA V  ++ GP++LP+  R  G  ++  +   +  + EL++E +  A+A
Sbjct: 1   MFDIGFSELLLIAVVALVVLGPERLPKAARFAGLLVRRARTQWESIKQELERELE--AEA 58

Query: 547 PSEGVEEINQQ-EKRDATVSSTKED 618
               +E   Q      A + S ++D
Sbjct: 59  LKRNLENAQQVIHDAQAQLQSNQQD 83



>gb:BX936398_834904 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 220

 Score = 37.4 bits (85), Expect = 0.38
 Identities = 21/89 (23%), Positives = 46/89 (51%), Gaps = 6/89 (6%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  EL+++  +  ++ GP++LP   R++   +++ +  A   + EL +E       
Sbjct: 1   MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAATVQNELAQELKLQELQ 60

Query: 529 DSLAQAPSEGVEEINQQEKRDATVSSTKE 615
           DSL +    G++ +  + K  A++   KE
Sbjct: 61  DSLKKVEQAGLQNLTPELK--ASMDELKE 87



>gb:AE016874_354493 Pseudomonas syringae pv. tomato str. DC3000
           section 19 of 21 of the complete
           genome.>gb:AE016853_1039668 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 91

 Score = 37.4 bits (85), Expect = 0.38
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA-PSEGVEEI 570
           +VI  V  L+FG KKL  +G  +G+++K F++A  + +   ++      QA P+     +
Sbjct: 10  IVILIVVVLVFGTKKLKGLGTDVGESIKGFRKAMHDDDKPAEQPAPQPQQAQPAPQGSPL 69

Query: 571 NQQEKRDATVSSTKE 615
           NQ    DA      E
Sbjct: 70  NQPHTIDAQAHKVDE 84



>sp|Q8ZAM3|TATB_YERPE Sec-independent protein translocase protein
           tatB homolog.>pir|AH0459|AH0459 Sec-independent protein
           translocase protein TatB [imported] - Yersinia pestis
           (strain CO92)>gb:AE013646_298784 Yersinia pestis KIM
           section 46 of 415 of the complete
           genome.>gb:AE017139_389017 Yersinia pestis biovar
           Medievalis str. 91001 section 13 of 16 of the complete
           genome.>gb:AJ414158_525533 Yersinia pestis strain CO92
           complete genome; segment 18/20.>gb:AE009952_928967
           Yersinia pestis KIM complete genome.>gb:AE017042_1145583
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 220

 Score = 37.4 bits (85), Expect = 0.38
 Identities = 21/89 (23%), Positives = 46/89 (51%), Gaps = 6/89 (6%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  EL+++  +  ++ GP++LP   R++   +++ +  A   + EL +E       
Sbjct: 1   MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRTLRSLAATVQNELAQELKLQELQ 60

Query: 529 DSLAQAPSEGVEEINQQEKRDATVSSTKE 615
           DSL +    G++ +  + K  A++   KE
Sbjct: 61  DSLKKVEQAGLQNLTPELK--ASMDELKE 87



>sp|P57047|TATB_HAEIN Sec-independent protein translocase protein
           tatB homolog.
          Length = 186

 Score = 37.4 bits (85), Expect = 0.38
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 6/77 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  EL+++  +  ++ GPK+LP   R++   +K+ +  A   + ELK+E       
Sbjct: 1   MFDIGFSELILLMVLGLVVLGPKRLPIAIRTVMDWVKTIRGLAANVQNELKQELKLQELQ 60

Query: 529 DSLAQAPSEGVEEINQQ 579
           DS+ +A S  ++ ++ +
Sbjct: 61  DSIKKAESLNLQALSPE 77



>gb:BA000023_691177 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 94

 Score = 37.0 bits (84), Expect = 0.50
 Identities = 23/64 (35%), Positives = 32/64 (50%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           ++I     LIFG  KLPEI RS+G+    F++   E E E       LAQ      ++  
Sbjct: 14  IIIVVAIILIFGASKLPEIFRSLGRATGEFKKGKLEAEME-------LAQLQQVQQQQQT 66

Query: 574 QQEK 585
           QQ+K
Sbjct: 67  QQQK 70



>sp|Q8XV90|TATB_RALSO Sec-independent protein translocase protein
           tatB homolog.>gb:AL646072_547869 Ralstonia solanacearum
           GMI1000 chromosome, complete sequence; segment 16/19.
          Length = 172

