BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7902
         (653 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|F86358|F86358 Similar to peptide transporter [imported] - Ar...   234   7e-61   Arabidopsis thaliana [mouse-ear cress]
gb:BT004638_1637672 Arabidopsis thaliana At1g22550 gene, complet...   230   2e-59   
pir|G86358|G86358 protein Similar to LeOPT1 [Lycopersicon escule...   230   2e-59   Arabidopsis thaliana [mouse-ear cress]
pir|B86359|B86359 protein Similar to LeOPT1 [Lycopersicon escule...   227   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AY065020_1566183 Arabidopsis thaliana At1g72120/F28P5_2 mRNA,...   226   2e-58   
pir|E96744|E96744 probable oligopeptide transporter F28P5.2 [imp...   226   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AP004669_1843008 Oryza sativa (japonica cultivar-group) genom...   214   1e-54   
gb:AP003566_1830928 Oryza sativa (japonica cultivar-group) genom...   214   1e-54   
gb:AP003235_1825911 Oryza sativa (japonica cultivar-group) genom...   209   3e-53   
gb:AC108502_1738512 Oryza sativa (japonica cultivar-group) chrom...   199   4e-50   
pir|G96744|G96744 probable peptide transporter PTR2-B, T9N14.16 ...   194   8e-49   Arabidopsis thaliana [mouse-ear cress]
gb:AP003566_1830921 Oryza sativa (japonica cultivar-group) genom...   192   4e-48   
gb:AP004669_1843010 Oryza sativa (japonica cultivar-group) genom...   192   5e-48   
gb:AK175547_1817535 Arabidopsis thaliana mRNA for putative pepti...   190   2e-47   
gb:AY090354_1574104 Arabidopsis thaliana At1g72130/F28P5.1 mRNA,...   183   3e-45   
gb:AC069273_1540772 Arabidopsis thaliana chromosome 1 BAC F28P5 ...   183   3e-45   
pir|F96744|F96744 probable peptide transporter PTR2-B T9N14.15 [...   183   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AP005869_1859325 Oryza sativa (japonica cultivar-group) genom...   180   2e-44   
gb:AP003566_1830929 Oryza sativa (japonica cultivar-group) genom...   179   5e-44   
gb:OSJN00099_1694893 Oryza sativa genomic DNA, chromosome 4, BAC...   171   1e-41   
pir|T47573|T47573 peptide transport-like protein - Arabidopsis t...   169   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AP003566_1830922 Oryza sativa (japonica cultivar-group) genom...   169   5e-41   
gb:AP003235_1825912 Oryza sativa (japonica cultivar-group) genom...   169   5e-41   
gb:AK117678_1815699 Arabidopsis thaliana At1g72130 mRNA for puta...   168   6e-41   
gb:AB067652_1522599 Oryza sativa (japonica cultivar-group) OsPTR...   166   3e-40   
gb:AF016713_1761512 Lycopersicon esculentum oligopeptide transpo...   165   5e-40   
pir|T04378|T04378 peptide transport protein - barley>gb:AF023472...   164   1e-39   Hordeum vulgare [barley]
gb:AP002483_1822204 Oryza sativa (japonica cultivar-group) genom...   164   2e-39   
gb:AY063897_1565844 Arabidopsis thaliana putative PTR2 family pe...   159   4e-38   
pir|G84829|G84829 probable PTR2 family peptide transporter [impo...   159   4e-38   Arabidopsis thaliana [mouse-ear cress]
pir|T45936|T45936 transporter-like protein - Arabidopsis thalian...   157   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AF213936_1777806 Prunus dulcis amino acid/peptide transporter...   157   1e-37   
gb:AY058836_1564373 Arabidopsis thaliana At1g62200/F19K23_13 mRN...   157   2e-37   
pir|E84798|E84798 probable peptide/amino acid transporter [impor...   157   2e-37   Arabidopsis thaliana [mouse-ear cress]
pir|T45958|T45958 oligopeptide transporter-like protein - Arabid...   156   3e-37   Arabidopsis thaliana [mouse-ear cress]
pir|E96648|E96648 hypothetical protein F19K23.13 [imported] - Ar...   156   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AY289622_1594949 Vicia faba peptide transporter 1 (PTR1) mRNA...   155   4e-37   
gb:AP003566_1830926 Oryza sativa (japonica cultivar-group) genom...   154   1e-36   
gb:AP003235_1825915 Oryza sativa (japonica cultivar-group) genom...   154   1e-36   
pir|S46236|S46236 histidine transport protein - Arabidopsis thal...   154   1e-36   Arabidopsis thaliana [mouse-ear cress]
sp|P46032|PT2B_ARATH|PT2B_ARATH Peptide transporter PTR2-B (Histidine trans...   154   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023039 Oryza sativa (japonica cultivar-group) chrom...   153   3e-36   
gb:AB052786_1521245 Glycine max mRNA for putative nitrate transp...   148   7e-35   
gb:AE016959_1020655 Oryza sativa (japonica cultivar-group) chrom...   148   7e-35   
gb:AP004669_1843007 Oryza sativa (japonica cultivar-group) genom...   147   1e-34   
gb:AP003566_1830927 Oryza sativa (japonica cultivar-group) genom...   147   1e-34   
gb:AP003566_1830923 Oryza sativa (japonica cultivar-group) genom...   147   1e-34   
pir|T47604|T47604 oligopeptide transporter-like protein - Arabid...   147   1e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AB006698_1509860 Arabidopsis thaliana genomic DNA, chromosome...   144   1e-33   
gb:BT003860_1636988 Arabidopsis thaliana clone RAFL14-90-E04 (R2...   144   2e-33   
pir|A84432|A84432 probable peptide/amino acid transporter [impor...   144   2e-33   Arabidopsis thaliana [mouse-ear cress]
pir|G86449|G86449 F5D14.23 protein - Arabidopsis thaliana>gb:AE0...   143   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023035 Oryza sativa (japonica cultivar-group) chrom...   142   5e-33   
gb:AK118142_1816136 Arabidopsis thaliana At4g21680 mRNA for puta...   140   1e-32   
gb:AY064057_1565995 Arabidopsis thaliana putative peptide transp...   140   1e-32   
gb:AB006698_1509861 Arabidopsis thaliana genomic DNA, chromosome...   140   1e-32   
gb:AP004096_1837679 Oryza sativa (japonica cultivar-group) genom...   138   7e-32   
gb:AP003621_1831571 Oryza sativa (japonica cultivar-group) genom...   138   9e-32   
gb:AC093018_1735829 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   137   1e-31   
gb:AY587265_1616475 Triticum aestivum low affinity nitrate trans...   137   1e-31   
gb:AE016959_1020652 Oryza sativa (japonica cultivar-group) chrom...   137   1e-31   
gb:AE016959_1020642 Oryza sativa (japonica cultivar-group) chrom...   137   2e-31   
gb:BNU17987_1633659 Brassica napus RCH2 protein mRNA, complete cds.   135   5e-31   
gb:AP003621_1831570 Oryza sativa (japonica cultivar-group) genom...   135   6e-31   
gb:NPL277085_1691079 Nicotiana plumbaginifolia mRNA for putative...   134   1e-30   
gb:NPL277084_1691078 Nicotiana plumbaginifolia mRNA for putative...   134   1e-30   
gb:AB102806_1526337 Nicotiana tabacum NtNRT1.1-t mRNA for nitrat...   134   1e-30   
gb:AB102805_1526336 Nicotiana tabacum NtNRT1.1-s mRNA for nitrat...   134   1e-30   
gb:AE016959_1020935 Oryza sativa (japonica cultivar-group) chrom...   134   1e-30   
gb:BNA278966_1633311 Brassica napus mRNA for nitrate transporter...   134   2e-30   
gb:AB102807_1526338 Nicotiana tabacum NtNRT1.2-s mRNA for nitrat...   133   2e-30   
gb:AB102808_1526339 Nicotiana tabacum NtNRT1.2-t mRNA for nitrat...   132   4e-30   
sp|Q05085|CHL1_ARATH|CHL1_ARATH Nitrate/chlorate transporter.>pir|A45772|A4...   132   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AY587264_1616474 Triticum aestivum low affinity nitrate trans...   131   1e-29   
gb:AF000392_1760498 Lotus japonicus peptide transporter (LjNOD65...   130   1e-29   
gb:AB128925_1528356 Prunus persica PpNRT1 gene for nitrate trans...   130   2e-29   
gb:AB089677_1524914 Prunus persica PpNRT1 mRNA for nitrate trans...   130   2e-29   
gb:AE016959_1020657 Oryza sativa (japonica cultivar-group) chrom...   130   3e-29   
pir|T05843|T05843 peptide transport protein homolog F17L22.140 -...   129   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AP004047_1836888 Oryza sativa (japonica cultivar-group) genom...   129   6e-29   
gb:AF140606_1771555 Oryza sativa nitrate transporter (NRT1) mRNA...   129   6e-29   
gb:AY099800_1576825 Arabidopsis thaliana putative nitrate transp...   129   6e-29   
pir|T52608|T52608 probable nitrate transporter [imported] - Arab...   129   6e-29   Arabidopsis thaliana [mouse-ear cress]
pir|F84663|F84663 probable nitrate transporter [imported] - Arab...   129   6e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1020653 Oryza sativa (japonica cultivar-group) chrom...   125   5e-28   
gb:AE016959_1023995 Oryza sativa (japonica cultivar-group) chrom...   125   8e-28   
gb:AP003905_1835020 Oryza sativa (japonica cultivar-group) genom...   121   1e-26   
gb:AE016959_1020662 Oryza sativa (japonica cultivar-group) chrom...   121   1e-26   
gb:AP002818_1822868 Oryza sativa (japonica cultivar-group) genom...   120   3e-26   
gb:AP004994_1846927 Oryza sativa (japonica cultivar-group) genom...   119   3e-26   
gb:AP003372_1828661 Oryza sativa (japonica cultivar-group) genom...   119   6e-26   
gb:AGL488290_1811026 Alnus glutinosa mRNA for dicarboxylate tran...   118   8e-26   
gb:AY084539_1569628 Arabidopsis thaliana clone 111089 mRNA, comp...   117   1e-25   
gb:AB019232_1514187 Arabidopsis thaliana genomic DNA, chromosome...   117   1e-25   
gb:AP003999_1836131 Oryza sativa (japonica cultivar-group) genom...   116   3e-25   
gb:AC105769_1738203 Oryza sativa (japonica cultivar-group) chrom...   112   4e-24   
gb:OSJN00149_1695685 Oryza sativa genomic DNA, chromosome 4, BAC...   111   1e-23   
gb:AE016959_1023773 Oryza sativa (japonica cultivar-group) chrom...   110   2e-23   
gb:BT005728_1638663 Arabidopsis thaliana clone RAFL15-01-K12 (R2...   107   1e-22   
gb:ATH131464_1551986 Arabidopsis thaliana mRNA for nitrate trans...   107   2e-22   
pir|T52585|T52585 probable nitrate transporter ntp3 [imported] -...   107   2e-22   Arabidopsis thaliana [mouse-ear cress]
pir|A96710|A96710 hypothetical protein F24J5.19 [imported] - Ara...   107   2e-22   Arabidopsis thaliana [mouse-ear cress]
pir|T48587|T48587 peptide transporter-like protein - Arabidopsis...   105   7e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP004750_1844346 Oryza sativa (japonica cultivar-group) genom...   105   9e-22   
gb:AE016959_1023998 Oryza sativa (japonica cultivar-group) chrom...   104   1e-21   
gb:AY187878_1588173 Zea mays nitrate transporter (Nrt1.1) mRNA, ...   103   3e-21   
gb:AE016959_1022199 Oryza sativa (japonica cultivar-group) chrom...   103   3e-21   
gb:AP004994_1846925 Oryza sativa (japonica cultivar-group) genom...   102   4e-21   
gb:AP005175_1848772 Oryza sativa (japonica cultivar-group) genom...   102   6e-21   
gb:AE016959_1020640 Oryza sativa (japonica cultivar-group) chrom...   102   7e-21   
gb:AP004993_1846907 Oryza sativa (japonica cultivar-group) genom...   101   1e-20   
gb:AY090257_1574009 Arabidopsis thaliana At1g69870/T17F3_10 mRNA...   101   1e-20   
gb:OSJN00129_1695376 Oryza sativa genomic DNA, chromosome 4, BAC...   100   2e-20   
gb:AP004778_1844948 Oryza sativa (japonica cultivar-group) genom...    99   6e-20   
gb:OSJN00129_1695377 Oryza sativa genomic DNA, chromosome 4, BAC...    99   6e-20   
gb:AC130729_1740928 Oryza sativa (japonica cultivar-group) chrom...    99   8e-20   
gb:CSNITR1_1674000 Cucumis sativus mRNA for nitrite transporter ...    98   1e-19   
gb:AY035037_1559815 Arabidopsis thaliana putative oligopeptide t...    98   1e-19   
gb:AC092779_1735702 Oryza sativa chromosome 3 BAC OSJNBb0024N19 ...    98   1e-19   
gb:AB009053_1510684 Arabidopsis thaliana genomic DNA, chromosome...    98   1e-19   
gb:AP003857_1834399 Oryza sativa (japonica cultivar-group) genom...    97   2e-19   
gb:AY305030_1597541 Oryza sativa (japonica cultivar-group) nitra...    97   3e-19   
gb:OSJN00261_1697580 Oryza sativa genomic DNA, chromosome 4, BAC...    95   9e-19   
gb:BT000720_1634993 Arabidopsis thaliana clone RAFL09-73-M24 (R1...    94   2e-18   
pir|T51361|T51361 nitrate transporter NTL1 [validated] - Arabido...    94   2e-18   Arabidopsis thaliana [mouse-ear cress]
pir|G96720|G96720 nitrate transporter (NTL1), 53025-56402 [impor...    94   2e-18   Arabidopsis thaliana [mouse-ear cress]
gb:RATPCDC_2133348 Rattus norvegicus mRNA for proton-coupled dip...    94   2e-18   
sp|P51574|PET1_RAT|PET1_RAT Oligopeptide transporter, small intestine iso...    94   2e-18   Rattus norvegicus [brown rat]
gb:AY634368_1957812 Homo sapiens macrophage oligopeptide transpo...    94   3e-18   
gb:AF043233_1878539 Homo sapiens Caco-2 oligopeptide transporter...    94   3e-18   
gb:OSJN00175_1696208 Oryza sativa genomic DNA, chromosome 4, BAC...    94   3e-18   
gb:AY062453_1565109 Arabidopsis thaliana nitrate transporter (NT...    94   3e-18   
pir|JC5638|JC5638 pH-sensing regulatory factor - human>gb:AB0013...    94   3e-18   Homo sapiens [man]
sp|P46059|PET1_HUMAN|PET1_HUMAN Oligopeptide transporter, small intestine i...    94   3e-18   Homo sapiens [man]
gb:F205832S16_2112839 Mus musculus intestinal peptide transporte...    93   3e-18   
gb:AF205540_2059006 Mus musculus intestinal low-affinity peptide...    93   3e-18   
gb:AP003630_1831755 Oryza sativa (japonica cultivar-group) genom...    93   3e-18   
gb:AP003256_1826468 Oryza sativa (japonica cultivar-group) genom...    93   3e-18   
gb:AY180903_1426820 Sus scrofa peptide transporter 1 mRNA, compl...    93   3e-18   
gb:AP003566_1830924 Oryza sativa (japonica cultivar-group) genom...    92   6e-18   
gb:AP003235_1825913 Oryza sativa (japonica cultivar-group) genom...    92   6e-18   
gb:AY027496_1424079 Ovis aries proton-dependent gastrointestinal...    92   6e-18   
pir|T51439|T51439 oligopeptide transporter-like protein - Arabid...    92   1e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AY289936_1942820 Macaca fascicularis proton-dependent dipepti...    91   1e-17   
gb:AY289934_1942818 Macaca mulatta proton-dependent dipeptide tr...    91   2e-17   
gb:OSJN00292_1698070 Oryza sativa genomic DNA, chromosome 4, BAC...    91   2e-17   
gb:AF461733_1420736 Canis familiaris proton-coupled peptide cotr...    91   2e-17   
pir|G86322|G86322 hypothetical protein F6A14.2 - Arabidopsis tha...    90   3e-17   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00261_1697577 Oryza sativa genomic DNA, chromosome 4, BAC...    90   4e-17   
gb:AY300011_2525789 Danio rerio peptide transporter PEPT1 (slc15...    89   5e-17   
gb:OCU13707_1442429 Oryctolagus cuniculus oligopeptide transport...    89   7e-17   
sp|P36836|PET1_RABIT|PET1_RABIT Oligopeptide transporter, small intestine i...    89   7e-17   Oryctolagus cuniculus [domestic rabbit]
gb:AP003791_1833395 Oryza sativa (japonica cultivar-group) genom...    88   1e-16   
gb:AY099590_1576615 Arabidopsis thaliana putative transport prot...    88   1e-16   
gb:AY072134_1567028 Arabidopsis thaliana putative nitrate transp...    88   1e-16   
pir|C86397|C86397 protein T7N9.10 [imported] - Arabidopsis thali...    88   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AB052785_1521244 Glycine max mRNA for nitrate transporter NRT...    88   1e-16   
pir|A96721|A96721 probable peptide transporter T17F3.10 [importe...    88   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:RATPDPT_2133364 Rattus norvegicus proton-dependent peptide tr...    87   2e-16   
gb:ATAC010676_1543134 Arabidopsis thaliana chromosome III BAC T2...    87   2e-16   
gb:AP003256_1826467 Oryza sativa (japonica cultivar-group) genom...    87   2e-16   
gb:AC105769_1738202 Oryza sativa (japonica cultivar-group) chrom...    87   2e-16   
gb:OSJN00129_1695375 Oryza sativa genomic DNA, chromosome 4, BAC...    87   2e-16   
gb:AY084631_1569719 Arabidopsis thaliana clone 113723 mRNA, comp...    87   2e-16   
gb:AE014298_1124221 Drosophila melanogaster chromosome X, comple...    87   2e-16   
gb:AE014298_1124220 Drosophila melanogaster chromosome X, comple...    87   2e-16   
pir|H96561|H96561 probable peptide transporter [imported] - Arab...    87   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AF181635_1248302 Drosophila melanogaster BcDNA.GH06717 (BcDNA...    87   3e-16   
gb:AP003791_1833396 Oryza sativa (japonica cultivar-group) genom...    86   7e-16   
gb:AY157977_2516019 Meleagris gallopavo peptide transporter PepT...    85   1e-15   
gb:AY029615_2508674 Gallus gallus peptide transporter PepT1 mRNA...    84   2e-15   
gb:AP005173_1848761 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:AP003076_1824650 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:DMU97114_1381143 Drosophila melanogaster opt1 (opt) gene, alt...    84   2e-15   
gb:DMU97114_1381142 Drosophila melanogaster opt1 (opt) gene, alt...    84   2e-15   
gb:AE014298_1124219 Drosophila melanogaster chromosome X, comple...    84   2e-15   
gb:AE014298_1124218 Drosophila melanogaster chromosome X, comple...    84   2e-15   
gb:AE014298_1124217 Drosophila melanogaster chromosome X, comple...    84   2e-15   
pir|T13674|T13674 hypothetical protein EG0002.1 - fruit fly (Dro...    84   2e-15   Drosophila melanogaster
pir|T13673|T13673 hypothetical protein EG0002.1 - fruit fly (Dro...    84   2e-15   Drosophila melanogaster
gb:AF370202_1792090 Arabidopsis thaliana putative peptide transp...    84   2e-15   
gb:AF083746_1766976 Arabidopsis thaliana clone sps492-2 unknown ...    84   2e-15   
gb:AB020751_1514667 Arabidopsis thaliana genomic DNA, chromosome...    84   2e-15   
gb:BX294154_771789 Pirellula sp. strain 1 complete genome; segme...    84   2e-15   
pir|T06687|T06687 probable peptide transport protein T17F15.170 ...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
pir|H96720|H96720 probable peptide transporter T17F3.11 [importe...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AB026647_1517211 Arabidopsis thaliana genomic DNA, chromosome...    84   3e-15   
gb:AP003436_1829384 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AB052788_1521247 Glycine max mRNA for nitrate transporter NRT...    83   5e-15   
gb:AB052784_1521243 Glycine max mRNA for nitrate transporter NRT...    82   8e-15   
pir|E86397|E86397 protein T7N9.14 [imported] - Arabidopsis thali...    81   2e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AF428467_1799397 Arabidopsis thaliana AT3g47960/T17F15_170 mR...    80   2e-14   
sp|P91679|OPT1_DROME|OPT1_DROME Oligopeptide transporter 1 (YIN protein).>g...    79   5e-14   Drosophila melanogaster
gb:BC085327_2109193 Rattus norvegicus solute carrier family 15 (...    79   7e-14   
gb:BC051199_2100679 Mus musculus mRNA similar to solute carrier ...    79   7e-14   
gb:BC018335_2092659 Mus musculus solute carrier family 15 (H+/pe...    79   7e-14   
gb:AF257711_2060757 Mus musculus proton-dependent high affinity ...    79   7e-14   
gb:AF111811_2054910 Mus musculus proton-dependent high affinity ...    79   7e-14   
gb:AF083745_1766975 Arabidopsis thaliana clone sps492 unknown mRNA.    79   7e-14   
gb:AK018393_1159553 Mus musculus 16 days embryo lung cDNA, RIKEN...    79   7e-14   
pir|JC7501|JC7501 oligopeptide transporter PEPT2, kidney isoform...    79   7e-14   Mus musculus [mouse]
sp|Q63424|PET2_RAT|PET2_RAT Oligopeptide transporter, kidney isoform (Pep...    79   7e-14   Rattus norvegicus [brown rat]
gb:BC044572_1983484 Homo sapiens solute carrier family 15 (H+/pe...    78   1e-13   
gb:AB026647_1517209 Arabidopsis thaliana genomic DNA, chromosome...    78   1e-13   
sp|Q16348|PET2_HUMAN|PET2_HUMAN Oligopeptide transporter, kidney isoform (P...    78   1e-13   Homo sapiens [man]
gb:AY289935_1942819 Macaca mulatta proton-dependent dipeptide tr...    78   1e-13   
pir|T37329|T37329 probable oligopeptide transport protein - Caen...    77   3e-13   Caenorhabditis elegans [roundworm]
pir|T19017|T19017 hypothetical protein C06G8.2 - Caenorhabditis ...    77   3e-13   Caenorhabditis elegans [roundworm]
sp|Q17758|CPTA_CAEEL|CPTA_CAEEL Di-/tri-peptide transporter CPTA.>gb:CEC06G...    77   3e-13   Caenorhabditis elegans [roundworm]
pir|B86458|B86458 probable protein nitrate transporter NTL1 5408...    76   6e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AB012247_1511830 Arabidopsis thaliana genomic DNA, chromosome...    75   7e-13   
gb:BC054967_2551172 Xenopus laevis solute carrier family 15 (H+/...    75   1e-12   
pir|T48516|T48516 probable oligopeptide transporter protein - Ar...    75   1e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AL353574_1922730 Human DNA sequence from clone RP11-551M18 on...    74   2e-12   
gb:CNS07EGH_1374281 chromosome XI of strain GB-M1 of Encephalito...    74   2e-12   
sp|P46029|PET2_RABIT|PET2_RABIT Oligopeptide transporter, kidney isoform (P...    74   2e-12   Oryctolagus cuniculus [domestic rabbit]
gb:U39666_1403025 Caenorhabditis elegans cosmid K04E7, complete ...    74   3e-12   