 Score = 37.0 bits (84), Expect = 0.50
 Identities = 14/53 (26%), Positives = 31/53 (58%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +  LG+ +L +I  V  ++ GP++LP++ R+ G  +   Q+   + + E+ +E
Sbjct: 1   MIDLGISKLALIGAVALVVIGPERLPKVARTAGALIGRAQRYIADVKAEVSRE 53



>gb:AE017282_428241 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 104

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 15/53 (28%), Positives = 29/53 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F +G  E+++I  V  L FGP++LP++ R  G  ++  +        E++ E
Sbjct: 1   MFDIGFTEMLLIGLVALLAFGPERLPKVARETGYWIRKARSTLASVRAEIEHE 53



>gb:AE017148_391242 Helicobacter hepaticus ATCC 51449 section 5 of 6
           of the complete genome.>gb:AE017125_1025504 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 189

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 13/93 (13%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPE-------IGRSIGKTLKSFQQA------AKEFE 507
           +FG+G+ E++VI  V  +  GP KLP+         R++ KT+   ++         E +
Sbjct: 1   MFGVGIFEVLVILIVAVIALGPNKLPQTIVDIVKFFRAVKKTMAEAKETFDKEIQLSEIK 60

Query: 508 TELKKEPDSLAQAPSEGVEEINQQEKRDATVSS 606
            E  K  D+L    ++  ++I   E R+ +V S
Sbjct: 61  QEALKYKDTLESEVNKLTKDIRLDELREISVDS 93



>gb:AE016874_354494 Pseudomonas syringae pv. tomato str. DC3000
           section 19 of 21 of the complete
           genome.>gb:AE016853_1039669 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 153

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 4/54 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRS----IGKTLKSFQQAAKEFETEL 516
           +FG+   EL+++  V  L+ GP++LP   R+    IG+  +SF    +E E E+
Sbjct: 1   MFGISFSELLLVGLVALLVLGPERLPGAARTAGLWIGRLKRSFNAIKQEVEREI 54



>gb:SLI292256_183638 Streptomyces lividans putative tatB gene for
           twin arginine translocation complex component.
          Length = 158

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 13/50 (26%), Positives = 32/50 (64%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +G  ELV +  +  L+FGP KLP++ + + +T++  ++ +   + ++++E
Sbjct: 5   IGALELVTLVVLAVLVFGPDKLPKVIQDVTRTIRKIREFSDSAKQDIRQE 54



>gb:SCO939117_177440 Streptomyces coelicolor A3(2) complete genome;
           segment 14/29.
          Length = 82

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 3/64 (4%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKT---LKSFQQAAKEFETELKKEPDSLAQAP 549
           G+ EL +I  V A +   KKLPE+ RS GK+   LKS  +AA++ +     EP +    P
Sbjct: 3   GLSELAIILVVVAAVLAVKKLPELTRSAGKSARILKSEARAARDAD-----EPGTPRVIP 57

Query: 550 SEGV 561
            E V
Sbjct: 58  GETV 61



>gb:DFR439608_124097 Desulfitobacterium hafniense composite
           transposon Tn-Dha1 and pce operon (pceABCT genes),
           strain TCE1.
          Length = 112

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 15/49 (30%), Positives = 29/49 (59%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           +G  E+ +I  +  ++FGP++LP I R + K +   ++ + E   EL+K
Sbjct: 1   MGFTEIFLIMTIALILFGPEELPGIARRVAKVIMEVRKFSNESTKELQK 49



>gb:CR543861_103471 Acinetobacter sp. ADP1 complete genome.
          Length = 138

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD--SLA 540
           +F +   EL+  A +  +I GP+KLP   RS+    ++ +    + + +++ E D   L 
Sbjct: 1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK 60

Query: 541 QAPSEGVEEINQQEKR 588
           +   E +++I Q E++
Sbjct: 61  RVMQEELQKIKQNEEQ 76



>gb:CP000027_80557 Dehalococcoides ethenogenes 195, complete genome.
          Length = 78

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 22/82 (26%), Positives = 44/82 (53%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSE 555
           +G  E+++I  +  ++FG  ++P+IG S+GK L + ++   +FE E  K    + +   +
Sbjct: 4   IGPIEILIIVLLIVVVFGASRIPKIGESLGKALHNIRK-KNDFEEETPK--PKVVKKLED 60

Query: 556 GVEEINQQEKRDATVSSTKEDS 621
           G       EK    ++ TK++S
Sbjct: 61  GAVSAKINEK----IAETKKES 78



>gb:AE004969_59966 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 228

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 22/91 (24%), Positives = 46/91 (50%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +F  G+ EL+ +  +  ++ GP++LPE  R+ G+ +   Q+    F   +K+E D+  + 
Sbjct: 1   MFDFGLGELIFVGIIALIVLGPERLPEAARTAGRLIGRLQR----FVGSVKQELDTQIE- 55

Query: 547 PSEGVEEINQQEKRDATVSSTKEDS*TATAT 639
               +EE+ + ++     ++   DS   T T
Sbjct: 56  ----LEELRKVKQAFEAAAAQVRDSLKETDT 82



>sp|Q87B79|TATB_XYLFT Sec-independent protein translocase protein
           tatB homolog.>gb:AE012559_284969 Xylella fastidiosa
           Temecula1, section 7 of 9 of the complete
           genome.>gb:AE009442_961545 Xylella fastidiosa Temecula1,
           complete genome.
          Length = 138

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 17/58 (29%), Positives = 35/58 (60%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLA 540
           +F +G  EL++IA V  ++ GP++LP+  R  G  ++  +   +  + EL++E ++ A
Sbjct: 1   MFDIGFSELLLIAVVALVVLGPERLPKAARFAGLLVRRARTQWESIKQELERELEAEA 58



>sp|Q9FBK8|TATB_STRCO Sec-independent protein translocase protein
           tatB homolog.>gb:SCO939122_178822 Streptomyces
           coelicolor A3(2) complete genome; segment 19/29.
          Length = 161

 Score = 36.6 bits (83), Expect = 0.65
 Identities = 13/50 (26%), Positives = 32/50 (64%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +G  ELV +  +  L+FGP KLP++ + + +T++  ++ +   + ++++E
Sbjct: 5   IGALELVTLVVLAVLVFGPDKLPKVIQDVTRTIRKIREFSDSAKQDIRQE 54



>gb:CP000020_870226 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 126

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 19/80 (23%), Positives = 45/80 (56%), Gaps = 6/80 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  EL++I+ V  ++ GP++LP+  RS+ + + + +  A   + EL +E       
Sbjct: 1   MFDIGFWELILISVVGLVVLGPERLPKAIRSVAQFIGAAKSMANNVKDELSQELKIQELQ 60

Query: 529 DSLAQAPSEGVEEINQQEKR 588
           ++L +A    +++++   K+
Sbjct: 61  ENLRKAEQMNMDDLSPDLKK 80



>gb:BX640422_808161 Bordetella pertussis strain Tohama I, complete
           genome; segment 12/12.>gb:BX640436_812507 Bordetella
           parapertussis strain 12822, complete genome; segment
           14/14.>gb:BX640451_817511 Bordetella bronchiseptica
           strain RB50, complete genome; segment 15/16.
          Length = 75

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 17/67 (25%), Positives = 35/67 (52%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           +++  + AL+FG KKL  +G  +G  +K F++  K+   + K       Q  S+   ++ 
Sbjct: 10  LIVLVIIALVFGTKKLRNVGSDLGSAVKGFKEGMKDASAD-KPADQVTQQRVSDDTIDVQ 68

Query: 574 QQEKRDA 594
            +EK ++
Sbjct: 69  AKEKSNS 75



>gb:AF461118_513421 Ralstonia eutropha strain H16 tat gene cluster,
           complete sequence.
          Length = 77

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           +++  +  L+FG KKL  IG+ +G  +K F+   K+ E +   +P    +       ++ 
Sbjct: 10  LIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMKDGEGKAAADPAQSKELRDSTTIDVE 69

Query: 574 QQEK 585
            +EK
Sbjct: 70  AKEK 73



>gb:AE016912_355584 Chromobacterium violaceum ATCC 12472 section 3
           of 16 of the complete genome.>gb:AE016825_1040738
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 68

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKE 501
           L +   +++  +  L+FG KKLP IG+ +G  +K F++   E
Sbjct: 4   LSIWHWLIVLLIVVLVFGTKKLPGIGKDLGNAVKGFKEGMNE 45



>gb:AE013598_298108 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 215

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F +GV EL +IA V  ++ GP++LP+  R  G  ++  +      + EL++E
Sbjct: 1   MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERE 53



>gb:CR378663_93536 Photobacterium profundum SS9; segment 1/12.
          Length = 112

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 19/77 (24%), Positives = 44/77 (57%), Gaps = 6/77 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  EL++I+ V  ++ GP++LP   RS+ + + + +  A   + EL +E       
Sbjct: 1   MFDIGFWELILISVVGLVVLGPERLPVAIRSVSRWVGAARNMANSVKDELSQELKIQELQ 60