pir|T37330|T37330 probable low-affinity oligopeptide transport p...    74   3e-12   Caenorhabditis elegans [roundworm]
gb:BC079971_2561410 Xenopus laevis MGC80026 protein, mRNA (cDNA ...    73   5e-12   
gb:AF142441_1244368 Caenorhabditis elegans H+/oligopeptide sympo...    72   1e-11   
sp|O01840|OPT2_CAEEL|OPT2_CAEEL Hypothetical oligopeptide transporter F56F4...    72   1e-11   Caenorhabditis elegans [roundworm]
gb:OSJN00056_1694025 Oryza sativa genomic DNA, chromosome 4, BAC...    68   2e-10   
gb:AC115680_1206001 Dictyostelium discoideum chromosome 2 map 49...    68   2e-10   
gb:AF446367_1800500 Arabidopsis thaliana At1g69870/T17F3_10 mRNA...    66   5e-10   
gb:AC116963_1206896 Dictyostelium discoideum chromosome 2 map 46...    65   1e-09   
sp|Q9P380|PTR2_SCHPO|PTR2_SCHPO Probable peptide transporter Ptr2 (Peptide ...    65   1e-09   Schizosaccharomyces pombe
gb:AB091539_1525054 Carica papaya mRNA for peptide transporter, ...    65   1e-09   
gb:AE017282_428868 Methylococcus capsulatus str. Bath, complete ...    65   1e-09   
gb:AE015452_314428 Shewanella oneidensis MR-1 section 1 of 457 o...    64   2e-09   
pir|T47509|T47509 probable transporter protein - Arabidopsis tha...    64   2e-09   Arabidopsis thaliana [mouse-ear cress]
gb:BC016233_2092243 Mus musculus solute carrier family 15, membe...    64   2e-09   
gb:AY050630_2074568 Mus musculus peptide/histidine transporter m...    64   2e-09   
gb:BC037974_1982267 Homo sapiens solute carrier family 15, membe...    64   2e-09   
gb:AB020598_1865221 Homo sapiens mRNA for peptide transporter 3,...    64   2e-09   
sp|P46031|PT2A_ARATH|PT2A_ARATH Peptide transporter PTR2-A.>gb:ATHPTR2_1553...    64   2e-09   Arabidopsis thaliana [mouse-ear cress]
gb:CR378671_95999 Photobacterium profundum SS9; segment 9/12.          63   4e-09   
pir|T47508|T47508 probable transporter protein - Arabidopsis tha...    62   9e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AK117660_1815682 Arabidopsis thaliana At3g45680 mRNA for puta...    62   1e-08   
gb:AE016961_367775 Coxiella burnetii strain RSA 493, section 2 o...    62   1e-08   
gb:AY050629_1935247 Homo sapiens peptide/histidine transporter m...    61   1e-08   
gb:AY038999_1934821 Homo sapiens peptide/histidine transporter (...    61   1e-08   
gb:AE012240_280659 Xanthomonas campestris pv. campestris str. AT...    61   1e-08   
gb:BC087709_2110176 Rattus norvegicus peptide/histidine transpor...    61   2e-08   
gb:AB000280_2042987 Rattus norvegicus mRNA for peptide/histidine...    61   2e-08   
gb:AC149302_1745014 Solanum demissum chromosome 11 clone PGEC400...    60   2e-08   
gb:BA000031_706284 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    60   2e-08   
gb:AY170828_2516511 Chionodraco hamatus intestinal peptide trans...    60   4e-08   
gb:BA000037_721831 Vibrio vulnificus YJ016 DNA, chromosome I, co...    60   4e-08   
gb:AE016797_334975 Vibrio vulnificus CMCP6 chromosome I section ...    60   4e-08   
gb:AE011777_276391 Xanthomonas axonopodis pv. citri str. 306, se...    59   7e-08   
gb:AP003235_1825917 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
pir|T47505|T47505 hypothetical protein F9K21.230 - Arabidopsis t...    58   1e-07   Arabidopsis thaliana [mouse-ear cress]
sp|Q21219|OPT3_CAEEL|OPT3_CAEEL Hypothetical oligopeptide transporter K04E7...    58   2e-07   Caenorhabditis elegans [roundworm]
pir|T47511|T47511 probable transporter protein - Arabidopsis tha...    57   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AC149302_1745016 Solanum demissum chromosome 11 clone PGEC400...    57   4e-07   
gb:CR382130_1663121 Yarrowia lipolytica chromosome D of strain C...    57   4e-07   
gb:BT005911_1638833 Arabidopsis thaliana At3g45700 gene, complet...    57   4e-07   
pir|T47510|T47510 probable transporter protein - Arabidopsis tha...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:YSCPTR2_1730389 Saccharomyces cerevisiae S288C permease (PTR2...    56   6e-07   
gb:CP000001_851226 Bacillus cereus ZK, complete genome.                56   6e-07   
gb:AE017266_421989 Bacillus cereus ATCC 10987, section 3 of 18 o...    56   6e-07   
gb:AE017026_380944 Bacillus anthracis str. Ames section 3 of 18 ...    56   6e-07   
sp|P32901|PTR2_YEAST|PTR2_YEAST Peptide transporter PTR2 (Peptide permease ...    56   6e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:AP003235_1825914 Oryza sativa (japonica cultivar-group) genom...    55   8e-07   
gb:AE017000_375654 Bacillus cereus ATCC 14579 section 3 of 18 of...    55   8e-07   
gb:AY187281_1588144 Phaeosphaeria nodorum di/tri peptide transpo...    54   2e-06   
pir|T47512|T47512 probable transporter protein - Arabidopsis tha...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AE016945_363751 Bacteroides thetaiotaomicron VPI-5482, sectio...    54   2e-06   
pir|D96992|D96992 permease [imported] - Clostridium acetobutylic...    54   2e-06   Clostridium acetobutylicum
gb:AF121080_2055355 Mus musculus cAMP inducible 1 protein (Ci1) ...    54   3e-06   
gb:AK051941_1169864 Mus musculus 12 days embryo eyeball cDNA, RI...    54   3e-06   
gb:AF411071_508095 Sphingomonas sp. ACM-3962 MlrD (mlrD) gene, p...    54   3e-06   
gb:BA000016_673584 Clostridium perfringens str. 13 DNA, complete...    53   4e-06   
gb:AE013598_296051 Xanthomonas oryzae pv. oryzae KACC10331, comp...    53   4e-06   
gb:AB026665_2044421 Rattus norvegicus mRNA for peptide histidine...    52   7e-06   
gb:AE014297_1138715 Drosophila melanogaster chromosome 3R, compl...    52   7e-06   
gb:AP003621_1831573 Oryza sativa (japonica cultivar-group) genom...    52   9e-06   
gb:CR382125_1657795 Kluyveromyces lactis strain NRRL Y-1140 chro...    52   9e-06   
gb:AY094847_1298021 Drosophila melanogaster RE06505 full insert ...    52   9e-06   
gb:CP000021_872874 Vibrio fischeri ES114 chromosome II, complete...    52   1e-05   
gb:AE016771_329099 Escherichia coli CFT073 section 17 of 18 of t...    52   1e-05   
pir|F86108|F86108 probable peptide transporter yjdL [imported] -...    52   1e-05   
sp|P39276|YJDL_ECOLI|YJDL_ECOLI Hypothetical transporter yjdL.>pir|S56359|S...    52   1e-05   
gb:AE016914_356123 Chromobacterium violaceum ATCC 12472 section ...    51   2e-05   
gb:BX571865_786670 Photorhabdus luminescens subsp. laumondii TTO...    51   2e-05   
gb:AE016757_324830 Escherichia coli CFT073 section 3 of 18 of th...    51   2e-05   
gb:CP000026_75210 Salmonella enterica subsp. enterica serovar Pa...    51   2e-05   
pir|AG0826|AG0826 probable transmembrane transport protein STY28...    51   2e-05   
gb:AE005674_70170 Shigella flexneri 2a str. 301, complete genome...    50   3e-05   
pir|T47506|T47506 hypothetical protein F9K21.240 - Arabidopsis t...    50   3e-05   
pir|D85571|D85571 probable transport protein ybgH [imported] - E...    50   3e-05   
pir|F90720|F90720 probable transport protein ECs0734 [imported] ...    50   3e-05   
sp|P75742|YBGH_ECOLI|YBGH_ECOLI Hypothetical transporter ybgH.>pir|D64806|D...    50   3e-05   
gb:CR382135_1668272 Debaryomyces hansenii chromosome C of strain...    50   4e-05   
gb:AC149302_1745015 Solanum demissum chromosome 11 clone PGEC400...    49   6e-05   
gb:CR380953_1650722 Candida glabrata strain CBS138 chromosome G ...    49   6e-05   
gb:BX927157_834596 Corynebacterium glutamicum ATCC 13032, IS fin...    49   6e-05   
pir|C87672|C87672 peptide transporter CC3413 [imported] - Caulob...    49   6e-05   
gb:CP000020_870978 Vibrio fischeri ES114 chromosome I, complete ...    49   7e-05   
gb:MMPEPT1_2116924 M.musculus mRNA for proton-dependent peptide ...    49   1e-04   
gb:AP003238_1825994 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:CP000026_76817 Salmonella enterica subsp. enterica serovar Pa...    49   1e-04   
pir|C96621|C96621 hypothetical protein F23H11.6 [imported] - Ara...    49   1e-04   
pir|AB0588|AB0588 PTR2-family transport protein STY0750 [importe...    49   1e-04   
gb:AY167576_2516376 Anguilla anguilla H+/peptide transporter (Pe...    48   1e-04   
gb:CR382130_1663120 Yarrowia lipolytica chromosome D of strain C...    48   1e-04   
gb:AC134342_1741730 Oryza sativa (japonica cultivar-group) chrom...    48   2e-04   
gb:AY872168_2150332 Synthetic construct hypothetical protein (FT...    47   3e-04   
gb:AJ749949_531029 Francisella tularensis subsp. tularensis comp...    47   3e-04   
gb:AE016822_339527 Leifsonia xyli subsp. xyli str. CTCB07, compl...    47   3e-04   
gb:BA000035_717680 Corynebacterium efficiens YS-314 DNA, complet...    47   4e-04   
gb:AE016959_1020654 Oryza sativa (japonica cultivar-group) chrom...    45   8e-04   
gb:BX571966_795414 Burkholderia pseudomallei strain K96243, chro...    45   8e-04   
gb:BX571862_785832 Photorhabdus luminescens subsp. laumondii TTO...    45   8e-04   
gb:AF346500_503302 Photorhabdus luminescens strain W14 toxin com...    45   8e-04   
gb:AE017333_446367 Bacillus licheniformis DSM 13, complete genom...    45   8e-04   
gb:CP000009_863410 Gluconobacter oxydans 621H, complete genome.        45   0.001   
gb:BX936398_837134 Yersinia pseudotuberculosis IP32953 genome, c...    45   0.001   
gb:BA000045_742337 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   0.001   
gb:AP006618_561252 Nocardia farcinica IFM 10152 DNA, complete ge...    45   0.001   
gb:AE017026_380873 Bacillus anthracis str. Ames section 3 of 18 ...    45   0.001   
gb:AE008692_240739 Zymomonas mobilis subsp. mobilis ZM4, complet...    45   0.001   
gb:AE014258_306747 Streptococcus agalactiae 2603V/R section 68 o...    45   0.001   
gb:SAG766851_171041 Streptococcus agalactiae NEM316 complete gen...    45   0.001   
gb:AC133002_1741241 Oryza sativa chromosome 11 BAC OJ1123_D06 ge...    44   0.002   
gb:AE017266_421914 Bacillus cereus ATCC 10987, section 3 of 18 o...    44   0.002   
gb:BA000030_701369 Streptomyces avermitilis MA-4680 genomic DNA,...    44   0.002   
gb:AE008763_243146 Salmonella typhimurium LT2, section 67 of 220...    44   0.002   
gb:CP000026_76226 Salmonella enterica subsp. enterica serovar Pa...    44   0.002   
pir|AB0693|AB0693 probable proton/oligopeptide symporter STY1670...    44   0.002   
gb:AC133002_1741235 Oryza sativa chromosome 11 BAC OJ1123_D06 ge...    44   0.003   
gb:AL935253_550514 Lactobacillus plantarum strain WCFS1 complete...    44   0.003   
gb:BX248357_762469 Corynebacterium diphtheriae gravis NCTC13129,...    43   0.004   
gb:AE016761_326033 Escherichia coli CFT073 section 7 of 18 of th...    43   0.004   
gb:AE005674_71241 Shigella flexneri 2a str. 301, complete genome...    43   0.004   
pir|C85770|C85770 probable transport protein ydgR [imported] - E...    43   0.004   
sp|P77304|YDGR_ECOLI|YDGR_ECOLI Hypothetical transporter ydgR.>pir|D64920|D...    43   0.004   
sp|P94408|YCLF_BACSU|YCLF_BACSU Hypothetical transporter yclF.>pir|C69762|C...    43   0.004   
gb:AX813795_1475617 Sequence 35 from Patent WO03040292.                43   0.005   
gb:BX927155_834138 Corynebacterium glutamicum ATCC 13032, IS fin...    43   0.005   
gb:AE012556_284313 Xylella fastidiosa Temecula1, section 4 of 9 ...    43   0.005   
gb:CP000011_867767 Burkholderia mallei ATCC 23344 chromosome 2, ...    42   0.007   
gb:BA000035_716206 Corynebacterium efficiens YS-314 DNA, complet...    42   0.007   
gb:AE011409_272651 Leptospira interrogans serovar lai str. 56601...    42   0.007   
gb:CR378667_94915 Photobacterium profundum SS9; segment 5/12.          42   0.007   
gb:CP000033_90065 Lactobacillus acidophilus NCFM, complete genome.     42   0.007   
gb:CP000023_874880 Streptococcus thermophilus LMG 18311, complet...    42   0.009   
gb:AE017202_403952 Lactobacillus johnsonii NCC 533, section 3 of...    42   0.009   
gb:BC028394_1979253 Homo sapiens solute carrier family 15, membe...    42   0.012   
gb:CP000021_872875 Vibrio fischeri ES114 chromosome II, complete...    41   0.016   
gb:BX950851_841023 Erwinia carotovora subsp. atroseptica SCRI104...    41   0.016   
gb:AJ749949_531410 Francisella tularensis subsp. tularensis comp...    41   0.016   
gb:AE004969_61594 Neisseria gonorrhoeae FA 1090, complete genome.      41   0.016   
pir|G82016|G82016 probable peptide transporter NMA0222 [imported...    41   0.016   
pir|F81001|F81001 peptide transporter NMB2136 [imported] - Neiss...    41   0.016   
pir|H82624|H82624 di-tripeptide ABC transporter membrane protein...    41   0.016   
pir|AD0988|AD0988 probable PTR2 family transport protein STY4211...    41   0.016   
gb:OSJN00261_1697578 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.020   
gb:AE016768_328269 Escherichia coli CFT073 section 14 of 18 of t...    41   0.020   
gb:AE013800_300279 Yersinia pestis KIM section 200 of 415 of the...    41   0.020   
gb:AE011672_275411 Xanthomonas axonopodis pv. citri str. 306, se...    41   0.020   
gb:AE008865_245224 Salmonella typhimurium LT2, section 169 of 22...    41   0.020   
gb:ECOUW76_131056 E. coli chromosomal region from 76.0 to 81.5 m...    41   0.020   
gb:CP000026_78144 Salmonella enterica subsp. enterica serovar Pa...    41   0.020   
pir|AB0288|AB0288 probable proton dependent peptide transporter ...    41   0.020   
pir|H91174|H91174 probable transport protein ECs4368 [imported] ...    41   0.020   
sp|P36837|YHIP_ECOLI|YHIP_ECOLI Hypothetical transporter yhiP.>pir|C65147|C...    41   0.020   
sp|P36574|DTPT_LACLA|DTPT_LACLA Di-/tripeptide transporter.>pir|F86712|F867...    41   0.020   
gb:BA000032_708793 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    40   0.027   
gb:AF167992_484996 Legionella pneumophila iraAB locus, complete ...    40   0.027   
gb:CR628337_113981 Legionella pneumophila str. Lens complete gen...    40   0.027   
gb:CR378667_94917 Photobacterium profundum SS9; segment 5/12.          40   0.027   
gb:AY135563_2076695 Mus musculus DNA polymerase Q mRNA, complete...    40   0.035   
gb:AC130729_1740923 Oryza sativa (japonica cultivar-group) chrom...    40   0.035   
gb:CR382130_1663075 Yarrowia lipolytica chromosome D of strain C...    40   0.035   
gb:BX649605_1643348 Aspergillus fumigatus BAC pilot project supe...    40   0.035   
gb:AE016999_375589 Bacillus cereus ATCC 14579 section 2 of 18 of...    40   0.035   
gb:AE016961_367742 Coxiella burnetii strain RSA 493, section 2 o...    40   0.035   
gb:CR628336_110924 Legionella pneumophila str. Paris complete ge...    40   0.035   
pir|T10255|T10255 nitrite transport protein, chloroplast - cucumber    40   0.035   
gb:BA000038_724582 Vibrio vulnificus YJ016 DNA, chromosome II, c...    40   0.045   
gb:AE016948_364557 Enterococcus faecalis V583, section 2 of 11 o...    40   0.045   
gb:AE016929_360189 Bacteroides thetaiotaomicron VPI-5482, sectio...    40   0.045   
gb:AE016923_358716 Chromobacterium violaceum ATCC 12472 section ...    40   0.045   
pir|AD1503|AD1503 di-tripeptide transporter homolog lin0564 [imp...    40   0.045   
pir|AD1144|AD1144 di-tripeptide transporter homolog lmo0555 [imp...    40   0.045   
gb:CP000020_871300 Vibrio fischeri ES114 chromosome I, complete ...    39   0.059   
gb:AE017355_461847 Bacillus thuringiensis serovar konkukian str....    39   0.059   
gb:AE017324_443017 Listeria monocytogenes str. 4b F2365, section...    39   0.059   
gb:AE016813_339323 Vibrio vulnificus CMCP6 chromosome II section...    39   0.059   
gb:AE015571_315684 Shewanella oneidensis MR-1 section 120 of 457...    39   0.077   
gb:AE012141_279707 Xanthomonas campestris pv. campestris str. AT...    39   0.077   
gb:AY774669_2149382 Synthetic construct Francisella tularensis c...    39   0.10    
gb:BX842595_1643623 Neurospora crassa DNA linkage group II BAC c...    39   0.10    
gb:AJ749949_530903 Francisella tularensis subsp. tularensis comp...    39   0.10    
pir|E82255|E82255 proton/peptide symporter family protein VC0988...    39   0.10    
gb:AP004792_1845171 Oryza sativa (japonica cultivar-group) genom...    38   0.17    
gb:CR382131_1663643 Yarrowia lipolytica chromosome E of strain C...    38   0.17    
gb:CP000021_872824 Vibrio fischeri ES114 chromosome II, complete...    38   0.17    
gb:AHY276030_521809 Aeromonas hydrophila yqgF gene, yhiP gene, c...    38   0.17    
gb:AF293355_497024 Streptomyces collinus DSM2012 rubrinomycin ge...    38   0.17    
gb:AE013598_297775 Xanthomonas oryzae pv. oryzae KACC10331, comp...    38   0.17    
gb:BC056821_2552004 Danio rerio zgc:63767, mRNA (cDNA clone MGC:...    37   0.22    
gb:CR382130_1663284 Yarrowia lipolytica chromosome D of strain C...    37   0.22    
gb:SCO939115_176737 Streptomyces coelicolor A3(2) complete genom...    37   0.22    
gb:AY872133_2150297 Synthetic construct hypothetical protein (FT...    37   0.29    
gb:BA000038_724996 Vibrio vulnificus YJ016 DNA, chromosome II, c...    37   0.29    
gb:AE016809_338100 Vibrio vulnificus CMCP6 chromosome II section...    37   0.29    
gb:BC049320_2550177 Danio rerio zgc:63767, mRNA (cDNA clone MGC:...    37   0.38    
gb:CR382133_1666507 Debaryomyces hansenii chromosome A of strain...    36   0.50    
gb:AC003028_1530967 Arabidopsis thaliana chromosome 2 clone F16M...    36   0.50    
pir|T01242|T01242 peptide transport protein homolog At2g38100 - ...    36   0.50    
gb:CR382131_1664686 Yarrowia lipolytica chromosome E of strain C...    36   0.65    
gb:LPN7311_142008 Legionella pneumophila serogroup 1 lipopolysac...    35   1.1     
gb:POL243458_1700975 Penicillium olsonii mdr gene for putative m...    35   1.5     
gb:AP006841_572816 Bacteroides fragilis YCH46 DNA, complete genome.    35   1.5     
gb:BX248358_762813 Corynebacterium diphtheriae gravis NCTC13129,...    34   1.9     
gb:AJ749949_531462 Francisella tularensis subsp. tularensis comp...    34   1.9     
gb:AE017283_429928 Propionibacterium acnes KPA171202, complete g...    34   1.9     
gb:AY871943_2150107 Synthetic construct hypothetical protein (FT...    34   2.5     
gb:CP000021_872772 Vibrio fischeri ES114 chromosome II, complete...    34   2.5     
gb:BA000036_720780 Corynebacterium glutamicum ATCC 13032 DNA, co...    34   2.5     
gb:AJ749949_531710 Francisella tularensis subsp. tularensis comp...    34   2.5     
gb:AE017319_441269 Desulfovibrio vulgaris subsp. vulgaris str. H...    34   2.5     
gb:AE015596_315905 Shewanella oneidensis MR-1 section 145 of 457...    33   3.2     
gb:AE011334_271791 Leptospira interrogans serovar lai str. 56601...    33   3.2     
gb:CP000029_81013 Staphylococcus epidermidis RP62A, complete gen...    33   3.2     
gb:U72639_2153889 Synthetic transposon Tn5515 transposase, chlor...    33   4.2     
gb:AC084218_1733372 Oryza sativa (japonica cultivar-group) chrom...    33   4.2     
gb:CGU85507_846230 Corynebacterium glutamicum plasmid pXZ10145.1...    33   4.2     
gb:AY266269_604113 Corynebacterium jeikeium plasmid pA501, compl...    33   4.2     
gb:AF024666_470071 Corynebacterium striatum strain M82B R-plasmi...    33   4.2     
gb:AY800391_2385405 Hepatitis B virus isolate ZY041026, complete...    33   5.5     
gb:AB073853_2166255 Hepatitis B virus DNA, complete genome, isol...    33   5.5     
gb:AY390770_1325111 Asterias rubens lysozyme mRNA, complete cds.       33   5.5     
gb:BA000040_730947 Bradyrhizobium japonicum USDA 110 DNA, comple...    33   5.5     
gb:AP008231_582021 Synechococcus elongatus PCC 6301 DNA, complet...    33   5.5     
gb:AP006840_569376 Symbiobacterium thermophilum DNA, complete ge...    33   5.5     
gb:A08113_1447131 Synthetic DNA sequence of chloramphenicol-resi...    32   7.2     
gb:BA000030_699304 Streptomyces avermitilis MA-4680 genomic DNA,...    32   7.2     
gb:AL935261_552789 Lactobacillus plantarum strain WCFS1 complete...    32   7.2     
gb:AE017317_440695 Desulfovibrio vulgaris subsp. vulgaris str. H...    32   7.2     
gb:AE017283_430422 Propionibacterium acnes KPA171202, complete g...    32   7.2     
gb:TACID3_196536 Thermoplasma acidophilum complete genome; segme...    32   7.2     
pir|T18250|T18250 peptide transport protein - yeast (Candida alb...    32   7.2     
sp|P46030|PTR2_CANAL|PTR2_CANAL Peptide transporter PTR2.>gb:CAU09781_16454...    32   7.2     
gb:PMA532589_1700700 Plantago major macronuclear mRNA for polyol...    32   9.4     
gb:AF434490_1420033 Oryctolagus cuniculus RUd-029-H immunoglobul...    32   9.4     
gb:BX571856_780235 Staphylococcus aureus subsp. aureus strain MR...    32   9.4     
gb:AF056309_474160 Streptomyces argillaceus membrane protein and...    32   9.4     
pir|H89844|H89844 hypothetical protein SA0682 [imported] - Staph...    32   9.4     