Query: 529 DSLAQAPSEGVEEINQQ 579
           ++L +A   G+++++ +
Sbjct: 61  ENLKKAEQMGMKDLSPE 77



>sp|Q8PEX3|TATB_XANAC Sec-independent protein translocase protein
           tatB homolog.>gb:AE012074_279123 Xanthomonas axonopodis
           pv. citri str. 306, section 452 of 469 of the complete
           genome.>gb:AE008923_920898 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 208

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F +GV EL +IA V  ++ GP++LP+  R  G  ++  +      + EL++E
Sbjct: 1   MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERE 53



>sp|Q8E9R3|TATB_SHEON Sec-independent protein translocase protein
           tatB homolog.>gb:AE015852_318514 Shewanella oneidensis
           MR-1 section 401 of 457 of the complete
           genome.>gb:AE014299_954111 Shewanella oneidensis MR-1
           complete genome.
          Length = 149

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 22/75 (29%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAA----KEFETELKKEP--DS 534
           G+G  EL++I  +  ++ GP++LP   RS+   +++ ++ A    +E E ELK E     
Sbjct: 4   GIGFMELLLIGVLGLIVLGPERLPVAVRSVTSWVRAMKRMANSVKEELEQELKIEQLHAD 63

Query: 535 LAQAPSEGVEEINQQ 579
           L +A S+G+  ++ +
Sbjct: 64  LKKAESKGLSNLSPE 78



>sp|Q9PNB9|TATA_CAMJE Sec-independent protein translocase protein
           tatA/E homolog.>pir|B81323|B81323 hypothetical protein
           Cj1176c [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X4_847549 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           4/6.>gb:CP000025_879050 Campylobacter jejuni RM1221,
           complete genome.
          Length = 79

 Score = 36.2 bits (82), Expect = 0.85
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           ++I  +  L+FG KK+PE+ + +GK +K+F+      + E+ K    +     E  +   
Sbjct: 11  LIILLIVVLLFGAKKIPELAKGLGKGIKTFKDEMNN-DDEVAKNTQKI-----EENKNTT 64

Query: 574 QQEKRDATVSSTKE 615
                DA++  TK+
Sbjct: 65  NNTNADASIDETKK 78



>gb:BX321858_772966 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 3/10.
          Length = 131

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEP--DSLA 540
           +F +   ELVV+  V  ++ GP++LP + R+ G  L   ++   + + +L +E   DSL 
Sbjct: 1   MFDISFAELVVVGIVALIVIGPERLPAVARTAGYFLGRARRYVDQVKHDLHEEMELDSLR 60

Query: 541 QAPSEGVEEINQQE 582
           +      E +N  E
Sbjct: 61  KLRDSMHETVNSFE 74



>gb:BA000030_701000 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 148

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 13/50 (26%), Positives = 33/50 (66%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +G  ELV +  +  L+FGP KLP++ + + +T++  ++ ++  + ++++E
Sbjct: 5   IGPLELVTLVVLAVLVFGPDKLPKMIQDVTRTIRKIREFSESAKQDIREE 54



>gb:CR628336_113090 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_116028 Legionella pneumophila str.
           Lens complete genome.
          Length = 61

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           L G+    L++I  +   +FG  KL  IG  +G+ +K+F++A    ET   ++ D
Sbjct: 3   LSGISPLSLLLILAIIVALFGTSKLKTIGSDLGEAIKNFRKAMNSEETNDTQKDD 57



>sp|P57800|TATB_PASMU Sec-independent protein translocase protein
           tatB homolog.>gb:AE006205_216578 Pasteurella multocida
           subsp. multocida str. Pm70 section 172 of 204 of the
           complete genome.>gb:AE004439_1119308 Pasteurella
           multocida subsp. multocida str. Pm70, complete genome.
          Length = 191

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD-SLAQ 543
           +F +G  EL +I  +  L+ GPK+LP   R++   + + +  A   + ELK+E      Q
Sbjct: 1   MFDIGFSELFLILVIGLLVLGPKRLPVAIRTVMGWVATIRGLASNVQNELKQELKLQELQ 60

Query: 544 APSEGVEEINQQE 582
              +  EE+N Q+
Sbjct: 61  ESIKKAEELNFQQ 73



>gb:AE016822_339961 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 76

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           L GL    L++I  V  L+FG  KLP + +S+G++++ F+    E + +  K+
Sbjct: 2   LGGLTGWHLLIILAVILLLFGAPKLPALAKSVGQSMRIFKGEVNEMKKDGDKD 54



>gb:AE016777_330480 Pseudomonas putida KT2440 section 4 of 21 of the
           complete genome.>gb:AE015451_945557 Pseudomonas putida
           KT2440 complete genome.
          Length = 77

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQA-AKEFETELKKEPDSLAQAP 549
           G+G+ +LV++  +  L+FG K+L  +G  +G+ ++ F+++   + +     +     Q P
Sbjct: 3   GIGIWQLVIVLLIVFLLFGTKRLKGLGSDVGEAIQGFRKSMGGDNDASAADQAHVQQQCP 62

Query: 550 SEGVEEINQQEKRD 591
             G  ++ QQ + D
Sbjct: 63  LNG--QVAQQSQAD 74



>gb:AE014291_308322 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 80

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 16/64 (25%), Positives = 36/64 (56%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           +++  V  L+FG  K+PE+   + K +K+F+Q     + + K++P ++     E V+++ 
Sbjct: 18  LIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMA--DEDAKEDPRTIDAKAEEPVKDVK 75

Query: 574 QQEK 585
           +  K
Sbjct: 76  KTTK 79



>gb:LPN276399_141890 Legionella pneumophila tatA gene.
          Length = 61

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           L G+    L++I  +   +FG  KL  IG  +G+ +K+F++A    ET   ++ D
Sbjct: 3   LSGISPLSLLLILAIIIALFGTSKLKTIGSDLGEAIKNFRKAMNSEETNDTQKDD 57



>sp|Q8YGS4|TATA_BRUME Sec-independent protein translocase protein
           tatA/E homolog.>pir|AF3387|AF3387 sec-independent
           protein translocase protein tatA [imported] - Brucella
           melitensis (strain 16M)>gb:AE009548_253002 Brucella
           melitensis 16M chromosome I, section 105 of 195 of the
           complete sequence.>gb:AE008917_978914 Brucella
           melitensis 16M chromosome I, complete sequence.
          Length = 72

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 16/64 (25%), Positives = 36/64 (56%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           +++  V  L+FG  K+PE+   + K +K+F+Q     + + K++P ++     E V+++ 
Sbjct: 10  LIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMA--DEDAKEDPRTIDAKAEEPVKDVK 67

Query: 574 QQEK 585
           +  K
Sbjct: 68  KTTK 71



>gb:BX294143_768451 Pirellula sp. strain 1 complete genome; segment
           11/24.
          Length = 100

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 12/41 (29%), Positives = 27/41 (65%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKE 501
           G+PE++++  +  ++FG  KLP + R++G++   F++   E
Sbjct: 44  GLPEMLIVLVICLVLFGGAKLPSLMRNLGRSANEFKRGMAE 84



>gb:AE017256_417957 Wolbachia endosymbiont of Drosophila
           melanogaster, section 1 of 5 of the complete
           genome.>gb:AE017321_442310 Wolbachia endosymbiont strain
           TRS of Brugia malayi, complete
           genome.>gb:AE017196_1058594 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 55

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 16/52 (30%), Positives = 30/52 (57%)
 Frame = +1

Query: 376 LGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPD 531
           LG  +L ++  +  ++FG  +LP++   +GK +K+ +Q  K+ E     EPD
Sbjct: 3   LGPWQLFLVLIIILVLFGAGRLPQVMGDLGKGIKNLKQELKDSEKLSSNEPD 54



>gb:AAM320523_62 Acidianus ambivalens partial ORF1, sdhF gene, sdhE
           gene, sdhB gene, ORF2, tatC gene, tatB gene, tatA gene,
           hydS gene, isp1 gene, isp2 gene, hydL gene, hyd1 gene,
           hyd2 gene, hypD gene, hypC gene, hypD gene, hyp1 gene,
           hyp2 gene, hoxM gene and nanT gene.
          Length = 96

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKK 522
           V+I     L FG  K+PE+ RS+G+ L  F++   E E E+++
Sbjct: 10  VIIIVALILFFGTNKIPELFRSMGRALGEFKKGRLEAEMEMQQ 52



>sp|Q92Q24|TATB_RHIME Sec-independent protein translocase protein
           tatB homolog.>gb:SME591787_185548 Sinorhizobium meliloti
           1021 complete chromosome; segment 6/12.
          Length = 215

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETE 513
           +  +G  ELVVIA V  ++ GPK LP + R+ G+     +  A +F  +
Sbjct: 1   MLDIGWTELVVIAIVLIIVVGPKDLPPMLRAFGRMTSKMRGMASDFRRQ 49



>sp|O25700|TATB_HELPY Sec-independent protein translocase protein
           tatB homolog.>pir|D64652|D64652 probable ABC transporter
           - Helicobacter pylori (strain 26695)>gb:AE000613_25224
           Helicobacter pylori 26695 section 91 of 134 of the
           complete genome.>gb:AE000511_880663 Helicobacter pylori
           26695 complete genome.
          Length = 160