>pir|F86358|F86358 Similar to peptide transporter [imported] -
           Arabidopsis thaliana>gb:AE005172_891207 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC006551_1534439 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.
          Length = 570

 Score =  234 bits (598), Expect = 7e-61
 Identities = 123/187 (65%), Positives = 148/187 (79%), Gaps = 13/187 (6%)
 Frame = +2

Query: 131 SVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENV 310
           +VDY+ +PA++S SG WRSA FIIGVE+AERFAYYGI  NLI+YLTGPLGQSTA AA NV
Sbjct: 18  TVDYRNKPAVKSSSGGWRSAGFIIGVEVAERFAYYGISSNLITYLTGPLGQSTAAAAANV 77

Query: 311 NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYIL-------------GLGFLTLSAV 451
           NAW+GTASLLPLLGAFVA SFLGR+RTI++AS LYI+             GLG LTLSA+
Sbjct: 78  NAWSGTASLLPLLGAFVADSFLGRFRTILAASALYIVMSLKLYSDLIEQQGLGVLTLSAM 137

Query: 452 LHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
           +    S+C+ +    +CS P+F++I FF +LYLV LAQGGHKPCVQAFGADQFD ++P+E
Sbjct: 138 I---PSDCKVSNLLSSCS-PRFQVITFFSALYLVALAQGGHKPCVQAFGADQFDEKEPEE 193

Query: 632 NKAKSSF 652
            KAKSSF
Sbjct: 194 CKAKSSF 200



>gb:BT004638_1637672 Arabidopsis thaliana At1g22550 gene, complete
           cds.
          Length = 564

 Score =  230 bits (586), Expect = 2e-59
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 1/187 (0%)
 Frame = +2

Query: 95  ETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGP 274
           E   L  DSV  SVD++G PA +S +G WRSA++IIGVE+ ERFAY+GIG NLI+YLTGP
Sbjct: 6   EEAALIEDSVSDSVDHRGLPAGKSSTGGWRSAWYIIGVEVGERFAYFGIGSNLITYLTGP 65

Query: 275 LGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL 454
           LGQSTATAA NVN W+GTAS+LP+LGAF+A ++LGRYRTI+ AS++YILGLG LTLS++L
Sbjct: 66  LGQSTATAAVNVNTWSGTASILPVLGAFIADAYLGRYRTIVVASLIYILGLGLLTLSSIL 125

Query: 455 HSKSSNCQDATNNDTCSPPQFEI-IFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
                + Q   N +  + P F + I FF SLYLV + QGGHKPCVQAFGADQFD  DP+E
Sbjct: 126 ILMGLSEQRQHNRNASAKPFFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDVGDPKE 185

Query: 632 NKAKSSF 652
             ++ SF
Sbjct: 186 RISRGSF 192



>pir|G86358|G86358 protein Similar to LeOPT1 [Lycopersicon
           esculentum] [imported] - Arabidopsis
           thaliana>gb:AE005172_891208 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006551_1534438 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.
          Length = 564

 Score =  230 bits (586), Expect = 2e-59
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 1/187 (0%)
 Frame = +2

Query: 95  ETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGP 274
           E   L  DSV  SVD++G PA +S +G WRSA++IIGVE+ ERFAY+GIG NLI+YLTGP
Sbjct: 6   EEAALIEDSVSDSVDHRGLPAGKSSTGGWRSAWYIIGVEVGERFAYFGIGSNLITYLTGP 65

Query: 275 LGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL 454
           LGQSTATAA NVN W+GTAS+LP+LGAF+A ++LGRYRTI+ AS++YILGLG LTLS++L
Sbjct: 66  LGQSTATAAVNVNTWSGTASILPVLGAFIADAYLGRYRTIVVASLIYILGLGLLTLSSIL 125

Query: 455 HSKSSNCQDATNNDTCSPPQFEI-IFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
                + Q   N +  + P F + I FF SLYLV + QGGHKPCVQAFGADQFD  DP+E
Sbjct: 126 ILMGLSEQRQHNRNASAKPFFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDVGDPKE 185

Query: 632 NKAKSSF 652
             ++ SF
Sbjct: 186 RISRGSF 192



>pir|B86359|B86359 protein Similar to LeOPT1 [Lycopersicon
           esculentum] [imported] - Arabidopsis
           thaliana>gb:AE005172_891211 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006551_1534435 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.
          Length = 565

 Score =  227 bits (578), Expect = 2e-58
 Identities = 119/193 (61%), Positives = 145/193 (75%), Gaps = 1/193 (0%)
 Frame = +2

Query: 77  MDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLI 256
           M +P+ E   L+ D V  SVD++G PA +S +G WRSA+FIIGVE+AERFAY+GI  NLI
Sbjct: 1   MKIPEEEVALLE-DYVSDSVDHRGFPAGKSSTGGWRSAWFIIGVEVAERFAYFGIACNLI 59

Query: 257 SYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFL 436
           +YLTGPLGQSTA AA NVN W+GTAS+LP+LGAFVA ++LGRYRTI+ AS++YILGLG L
Sbjct: 60  TYLTGPLGQSTAKAAVNVNTWSGTASILPILGAFVADAYLGRYRTIVVASLIYILGLGLL 119

Query: 437 TLSAVLHSKSSNCQDATNNDTCSPPQFEI-IFFFFSLYLVGLAQGGHKPCVQAFGADQFD 613
           TLSA L     + Q    ND  + P   +   FF SLYLV + QGGHKPCVQAFGADQFD
Sbjct: 120 TLSASLIIMGLSKQ---RNDASAKPSIWVNTLFFCSLYLVAIGQGGHKPCVQAFGADQFD 176

Query: 614 TQDPQENKAKSSF 652
            +DP+E  A+ SF
Sbjct: 177 AEDPKEVIARGSF 189



>gb:AY065020_1566183 Arabidopsis thaliana At1g72120/F28P5_2 mRNA,
           complete cds.>gb:BT001020_1635275 Arabidopsis thaliana
           At1g72120/F28P5_2 mRNA, complete cds.
          Length = 557

 Score =  226 bits (577), Expect = 2e-58
 Identities = 117/182 (64%), Positives = 137/182 (75%)
 Frame = +2

Query: 107 LQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQS 286
           LQ + V  +VD++G  A RS +GRWR+A FIIGVE+AERFAYYGIG NLISYLTGPLG+S
Sbjct: 9   LQEEYVTDAVDHRGLDARRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISYLTGPLGES 68

Query: 287 TATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS 466
           TA AA NVNAW+G A+LLP+LGAFVA +FLGRYRTII +S++Y+LGL FLTLSA L    
Sbjct: 69  TAVAAANVNAWSGIATLLPVLGAFVADAFLGRYRTIIISSLIYVLGLAFLTLSAFLIPN- 127

Query: 467 SNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKS 646
                 T   T S   F  + FFFSLYLV + Q GHKPCVQAFGADQFD +D QE   +S
Sbjct: 128 ------TTEVTSSTSSFLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQEKSDRS 181

Query: 647 SF 652
           SF
Sbjct: 182 SF 183



>pir|E96744|E96744 probable oligopeptide transporter F28P5.2
           [imported] - Arabidopsis thaliana>gb:AE005173_894759
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC069273_1540773 Arabidopsis thaliana
           chromosome 1 BAC F28P5 genomic sequence, complete
           sequence.
          Length = 1095

 Score =  226 bits (577), Expect = 2e-58
 Identities = 117/182 (64%), Positives = 137/182 (75%)
 Frame = +2

Query: 107 LQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQS 286
           LQ + V  +VD++G  A RS +GRWR+A FIIGVE+AERFAYYGIG NLISYLTGPLG+S
Sbjct: 9   LQEEYVTDAVDHRGLAARRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISYLTGPLGES 68

Query: 287 TATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS 466
           TA AA NVNAW+G A+LLP+LGAFVA +FLGRYRTII +S++Y+LGL FLTLSA L    
Sbjct: 69  TAVAAANVNAWSGIATLLPVLGAFVADAFLGRYRTIIISSLIYVLGLAFLTLSAFLIPN- 127

Query: 467 SNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKS 646
                 T   T S   F  + FFFSLYLV + Q GHKPCVQAFGADQFD +D QE   +S
Sbjct: 128 ------TTEVTSSTSSFLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQEKSDRS 181

Query: 647 SF 652
           SF
Sbjct: 182 SF 183



 Score =  224 bits (572), Expect = 8e-58
 Identities = 121/201 (60%), Positives = 143/201 (71%)
 Frame = +2

Query: 50   WAMAITGATMDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFA 229
            W +AI   T          LQ + V  +VD++G  A RS +GRWR+A+FIIGVE+AERFA
Sbjct: 529  WLLAIKMTTTSKTS-----LQEEYVIDAVDHRGFSARRSITGRWRAAWFIIGVEVAERFA 583

Query: 230  YYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASV 409
             YGIG NLISYLTGPLGQSTA AA NVNAW+G +++LPLLGAFVA +FLGRY TII AS 
Sbjct: 584  NYGIGSNLISYLTGPLGQSTAVAAANVNAWSGISTILPLLGAFVADAFLGRYITIIIASF 643

Query: 410  LYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQ 589
            +Y+LGL FLTLSA L   ++         T SP  F    FFFSLYLV + Q GHKPCVQ
Sbjct: 644  IYVLGLAFLTLSAFLIPNNTEV-------TSSPSSFLNALFFFSLYLVAIGQSGHKPCVQ 696

Query: 590  AFGADQFDTQDPQENKAKSSF 652
            AFGADQFD ++PQEN  +SSF
Sbjct: 697  AFGADQFDEKNPQENSDRSSF 717



>gb:AP004669_1843008 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0491F11.
          Length = 361

 Score =  214 bits (544), Expect = 1e-54
 Identities = 112/176 (63%), Positives = 133/176 (75%), Gaps = 2/176 (1%)
 Frame = +2

Query: 131 SVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENV 310
           +VD+ GRPA R  SGRW +A FIIGVE++ERFA+ GI  NLI+YLTGPLGQSTA+AA  +
Sbjct: 15  AVDHLGRPASRRTSGRWLAALFIIGVEISERFAFGGISGNLITYLTGPLGQSTASAAAAI 74

Query: 311 NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL--HSKSSNCQDA 484
           NAW G A LLPLLGA VA S+LGRYR II AS+LYILGLG LTLS VL  H ++ +  +A
Sbjct: 75  NAWNGAALLLPLLGAAVADSWLGRYRIIICASLLYILGLGMLTLSPVLVPHQQAESGDNA 134

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            NN   S     + FF+ SLY+V  AQGGHKPCVQAFGADQFD  DP+E  ++SSF
Sbjct: 135 DNN-ASSSMDIHVAFFYLSLYIVAFAQGGHKPCVQAFGADQFDENDPEECASRSSF 189



>gb:AP003566_1830928 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 548

 Score =  214 bits (544), Expect = 1e-54
 Identities = 112/176 (63%), Positives = 133/176 (75%), Gaps = 2/176 (1%)
 Frame = +2

Query: 131 SVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENV 310
           +VD+ GRPA R  SGRW +A FIIGVE++ERFA+ GI  NLI+YLTGPLGQSTA+AA  +
Sbjct: 15  AVDHLGRPASRRTSGRWLAALFIIGVEISERFAFGGISGNLITYLTGPLGQSTASAAAAI 74

Query: 311 NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL--HSKSSNCQDA 484
           NAW G A LLPLLGA VA S+LGRYR II AS+LYILGLG LTLS VL  H ++ +  +A
Sbjct: 75  NAWNGAALLLPLLGAAVADSWLGRYRIIICASLLYILGLGMLTLSPVLVPHQQAESGDNA 134

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            NN   S     + FF+ SLY+V  AQGGHKPCVQAFGADQFD  DP+E  ++SSF
Sbjct: 135 DNN-ASSSMDIHVAFFYLSLYIVAFAQGGHKPCVQAFGADQFDENDPEECASRSSF 189



>gb:AP003235_1825911 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843000 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 545

 Score =  209 bits (532), Expect = 3e-53
 Identities = 104/201 (51%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = +2

Query: 59  AITGATMDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYG 238
           A+T A + LP +E       +V G+VD++GRPA R+ +GRW +A F++GVE+AERFAY+G
Sbjct: 5   AVTDALL-LPRSE------GAVAGAVDFRGRPASRASTGRWSAAMFVLGVEIAERFAYHG 57

Query: 239 IGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYI 418
           +  NLISYLTGPLG+STA AA  +N W+G A++LPLL A VA ++LGRYRTI+ AS+L++
Sbjct: 58  VSANLISYLTGPLGESTAGAAAAINLWSGVATMLPLLVACVADAWLGRYRTIVLASLLFV 117

Query: 419 LGLGFLTLSAVL---HSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQ 589
           + +G LTLS+ L   H     C   + + +C+P   ++  F+ SLYLV LA+ GHKPC Q
Sbjct: 118 VSMGMLTLSSALPAFHGDGGGCSYTSKSLSCAPSTAQVAIFYVSLYLVALAEAGHKPCAQ 177

Query: 590 AFGADQFDTQDPQENKAKSSF 652
           AFGADQFD  D +E+ ++SSF
Sbjct: 178 AFGADQFDQNDAKESVSRSSF 198



>gb:AC108502_1738512 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1378_A04, complete
           sequence.>gb:AC130600_1740744 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0048I21,
           complete sequence.
          Length = 530

 Score =  199 bits (505), Expect = 4e-50
 Identities = 103/180 (57%), Positives = 125/180 (69%), Gaps = 2/180 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           S D  +   G    R  +G WRSA FII VE+AERFAYYG+  NLISYLTGP G++TA A
Sbjct: 5   STDPLLPRAGAARRRPATGGWRSALFIIWVEVAERFAYYGVSSNLISYLTGPFGETTAAA 64

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNC 475
           A  VNAW+G AS+LPLLGA VA S+LGRYRTI+++SVLYI GLG L LS+   S +S  C
Sbjct: 65  AAAVNAWSGAASMLPLLGAAVADSWLGRYRTIVASSVLYITGLGLLALSSTFSSPQSQQC 124

Query: 476 QDA-TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             +      C     +  FF+ SLYLV +AQ GHKPCVQAFGADQFD  DP E+ ++S+F
Sbjct: 125 SSSGDGRQVCRSSSVQRAFFYVSLYLVAIAQSGHKPCVQAFGADQFDATDPGESSSRSTF 184



>pir|G96744|G96744 probable peptide transporter PTR2-B, T9N14.16
           [imported] - Arabidopsis thaliana>gb:AE005173_894761
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC067754_1540313 Arabidopsis thaliana
           chromosome 1 BAC T9N14 genomic sequence, complete
           sequence.>gb:BT015165_1642135 Arabidopsis thaliana
           At1g72140 gene, complete cds.
          Length = 555

 Score =  194 bits (494), Expect = 8e-49
 Identities = 99/189 (52%), Positives = 133/189 (70%), Gaps = 1/189 (0%)
 Frame = +2

Query: 89  DAET-QFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYL 265
           D ET   + +++V+ SVD++G P+IRS SG W+S+ F +  E+AE+FAY+GI  NLI+Y 
Sbjct: 7   DNETGAIVSNENVEFSVDFRGNPSIRSSSGAWKSSGFTMCAEVAEKFAYFGIASNLITYF 66

Query: 266 TGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLS 445
           T  LG+STA AA NVN W GTA+ LPL+   +A SFLGR+RTI+  S  YI+GLG LT S
Sbjct: 67  TEALGESTAVAASNVNLWLGTAAFLPLIWGSIADSFLGRFRTILLTSSFYIMGLGLLTFS 126

Query: 446 AVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDP 625
           A +    S C D    ++C   Q ++I FF +LYL+ L +GG K C++AFGADQFD QDP
Sbjct: 127 ATI---PSLCNDQETRESC-VSQVKVIIFFCALYLIALGEGGFKVCLRAFGADQFDEQDP 182

Query: 626 QENKAKSSF 652
            E+KAKSS+
Sbjct: 183 NESKAKSSY 191



>gb:AP003566_1830921 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 617

 Score =  192 bits (488), Expect = 4e-48
 Identities = 104/234 (44%), Positives = 145/234 (61%), Gaps = 36/234 (15%)
 Frame = +2

Query: 59  AITGATMDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYG 238
           A+T A + LP +E       +V G+VD++GRPA R+ +GRW +A F++GVE+AERFAY+G
Sbjct: 44  AVTDALL-LPRSE------GAVAGAVDFRGRPASRASTGRWSAAMFVLGVEIAERFAYHG 96

Query: 239 IGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYI 418
           +  NLISYLTGPLG+STA AA  +N W+G A++LPLL A VA ++LGRYRTI+ AS+L++
Sbjct: 97  VSANLISYLTGPLGESTAGAAAAINLWSGVATMLPLLVACVADAWLGRYRTIVLASLLFV 156

Query: 419 L---------------------------------GLGFLTLSAVL---HSKSSNCQDATN 490
           +                                  +G LTLS+ L   H     C   + 
Sbjct: 157 VKKAHAFLQMNFSKSPTYIQFGGESAATRFGKKKSMGMLTLSSALPAFHGDGGGCSYTSK 216

Query: 491 NDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           + +C+P   ++  F+ SLYLV LA+ GHKPC QAFGADQFD  D +E+ ++SSF
Sbjct: 217 SLSCAPSTAQVAIFYVSLYLVALAEAGHKPCAQAFGADQFDQNDAKESVSRSSF 270



>gb:AP004669_1843010 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0491F11.
          Length = 542

 Score =  192 bits (487), Expect = 5e-48
 Identities = 100/174 (57%), Positives = 122/174 (70%)
 Frame = +2

Query: 131 SVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENV 310
           +VD+ G PA R  SGRW +A+F+IG E+ ERFAY GI  NL+ YLTGPL Q TA AA  V
Sbjct: 21  AVDHLGGPASRGSSGRWPAAFFLIGAEVGERFAYSGIMGNLVIYLTGPLRQPTAAAAAAV 80

Query: 311 NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATN 490
           N W GT+ LLPLLG+ VA S+LGRYRTI+ AS+LYILGLG +T+S+VL  + S+      
Sbjct: 81  NVWMGTSMLLPLLGSAVADSWLGRYRTIVCASLLYILGLGMITVSSVLAPEESS------ 134

Query: 491 NDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
               S     + FF+FSLY+V  AQGGHKPC QA GADQFD  DP E  ++SSF
Sbjct: 135 --ESSNLAAHVAFFYFSLYVVAFAQGGHKPCAQALGADQFDENDPGELASRSSF 186



>gb:AK175547_1817535 Arabidopsis thaliana mRNA for putative peptide
           transporter PTR2-B, complete cds, clone: RAFL21-96-L14.
          Length = 555

 Score =  190 bits (483), Expect = 2e-47
 Identities = 98/189 (51%), Positives = 132/189 (69%), Gaps = 1/189 (0%)
 Frame = +2

Query: 89  DAET-QFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYL 265
           D ET   + +++V+ SVD++G P+IRS SG W+S+ F +  E+AE+FAY+GI  NLI+Y 
Sbjct: 7   DNETGAIVSNENVEFSVDFRGNPSIRSSSGAWKSSGFTMCAEVAEKFAYFGIASNLITYF 66

Query: 266 TGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLS 445
           T  LG+STA AA NVN W GTA+ LPL+   +A SFLGR+RTI+  S  YI+GLG LT S
Sbjct: 67  TEALGESTAVAASNVNLWLGTAAFLPLIWGSIADSFLGRFRTILLTSSFYIMGLGLLTFS 126

Query: 446 AVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDP 625
           A +    S C D    ++    Q ++I FF +LYL+ L +GG K C++AFGADQFD QDP
Sbjct: 127 ATI---PSLCNDQETRES-YVSQVKVIIFFCALYLIALGEGGFKVCLRAFGADQFDEQDP 182