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 12/95 (12%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPE-------IGRSIGKTLKSFQQAA-KEFE-TELK 519
           +FG+G  E++V+  V  +  GP+K P+         R++ KTL   +    KE    E+K
Sbjct: 1   MFGMGFFEILVVLVVAIIFLGPEKFPQAVVDVVKFFRAVKKTLNDAKDTLDKEINIEEIK 60

Query: 520 KEP---DSLAQAPSEGVEEINQQEKRDATVSSTKE 615
           KE      L +   E ++ +  +E  DA V++  E
Sbjct: 61  KETLEYQKLFENKVESLKGVKIEELEDAKVTAENE 95



>sp|Q9PHT7|TATB_CAMJE Sec-independent protein translocase protein
           tatB homolog.>pir|B81405|B81405 hypothetical protein
           Cj0579c [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X2_846980 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           2/6.>gb:CP000025_878447 Campylobacter jejuni RM1221,
           complete genome.
          Length = 138

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = +1

Query: 388 ELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           E++VI  V  L+ GP KLPE    I K LK+ ++   + ++ ++KE
Sbjct: 5   EIIVILVVAILVLGPDKLPEAIVQIAKILKAVKRNIDDAKSSIEKE 50



>sp|Q8P3H9|TATB_XANCP Sec-independent protein translocase protein
           tatB homolog.>gb:AE012532_283311 Xanthomonas campestris
           pv. campestris str. ATCC 33913, section 440 of 460 of
           the complete genome.>gb:AE008922_916593 Xanthomonas
           campestris pv. campestris str. ATCC 33913, complete
           genome.
          Length = 195

 Score = 34.7 bits (78), Expect = 2.5
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F +G  EL +IA V  ++ GP++LP+  R  G  ++  +      + EL++E
Sbjct: 1   MFDIGFSELALIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERE 53



>sp|Q9ZM58|TATB_HELPJ Sec-independent protein translocase protein
           tatB homolog.>pir|E71942|E71942 hypothetical protein
           jhp0365 - Helicobacter pylori (strain
           J99)>gb:AE001471_35357 Helicobacter pylori, strain J99
           section 32 of 132 of the complete
           genome.>gb:AE001439_884127 Helicobacter pylori, strain
           J99 complete genome.
          Length = 160

 Score = 34.7 bits (78), Expect = 2.5
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 12/95 (12%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPE-------IGRSIGKTLKSFQQAA-KEFE-TELK 519
           +FG+G  E++V+  V  +  GP+K P+         R++ KTL   +    KE    E+K
Sbjct: 1   MFGMGFFEILVVLIVAIIFLGPEKFPQAVVDIVKFFRAVKKTLNDAKDTLDKEINIEEIK 60

Query: 520 KEP---DSLAQAPSEGVEEINQQEKRDATVSSTKE 615
           KE      L +   E ++ +  +E  DA V++  E
Sbjct: 61  KETLEYQKLFENKVESLKGVKIEELEDAKVTAENE 95



>gb:BX950851_838956 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 197

 Score = 34.3 bits (77), Expect = 3.2
 Identities = 13/53 (24%), Positives = 31/53 (58%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F +G  EL+++  +  ++ GP++LP   R++   +++ +  A   + EL +E
Sbjct: 1   MFDIGFGELLLVMVLGLIVLGPERLPVAVRTVASWIRTLRSLASTVQNELSQE 53



>gb:BX321858_772967 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 3/10.
          Length = 76

 Score = 34.3 bits (77), Expect = 3.2
 Identities = 16/64 (25%), Positives = 31/64 (48%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEIN 573
           +V+  +  L+FG KKL  +G  +G  ++ F++  K  E E    P +          EI 
Sbjct: 10  LVVLAIVVLVFGTKKLRNLGSDLGGAVRGFKEGMKGAEEESTPPPPAQQVTGHSIKSEIE 69

Query: 574 QQEK 585
           ++++
Sbjct: 70  EKDQ 73



>gb:AE017340_456998 Idiomarina loihiensis L2TR, complete genome.
          Length = 72

 Score = 34.3 bits (77), Expect = 3.2
 Identities = 14/51 (27%), Positives = 30/51 (58%)
 Frame = +1

Query: 373 GLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           G+ + +L V+  +  L+FG KKL  +G  +G  +K F+ +  +  ++ +K+
Sbjct: 5   GMSMVQLGVLLVIVILLFGSKKLRTLGSDLGSAIKGFKSSITDEPSDREKD 55