Query: 626 QENKAKSSF 652
            E+KAKSS+
Sbjct: 183 NESKAKSSY 191



>gb:AY090354_1574104 Arabidopsis thaliana At1g72130/F28P5.1 mRNA,
           complete cds.>gb:BT000836_1635091 Arabidopsis thaliana
           putative oligopeptide transporter (At1g72130/F28P5.1)
           mRNA, complete cds.
          Length = 538

 Score =  183 bits (464), Expect = 3e-45
 Identities = 94/161 (58%), Positives = 114/161 (70%)
 Frame = +2

Query: 170 SGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLL 349
           SG W+SA  II V+MAERFAY+GI  NLI YLTGPLG+STA AA NVNAWTGT + LPLL
Sbjct: 26  SGGWKSARLIIVVQMAERFAYFGIASNLIMYLTGPLGESTAAAAANVNAWTGTVAFLPLL 85

Query: 350 GAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIF 529
           G F+A S+LGR+RTII +S LYILGLG L+ S ++ S  S   +          Q +   
Sbjct: 86  GGFLADSYLGRFRTIIISSSLYILGLGLLSFSTMIPSHQSKDSN----------QLQETI 135

Query: 530 FFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           FFFSLYLV + QGG+ PC++ FGADQFD  D +E + KSSF
Sbjct: 136 FFFSLYLVAIGQGGYNPCIKVFGADQFDGNDHKEARDKSSF 176



>gb:AC069273_1540772 Arabidopsis thaliana chromosome 1 BAC F28P5
           genomic sequence, complete sequence.
          Length = 763

 Score =  183 bits (464), Expect = 3e-45
 Identities = 94/161 (58%), Positives = 114/161 (70%)
 Frame = +2

Query: 170 SGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLL 349
           SG W+SA  II V+MAERFAY+GI  NLI YLTGPLG+STA AA NVNAWTGT + LPLL
Sbjct: 26  SGGWKSARLIIVVQMAERFAYFGIASNLIMYLTGPLGESTAAAAANVNAWTGTVAFLPLL 85

Query: 350 GAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIF 529
           G F+A S+LGR+RTII +S LYILGLG L+ S ++ S  S   +          Q +   
Sbjct: 86  GGFLADSYLGRFRTIIISSSLYILGLGLLSFSTMIPSHQSKDSN----------QLQETI 135

Query: 530 FFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           FFFSLYLV + QGG+ PC++ FGADQFD  D +E + KSSF
Sbjct: 136 FFFSLYLVAIGQGGYNPCIKVFGADQFDGNDHKEARDKSSF 176



 Score =  127 bits (320), Expect = 1e-28
 Identities = 70/129 (54%), Positives = 90/129 (69%), Gaps = 1/129 (0%)
 Frame = +2

Query: 269 GPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYIL-GLGFLTLS 445
           G +G+STA AA NVNAW+G  S LPLLG F+A SFLGR+RTI+ A  LYI+ GLG L+ S
Sbjct: 516 GFIGESTAAAAANVNAWSGV-SFLPLLGGFIADSFLGRFRTIVIAYSLYIMQGLGLLSFS 574

Query: 446 AVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDP 625
           A+    SSN +D        P Q ++I FF SLYL+ + QGG+KPC++ FGADQFD  D 
Sbjct: 575 AMT---SSNSKD--------PNQLQVILFFCSLYLIAIGQGGYKPCIKVFGADQFDGNDI 623

Query: 626 QENKAKSSF 652
           ++ K KSS+
Sbjct: 624 KDAKDKSSY 632



>pir|F96744|F96744 probable peptide transporter PTR2-B T9N14.15
           [imported] - Arabidopsis thaliana>gb:AE005173_894760
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC067754_1540312 Arabidopsis thaliana
           chromosome 1 BAC T9N14 genomic sequence, complete
           sequence.
          Length = 812

 Score =  183 bits (464), Expect = 3e-45
 Identities = 94/161 (58%), Positives = 114/161 (70%)
 Frame = +2

Query: 170 SGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLL 349
           SG W+SA  II V+MAERFAY+GI  NLI YLTGPLG+STA AA NVNAWTGT + LPLL
Sbjct: 26  SGGWKSARLIIVVQMAERFAYFGIASNLIMYLTGPLGESTAAAAANVNAWTGTVAFLPLL 85

Query: 350 GAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIF 529
           G F+A S+LGR+RTII +S LYILGLG L+ S ++ S  S   +          Q +   
Sbjct: 86  GGFLADSYLGRFRTIIISSSLYILGLGLLSFSTMIPSHQSKDSN----------QLQETI 135

Query: 530 FFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           FFFSLYLV + QGG+ PC++ FGADQFD  D +E + KSSF
Sbjct: 136 FFFSLYLVAIGQGGYNPCIKVFGADQFDGNDHKEARDKSSF 176



 Score =  148 bits (373), Expect = 9e-35
 Identities = 84/169 (49%), Positives = 107/169 (63%), Gaps = 15/169 (8%)
 Frame = +2

Query: 191 YFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGS 370
           +F    +  E  + YGI LNLI+YLTGPLG+STA AA NVNAW+G  S LPLLG F+A S
Sbjct: 525 WFAKSYQNIELESLYGISLNLITYLTGPLGESTAAAAANVNAWSGV-SFLPLLGGFIADS 583

Query: 371 FLGRYRTIISASVLYIL---------------GLGFLTLSAVLHSKSSNCQDATNNDTCS 505
           FLGR+RTI+ A  LYI+               GLG L+ SA+    SSN +D        
Sbjct: 584 FLGRFRTIVIAYSLYIMVYNNLLLKTSLLKHQGLGLLSFSAMT---SSNSKD-------- 632

Query: 506 PPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           P Q ++I FF SLYL+ + QGG+KPC++ FGADQFD  D ++ K KSS+
Sbjct: 633 PNQLQVILFFCSLYLIAIGQGGYKPCIKVFGADQFDGNDIKDAKDKSSY 681



>gb:AP005869_1859325 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 572

 Score =  180 bits (456), Expect = 2e-44
 Identities = 88/183 (48%), Positives = 124/183 (67%), Gaps = 1/183 (0%)
 Frame = +2

Query: 107 LQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQS 286
           ++  + DG+ D+ G+PA+RS+SG WR+  FI+G E  ER AYYG+  NL++Y+   L Q 
Sbjct: 1   MEATTTDGTTDHAGKPAVRSKSGTWRACPFILGNECCERLAYYGMSANLVNYMVDRLRQG 60

Query: 287 TATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA-VLHSK 463
            A AA +VN W+GT  ++PL+GAF+A ++LGRYRTI +   LYI+GL  LT+SA V   K
Sbjct: 61  NAGAAASVNNWSGTCYVMPLVGAFLADAYLGRYRTIAAFMALYIVGLALLTMSASVPGMK 120

Query: 464 SSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
             NC    +  +C P   +   FF +LYL+ L  GG KPCV +FGADQFD  DP+E+++K
Sbjct: 121 PPNCA-TISASSCGPSPGQSAAFFVALYLIALGTGGIKPCVSSFGADQFDDADPREHRSK 179

Query: 644 SSF 652
           +SF
Sbjct: 180 ASF 182



>gb:AP003566_1830929 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 574

 Score =  179 bits (453), Expect = 5e-44
 Identities = 100/197 (50%), Positives = 122/197 (61%), Gaps = 23/197 (11%)
 Frame = +2

Query: 131 SVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENV 310
           +VD+ G PA R  SGRW +A+F+IG E+ ERFAY GI  NL+ YLTGPL Q TA AA  V
Sbjct: 21  AVDHLGGPASRGSSGRWPAAFFLIGAEVGERFAYSGIMGNLVIYLTGPLRQPTAAAAAAV 80

Query: 311 NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYIL----------------------- 421
           N W GT+ LLPLLG+ VA S+LGRYRTI+ AS+LYIL                       
Sbjct: 81  NVWMGTSMLLPLLGSAVADSWLGRYRTIVCASLLYILVPAYKLLSWLGLEPDFFFLLFLQ 140

Query: 422 GLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGA 601
           GLG +T+S+VL  + S+          S     + FF+FSLY+V  AQGGHKPC QA GA
Sbjct: 141 GLGMITVSSVLAPEESS--------ESSNLAAHVAFFYFSLYVVAFAQGGHKPCAQALGA 192

Query: 602 DQFDTQDPQENKAKSSF 652
           DQFD  DP E  ++SSF
Sbjct: 193 DQFDENDPGELASRSSF 209



>gb:OSJN00099_1694893 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0020J19, complete sequence.
          Length = 510

 Score =  171 bits (432), Expect = 1e-41
 Identities = 92/190 (48%), Positives = 126/190 (66%), Gaps = 1/190 (0%)
 Frame = +2

Query: 83  LPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISY 262
           LP+ E    + +++ G  D++GRP  R+ SG WRSA F+  +E+A  FAY+G+  NLI+Y
Sbjct: 7   LPNEE----EEEALPGVSDFRGRPVYRATSGGWRSALFVAVLELAGSFAYFGVSANLITY 62

Query: 263 LTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTL 442
           LTGP+GQS A+AA  VNAW+G A +LPLLGAF+A SFLGRY +I+ A  LY+LG G LT+
Sbjct: 63  LTGPMGQSNASAAAAVNAWSGAACMLPLLGAFLADSFLGRYPSILLACTLYLLGYGMLTV 122

Query: 443 -SAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQ 619
            S+V+ SKS                 ++   + SLYLV LAQG  KPC  A GA+QFD +
Sbjct: 123 ASSVVASKS-----------------QVGILYVSLYLVALAQGFDKPCGLALGAEQFDPE 165

Query: 620 DPQENKAKSS 649
            P+E+ ++SS
Sbjct: 166 HPRESASRSS 175



>pir|T47573|T47573 peptide transport-like protein - Arabidopsis
           thaliana>gb:ATF24B22_1549823 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24B22.>gb:AY084773_1569857
           Arabidopsis thaliana clone 117581 mRNA, complete
           sequence.>gb:AY113884_1578295 Arabidopsis thaliana
           putative peptide transport protein (At3g54140) mRNA,
           complete cds.>gb:AF360155_1791111 Arabidopsis thaliana
           putative peptide transport protein (At3g54140) mRNA,
           complete cds.
          Length = 570

 Score =  169 bits (429), Expect = 3e-41
 Identities = 86/177 (48%), Positives = 111/177 (62%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD    PA + ++G W++  FI+G E  ER AYYG+G NL++YL   L Q  ATAA 
Sbjct: 10  DGTVDIHKNPANKEKTGNWKACRFILGNECCERLAYYGMGTNLVNYLESRLNQGNATAAN 69

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA-VLHSKSSNCQD 481
           NV  W+GT  + PL+GAF+A ++LGRY TI +   +Y+ G+  LTLSA V   K  NC  
Sbjct: 70  NVTNWSGTCYITPLIGAFIADAYLGRYWTIATFVFIYVSGMTLLTLSASVPGLKPGNC-- 127

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             N DTC P   +   FF +LY++ L  GG KPCV +FGADQFD  D  E   KSSF
Sbjct: 128 --NADTCHPNSSQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDENEKIKKSSF 182



>gb:AP003566_1830922 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 548

 Score =  169 bits (427), Expect = 5e-41
 Identities = 83/179 (46%), Positives = 119/179 (66%)
 Frame = +2

Query: 116 DSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTAT 295
           D+V G+VDY+GRPA R+ +G W+S+ F++ +E+AERFAY G+  NLI+YLTGPLGQ  A 
Sbjct: 19  DTVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR 78

Query: 296 AAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNC 475
           AA +++AW G + +LPL  A VA ++LGRYR I+ ASV+++L +G L++S+      +  
Sbjct: 79  AAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASVIFVLSMGTLSMSSAFPVSRAG- 137

Query: 476 QDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                          +  F+ +LY+V L +G HKPC QAF ADQFD +D  E  A+SSF
Sbjct: 138 --------------HVAVFYVALYMVALGEGAHKPCAQAFAADQFDEKDGGECAARSSF 182



>gb:AP003235_1825912 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843001 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 532

 Score =  169 bits (427), Expect = 5e-41
 Identities = 83/179 (46%), Positives = 119/179 (66%)
 Frame = +2

Query: 116 DSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTAT 295
           D+V G+VDY+GRPA R+ +G W+S+ F++ +E+AERFAY G+  NLI+YLTGPLGQ  A 
Sbjct: 3   DTVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR 62

Query: 296 AAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNC 475
           AA +++AW G + +LPL  A VA ++LGRYR I+ ASV+++L +G L++S+      +  
Sbjct: 63  AAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASVIFVLSMGTLSMSSAFPVSRAG- 121

Query: 476 QDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                          +  F+ +LY+V L +G HKPC QAF ADQFD +D  E  A+SSF
Sbjct: 122 --------------HVAVFYVALYMVALGEGAHKPCAQAFAADQFDEKDGGECAARSSF 166



>gb:AK117678_1815699 Arabidopsis thaliana At1g72130 mRNA for
           putative peptide transporter PTR2-B, complete cds,
           clone: RAFL17-34-C15.
          Length = 499

 Score =  168 bits (426), Expect = 6e-41
 Identities = 86/147 (58%), Positives = 104/147 (70%)
 Frame = +2

Query: 212 MAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRT 391
           MAERFAY+GI  NLI YLTGPLG+STA AA NVNAWTGT + LPLLG F+A S+LGR+RT
Sbjct: 1   MAERFAYFGIASNLIMYLTGPLGESTAAAAANVNAWTGTVAFLPLLGGFLADSYLGRFRT 60

Query: 392 IISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGG 571
           II +S LYILGLG L+ S ++ S  S   +          Q +   FFFSLYLV + QGG
Sbjct: 61  IIISSSLYILGLGLLSFSTMIPSHQSKDSN----------QLQETIFFFSLYLVAIGQGG 110

Query: 572 HKPCVQAFGADQFDTQDPQENKAKSSF 652
           + PC++ FGADQFD  D +E + KSSF
Sbjct: 111 YNPCIKVFGADQFDGNDHKEARDKSSF 137



>gb:AB067652_1522599 Oryza sativa (japonica cultivar-group) OsPTR1
           mRNA for peptide transporter, complete
           cds.>gb:AB067653_1522600 Oryza sativa (japonica
           cultivar-group) OsPTR1 gene for peptide transporter,
           complete cds.>gb:AC147426_1744673 Oryza sativa
           chromosome 3 B1377B10 genomic sequence, complete
           sequence.
          Length = 593

 Score =  166 bits (420), Expect = 3e-40
 Identities = 84/176 (47%), Positives = 110/176 (62%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD+ G P ++ R+GRWR+  FI+G E  ER AYYGI  NL++YLT  L    A+AA 
Sbjct: 36  DGSVDFSGNPVVKERTGRWRACPFILGNECCERLAYYGISTNLVTYLTKKLHDGNASAAS 95

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NV AW GT  L PL+GA +A ++ GRY TI + S +Y +G+  LTLSA + +      + 
Sbjct: 96  NVTAWQGTCYLTPLIGAILADAYWGRYWTIATFSTIYFIGMAVLTLSASVPTFMPPPCEG 155

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           +     +P Q+ +  FF  LYL+ L  GG KPCV +FGADQFD  DP E   K SF
Sbjct: 156 SFCPPANPLQYTV--FFLGLYLIALGTGGIKPCVSSFGADQFDDTDPVERIQKGSF 209



>gb:AF016713_1761512 Lycopersicon esculentum oligopeptide
           transporter (LeOPT1) mRNA, complete cds.
          Length = 580

 Score =  165 bits (418), Expect = 5e-40
 Identities = 86/177 (48%), Positives = 112/177 (63%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD KG P ++S +G WR+  FI+G E  ER AYYGI  NL++YLT  L +   +AA 
Sbjct: 23  DGSVDIKGNPVLKSETGNWRACPFILGNECCERLAYYGIAANLVTYLTKKLHEGNVSAAR 82

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT  + PL+GA +A ++ GRY TI + S +Y +G+  LTLSA + + K   C  
Sbjct: 83  NVTTWQGTCYITPLIGAVLADAYWGRYWTIATFSTIYFIGMCTLTLSASVPAFKPPQCVG 142

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           +    + SP Q+ I  FFF LYL+ L  GG KPCV +FGADQFD  DP+E   K SF
Sbjct: 143 SV-CPSASPAQYAI--FFFGLYLIALGTGGIKPCVSSFGADQFDDTDPKERVKKGSF 196



>pir|T04378|T04378 peptide transport protein -
           barley>gb:AF023472_1762048 Hordeum vulgare peptide
           transporter (ptr1) mRNA, complete cds.
          Length = 579

 Score =  164 bits (415), Expect = 1e-39
 Identities = 78/176 (44%), Positives = 109/176 (61%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD KG PA++  +G WR+  +I+  E  ER AYYG+  NL++++   +G + A AA 
Sbjct: 12  DGTVDIKGNPALKKDTGNWRACPYILANECCERLAYYGMSTNLVNFMKDRMGMANAAAAN 71

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NV  W GT  + PL+GAF+A ++LGR+ TI S  ++YI GLG LT++  +H     C   
Sbjct: 72  NVTNWGGTCYITPLIGAFLADAYLGRFWTIASFMIIYIFGLGLLTMATSVHGLVPAC--- 128

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            +   C P   +    F +LYL+ L  GG KPCV +FGADQFD  D  E K+KSSF
Sbjct: 129 ASKGVCDPTPGQSAAVFIALYLIALGTGGIKPCVSSFGADQFDEHDDVERKSKSSF 184



>gb:AP002483_1822204 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0019D06.>gb:AP003311_1827798
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0024G09.
          Length = 580

 Score =  164 bits (414), Expect = 2e-39
 Identities = 80/176 (45%), Positives = 110/176 (62%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD KG PA +  +G WR+  +I+  E  ER AYYG+  NL++Y+   LGQ +A AA 
Sbjct: 12  DGTVDVKGNPATKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKTRLGQESAIAAN 71

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NV  W+GT  + PLLGAF+A +++GR+ TI S  ++YILGL  LT++    S       A
Sbjct: 72  NVTNWSGTCYITPLLGAFLADAYMGRFWTIASFMIIYILGLALLTMA----SSVKGLVPA 127

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            +   C P + +    F +LYL+ L  GG KPCV +FGADQFD  D  E ++KSSF
Sbjct: 128 CDGGACHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSKSSF 183



>gb:AY063897_1565844 Arabidopsis thaliana putative PTR2 family
           peptide transporter protein (At2g40460) mRNA, complete
           cds.
          Length = 583

 Score =  159 bits (402), Expect = 4e-38
 Identities = 72/176 (40%), Positives = 113/176 (64%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD +GRP + S++GRWR+  F++G E  ER A+YGI  NL++YLT  L + T ++  
Sbjct: 10  DGTVDLQGRPVLASKTGRWRACSFLLGYEAFERMAFYGIASNLVNYLTKRLHEDTISSVR 69

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NVN W+G   + P+ GA++A S++GR+ T  ++S++Y+LG+  LT++  + S    C++ 
Sbjct: 70  NVNNWSGAVWITPIAGAYIADSYIGRFWTFTASSLIYVLGMILLTMAVTVKSLRPTCENG 129

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             N   S    ++ FF+ SLY + +  GG KP +  FGADQFD+   +E K K SF
Sbjct: 130 VCNKASS---LQVTFFYISLYTIAIGAGGTKPNISTFGADQFDSYSIEEKKQKVSF 182



>pir|G84829|G84829 probable PTR2 family peptide transporter
           [imported] - Arabidopsis thaliana>gb:AC002336_1530447
           Arabidopsis thaliana chromosome 2 clone T2P4 map
           CIC10A06, complete sequence.>gb:AY094400_1575706
           Arabidopsis thaliana At2g40460/T2P4.19 mRNA, complete
           cds.>gb:AY150513_1585078 Arabidopsis thaliana putative
           PTR2 family peptide transporter (At2g40460) mRNA,
           complete cds.>gb:BT002242_1635845 Arabidopsis thaliana
           At2g40460/T2P4.19 mRNA, complete cds.
          Length = 583

 Score =  159 bits (402), Expect = 4e-38
 Identities = 72/176 (40%), Positives = 113/176 (64%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD +GRP + S++GRWR+  F++G E  ER A+YGI  NL++YLT  L + T ++  
Sbjct: 10  DGTVDLQGRPVLASKTGRWRACSFLLGYEAFERMAFYGIASNLVNYLTKRLHEDTISSVR 69

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NVN W+G   + P+ GA++A S++GR+ T  ++S++Y+LG+  LT++  + S    C++ 
Sbjct: 70  NVNNWSGAVWITPIAGAYIADSYIGRFWTFTASSLIYVLGMILLTMAVTVKSLRPTCENG 129

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             N   S    ++ FF+ SLY + +  GG KP +  FGADQFD+   +E K K SF
Sbjct: 130 VCNKASS---LQVTFFYISLYTIAIGAGGTKPNISTFGADQFDSYSIEEKKQKVSF 182



>pir|T45936|T45936 transporter-like protein - Arabidopsis
           thaliana>gb:ATF5K20_1550800 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F5K20.
          Length = 620

 Score =  157 bits (398), Expect = 1e-37
 Identities = 77/178 (43%), Positives = 114/178 (64%), Gaps = 1/178 (0%)
 Frame = +2

Query: 122 VDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAA 301
           +D S D +G   +R+++G WR+A FIIG+E +ER +Y+GI  NL+ YLT  L Q    A 
Sbjct: 22  LDSSTDSRGEIPLRAQTGAWRAALFIIGIEFSERLSYFGISTNLVVYLTTILHQDLKMAV 81

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQD 481
           +N N W+G  +L+PLLG FVA ++LGRY T++ A+ +Y++GL  LTLS  +         
Sbjct: 82  KNTNYWSGVTTLMPLLGGFVADAYLGRYGTVLLATTIYLMGLILLTLSWFIPGLK----- 136

Query: 482 ATNNDTC-SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           A + D C  P +   I FF ++YL+ +  GGHKP +++FGADQF+   P+E K K S+
Sbjct: 137 ACHEDMCVEPRKAHEIAFFIAIYLISIGTGGHKPSLESFGADQFEDGHPEERKMKMSY 194



>gb:AF213936_1777806 Prunus dulcis amino acid/peptide transporter
           (PTR2) mRNA, complete cds.
          Length = 559

 Score =  157 bits (397), Expect = 1e-37
 Identities = 81/177 (45%), Positives = 110/177 (62%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD  G+P ++  +G W +  FI+G E  ER A+YGI  NL++YLT  L +   +AA 
Sbjct: 27  DGSVDITGKPVLKQSTGNWXACPFILGTECCERLAFYGISTNLVTYLTHKLHEGNVSAAR 86

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W+GT  L PL+GA +A ++ GRY TI   S +Y +G+  LT+SA + + K   C D
Sbjct: 87  NVTTWSGTCYLTPLIGAVLADAYWGRYWTIAIFSTIYFIGMCTLTISASVPALKPPQCVD 146

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           +    + SP Q+ +  FFF LYL+ L  GG KPCV +FGADQFD  D +E   K SF
Sbjct: 147 SV-CPSASPAQYGV--FFFGLYLIALRTGGIKPCVSSFGADQFDDTDSRERVKKGSF 200



>gb:AY058836_1564373 Arabidopsis thaliana At1g62200/F19K23_13 mRNA,
           complete cds.
          Length = 590

 Score =  157 bits (396), Expect = 2e-37
 Identities = 82/183 (44%), Positives = 106/183 (57%), Gaps = 1/183 (0%)
 Frame = +2

Query: 107 LQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQS 286
           L   + DGS+D  G P  + ++G W++  FI+G E  ER AYYGI  NLI+Y T  L +S
Sbjct: 32  LSSTAEDGSIDIYGNPPSKKKTGNWKACPFILGNECCERLAYYGIAKNLITYYTSELHES 91

Query: 287 TATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS 466
             +AA +V  W GT  + PL+GA +A S+ GRY TI S S +Y +G+  LTLSA L    
Sbjct: 92  NVSAASDVMIWQGTCYITPLIGAVIADSYWGRYWTIASFSAIYFIGMALLTLSASLPVLK 151

Query: 467 SNCQDATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
                      CSP    +   FF  LYL+ L  GG KPCV +FGADQFD  DP+E   K
Sbjct: 152 PAACAGVAAALCSPATTVQYAVFFTGLYLIALGTGGIKPCVSSFGADQFDDTDPRERVRK 211

Query: 644 SSF 652
           +SF
Sbjct: 212 ASF 214



>pir|E84798|E84798 probable peptide/amino acid transporter
           [imported] - Arabidopsis thaliana>gb:AC007661_1536102
           Arabidopsis thaliana chromosome II section 205 of 255 of
           the complete sequence. Sequence from clones F13M22,
           T8P21, F16M14.
          Length = 575

 Score =  157 bits (396), Expect = 2e-37
 Identities = 74/177 (41%), Positives = 112/177 (63%)
 Frame = +2

Query: 122 VDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAA 301
           +D S+D +GR  +R+R+G WR+A FII +E +ER +Y+G+  NL+ YLT  L Q    A 
Sbjct: 23  LDSSLDSRGRVPLRARTGAWRAALFIIAIEFSERLSYFGLATNLVVYLTTILNQDLKMAI 82

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQD 481
            NVN W+G  +L+PLLG F+A ++LGRY T++ A+ +Y++GL  LT+S  +       Q+
Sbjct: 83  RNVNYWSGVTTLMPLLGGFIADAYLGRYATVLVATTIYLMGLVLLTMSWFIPGLKPCHQE 142

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                   P +   + FF ++YL+ +  GGHKP +++FGADQFD    +E K K SF
Sbjct: 143 V----CVEPRKAHEVAFFIAIYLISIGTGGHKPSLESFGADQFDDDHVEERKMKMSF 195



>pir|T45958|T45958 oligopeptide transporter-like protein -
           Arabidopsis thaliana>gb:ATF7J8_1550997 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F7J8 (ESSA
           project).
          Length = 570

 Score =  156 bits (395), Expect = 3e-37
 Identities = 75/176 (42%), Positives = 112/176 (63%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG++D   +PA ++++G W++  FI+G E  ER AYYG+  NLI+YL   +     +A++
Sbjct: 11  DGTLDIHKKPANKNKTGTWKACRFILGTECCERLAYYGMSTNLINYLEKQMNMENVSASK 70

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V+ W+GT    PL+GAF+A ++LGRY TI S  V+YI G+  LT+SA +   +  C   
Sbjct: 71  SVSNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYIAGMTLLTISASVPGLTPTC--- 127

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            + +TC     +    F +LYL+ L  GG KPCV +FGADQFD  D +E ++KSSF
Sbjct: 128 -SGETCHATAGQTAITFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKESKSSF 182



>pir|E96648|E96648 hypothetical protein F19K23.13 [imported] -
           Arabidopsis thaliana>gb:AE005173_893887 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F19K23_1677697 Sequence of BAC F19K23 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 568

 Score =  156 bits (395), Expect = 3e-37
 Identities = 81/177 (45%), Positives = 104/177 (58%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGS+D  G P  + ++G W++  FI+G E  ER AYYGI  NLI+Y T  L +S  +AA 
Sbjct: 23  DGSIDIYGNPPSKKKTGNWKACPFILGNECCERLAYYGIAKNLITYYTSELHESNVSAAS 82

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  W GT  + PL+GA +A S+ GRY TI S S +Y +G+  LTLSA L          
Sbjct: 83  DVMIWQGTCYITPLIGAVIADSYWGRYWTIASFSAIYFIGMALLTLSASLPVLKPAACAG 142

Query: 485 TNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                CSP    +   FF  LYL+ L  GG KPCV +FGADQFD  DP+E   K+SF
Sbjct: 143 VAAALCSPATTVQYAVFFTGLYLIALGTGGIKPCVSSFGADQFDDTDPRERVRKASF 199



>gb:AY289622_1594949 Vicia faba peptide transporter 1 (PTR1) mRNA,
           complete cds.
          Length = 584

 Score =  155 bits (393), Expect = 4e-37
 Identities = 83/178 (46%), Positives = 109/178 (61%), Gaps = 2/178 (1%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLIS-YLTGPLGQSTATAA 301
           DGSVD+KGRP ++  +G W++  FI+G E  ER AYYGI  NL+   L   L +   +AA
Sbjct: 27  DGSVDFKGRPVLKKNTGNWKACPFILGNECCERLAYYGIATNLVKPILLAKLHEGNVSAA 86

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQ 478
            NV  W GT  L PL+GA +A S+ GRY TI   S++Y +G+G LTLSA + + K + C 
Sbjct: 87  RNVTTWQGTCYLAPLIGAVLADSYWGRYWTIAIFSMIYFIGMGTLTLSASIPALKPAECL 146

Query: 479 DATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            A      +P Q+ +  FF  LYL+ L  GG KPCV +FGADQFD  D +E   K SF
Sbjct: 147 GAV-CPPATPAQYAV--FFIGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVKKGSF 201



>gb:AP003566_1830926 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 586

 Score =  154 bits (389), Expect = 1e-36
 Identities = 80/167 (47%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G WR+A F+I V   ER  + G+  NL+ YLTGP+G STA AA   NAW GT  +L L+G
Sbjct: 72  GGWRAARFLIAVGFLERIGFNGVQGNLVMYLTGPMGMSTAAAAAGANAWGGTVLVLTLVG 131

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL---HSKSSNCQDATNNDTCSPPQ--- 514
           A  A S LGRYR I++A VL++L LG LT+S+V+   H   ++C DA    + SPP    
Sbjct: 132 ALAADSRLGRYRAIVAAGVLHLLSLGMLTISSVMQPNHPHPASCHDAAAACSPSPPPPPS 191

Query: 515 -FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              ++FF  +LYL+ LAQG H PC +AFGADQF   DP    ++SS+
Sbjct: 192 LARLVFFHAALYLLALAQGFHNPCSEAFGADQFAASDPGARASRSSY 238



>gb:AP003235_1825915 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843004 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 537

 Score =  154 bits (389), Expect = 1e-36
 Identities = 80/167 (47%), Positives = 106/167 (63%), Gaps = 7/167 (4%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G WR+A F+I V   ER  + G+  NL+ YLTGP+G STA AA   NAW GT  +L L+G
Sbjct: 23  GGWRAARFLIAVGFLERIGFNGVQGNLVMYLTGPMGMSTAAAAAGANAWGGTVLVLTLVG 82

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL---HSKSSNCQDATNNDTCSPPQ--- 514
           A  A S LGRYR I++A VL++L LG LT+S+V+   H   ++C DA    + SPP    
Sbjct: 83  ALAADSRLGRYRAIVAAGVLHLLSLGMLTISSVMQPNHPHPASCHDAAAACSPSPPPPPS 142

Query: 515 -FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              ++FF  +LYL+ LAQG H PC +AFGADQF   DP    ++SS+
Sbjct: 143 LARLVFFHAALYLLALAQGFHNPCSEAFGADQFAASDPGARASRSSY 189



>pir|S46236|S46236 histidine transport protein - Arabidopsis
           thaliana>gb:ATLBNT1_1553564 Arabadopsis thaliana
           Landsberg NT1 mRNA.
          Length = 586

 Score =  154 bits (389), Expect = 1e-36
 Identities = 84/180 (46%), Positives = 111/180 (61%), Gaps = 4/180 (2%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD+ G P ++ ++G W++  FI+G E  ER AYYGI  NLI+YLT  L Q   +AA 
Sbjct: 27  DGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKLHQGNVSAAT 86

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT  L PL+GA +A ++ GRY TI   S +Y +G+  LTLSA + + K + C  
Sbjct: 87  NVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVPALKPAEC-- 144

Query: 482 ATNNDTC---SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
               D C   +P Q+ +  FF  LYL+ L  GG KPCV +FGADQFD  D +E   K+SF
Sbjct: 145 --IGDFCPSATPAQYAM--FFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRKASF 200



>sp|P46032|PT2B_ARATH Peptide transporter PTR2-B (Histidine
           transporting protein).>pir|C84432|C84432 histidine
           transport protein (PTR2-B) [imported] - Arabidopsis
           thaliana>gb:AC006532_1534374 Arabidopsis thaliana
           chromosome 2 clone F14H20 map CIC11A04, complete
           sequence.>gb:ATHATPT_1553051 Arabidopsis thaliana
           transport protein (PTR2-B) mRNA, complete
           cds.>gb:AY143954_1583411 Arabidopsis thaliana
           At2g02040/F14H20.11 mRNA, complete
           cds.>gb:AF372946_1792661 Arabidopsis thaliana
           At2g02040/F14H20.11 mRNA, complete cds.
          Length = 585

 Score =  154 bits (389), Expect = 1e-36
 Identities = 84/180 (46%), Positives = 111/180 (61%), Gaps = 4/180 (2%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD+ G P ++ ++G W++  FI+G E  ER AYYGI  NLI+YLT  L Q   +AA 
Sbjct: 27  DGSVDFNGNPPLKEKTGNWKACPFILGNECCERLAYYGIAGNLITYLTTKLHQGNVSAAT 86

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT  L PL+GA +A ++ GRY TI   S +Y +G+  LTLSA + + K + C  
Sbjct: 87  NVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVPALKPAEC-- 144

Query: 482 ATNNDTC---SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
               D C   +P Q+ +  FF  LYL+ L  GG KPCV +FGADQFD  D +E   K+SF
Sbjct: 145 --IGDFCPSATPAQYAM--FFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRKASF 200



>gb:AE016959_1023039 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC026815_1539706
           Oryza sativa chromosome 10 BAC OSJNBa0079L16 genomic
           sequence, complete sequence.>gb:AE017104_1752858 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           58 of 77 of the complete sequence.
          Length = 608

 Score =  153 bits (386), Expect = 3e-36
 Identities = 76/179 (42%), Positives = 110/179 (61%), Gaps = 3/179 (1%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD  G P +RS+ G W++  F++  E+ ER AYYGI  NL+ YLT  L Q T ++A 
Sbjct: 19  DGTVDLHGNPVLRSKRGGWKACGFVVVYEVFERMAYYGISSNLVLYLTTKLHQGTVSSAN 78

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT  + P+LGA++A + LGRYRT + AS++Y++G+  LTL+  + S K   C  
Sbjct: 79  NVTNWVGTIWMTPILGAYIADAHLGRYRTFMIASLIYLIGMSLLTLAVSVPSLKPPKCGA 138

Query: 482 ATNNDTCS--PPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            T +  CS      ++  FF +LY++ +  GG KP +   GADQFD   P+E + K SF
Sbjct: 139 GTADPGCSEKASSLQLGVFFLALYILAVGTGGTKPNISTIGADQFDDHHPRERRHKLSF 197



>gb:AB052786_1521245 Glycine max mRNA for putative nitrate
           transporter NRT1-3, complete cds.
          Length = 574

 Score =  148 bits (374), Expect = 7e-35
 Identities = 75/177 (42%), Positives = 106/177 (59%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+V+ KG+P +RS+SG W++  F++  E+ ER AYYGI  NLI YLT  L Q T ++A 
Sbjct: 16  DGTVNIKGKPILRSKSGGWKACSFVVVYEVFERMAYYGISSNLILYLTTKLHQGTVSSAN 75

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT  + P+LGA++A +FLGRY T + AS +Y+ G+  LTL+  L S K   C +
Sbjct: 76  NVTNWVGTIWMTPILGAYIADAFLGRYWTFVIASTVYLSGMSLLTLAVSLPSLKPPQCFE 135

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                       ++  F+ +LY + +  GG KP +   GADQFD   P+E   K SF
Sbjct: 136 KDVTKCAKASTLQLAVFYGALYTLAVGTGGTKPNISTIGADQFDDFHPKEKLHKLSF 192



>gb:AE016959_1020655 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732723
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750474 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 578

 Score =  148 bits (374), Expect = 7e-35
 Identities = 82/188 (43%), Positives = 114/188 (60%)
 Frame = +2

Query: 89  DAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLT 268
           DA++++    + DGSVD   +PA++  +G WR+ + I+GVE +E  AYYGI  NL++YLT
Sbjct: 22  DADSEY----TGDGSVDVNNQPALKRSTGNWRACFMILGVEFSENLAYYGISKNLVTYLT 77

Query: 269 GPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA 448
             L +S   AA N +AW+G   L PL GAF+A ++ G+YRT+++   +YILGL  LTL A
Sbjct: 78  KILHESKVNAARNSSAWSGACYLTPLFGAFLADTYWGKYRTVLTFLPIYILGL--LTLMA 135

Query: 449 VLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQ 628
                SS     T++D  +  Q   +  +  LYLV    GG KPC  AFGADQFD  D  
Sbjct: 136 STSLPSS----MTSSD--AGHQLHSVAVYLGLYLVAFGNGGVKPCTSAFGADQFDGGDAA 189

Query: 629 ENKAKSSF 652
           E + K SF
Sbjct: 190 ELRRKGSF 197



>gb:AP004669_1843007 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0491F11.
          Length = 662

 Score =  147 bits (372), Expect = 1e-34
 Identities = 80/167 (47%), Positives = 104/167 (62%), Gaps = 7/167 (4%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G WR+A FII V   ER  +YG+  NL+ YLTG +G S A AA   NAW GT  +L L+G
Sbjct: 25  GGWRAALFIIAVGFLERVGFYGVQGNLMMYLTGLMGMSMAAAAAADNAWGGTVMVLTLVG 84

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL---HSKSSNCQDATNNDTCSP---PQ 514
           A  A S LGRYR +++A VLY+L LG LT+S+ L   H + ++C        C P   P 
Sbjct: 85  ALAADSHLGRYRAVVAAGVLYLLSLGMLTVSSTLQPKHPRPASCNGGAT--ACLPPPSPT 142

Query: 515 FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQF-DTQDPQENKAKSSF 652
             + FF+ +LYL+ LAQG HKPC +A GADQF D  DP  N ++SS+
Sbjct: 143 SRLAFFYAALYLLALAQGFHKPCSEAIGADQFADDADPGANASRSSY 189



>gb:AP003566_1830927 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 678

 Score =  147 bits (372), Expect = 1e-34
 Identities = 80/167 (47%), Positives = 104/167 (62%), Gaps = 7/167 (4%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G WR+A FII V   ER  +YG+  NL+ YLTG +G S A AA   NAW GT  +L L+G
Sbjct: 25  GGWRAALFIIAVGFLERVGFYGVQGNLMMYLTGLMGMSMAAAAAADNAWGGTVMVLTLVG 84

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL---HSKSSNCQDATNNDTCSP---PQ 514
           A  A S LGRYR +++A VLY+L LG LT+S+ L   H + ++C        C P   P 
Sbjct: 85  ALAADSHLGRYRAVVAAGVLYLLSLGMLTVSSTLQPKHPRPASCNGGAT--ACLPPPSPT 142

Query: 515 FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQF-DTQDPQENKAKSSF 652
             + FF+ +LYL+ LAQG HKPC +A GADQF D  DP  N ++SS+
Sbjct: 143 SRLAFFYAALYLLALAQGFHKPCSEAIGADQFADDADPGANASRSSY 189



>gb:AP003566_1830923 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 521

 Score =  147 bits (372), Expect = 1e-34
 Identities = 79/177 (44%), Positives = 111/177 (62%), Gaps = 7/177 (3%)
 Frame = +2

Query: 143 KGRPAIRSRSGR---WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVN 313
           +  P+  S+SG    W +A+F++    AER  + G+  NLI YLTG LG STA AA  VN
Sbjct: 12  EAEPSTGSKSGGRGGWPAAFFLLAAVFAERVGFNGVQGNLIMYLTGQLGMSTAAAAAGVN 71

Query: 314 AWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSN--CQD-- 481
           AW GTA +LPLLGA  A S++GR R ++++ VLY+L LG LT+S+++    +   CQD  
Sbjct: 72  AWGGTAFMLPLLGALAADSWIGRPRAVVASGVLYLLSLGMLTVSSMVAPPQATMVCQDTA 131

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           A  +   + P   + F + +LYL+ L QG H+PCVQA GADQF   +P    ++SSF
Sbjct: 132 AVCSSPAAAPAGRVAFCYVALYLLALGQGFHRPCVQAMGADQFSESNPGGLASRSSF 188



>pir|T47604|T47604 oligopeptide transporter-like protein -
           Arabidopsis thaliana>gb:ATT14E10_1554460 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T14E10.
          Length = 555

 Score =  147 bits (372), Expect = 1e-34
 Identities = 72/160 (45%), Positives = 103/160 (64%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G W +A FII VE+AERFA+YG+  NLI++LT  LGQSTATAA+N+N W G + + P+LG
Sbjct: 14  GGWNAALFIIVVEIAERFAFYGLASNLITFLTNELGQSTATAAKNINTWIGVSCMFPILG 73

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
           AF+A S LGR++T++  S +Y+LG+  L LS  + ++                +     F
Sbjct: 74  AFLADSILGRFKTVLLTSFIYLLGIVMLPLSVTVVAR----------------RMREKVF 117

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           F +LY++ + +GGHKPCV  F ADQF   + +E  AK+SF
Sbjct: 118 FMALYVMAVGEGGHKPCVMTFAADQFGEANAEEKAAKTSF 157



>gb:AB006698_1509860 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCL19.
          Length = 586

 Score =  144 bits (364), Expect = 1e-33
 Identities = 73/177 (41%), Positives = 104/177 (58%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD +G    RS++GRW++  F++  E+ ER AYYGI  NL+ Y+T  L Q T  ++ 
Sbjct: 13  DGTVDLRGNRVRRSQTGRWKACSFVVVYEVFERMAYYGISSNLVIYMTTKLHQGTVKSSN 72

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT+ L P+LGA+VA +  GRY T + +S +Y+LG+  LTLS  L   K   C  
Sbjct: 73  NVTNWVGTSWLTPILGAYVADAHFGRYITFVISSAIYLLGMALLTLSVSLPGLKPPKCST 132

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           A   +       ++  FF +LY + +  GG KP +   GADQFD  DP++   K SF
Sbjct: 133 ANVENCEKASVIQLAVFFGALYTLAIGTGGTKPNISTIGADQFDEFDPKDKIHKHSF 189



>gb:BT003860_1636988 Arabidopsis thaliana clone RAFL14-90-E04
           (R20372) putative peptide/amino acid transporter protein
           (At2g02020) mRNA, complete cds.
          Length = 302

 Score =  144 bits (362), Expect = 2e-33
 Identities = 82/205 (40%), Positives = 109/205 (53%), Gaps = 6/205 (2%)
 Frame = +2

Query: 56  MAITGATMDLPDAETQFLQHD----SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAER 223
           MA       L + E   +Q +    + DGS+D  G P ++  +G W++  FI   E  ER
Sbjct: 1   MASIDEERSLLEVEESLIQEEVKLYAEDGSIDIHGNPPLKQTTGNWKACPFIFANECCER 60

Query: 224 FAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISA 403
            AYYGI  NLI+Y T  L ++  +AA +V  W GT  + PL+GA +A ++ GRY TI   
Sbjct: 61  LAYYGIAKNLITYFTNELHETNVSAARHVMTWQGTCYITPLIGALIADAYWGRYWTIACF 120

Query: 404 SVLYILGLGFLTLSA-VLHSKSSNCQDATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHK 577
           S +Y  G+  LTLSA V   K + C        C P    +    F  LYL+ L  GG K
Sbjct: 121 SAIYFTGMVALTLSASVPGLKPAEC----IGSLCPPATMVQSTVLFSGLYLIALGTGGIK 176

Query: 578 PCVQAFGADQFDTQDPQENKAKSSF 652
           PCV +FGADQFD  DP E   K+SF
Sbjct: 177 PCVSSFGADQFDKTDPSERVRKASF 201



>pir|A84432|A84432 probable peptide/amino acid transporter
           [imported] - Arabidopsis thaliana>gb:AC006532_1534372
           Arabidopsis thaliana chromosome 2 clone F14H20 map
           CIC11A04, complete sequence.
          Length = 545

 Score =  144 bits (362), Expect = 2e-33
 Identities = 82/205 (40%), Positives = 109/205 (53%), Gaps = 6/205 (2%)
 Frame = +2

Query: 56  MAITGATMDLPDAETQFLQHD----SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAER 223
           MA       L + E   +Q +    + DGS+D  G P ++  +G W++  FI   E  ER
Sbjct: 1   MASIDEERSLLEVEESLIQEEVKLYAEDGSIDIHGNPPLKQTTGNWKACPFIFANECCER 60

Query: 224 FAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISA 403
            AYYGI  NLI+Y T  L ++  +AA +V  W GT  + PL+GA +A ++ GRY TI   
Sbjct: 61  LAYYGIAKNLITYFTNELHETNVSAARHVMTWQGTCYITPLIGALIADAYWGRYWTIACF 120

Query: 404 SVLYILGLGFLTLSA-VLHSKSSNCQDATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHK 577
           S +Y  G+  LTLSA V   K + C        C P    +    F  LYL+ L  GG K
Sbjct: 121 SAIYFTGMVALTLSASVPGLKPAEC----IGSLCPPATMVQSTVLFSGLYLIALGTGGIK 176