>sp|P57048|TATB_SALTY Sec-independent protein translocase protein
           tatB.>gb:CP000026_78475 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008885_245591 Salmonella typhimurium LT2,
           section 189 of 220 of the complete
           genome.>gb:AE006468_1002673 Salmonella typhimurium LT2,
           complete genome.
          Length = 182

 Score = 34.3 bits (77), Expect = 3.2
 Identities = 17/79 (21%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  EL+++  +  ++ GP++LP   +++   +++ +  A   + EL +E       
Sbjct: 1   MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQ 60

Query: 529 DSLAQAPSEGVEEINQQEK 585
           DSL +     +E +  + K
Sbjct: 61  DSLKKVEKASLENLTPELK 79



>sp|Q8Z3C0|TATB_SALTI Sec-independent protein translocase protein
           tatB.>pir|AH0915|AH0915 sec-independent protein
           translocase protein [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:AE016845_347307 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 12 of 16 of the
           complete genome.>gb:AL627278_543640 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 14/20.>gb:AE014613_984639 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 182

 Score = 34.3 bits (77), Expect = 3.2
 Identities = 17/79 (21%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE------P 528
           +F +G  EL+++  +  ++ GP++LP   +++   +++ +  A   + EL +E       
Sbjct: 1   MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQ 60

Query: 529 DSLAQAPSEGVEEINQQEK 585
           DSL +     +E +  + K
Sbjct: 61  DSLKKVEKASLENLTPELK 79



>gb:BX640451_817512 Bordetella bronchiseptica strain RB50, complete
           genome; segment 15/16.
          Length = 140

 Score = 33.9 bits (76), Expect = 4.2
 Identities = 12/44 (27%), Positives = 29/44 (65%)
 Frame = +1

Query: 394 VVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +VI  +  ++ GP++LP++ R+IG  L   Q+   + ++++++E
Sbjct: 1   MVIGVIALVVIGPERLPKVARTIGHLLGRAQRYVNDVKSDIRRE 44



>gb:BX251411_764647 Tropheryma whipplei TW08/27, complete genome;
           segment 2/3.
          Length = 93

 Score = 33.9 bits (76), Expect = 4.2
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 8/82 (9%)
 Frame = +1

Query: 391 LVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE---PDS---LAQAPS 552
           L+VI  V  L+FG  +LP++ +S+ + LK F+++  E     + +   PDS    A++ S
Sbjct: 10  LLVILLVIVLLFGTSRLPKLSKSVVEALKIFRRSFNEASDITRSQDGHPDSQGNFAESAS 69

Query: 553 E--GVEEINQQEKRDATVSSTK 612
               V+   Q EKR +   + K
Sbjct: 70  SVPFVKSEKQSEKRASVTEAKK 91



>gb:CP000031_86691 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 71

 Score = 33.9 bits (76), Expect = 4.2
 Identities = 15/53 (28%), Positives = 32/53 (60%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           L  +G+P L++IA V  ++FG  K+  +   +GK + +F++   +   EL+++
Sbjct: 2   LNNIGLPGLLLIAVVVLVLFGRGKISSLMGEVGKGITAFKKGVSDGSKELEED 54



>gb:CP000010_866837 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 175

 Score = 33.5 bits (75), Expect = 5.5
 Identities = 13/53 (24%), Positives = 29/53 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +  LG+ ++ +I  V  ++ GP++LP + R+ G      Q+   + + E+ +E
Sbjct: 1   MLDLGLSKMALIGVVALVVLGPERLPRVARTAGALFGRAQRYINDVKAEVSRE 53



>gb:BX572602_802461 Rhodopseudomonas palustris CGA009 complete
           genome; segment 10/16.
          Length = 169

 Score = 33.5 bits (75), Expect = 5.5
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 13/82 (15%)
 Frame = +1

Query: 397 VIAGVTALI-FGPKKLPEIGRSIGKTLKSFQQAAKEFE------------TELKKEPDSL 537
           ++ GV ALI  GPK+LP + R++G+ +   ++ A EF+             +LKK  D +
Sbjct: 1   MVIGVVALIAIGPKELPGVLRTVGQWMGKARRLATEFQGQFQEAMREAEMADLKKSFDEV 60

Query: 538 AQAPSEGVEEINQQEKRDATVS 603
            +A S G+   N   K  + V+
Sbjct: 61  KEATS-GLSTNNMLTKLSSEVT 81



>gb:BX571965_792925 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 175

 Score = 33.5 bits (75), Expect = 5.5
 Identities = 13/53 (24%), Positives = 29/53 (54%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +  LG+ ++ +I  V  ++ GP++LP + R+ G      Q+   + + E+ +E
Sbjct: 1   MLDLGLSKMALIGVVALVVLGPERLPRVARTAGALFGRAQRYINDVKAEVSRE 53