Query: 578 PCVQAFGADQFDTQDPQENKAKSSF 652
           PCV +FGADQFD  DP E   K+SF
Sbjct: 177 PCVSSFGADQFDKTDPSERVRKASF 201



>pir|G86449|G86449 F5D14.23 protein - Arabidopsis
           thaliana>gb:AE005172_892084 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F5D14_1678323 Sequence of BAC F5D14 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 606

 Score =  143 bits (361), Expect = 2e-33
 Identities = 72/182 (39%), Positives = 113/182 (62%), Gaps = 1/182 (0%)
 Frame = +2

Query: 110 QHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQST 289
           + ++ DG+VDY GRP+IRS SG+W +   I+  +     A++G+G+NL+ +LT  L Q+ 
Sbjct: 10  EEETRDGTVDYYGRPSIRSNSGQWVAGIVILLNQGLATLAFFGVGVNLVLFLTRVLQQNN 69

Query: 290 ATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLH-SKS 466
           A AA NV+ WTGT  +  L+GAF++ S+ GRY+T     V++++GL  L+LS+ +   + 
Sbjct: 70  ADAANNVSKWTGTVYIFSLVGAFLSDSYWGRYKTCAIFQVIFVIGLSSLSLSSYMFLIRP 129

Query: 467 SNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKS 646
             C D       S    EI  F+FS+YL+ L  GG++P +   GADQFD + P+E  +K 
Sbjct: 130 RGCGDEV-TPCGSHSMMEITMFYFSIYLIALGYGGYQPNIATLGADQFDEEHPKEGYSKI 188

Query: 647 SF 652
           +F
Sbjct: 189 AF 190



>gb:AE016959_1023035 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC026815_1539702
           Oryza sativa chromosome 10 BAC OSJNBa0079L16 genomic
           sequence, complete sequence.>gb:AE017103_1752854 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           57 of 77 of the complete sequence.
          Length = 607

 Score =  142 bits (358), Expect = 5e-33
 Identities = 74/177 (41%), Positives = 101/177 (57%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD +G P +RS+ G W++  FI+  E+ ER AYYGI  NL+ YLT  L Q T  AA 
Sbjct: 15  DGSVDLRGNPVLRSKRGGWKACSFIVVYELFERMAYYGIASNLVIYLTEKLHQGTVEAAN 74

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NV  W+GT  + PL+GA VA ++LGRY T ++ S +Y++G+  LTL+  + +      D 
Sbjct: 75  NVTNWSGTVFITPLIGAVVADAWLGRYWTFVAGSAVYLMGMLLLTLAVSVPALKPPPCDG 134

Query: 485 TNNDTC-SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                C      ++  +F  LY + L  GG KP +   GADQFD   P E   K SF
Sbjct: 135 GGGAACPRASALQLGVYFGGLYTIALGHGGTKPNISTIGADQFDDFHPPEKLHKLSF 191



>gb:AK118142_1816136 Arabidopsis thaliana At4g21680 mRNA for
           putative peptide transporter, complete cds, clone:
           RAFL19-44-G15.
          Length = 589

 Score =  140 bits (354), Expect = 1e-32
 Identities = 72/178 (40%), Positives = 107/178 (60%), Gaps = 2/178 (1%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD  G PAIR+ +G+W +A  I+  +     A++G+G+NL+ +LT  +GQ  A AA 
Sbjct: 14  DGSVDRHGNPAIRANTGKWLTAILILVNQGLATLAFFGVGVNLVLFLTRVMGQDNAEAAN 73

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLS-AVLHSKSSNCQD 481
           NV+ WTGT  +  LLGAF++ S+ GRY+T       ++ GL  L+LS   L  + S C  
Sbjct: 74  NVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLMMLSLSTGALLLEPSGC-- 131

Query: 482 ATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              +  C P   F+ + F+ S+YL+ L  GG++P +  FGADQFD +D  E  +K +F
Sbjct: 132 GVEDSPCKPHSTFKTVLFYLSVYLIALGYGGYQPNIATFGADQFDAEDSVEGHSKIAF 189



>gb:AY064057_1565995 Arabidopsis thaliana putative peptide
           transporter protein (At5g46050) mRNA, complete cds.
          Length = 582

 Score =  140 bits (354), Expect = 1e-32
 Identities = 74/178 (41%), Positives = 101/178 (56%), Gaps = 2/178 (1%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD +G P  RS  GRW++  F++  E+ ER AYYGI  NL  Y+T  L Q T  ++ 
Sbjct: 13  DGTVDLQGNPVRRSIRGRWKACSFVVVYEVFERMAYYGISSNLFIYMTTKLHQGTVKSSN 72

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT+ L P+LGA+V  + LGRY T + +  +Y  G+  LTLS  +   K   C  
Sbjct: 73  NVTNWVGTSWLTPILGAYVGDALLGRYITFVISCAIYFSGMMVLTLSVTIPGIKPPEC-S 131

Query: 482 ATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            TN + C      ++  FF +LY + +  GG KP +   GADQFD  DP+E   K SF
Sbjct: 132 TTNVENCEKASVLQLAVFFGALYTLAIGTGGTKPNISTIGADQFDVFDPKEKTQKLSF 189



>gb:AB006698_1509861 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCL19.>gb:AY150511_1585076 Arabidopsis thaliana
           peptide transporter (At5g46050) mRNA, complete cds.
          Length = 582

 Score =  140 bits (354), Expect = 1e-32
 Identities = 74/178 (41%), Positives = 101/178 (56%), Gaps = 2/178 (1%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD +G P  RS  GRW++  F++  E+ ER AYYGI  NL  Y+T  L Q T  ++ 
Sbjct: 13  DGTVDLQGNPVRRSIRGRWKACSFVVVYEVFERMAYYGISSNLFIYMTTKLHQGTVKSSN 72

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
           NV  W GT+ L P+LGA+V  + LGRY T + +  +Y  G+  LTLS  +   K   C  
Sbjct: 73  NVTNWVGTSWLTPILGAYVGDALLGRYITFVISCAIYFSGMMVLTLSVTIPGIKPPEC-S 131

Query: 482 ATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            TN + C      ++  FF +LY + +  GG KP +   GADQFD  DP+E   K SF
Sbjct: 132 TTNVENCEKASVLQLAVFFGALYTLAIGTGGTKPNISTIGADQFDVFDPKEKTQKLSF 189



>gb:AP004096_1837679 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1743_B12.
          Length = 610

 Score =  138 bits (348), Expect = 7e-32
 Identities = 71/180 (39%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           ++DGSVD KG PA++ +SG W +   I+  +     A++G+ +NL+ +LT  L QS   A
Sbjct: 32  TLDGSVDIKGSPAVKGKSGGWLAGGLILLNQGLATLAFFGVNVNLVLFLTRVLQQSNGDA 91

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLH-SKSSNC 475
           A NV+ WTGT  +  L+GAF++ S+ GRY+T      +++LGL  L+LS+ L+  +   C
Sbjct: 92  ANNVSKWTGTVYMFSLIGAFLSDSYWGRYKTCAIFQAIFVLGLALLSLSSRLYLIRPVGC 151

Query: 476 QDATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              T +  C P    E+  F+ +LY++    GG++P V  FGADQFD +DP E+ +K SF
Sbjct: 152 --GTEHVPCEPHSGAELGIFYIALYMIAFGNGGYQPNVATFGADQFDGEDPAESHSKVSF 209



>gb:AP003621_1831571 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003761_1833088 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0018H04.
          Length = 571

 Score =  138 bits (347), Expect = 9e-32
 Identities = 69/178 (38%), Positives = 101/178 (56%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           + DGS+D  G PA++ R+G WR+   I+G E  +  AY+G+ +NL++YLT  L QS   A
Sbjct: 25  TTDGSLDIDGNPALKHRTGGWRACRSILGTEFCQCLAYFGMTINLVTYLTTELHQSNVAA 84

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQ 478
           A+NV+ W  T  L PL GA VA S+ G+Y T++    + + GL   +LSA+L     N  
Sbjct: 85  AKNVSTWQATCFLTPLAGAIVADSYWGKYHTMVVGCCIGVAGLLMASLSALLPLLIKNI- 143

Query: 479 DATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                 T +    +    F  LY++    GG +PC+ +FGADQFD  DP E  +K S+
Sbjct: 144 -----STLAMASAQEFVLFLGLYMIAFGVGGLRPCLMSFGADQFDAGDPSERNSKGSY 196



>gb:AC093018_1735829 Oryza sativa chromosome 3 BAC OSJNBb0081B07
           genomic sequence, complete sequence.
          Length = 585

 Score =  137 bits (346), Expect = 1e-31
 Identities = 69/176 (39%), Positives = 107/176 (60%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           D SVDY+GRP +R+ +G W++A FII +E +ER +Y+G+  +L+ YLT  L +    AA+
Sbjct: 24  DSSVDYQGRPPLRAATGSWKAAMFIILIEFSERLSYFGLATSLMIYLTKVLQEEMKFAAK 83

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NVN WT   +L+PL+G F+A  +LGR+ T++ ++++Y+ GL  L +S +    S   +  
Sbjct: 84  NVNYWTSVTTLMPLVGGFLADGYLGRFSTVLFSTLIYLSGLILLAISQL----SPRLKPE 139

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            N             FF ++YLV +  GGHKP +++FGADQFD     E   K S+
Sbjct: 140 RN------LHLHETLFFVAIYLVSVGTGGHKPALESFGADQFDDGHAAERVQKMSY 189



>gb:AY587265_1616475 Triticum aestivum low affinity nitrate
           transporter NRT1.1 mRNA, complete cds.
          Length = 586

 Score =  137 bits (346), Expect = 1e-31
 Identities = 78/176 (44%), Positives = 101/176 (57%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSV   G PA R  +G W++++ II        AY  IG NL+SYLT  L ++   AA 
Sbjct: 29  DGSVCISGHPASRKHTGNWKASFLIIVCSFCCYLAYSSIGKNLVSYLTKVLHETNLDAAR 88

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  W GT+ L PL+GAFVA S+LG+YRT + A  ++I+G+  L LSA L   S+     
Sbjct: 89  HVATWQGTSYLAPLVGAFVADSYLGKYRTALIACKIFIIGMMMLLLSAALQLISAGPHAW 148

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           T        Q+ I  F   LY+VGL  G  +PCV +FGADQFD  D  E   KSSF
Sbjct: 149 TVWVHLVSSQYTI--FLIGLYMVGLGYGAQRPCVTSFGADQFDDTDYVEKTRKSSF 202



>gb:AE016959_1020652 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732720
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750471 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 591

 Score =  137 bits (346), Expect = 1e-31
 Identities = 72/180 (40%), Positives = 99/180 (55%), Gaps = 4/180 (2%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+VD   RPA++  +G WR+ +FI+G E  +   +  +  NL+ YLT  L +S   AA 
Sbjct: 38  DGTVDIDRRPALKHSTGNWRACFFILGAEFTQCLCFSAVVKNLVRYLTSVLQESNVNAAR 97

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA----VLHSKSSN 472
           +V+ W GT    PL+GAF+A +F GRYRTI+    +Y +G+  LT SA    +LH   +N
Sbjct: 98  SVSTWIGTCFFTPLIGAFLADTFWGRYRTIVICLSVYSIGMLILTTSASLPFLLHDSYNN 157

Query: 473 CQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             D              +  +  LYL+ L  GG KPC+ A GADQFD  DP E   K SF
Sbjct: 158 GDDIRR-----------VVAYLGLYLIALGAGGIKPCMSALGADQFDGADPVERVTKGSF 206



>gb:AE016959_1020642 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068654_1540428
           Genomic Sequence For Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare Clone OSJNBa0015O22
           From Chromosome 10, complete
           sequence.>gb:AE017049_1750461 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 601

 Score =  137 bits (345), Expect = 2e-31
 Identities = 73/176 (41%), Positives = 95/176 (53%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +GSVD KG PA ++ +G+W++ Y I+G E     AYY +G NL+SYLT   GQS  TAA 
Sbjct: 58  NGSVDVKGNPASKTHTGKWKACYSILGGEFCGALAYYAVGTNLVSYLTKVQGQSNVTAAS 117

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           N+ AW G   L  +LGAF+A S+ GR+RTI+ +   +  G+  LTLSAV+          
Sbjct: 118 NIAAWQGNCYLTTILGAFLADSYWGRHRTIVVSLTTFTFGMVLLTLSAVVPPNMHRSMAT 177

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              +  S            LY+  L  GG  PCV  FGADQFD  D  E   K  F
Sbjct: 178 FPQEALSS---------LGLYMTALGLGGIWPCVPTFGADQFDDTDVSEKAQKELF 224



>gb:BNU17987_1633659 Brassica napus RCH2 protein mRNA, complete cds.
          Length = 589

 Score =  135 bits (341), Expect = 5e-31
 Identities = 74/193 (38%), Positives = 108/193 (55%), Gaps = 1/193 (0%)
 Frame = +2

Query: 77  MDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLI 256
           M LP+ +TQ L       + D++GRPA RS++G W SA  I+ +E  ER    GIG+NL+
Sbjct: 1   MSLPETKTQTLLD-----AWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLV 55

Query: 257 SYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFL 436
           +YLTG +    ATAA  V  + GT+ +L LLG F+A +FLGRY TI   + +   G+  L
Sbjct: 56  TYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSIL 115

Query: 437 TLSAVLHS-KSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFD 613
           TLS ++   +   C   T++        ++   + +LYL  L  GG K  V  FG+DQFD
Sbjct: 116 TLSTIIPGLRPPRCDPTTSSHCVQANGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD 175

Query: 614 TQDPQENKAKSSF 652
             +P+E    + F
Sbjct: 176 DTEPKERSQMTYF 188



>gb:AP003621_1831570 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003761_1833087 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0018H04.
          Length = 569

 Score =  135 bits (340), Expect = 6e-31
 Identities = 74/178 (41%), Positives = 102/178 (57%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           + DGS+D  G PA++ R+G WR+   I+G E     AYYGI  NL++YLT  L QS   A
Sbjct: 23  TTDGSLDIDGNPALKHRTGGWRACRSILGTEFCYCLAYYGIMYNLVTYLTTVLHQSNVAA 82

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQ 478
           A+NV+ W  T  L PL GA VA S+ GRYRT++    + + G+   +LSA+L        
Sbjct: 83  AKNVSTWQATCFLTPLAGAVVADSYWGRYRTMVVGCCVAVAGMLMASLSALLPQLI---- 138

Query: 479 DATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                ++ S    EII  F  LY++    GG +PC+ +FGADQFD  DP E  +K S+
Sbjct: 139 -----ESSSTLSMEII-LFLGLYMIAFGVGGLRPCLISFGADQFDAGDPSELISKGSY 190



>gb:NPL277085_1691079 Nicotiana plumbaginifolia mRNA for putative
           low-affinity nitrate transporter (nrt1.2 gene).
          Length = 594

 Score =  134 bits (338), Expect = 1e-30
 Identities = 70/166 (42%), Positives = 98/166 (59%), Gaps = 1/166 (0%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           DYKGRPA+RS SG W S   I+GVE  ER    GI +NL++YLTG +    ATAA NV  
Sbjct: 18  DYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTN 77

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L LLG FVA +FLGRY TI   + +  +G+  LT+S ++ S +   C+   ++
Sbjct: 78  FLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSS 137

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
                   +++  + +LY+  L  GG K  V  FG DQFD  D +E
Sbjct: 138 SCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFDDGDKKE 183



>gb:NPL277084_1691078 Nicotiana plumbaginifolia mRNA for putative
           low-affinity nitrate transporter (nrt1.1 gene).
          Length = 590

 Score =  134 bits (337), Expect = 1e-30
 Identities = 71/167 (42%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           DYKGRPA+RS SG W SA  I+G+E  ER    GI +NL++YLTG +    A++A NV  
Sbjct: 18  DYKGRPAVRSSSGGWSSAAMILGIEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTN 77

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L LLG FVA +FLGRY TI   + +  +G+  LT+S ++ S +   C  +  +
Sbjct: 78  FLGTSFMLTLLGGFVADTFLGRYLTIGIFTTIQAMGVTILTISTIIPSLRPPKC--SPGS 135

Query: 494 DTCSPPQF-EIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
            TC P    +++  + +LY+  L  GG K  V  FG+DQFD  D +E
Sbjct: 136 STCIPASSKQLMVLYIALYMTALGTGGLKSSVSGFGSDQFDETDKKE 182



>gb:AB102806_1526337 Nicotiana tabacum NtNRT1.1-t mRNA for nitrate
           transporter, complete cds.
          Length = 590

 Score =  134 bits (337), Expect = 1e-30
 Identities = 71/167 (42%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           DYKGRPA+RS SG W SA  I+G+E  ER    GI +NL++YLTG +    A++A NV  
Sbjct: 18  DYKGRPAVRSSSGGWSSAAMILGIEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTN 77

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L LLG FVA +FLGRY TI   + +  +G+  LT+S ++ S +   C  +  +
Sbjct: 78  FLGTSFMLTLLGGFVADTFLGRYLTIGIFTTIQAMGVTILTISTIIPSLRPPKC--SPGS 135

Query: 494 DTCSPPQF-EIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
            TC P    +++  + +LY+  L  GG K  V  FG+DQFD  D +E
Sbjct: 136 STCIPASSKQLMVLYIALYMTALGTGGLKSSVSGFGSDQFDETDKKE 182



>gb:AB102805_1526336 Nicotiana tabacum NtNRT1.1-s mRNA for nitrate
           transporter, complete cds.
          Length = 590

 Score =  134 bits (337), Expect = 1e-30
 Identities = 71/167 (42%), Positives = 102/167 (61%), Gaps = 2/167 (1%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           DYKGRPA+RS SG W SA  I+G+E  ER    GI +NL++YLTG +    A++A NV  
Sbjct: 18  DYKGRPAVRSSSGGWSSAAMILGIEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTN 77

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L LLG FVA +FLGRY TI   + +  +G+  LT+S ++ S +   C  +  +
Sbjct: 78  FLGTSFMLTLLGGFVADTFLGRYLTIGIFTTIQAMGVTILTISTIIPSLRPPKC--SPGS 135

Query: 494 DTCSPPQF-EIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
            TC P    +++  + +LY+  L  GG K  V  FG+DQFD  D +E
Sbjct: 136 STCIPASSKQLMVLYIALYMTALGTGGLKSSVSGFGSDQFDETDKKE 182



>gb:AE016959_1020935 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091665_1734851
           Oryza sativa chromosome 10 clone OSJNBb0016M10, complete
           sequence.>gb:AE017056_1750754 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 10 of 77 of the
           complete sequence.
          Length = 553

 Score =  134 bits (337), Expect = 1e-30
 Identities = 72/153 (47%), Positives = 95/153 (62%), Gaps = 1/153 (0%)
 Frame = +2

Query: 164 SRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLP 343
           +R G WR+A+F++ V   ER  ++G+  NL+ YLTGP+  STA AA   NAW GT  +L 
Sbjct: 25  ARRGGWRAAFFLVVVGFLERIGFFGVQGNLMLYLTGPMAMSTAAAATAANAWGGTVLVLT 84

Query: 344 LLGAFVA-GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFE 520
           L G   A  S LGRYR +I AS LY+L LG LT S    S S   Q AT+  + S     
Sbjct: 85  LAGGLAADSSGLGRYRAVIVASALYLLSLGMLTAS----SSSMAAQRATSPPSSSAGGAV 140

Query: 521 IIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQ 619
           ++ F+ +LYL+ LAQG H PC +AFGADQF+ +
Sbjct: 141 VVVFYAALYLLALAQGFHTPCAEAFGADQFERE 173



>gb:BNA278966_1633311 Brassica napus mRNA for nitrate transporter
           (nrt1 gene).
          Length = 588

 Score =  134 bits (336), Expect = 2e-30
 Identities = 73/192 (38%), Positives = 107/192 (55%)
 Frame = +2

Query: 77  MDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLI 256
           M LP+ ++Q L       + D++GRPA RS++G W SA  I+ +E  ER    GIG+NL+
Sbjct: 1   MSLPETKSQTLLD-----AWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLV 55

Query: 257 SYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFL 436
           +YLTG +    ATAA  V  + GT+ +L LLG F+A +FLGRY TI   + +   G+  L
Sbjct: 56  TYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIAHTFLGRYLTIAIFAAIQATGVSIL 115

Query: 437 TLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDT 616
           TLS ++          T++    P   ++   + +LYL  L  GG K  V  FG+DQFD 
Sbjct: 116 TLSTIIPGFQPPRCPTTSSHCVQPSGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFDE 175

Query: 617 QDPQENKAKSSF 652
            +P+E    + F
Sbjct: 176 TEPKEQSQMTYF 187



>gb:AB102807_1526338 Nicotiana tabacum NtNRT1.2-s mRNA for nitrate
           transporter, complete cds.
          Length = 594

 Score =  133 bits (335), Expect = 2e-30
 Identities = 69/166 (41%), Positives = 97/166 (58%), Gaps = 1/166 (0%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           DYKGRPA+RS SG W S   I+GVE  ER    GI +NL++YLTG +    ATAA NV  
Sbjct: 18  DYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANNVTN 77

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L L G FVA +FLGRY TI   + +  +G+  LT+S ++ S +   C+   ++
Sbjct: 78  FLGTSFMLTLFGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSS 137

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
                   +++  + +LY+  L  GG K  V  FG DQFD  D +E
Sbjct: 138 SCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFDDADKKE 183



>gb:AB102808_1526339 Nicotiana tabacum NtNRT1.2-t mRNA for nitrate
           transporter, complete cds.
          Length = 594

 Score =  132 bits (333), Expect = 4e-30
 Identities = 68/166 (40%), Positives = 98/166 (59%), Gaps = 1/166 (0%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           DYKGRPA+RS SG W S   I+GVE  ER    GI +NL++YLTG +    A++A NV  
Sbjct: 18  DYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNASSANNVTN 77

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L LLG FVA +FLGRY TI   + +  +G+  LT+S ++ S +   C+   ++
Sbjct: 78  FLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQVGSS 137

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
                   +++  + +LY+  L  GG K  V  FG DQFD  D +E
Sbjct: 138 SCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFDDSDKKE 183