>gb:AE017283_430431 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 137

 Score = 33.5 bits (75), Expect = 5.5
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +1

Query: 379 GVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           G  E+ V+  +  L+FGP KLPE+ R   +     +  A     +L+ E
Sbjct: 5   GPAEIAVLIVIAVLMFGPDKLPEMARKAARIYHYLKDIANNTRDQLRSE 53



>gb:AE017261_420149 Picrophilus torridus DSM 9790, complete genome.
          Length = 93

 Score = 33.5 bits (75), Expect = 5.5
 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%)
 Frame = +1

Query: 382 VPELVVIAGVTALIFG-PKKLPEIGRSIGKTLKSFQQAAKEFETEL 516
           + + +++  V  +IFG  KK+PE+ R++G+    F++   E E E+
Sbjct: 5   IDDWLILIVVAVIIFGGTKKIPELARNLGRATGEFKKGQMEIENEI 50



>gb:AE013146_289557 Thermoanaerobacter tengcongensis MB4, section
           173 of 244 of the complete genome.>gb:AE008691_1111622
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 111

 Score = 33.5 bits (75), Expect = 5.5
 Identities = 18/74 (24%), Positives = 37/74 (50%)
 Frame = +1

Query: 400 IAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEEINQQ 579
           +A    ++F PK    I  S+ K+LK  Q A  +      +    + +A  + +EE+NQ 
Sbjct: 17  VAAALGMMFYPKAKENIKPSLEKSLKEMQDAINKAVKFFDENKQKITEAIKKKIEELNQT 76

Query: 580 EKRDATVSSTKEDS 621
            ++  +++  KE++
Sbjct: 77  AQK-GSITKQKEEA 89



>gb:PST299712_161652 Pseudomonas stutzeri tatA gene, tatB gene and
           tatC gene.
          Length = 139

 Score = 33.1 bits (74), Expect = 7.2
 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 4/78 (5%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLP----EIGRSIGKTLKSFQQAAKEFETELKKEPDS 534
           +F +G  EL+++  V  ++ GP++LP      G  +G+  +SF     E E E+  + + 
Sbjct: 1   MFDIGFTELLLVGLVALMVLGPERLPGAVRPTGLWVGRLKRSFANIKAEVEREIGAD-EI 59

Query: 535 LAQAPSEGVEEINQQEKR 588
             Q  +E + ++ ++ K+
Sbjct: 60  RRQLHNERILDLEREMKQ 77



>gb:BX897699_827186 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 146

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 17/67 (25%), Positives = 37/67 (55%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQA 546
           +FG+   E +VI  V  ++ GPK LP++ +++ + +   +  A EF  +     D++ QA
Sbjct: 1   MFGIDGLEFLVILLVLIVVVGPKDLPKMLKTMARAIAYVRSTANEFRHQF---DDAIKQA 57

Query: 547 PSEGVEE 567
             + +++
Sbjct: 58  ELDDLQK 64



>gb:AE016912_355585 Chromobacterium violaceum ATCC 12472 section 3
           of 16 of the complete genome.>gb:AE016825_1040739
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 174

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 18/72 (25%), Positives = 40/72 (55%)
 Frame = +1

Query: 388 ELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKEPDSLAQAPSEGVEE 567
           E V+I  V  ++ GP++LP + R++G  +   Q+     + ++++      QA  +G++ 
Sbjct: 8   EFVLIGVVALVVLGPERLPTVARTVGALVARAQRFVANVKADMQQ------QANLQGLDS 61

Query: 568 INQQEKRDATVS 603
           + +Q+ +DA  S
Sbjct: 62  L-RQDLQDAAHS 72



>gb:AE016827_342130 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 204

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = +1

Query: 367 LFGLGVPELVVIAGVTALIFGPKKLPEIGRSIGKTLKSFQQAAKEFETELKKE 525
           +F +G  EL++I  V  ++ GPK+LP   R++   +++ +  A   + EL +E
Sbjct: 1   MFDIGFSELLLIFIVGLVVLGPKRLPVAIRTVMGWVRTIRGLAANVQNELAQE 53


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 824,239,750
Number of Sequences: 1806583
Number of extensions: 16312472
Number of successful extensions: 47302
Number of sequences better than 10.0: 217
Number of HSP's better than 10.0 without gapping: 45140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47278
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 60430988688
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)