>sp|Q05085|CHL1_ARATH Nitrate/chlorate
           transporter.>pir|A45772|A45772 nitrate-inducible nitrate
           transporter - Arabidopsis thaliana>gb:ATHCHL1A_1553107
           Arabidopsis thaliana chlorate/nitrate transporter (CHL1)
           mRNA, complete cds.>gb:BT002016_1635619 Arabidopsis
           thaliana putative NPK1-related protein kinase 2
           (At1g12110) mRNA, complete cds.>gb:BT008783_1639979
           Arabidopsis thaliana At1g12110 gene, complete
           cds.>gb:F12F1_1677332 Arabidopsis thaliana chromosome 1
           BAC F12F1 sequence, complete sequence.
          Length = 590

 Score =  132 bits (332), Expect = 5e-30
 Identities = 72/193 (37%), Positives = 108/193 (55%), Gaps = 1/193 (0%)
 Frame = +2

Query: 77  MDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLI 256
           M LP+ ++  +  D+ D    ++GRPA RS++G W SA  I+ +E  ER    GIG+NL+
Sbjct: 1   MSLPETKSDDILLDAWD----FQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLV 56

Query: 257 SYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFL 436
           +YLTG +    ATAA  V  + GT+ +L LLG F+A +FLGRY TI   + +   G+  L
Sbjct: 57  TYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSIL 116

Query: 437 TLSAVLHS-KSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFD 613
           TLS ++   +   C   T++        ++   + +LYL  L  GG K  V  FG+DQFD
Sbjct: 117 TLSTIIPGLRPPRCNPTTSSHCEQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD 176

Query: 614 TQDPQENKAKSSF 652
             +P+E    + F
Sbjct: 177 ETEPKERSKMTYF 189



>gb:AY587264_1616474 Triticum aestivum low affinity nitrate
           transporter NRT1.2 mRNA, complete cds.
          Length = 586

 Score =  131 bits (329), Expect = 1e-29
 Identities = 75/176 (42%), Positives = 96/176 (54%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSV   G PA R  +G W+ +   I        AY  IG NL+SYLT  L ++   AA 
Sbjct: 29  DGSVCTSGHPASRKHTGNWKVSSLTIVCSFCCYLAYSSIGKNLVSYLTKVLDETNLDAAR 88

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  W GT+ L PL+GAFVA S+LG+YRT + +  ++I+G+  L LSA L   S+     
Sbjct: 89  HVATWQGTSYLAPLVGAFVADSYLGKYRTALISCTIFIMGMMMLLLSAALPLISAGPHAW 148

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           T      P     I F   LY+VGL  G   PCV +FGADQFD  +  E   KSSF
Sbjct: 149 TL--WADPISSRYIIFLVGLYMVGLGYGAQCPCVTSFGADQFDDTNEMEKTRKSSF 202



>gb:AF000392_1760498 Lotus japonicus peptide transporter (LjNOD65)
           mRNA, complete cds.
          Length = 574

 Score =  130 bits (328), Expect = 1e-29
 Identities = 62/178 (34%), Positives = 107/178 (60%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           ++DG+VD  GRP + S +G+ ++  +I+   + ERFAYYG+G NL++++T  L +   ++
Sbjct: 7   TLDGTVDLAGRPVLSSLTGKQKACTYILVYRVLERFAYYGVGANLVNFMTTQLNKDVVSS 66

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQ 478
             + N W+G A+L P+LGA++A ++ GR+ TI  + ++Y +GL  L L+  L S    C+
Sbjct: 67  ITSFNNWSGLATLTPILGAYIADTYTGRFWTITFSLLIYAIGLVLLVLTTTLKSLRPACE 126

Query: 479 DATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           +    +  +    ++  F+ SLY + +  G  KP +  FGADQFD    +E + K SF
Sbjct: 127 NGICREASN---LQVALFYTSLYTIAVGSGAVKPNMSTFGADQFDDFRHEEKEQKVSF 181



>gb:AB128925_1528356 Prunus persica PpNRT1 gene for nitrate
           transporter, partial cds.
          Length = 594

 Score =  130 bits (327), Expect = 2e-29
 Identities = 69/173 (39%), Positives = 99/173 (57%), Gaps = 1/173 (0%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           D+KGRPA RS++G W +A  I+G E  ER    GI +NL++YLTG +    AT+A  V  
Sbjct: 20  DFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTN 79

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L LLG FVA +FLGRY TI   +    +G+  LT+S  + S +   C   T+ 
Sbjct: 80  FLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTISTTIPSLRPPKCTSDTST 139

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                   +++  + +LYL  L  GG K  V  FG+DQFD  D QE +  ++F
Sbjct: 140 PCIPASGKQLMVLYIALYLTALGTGGLKSSVSGFGSDQFDESDKQERRQMTNF 192



>gb:AB089677_1524914 Prunus persica PpNRT1 mRNA for nitrate
           transporter, complete cds.
          Length = 596

 Score =  130 bits (327), Expect = 2e-29
 Identities = 69/173 (39%), Positives = 99/173 (57%), Gaps = 1/173 (0%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           D+KGRPA RS++G W +A  I+G E  ER    GI +NL++YLTG +    AT+A  V  
Sbjct: 20  DFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLTGTMHLGNATSANTVTN 79

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNN 493
           + GT+ +L LLG FVA +FLGRY TI   +    +G+  LT+S  + S +   C   T+ 
Sbjct: 80  FLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTISTTIPSLRPPKCTSDTST 139

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                   +++  + +LYL  L  GG K  V  FG+DQFD  D QE +  ++F
Sbjct: 140 PCIPASGKQLMVLYIALYLTALGTGGLKSSVSGFGSDQFDESDKQERRQMTNF 192



>gb:AE016959_1020657 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732725
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750476 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 576

 Score =  130 bits (326), Expect = 3e-29
 Identities = 68/176 (38%), Positives = 100/176 (56%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD    PA++  +G WR+ + I+GVE  E   Y+ I  NL+++LT  L +S   AA 
Sbjct: 25  DGSVDINKEPALKHSTGNWRACFLILGVEFCENMTYFVISRNLVTFLTTVLHESKVDAAR 84

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           NV+AW G   L P++GAF+A ++ GRY TI+    +YI G+  +T+SA L    ++ +  
Sbjct: 85  NVSAWVGACFLTPVVGAFLADTYWGRYWTIVVFLPVYITGMLIVTVSASLPMFLTSSEHG 144

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             + +           +  LYL  L  G  KPC  +FGADQFD+ D +E   K+SF
Sbjct: 145 NVHRS---------VVYLGLYLAALGSGAMKPCTSSFGADQFDSTDLEELPKKASF 191



>pir|T05843|T05843 peptide transport protein homolog F17L22.140 -
           Arabidopsis thaliana>gb:ATCHRIV55_1546005 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           55.>gb:ATF17L22_1548990 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17L22 (ESSAII project).
          Length = 576

 Score =  129 bits (324), Expect = 4e-29
 Identities = 71/178 (39%), Positives = 101/178 (56%), Gaps = 2/178 (1%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSVD  G PAIR+ +G+W +A  I+GV             NL+ +LT  +GQ  A AA 
Sbjct: 14  DGSVDRHGNPAIRANTGKWLTAILILGV-------------NLVLFLTRVMGQDNAEAAN 60

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLS-AVLHSKSSNCQD 481
           NV+ WTGT  +  LLGAF++ S+ GRY+T       ++ GL  L+LS   L  + S C  
Sbjct: 61  NVSKWTGTVYIFSLLGAFLSDSYWGRYKTCAIFQASFVAGLMMLSLSTGALLLEPSGC-- 118

Query: 482 ATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              +  C P   F+ + F+ S+YL+ L  GG++P +  FGADQFD +D  E  +K +F
Sbjct: 119 GVEDSPCKPHSTFKTVLFYLSVYLIALGYGGYQPNIATFGADQFDAEDSVEGHSKIAF 176



>gb:AP004047_1836888 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1191_G08.>gb:AP004098_1837706 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ2056_H01.
          Length = 584

 Score =  129 bits (323), Expect = 6e-29
 Identities = 62/177 (35%), Positives = 106/177 (59%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGS+D +G PA+++++G WRS+  ++        A++G+G+NL+ +L   L Q  A AA 
Sbjct: 17  DGSMDRRGNPAVKAKTGNWRSSILLLVNYGLVTCAFFGVGVNLVVFLRRVLHQDNAEAAN 76

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA-VLHSKSSNCQD 481
           +++ WTGT  +  L+GAF++ S+ GRY T     ++Y+ GL  L+L++  L  K + C  
Sbjct: 77  SISKWTGTVYIFSLIGAFMSDSYWGRYITCAIFQMIYVTGLVILSLASWFLLVKPTGC-G 135

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           A      +P    +  F+ S Y++    GG++P +  FG+DQFD  DP+E ++K +F
Sbjct: 136 AAGEHCDAPSSAGVALFYLSTYMIAFGNGGYQPSIATFGSDQFDETDPREARSKVAF 192



>gb:AF140606_1771555 Oryza sativa nitrate transporter (NRT1) mRNA,
           complete cds.
          Length = 584

 Score =  129 bits (323), Expect = 6e-29
 Identities = 71/176 (40%), Positives = 97/176 (55%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DGSV  +G PA+R  +G W+ +   I        A+  I  NL+SYLT  L ++   AA 
Sbjct: 27  DGSVCIRGHPALRKHTGNWKGSSLAIVFSFCSYLAFTSIVKNLVSYLTKVLHETNVAAAR 86

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  W+GT+ L PL+GAF+A S+LG+Y TI+    ++I+GL  L LSA +   S+     
Sbjct: 87  DVATWSGTSYLAPLVGAFLADSYLGKYCTILIFCTIFIIGLMMLLLSAAVPLISTGPHSW 146

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                  P   + I FF  LY+V L  G   PC+ +FGADQFD  D  E   KSSF
Sbjct: 147 I--IWTDPVSSQNIIFFVGLYMVALGYGAQCPCISSFGADQFDDTDENERTKKSSF 200



>gb:AY099800_1576825 Arabidopsis thaliana putative nitrate
           transporter (At2g26690) mRNA, complete cds.
          Length = 577

 Score =  129 bits (323), Expect = 6e-29
 Identities = 73/180 (40%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           +V  +VDYKGRPA +S++G W +A  I+G+E+ ER +  GI +NL++YL   +   ++T+
Sbjct: 8   TVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTS 67

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNC 475
           A  V  + GT+ LL LLG F+A SFLGR++TI   S +  LG G L ++  L   +   C
Sbjct: 68  ANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLPELRPPTC 127

Query: 476 QDATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
               + + C P   F++   + SLYL+ L  GG K  +  FG+DQFD +DP+E KA  +F
Sbjct: 128 H---HGEACIPATAFQMTILYVSLYLIALGTGGLKSSISGFGSDQFDDKDPKE-KAHMAF 183



>pir|T52608|T52608 probable nitrate transporter [imported] -
           Arabidopsis thaliana>gb:ATH011604_1551926 Arabidopsis
           thaliana mRNA for nitrate transporter.
          Length = 577

 Score =  129 bits (323), Expect = 6e-29
 Identities = 73/180 (40%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           +V  +VDYKGRPA +S++G W +A  I+G+E+ ER +  GI +NL++YL   +   ++T+
Sbjct: 8   TVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTS 67

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNC 475
           A  V  + GT+ LL LLG F+A SFLGR++TI   S +  LG G L ++  L   +   C
Sbjct: 68  ANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLPELRPPTC 127

Query: 476 QDATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
               + + C P   F++   + SLYL+ L  GG K  +  FG+DQFD +DP+E KA  +F
Sbjct: 128 H---HGEACIPATAFQMTILYVSLYLIALGTGGLKSSISGFGSDQFDDKDPKE-KAHMAF 183



>pir|F84663|F84663 probable nitrate transporter [imported] -
           Arabidopsis thaliana>gb:AC003105_1531086 Arabidopsis
           thaliana chromosome 2 clone F18A8 map B68, complete
           sequence.
          Length = 586

 Score =  129 bits (323), Expect = 6e-29
 Identities = 73/180 (40%), Positives = 110/180 (61%), Gaps = 2/180 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           +V  +VDYKGRPA +S++G W +A  I+G+E+ ER +  GI +NL++YL   +   ++T+
Sbjct: 17  TVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTS 76

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNC 475
           A  V  + GT+ LL LLG F+A SFLGR++TI   S +  LG G L ++  L   +   C
Sbjct: 77  ANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLPELRPPTC 136

Query: 476 QDATNNDTCSP-PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
               + + C P   F++   + SLYL+ L  GG K  +  FG+DQFD +DP+E KA  +F
Sbjct: 137 H---HGEACIPATAFQMTILYVSLYLIALGTGGLKSSISGFGSDQFDDKDPKE-KAHMAF 192



>gb:AE016959_1020653 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732721
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750472 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 566

 Score =  125 bits (315), Expect = 5e-28
 Identities = 65/176 (36%), Positives = 103/176 (58%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           DG+V+   +PA++  +G WR+ +FI+G + AE   ++ +  NL+ YLT  L +S   AA+
Sbjct: 28  DGTVNSDKKPALKQSTGHWRACFFILGAQFAETLCFFMVSKNLVMYLTSALHESNIDAAQ 87

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V+ W GT+   PL+GAF+A ++ GRY T + +  + I+G+  +T+S+     +S+    
Sbjct: 88  SVSIWIGTSFFTPLIGAFLADTYWGRYWTTVISLFIIIIGMLIVTVSSSPLFLNSSYY-- 145

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            N + C          +  LYL  +  G  KPC+ AFGADQFD+ DP E  AK SF
Sbjct: 146 -NWNICRAT------VYTGLYLTAVGSGCMKPCIPAFGADQFDSADPVERLAKGSF 194



>gb:AE016959_1023995 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC018727_1538376
           Oryza sativa chromosome 10 BAC OSJNBa0056G17 genomic
           sequence, complete sequence.>gb:AE017123_1753814 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           77 of 77 of the complete sequence.
          Length = 569

 Score =  125 bits (313), Expect = 8e-28
 Identities = 73/194 (37%), Positives = 107/194 (55%), Gaps = 2/194 (1%)
 Frame = +2

Query: 77  MDLPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLI 256
           M+  DA+   L H +   +  Y   P        W++   I+  E  E  AY GI LNL+
Sbjct: 3   MESGDAQLPLLHHQASASNQHYTKPPF------NWKAPALILAFEFLESIAYAGISLNLV 56

Query: 257 SYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFL 436
            YL   L  +TA+ A NV+ W GT  L P+LGAF+A ++ G+Y+TI  ++V Y++GL  +
Sbjct: 57  VYLGTVLHGTTASNAANVDTWNGTTFLTPVLGAFLADTYWGKYKTIAISTVFYLIGLLVI 116

Query: 437 TLSAVLHSKSSNCQDATNNDTCSPPQ--FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQF 610
           T SAV+ S     Q A  N +  PP   F+   FF +LYL+ +  GG K  +  FGADQ+
Sbjct: 117 TASAVIPS----LQPAPCNGSSCPPATGFQYFVFFTALYLISVGTGGVKSALLPFGADQY 172

Query: 611 DTQDPQENKAKSSF 652
           +  + +E+K K SF
Sbjct: 173 NDSNLEESKKKQSF 186



>gb:AP003905_1835020 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1177_E11.
          Length = 603

 Score =  121 bits (303), Expect = 1e-26
 Identities = 74/198 (37%), Positives = 102/198 (51%), Gaps = 8/198 (4%)
 Frame = +2

Query: 83  LPDAETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISY 262
           LP+   Q    + +  + DY+GRPA RSR+GRW +A  I+  E+ ER    GI +NL++Y
Sbjct: 5   LPETNAQAAAEEVLGDAWDYRGRPAARSRTGRWGAAAMILVAELNERLTTLGIAVNLVTY 64

Query: 263 LTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTL 442
           LT  +    A AA  V  + GT+ +L LLG FVA SFLGRY TI   + +   G+  LT+
Sbjct: 65  LTATMHAGNAEAANVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTI 124

Query: 443 S--------AVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFG 598
           S        A   + S+ C+ AT          ++   + +LYL  L  GG K  V  FG
Sbjct: 125 STAAPGLRPAACAAGSAACERATG--------AQMGVLYLALYLTALGTGGLKSSVSGFG 176

Query: 599 ADQFDTQDPQENKAKSSF 652
           +DQFD  D  E      F
Sbjct: 177 SDQFDESDSGEKSQMMRF 194



>gb:AE016959_1020662 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732730
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AC098694_1736851 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OJ1014H12, complete
           sequence.>gb:AE017049_1750481 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 556

 Score =  121 bits (303), Expect = 1e-26
 Identities = 70/160 (43%), Positives = 95/160 (59%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G WR+   I+G E+++  A+ GI  NL+SYLTG +G+S   AA +V+AWTGT  L PL+G
Sbjct: 37  GGWRACVLILGTELSDCLAFAGIARNLVSYLTGVVGESNVAAARDVSAWTGTCFLTPLVG 96

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
           AF+A SFLGR  TI+    +Y +G+  LT+SA   S ++   DA+++             
Sbjct: 97  AFIADSFLGRRTTILLFLSIYSMGMITLTVSA---SFATPHLDASSDGVLRAT------V 147

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           F  LYLV L  GG KPC    GADQFD  D     A++SF
Sbjct: 148 FLGLYLVALGVGGIKPCASPLGADQFDDDDAAP-AARASF 186



>gb:AP002818_1822868 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0436E04.>gb:AP002969_1824013 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0455C04.
          Length = 606

 Score =  120 bits (300), Expect = 3e-26
 Identities = 68/182 (37%), Positives = 103/182 (56%), Gaps = 9/182 (4%)
 Frame = +2

Query: 107 LQHDSVDGSVDYKGRP---AIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPL 277
           +  D   G VD +G P   A  +R+G W +A FI G EMAER AYYG+ LN++ ++   +
Sbjct: 35  IDDDGGVGVVDIRGSPMGSAELARTGGWVAAVFIFGNEMAERMAYYGLSLNMVIFMFNVM 94

Query: 278 GQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLH 457
            +  A +A  VN + G +    LLG F+A ++LGRY TI + + LY+LGL  LTL A + 
Sbjct: 95  HRPFAASANAVNNFLGISQASSLLGGFLADAYLGRYWTIAAFTTLYLLGLVALTLCATMP 154

Query: 458 SKSSNCQDATNN-----DTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQ 619
           +  +  QD  +        C  P  +++ + + +LY   L   G +PCV +FGADQF+ +
Sbjct: 155 ALQAPGQDECDGFAKLLGKCQQPHPWQMAYLYAALYTTALGAAGIRPCVSSFGADQFEER 214

Query: 620 DP 625
            P
Sbjct: 215 SP 216



>gb:AP004994_1846927 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846964 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 535

 Score =  119 bits (299), Expect = 3e-26
 Identities = 66/151 (43%), Positives = 93/151 (61%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           R+   II V   ERFAY G+  NL++YLT  +  ST+ AA++V+AW+G  S+LPLL A +
Sbjct: 17  RACVMIIVVASVERFAYKGVASNLVTYLTEVVEMSTSAAAKSVSAWSGVTSMLPLLTAVL 76

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A S+  RY TI ++S+LY++GL  LTL A+LH++            CS         FF 
Sbjct: 77  ADSYWDRYSTITASSLLYVVGLIGLTLWALLHTRM----------PCST-------LFFP 119

Query: 542 LYLVGLAQGGHKPCVQAFGADQFDTQDPQEN 634
           LYL+ + QGG+ P +QAFGADQ D  D  ++
Sbjct: 120 LYLISIGQGGYNPSLQAFGADQLDIGDDDDD 150



>gb:AP003372_1828661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OJ1014_G12.>gb:AP003443_1829452 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1144D11.
          Length = 587

 Score =  119 bits (297), Expect = 6e-26
 Identities = 71/178 (39%), Positives = 100/178 (56%), Gaps = 1/178 (0%)
 Frame = +2

Query: 122 VDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAA 301
           V  +VDY+G PA RS +G W +A  ++G+E+ ER +  GI +NL++YLTG +   +A AA
Sbjct: 23  VRDAVDYRGCPADRSATGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAA 82

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA-VLHSKSSNCQ 478
             V  + GT+ LL LLG F+A SFLGRY TI   +++  +G   L  S  V H +    +
Sbjct: 83  NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPPGE 142

Query: 479 DATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             T      P Q  ++  +  LYL+ L  GG K  V  FG DQFD +D +E  A   F
Sbjct: 143 QPT------PVQMAVL--YACLYLIALGTGGLKSSVSGFGTDQFDDRDGRERAAMGLF 192



>gb:AGL488290_1811026 Alnus glutinosa mRNA for dicarboxylate
           transporter (ptr1 gene).
          Length = 583

 Score =  118 bits (296), Expect = 8e-26
 Identities = 71/182 (39%), Positives = 104/182 (57%), Gaps = 5/182 (2%)
 Frame = +2

Query: 122 VDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAA 301
           +   VDYKG PA R+ +G W  A  I+G+E++ER +  GI +NL++YL G + QS+ T++
Sbjct: 10  ISDRVDYKGDPADRNTTGGWVPAALIVGIEVSERLSTMGIIVNLVTYLKGTMHQSSTTSS 69

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQ 478
            + +   GT+ LL LLG  +A SFLGRY TI   SV++ LG   L +SA L   + S C 
Sbjct: 70  NSTSNVAGTSFLLCLLGGILADSFLGRYWTIAIFSVIHALGTCMLAISAALPELRPSECN 129

Query: 479 DATNND---TC-SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKS 646
              ++D    C  P  F++   + +LY + L  GG K  V  FG +QFD  D +E    +
Sbjct: 130 --LHHDFPLKCEEPSSFQMGILYTALYSMALGVGGIKSSVSGFGTEQFDQNDEKEMSEMA 187

Query: 647 SF 652
            F
Sbjct: 188 HF 189



>gb:AY084539_1569628 Arabidopsis thaliana clone 111089 mRNA,
           complete sequence.
          Length = 590

 Score =  117 bits (294), Expect = 1e-25
 Identities = 65/177 (36%), Positives = 101/177 (57%), Gaps = 3/177 (1%)
 Frame = +2

Query: 116 DSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTAT 295
           D  + S DY+G P  +S++G W  A  I+G E++ER    GI +NL++YL G L  S+A 
Sbjct: 12  DGSEESFDYRGNPPDKSKTGGWLGAGLILGSELSERICVMGISMNLVTYLVGDLHISSAK 71

Query: 296 AAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSN 472
           +A  V  + GT +LL LLG F+A + LGRY+ +  ++ +  LG+  LT++  + S +   
Sbjct: 72  SATIVTNFMGTLNLLGLLGGFLADAKLGRYKMVAISASVTALGVLLLTVATTISSMRPPI 131

Query: 473 CQD--ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
           C D    ++        ++   + +LY + L  GG K  V  FG+DQFDT DP+E K
Sbjct: 132 CDDFRRLHHQCIEANGHQLALLYVALYTIALGGGGIKSNVSGFGSDQFDTSDPKEEK 188



>gb:AB019232_1514187 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIL23.>gb:AY143946_1583403 Arabidopsis
           thaliana At3g21670/MIL23_23 mRNA, complete
           cds.>gb:AF372959_1792672 Arabidopsis thaliana
           AT3g21670/MIL23_23 mRNA, complete cds.
          Length = 590

 Score =  117 bits (294), Expect = 1e-25
 Identities = 67/181 (37%), Positives = 103/181 (56%), Gaps = 6/181 (3%)
 Frame = +2

Query: 113 HDSVDGS---VDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQ 283
           H + DGS    DY+G P  +S++G W  A  I+G E++ER    GI +NL++YL G L  
Sbjct: 8   HGAKDGSEEAYDYRGNPPDKSKTGGWLGAGLILGSELSERICVMGISMNLVTYLVGDLHI 67

Query: 284 STATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS- 460
           S+A +A  V  + GT +LL LLG F+A + LGRY+ +  ++ +  LG+  LT++  + S 
Sbjct: 68  SSAKSATIVTNFMGTLNLLGLLGGFLADAKLGRYKMVAISASVTALGVLLLTVATTISSM 127

Query: 461 KSSNCQD--ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQEN 634
           +   C D    ++        ++   + +LY + L  GG K  V  FG+DQFDT DP+E 
Sbjct: 128 RPPICDDFRRLHHQCIEANGHQLALLYVALYTIALGGGGIKSNVSGFGSDQFDTSDPKEE 187

Query: 635 K 637
           K
Sbjct: 188 K 188



>gb:AP003999_1836131 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1115_A05.>gb:AP006161_1861123 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:B1267B06.
          Length = 609

 Score =  116 bits (291), Expect = 3e-25
 Identities = 67/178 (37%), Positives = 98/178 (55%), Gaps = 5/178 (2%)
 Frame = +2

Query: 134 VDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVN 313
           VDY+G P  +S++G W  A  I+G E+AER    GI +NL++YL G L  S A +A  V 
Sbjct: 18  VDYRGNPVDKSKTGGWLGAGLILGTELAERVCVMGISMNLVTYLVGDLHLSNAKSANIVT 77

Query: 314 AWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATN 490
            + GT +LL L+G F+A + LGRY TI  ++ +   G+  LT+  ++   +   C DA  
Sbjct: 78  NFMGTLNLLALVGGFLADAKLGRYLTIAISATIAATGVSLLTVDTMVPGMRPPPCADARG 137

Query: 491 NDT---CSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                 C P +  ++   + +LY V    GG K  V  FG+DQFD  DP+E +A   F
Sbjct: 138 AGAHLRCEPARGGQLAMLYAALYTVAAGAGGLKANVSGFGSDQFDGGDPREERAMVFF 195



>gb:AC105769_1738203 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1301_G07, complete
           sequence.>gb:AC108502_1738516 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1378_A04, complete
           sequence.
          Length = 176

 Score =  112 bits (281), Expect = 4e-24
 Identities = 58/111 (52%), Positives = 73/111 (65%), Gaps = 15/111 (13%)
 Frame = +2

Query: 134 VDYKGRPAIRSRSGRWRSAYFIIG---------------VEMAERFAYYGIGLNLISYLT 268
           VD++GRPA+R  +G WR     IG               VE+AERFA+YG+  NLI+YLT
Sbjct: 33  VDHRGRPALRGATGGWRQVVRSIGRPELRIIDAYELCGAVEIAERFAFYGVSANLITYLT 92

Query: 269 GPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYIL 421
           G LG+  A AA  +NAW G + LLPLLG  +A S+LGRYRTI+ AS+LYIL
Sbjct: 93  GSLGEGNAAAAAAINAWNGVSQLLPLLGGALADSWLGRYRTILLASLLYIL 143



>gb:OSJN00149_1695685 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0060P14, complete sequence.
          Length = 592

 Score =  111 bits (277), Expect = 1e-23
 Identities = 67/189 (35%), Positives = 98/189 (51%), Gaps = 9/189 (4%)
 Frame = +2

Query: 113 HDSVDGSV-DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQST 289
           H   DG V D++G P  + R+G W  A  I+G E+AER    GI +NL++YL G L  S 
Sbjct: 7   HGGDDGVVVDFRGNPVDKDRTGGWLGAGLILGTELAERVCVVGISMNLVTYLVGDLHLSN 66

Query: 290 ATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KS 466
           A +A  V  + GT +LL LLG F+A + LGRY T+  ++ +  +G+  L  S V+   + 
Sbjct: 67  ARSANIVTNFLGTLNLLALLGGFLADAVLGRYLTVAVSATIAAIGVSLLAASTVVPGMRP 126

Query: 467 SNCQDAT-------NNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDP 625
             C DA        +    +    ++   + +LY      GG K  V  FG+DQFD +D 
Sbjct: 127 PPCGDAVAAAAAAESGGCVAASGGQMAMLYAALYTAAAGAGGLKANVSGFGSDQFDGRDR 186

Query: 626 QENKAKSSF 652
           +E KA   F
Sbjct: 187 REGKAMLFF 195



>gb:AE016959_1023773 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC037426_1540041
           Oryza sativa chromosome 10 BAC OSJNBb0014I11 genomic
           sequence, complete sequence.>gb:AE017118_1753592 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           72 of 77 of the complete sequence.
          Length = 594

 Score =  110 bits (275), Expect = 2e-23
 Identities = 63/172 (36%), Positives = 88/172 (51%), Gaps = 3/172 (1%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           DYKGRPA R+ +G W  A  I+G E+ ER    GI +NL+ Y+TG +    A AA  V  
Sbjct: 18  DYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAANTVTN 77

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAV---LHSKSSNCQDAT 487
           + GT+ +L LLG FVA ++LGRY TI     +   G+  LT+S     L   +       
Sbjct: 78  FIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTISTAAPGLRPPACGDPKGA 137

Query: 488 NNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
           + +  +    ++   +  LYL  L  GG K  V  FG+DQFD  D    + K
Sbjct: 138 SAECVAADGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFDESDVDGERKK 189



>gb:BT005728_1638663 Arabidopsis thaliana clone RAFL15-01-K12
           (R20132) putative oligopeptide transporter protein
           (At5g01180) mRNA, partial cds.
          Length = 512

 Score =  107 bits (268), Expect = 1e-22
 Identities = 53/126 (42%), Positives = 78/126 (61%)
 Frame = +2

Query: 275 LGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL 454
           +     +A+++V+ W+GT    PL+GAF+A ++LGRY TI S  V+YI G+  LT+SA +
Sbjct: 3   MNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYIAGMTLLTISASV 62

Query: 455 HSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQEN 634
              +  C    + +TC     +    F +LYL+ L  GG KPCV +FGADQFD  D +E 
Sbjct: 63  PGLTPTC----SGETCHATAGQTAITFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEK 118

Query: 635 KAKSSF 652
           ++KSSF
Sbjct: 119 ESKSSF 124



>gb:ATH131464_1551986 Arabidopsis thaliana mRNA for nitrate
           transporter, partial.
          Length = 567

 Score =  107 bits (266), Expect = 2e-22
 Identities = 60/165 (36%), Positives = 94/165 (56%), Gaps = 3/165 (1%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTA 331
           P  +S++G W  A  I+G E++ER    GI +NL++YL G L  S+A +A  V  + GT 
Sbjct: 1   PPDKSKTGGWLGAGLILGSELSERICVMGISMNLVTYLVGDLHISSAKSATIVTNFMGTL 60

Query: 332 SLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD--ATNNDTC 502
           +LL LLG F+A + LGRY+ +  ++ +  LG+  LT++  + S +   C D    ++   
Sbjct: 61  NLLGLLGGFLADAKLGRYKMVAISASVTALGVLLLTVATTISSMRPPICDDFRRLHHQCI 120

Query: 503 SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
                ++   + +LY + L  GG K  V  FG+DQFDT DP+E K
Sbjct: 121 EANGHQLALLYVALYTIALGGGGIKSNVSGFGSDQFDTSDPKEEK 165



>pir|T52585|T52585 probable nitrate transporter ntp3 [imported] -
           Arabidopsis thaliana (fragment)
          Length = 567

 Score =  107 bits (266), Expect = 2e-22
 Identities = 60/165 (36%), Positives = 94/165 (56%), Gaps = 3/165 (1%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTA 331
           P  +S++G W  A  I+G E++ER    GI +NL++YL G L  S+A +A  V  + GT 
Sbjct: 1   PPDKSKTGGWLGAGLILGSELSERICVMGISMNLVTYLVGDLHISSAKSATIVTNFMGTL 60

Query: 332 SLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD--ATNNDTC 502
           +LL LLG F+A + LGRY+ +  ++ +  LG+  LT++  + S +   C D    ++   
Sbjct: 61  NLLGLLGGFLADAKLGRYKMVAISASVTALGVLLLTVATTISSMRPPICDDFRRLHHQCI 120

Query: 503 SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
                ++   + +LY + L  GG K  V  FG+DQFDT DP+E K
Sbjct: 121 EANGHQLALLYVALYTIALGGGGIKSNVSGFGSDQFDTSDPKEEK 165



>pir|A96710|A96710 hypothetical protein F24J5.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_894478 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY091784_1574742 Arabidopsis thaliana
           At1g68570/F24J5_7 mRNA, complete
           cds.>gb:BT002278_1635881 Arabidopsis thaliana
           At1g68570/F24J5_7 mRNA, complete cds.>gb:F24J5_1678009
           Arabidopsis thaliana chromosome 1 BAC F24J5 sequence,
           complete sequence.
          Length = 596

 Score =  107 bits (266), Expect = 2e-22
 Identities = 61/147 (41%), Positives = 84/147 (57%), Gaps = 1/147 (0%)
 Frame = +2

Query: 194 FIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSF 373
           FI   E+ E+ A  G   N+ISYLT  L      AA  +  + GT+SL PLLGAF+A SF
Sbjct: 32  FIFANEICEKLAVVGFHANMISYLTTQLHLPLTKAANTLTNFAGTSSLTPLLGAFIADSF 91

Query: 374 LGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNNDTCSPPQFEIIFFFFSLYL 550
            GR+ TI  AS++Y +G+  LT+SA++ + +   C+           Q  I+  + +L L
Sbjct: 92  AGRFWTITFASIIYQIGMTLLTISAIIPTLRPPPCKGEEVCVVADTAQLSIL--YVALLL 149

Query: 551 VGLAQGGHKPCVQAFGADQFDTQDPQE 631
             L  GG +PCV AFGADQFD  DP +
Sbjct: 150 GALGSGGIRPCVVAFGADQFDESDPNQ 176



>pir|T48587|T48587 peptide transporter-like protein - Arabidopsis
           thaliana>gb:ATT22N19_1555307 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T22N19 (ESSA
           project).>gb:AY072338_1567155 Arabidopsis thaliana
           peptide transporter-like protein (At5g13400; T22N19_50)
           mRNA, complete cds.>gb:AY128754_1580834 Arabidopsis
           thaliana peptide transporter-like protein (At5g13400)
           mRNA, complete cds.
          Length = 624

 Score =  105 bits (262), Expect = 7e-22
 Identities = 59/166 (35%), Positives = 100/166 (60%), Gaps = 6/166 (3%)
 Frame = +2

Query: 134 VDYKGRP-AIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENV 310
           V+  G+P A  S++G W +A+FI G EMAER AY+G+ +N+++++   + +   +++  V
Sbjct: 52  VNIHGKPIANLSKTGGWIAAFFIFGNEMAERMAYFGLSVNMVAFMFYVMHRPFESSSNAV 111

Query: 311 NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLH---SKSSNC-Q 478
           N + G +    +LG F+A ++LGRY TI   + +Y++GL  +TL A L       SNC Q
Sbjct: 112 NNFLGISQASSVLGGFLADAYLGRYWTIAIFTTMYLVGLIGITLGASLKMFVPDQSNCGQ 171

Query: 479 DATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFD 613
            +     C   + +++++ +  LY+ G    G +PCV +FGADQFD
Sbjct: 172 LSLLLGNCEEAKSWQMLYLYTVLYITGFGAAGIRPCVSSFGADQFD 217



>gb:AP004750_1844346 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0421H01.
          Length = 606

 Score =  105 bits (261), Expect = 9e-22
 Identities = 59/183 (32%), Positives = 96/183 (52%), Gaps = 7/183 (3%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMA-----ERFAYYGIGLNLISYLTGPLGQST 289
           D +  ++G P +++  G+   A  +  ++ A       FA++G+ + L+ +L   L Q  
Sbjct: 27  DQTQHFQGSPELKTSRGKMTMALLLALLDDAVSYVLANFAFFGVAVGLVVFLRQVLHQEN 86

Query: 290 ATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLT-LSAVLHSKS 466
           A AA +V+ W GT  +  L  AF++ S++GRY T I    ++I+GL  L+ LS  L  + 
Sbjct: 87  AEAANSVSMWMGTVYIFSLFCAFLSDSYMGRYITCIMFQFIFIVGLMLLSLLSWFLLVEP 146

Query: 467 SNCQDATNNDTCSPPQFE-IIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
             C D      C+ P    +  F+ S+Y+     GG++P V  FGADQFD  DP E + K
Sbjct: 147 PGCGDGGGLRQCAAPSRRGVAVFYLSIYMAAFGNGGYQPSVATFGADQFDDADPGERRRK 206

Query: 644 SSF 652
            +F
Sbjct: 207 QAF 209



>gb:AE016959_1023998 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC018727_1538379
           Oryza sativa chromosome 10 BAC OSJNBa0056G17 genomic
           sequence, complete sequence.>gb:AE017123_1753817 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           77 of 77 of the complete sequence.
          Length = 571

 Score =  104 bits (260), Expect = 1e-21
 Identities = 68/189 (35%), Positives = 100/189 (52%), Gaps = 20/189 (10%)
 Frame = +2

Query: 146 GRPAIRSRSG-----RWR---SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAA 301
           G P  RSR       RW+       I+G E+ E  A+ G+ LNL+ YL   L  + A  A
Sbjct: 8   GSPPSRSRGRDEKKKRWKWKLGPATILGFELLESIAFSGVALNLVVYLATVLHGTLAFNA 67

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQ 478
            +V+ W GT  ++P++GAF+A S+ G+YRTI+++ + Y+ GL  LT+SA + S + + C 
Sbjct: 68  AHVDTWNGTTFIVPVIGAFLADSYWGKYRTILASLLFYLAGLVLLTVSAAVPSLRPAPCT 127

Query: 479 DATNNDTCSP---PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQD--------P 625
                  CSP    QF +  FF +LYL  +  GG K  +  FGA+Q++  D        P
Sbjct: 128 GV----PCSPATGTQFSV--FFLALYLTSIGTGGVKSALLPFGAEQYERDDHDTDQEGAP 181

Query: 626 QENKAKSSF 652
              K K SF
Sbjct: 182 APEKTKQSF 190



>gb:AY187878_1588173 Zea mays nitrate transporter (Nrt1.1) mRNA,
           partial cds.
          Length = 455

 Score =  103 bits (257), Expect = 3e-21
 Identities = 58/141 (41%), Positives = 75/141 (53%)
 Frame = +2

Query: 230 YYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASV 409
           +  I  NL++YLT  L +S   AA N++AW+G   L PLLGAFVA S+LGRY TI+    
Sbjct: 3   FSAIATNLVTYLTTVLHESKVDAARNISAWSGVCFLTPLLGAFVADSYLGRYWTIVVVLP 62

Query: 410 LYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQ 589
           +YI+ +  L  SA L                          +  +YL  +A GG KPC+ 
Sbjct: 63  VYIVAMLVLIASASL-------------PVLFQSDVHPAVVYLGIYLAAIASGGVKPCIS 109

Query: 590 AFGADQFDTQDPQENKAKSSF 652
           AFGADQFD+ DP E   K SF
Sbjct: 110 AFGADQFDSSDPAELVKKGSF 130



>gb:AE016959_1022199 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC107314_1738429
           Oryza sativa (japonica cultivar-group) cultivar
           Nipponbare clone OJ1208D02 from chromosome 10, complete
           sequence.>gb:AE017085_1752018 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 39 of 77 of the
           complete sequence.
          Length = 551

 Score =  103 bits (257), Expect = 3e-21
 Identities = 60/153 (39%), Positives = 84/153 (54%), Gaps = 1/153 (0%)
 Frame = +2

Query: 197 IIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFL 376
           I  VE  E   +YG+  NL++YLT  L +S   AA++V+ W G+    PL+GAF+A ++ 
Sbjct: 31  IDSVEFTECICFYGVSKNLVTYLTSVLHESNVNAAQSVSIWIGSCFFTPLIGAFLADTYW 90

Query: 377 GRYRTIISASVLYILGLGFLTLSA-VLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLV 553
           GRY T++ + ++ ILG+  LT+SA  L   +S      +  T           +  LYL 
Sbjct: 91  GRYWTVVMSILVIILGMIVLTVSASPLFLNASFYNGGISRLT----------VYLGLYLF 140

Query: 554 GLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            L  GG KP + AFGADQFD  DP E   K SF
Sbjct: 141 ALGTGGIKPNIPAFGADQFDGADPVERVTKGSF 173



>gb:AP004994_1846925 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846962 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 521

 Score =  102 bits (255), Expect = 4e-21
 Identities = 59/150 (39%), Positives = 86/150 (57%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           R+   II V   ER AY G+G NL++YLT  +  ST+ AA++V+AW+G  S+LPLL A +
Sbjct: 9   RACVLIIVVASMERLAYKGVGSNLVTYLTEVVEMSTSAAAKSVSAWSGVTSMLPLLTAVL 68

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
             S+  RY TI ++S+ Y+  L  + L A+L ++               P   +I   F 
Sbjct: 69  TDSYWDRYSTITASSLFYVFVLIGVALVALLRTR--------------VPYSTLI---FP 111

Query: 542 LYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
           LYL+ + QGG+ P +QAFGADQ D  D  +
Sbjct: 112 LYLISIGQGGYNPSLQAFGADQLDIGDDDD 141



>gb:AP005175_1848772 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBb0040H10.>gb:AP005809_1858247 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0039M16.
          Length = 577

 Score =  102 bits (254), Expect = 6e-21
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 1/168 (0%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTA 331
           P ++++   WR+   I+G+E  E  A+ GI  NL+ Y+   L    A++A   + W GT+
Sbjct: 35  PQVKTKQSGWRAPSIILGLECLESMAFNGIATNLVVYIRSVLHGGIASSASTSSLWYGTS 94

Query: 332 SLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP 511
             +P+LGA +A ++ G Y+T++ + ++Y+LG  F+T+ A L S  + C    N ++CS  
Sbjct: 95  FFVPILGATIADTYWGNYKTVLISFIMYLLGTVFITVGAFLPSAPALC----NTESCSSM 150

Query: 512 Q-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              + + +F  LYL  +  GG +  +   GADQF+     + + + +F
Sbjct: 151 NGTQHLVYFSGLYLTAIGCGGVRSALLPLGADQFNNDSSLDIQKRRNF 198



>gb:AE016959_1020640 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068654_1540426
           Genomic Sequence For Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare Clone OSJNBa0015O22
           From Chromosome 10, complete
           sequence.>gb:AE017049_1750459 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 516

 Score =  102 bits (253), Expect = 7e-21
 Identities = 58/151 (38%), Positives = 81/151 (53%)
 Frame = +2

Query: 200 IGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLG 379
           +G E   + A++G+  +L+++LT  L Q  A AA N + W GT  + PL GA VA S LG
Sbjct: 12  VGTECLGQLAFFGVQYSLVTFLTTQLRQGNAEAARNFSMWQGTCYIAPLAGAIVADSCLG 71

Query: 380 RYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGL 559
           RYRTI++   +YI+G+G + L        S    A  + +  P  F +      LYL+ +
Sbjct: 72  RYRTILAFFSIYIIGMGTMAL--------SGASPAVISRSTQPAVFSL-----GLYLMAI 118

Query: 560 AQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             G  K CV  FGADQFD  D  E   KSS+
Sbjct: 119 GAGCIKSCVGPFGADQFDGGDAMERPKKSSY 149



>gb:AP004993_1846907 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0037N01.>gb:AP005382_1850697 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1001_B06.
          Length = 597

 Score =  101 bits (251), Expect = 1e-20
 Identities = 57/157 (36%), Positives = 89/157 (56%), Gaps = 2/157 (1%)
 Frame = +2

Query: 167 RSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPL 346
           + G +R+  FI   E+AE+ A  G   N++ YLT  L    A AA  +  + G +++ PL
Sbjct: 14  KKGGFRTMPFIFANEVAEKLAVLGFTTNMLMYLTRQLHMPLAKAATTLTNFGGVSAMTPL 73

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLH-SKSSNCQDATNNDTC-SPPQFE 520
           +GAF+A S +GR+ TI +AS++Y +G+  LT+SA +   +   C  A     C     ++
Sbjct: 74  IGAFLADSLVGRFWTIAAASLIYQVGMLLLTVSAAMPVFRPPPCSGAGGAGACDEAAPWQ 133

Query: 521 IIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
           +   + +L L  L  GG++PCV AFGADQFD  +  E
Sbjct: 134 LAVLYAALLLNALGAGGYRPCVVAFGADQFDESEAAE 170



>gb:AY090257_1574009 Arabidopsis thaliana At1g69870/T17F3_10 mRNA,
           complete cds.>gb:AY125531_1580336 Arabidopsis thaliana
           At1g69870/T17F3_10 mRNA, complete cds.
          Length = 620

 Score =  101 bits (251), Expect = 1e-20
 Identities = 58/168 (34%), Positives = 88/168 (52%), Gaps = 3/168 (1%)
 Frame = +2

Query: 158 IRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASL 337
           +  + G WR+  FI+G E  ER    G+  N + YLT         AA  +N W+G  +L
Sbjct: 48  VEKKPGGWRAVSFILGNETLERLGSIGLLANFMVYLTKVFHLEQVDAANVINIWSGFTNL 107

Query: 338 LPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA---VLHSKSSNCQDATNNDTCSP 508
            PL+GA+++ +++GR++TI  AS   +LGL  +TL+A    LH  S N QD  +     P
Sbjct: 108 TPLVGAYISDTYVGRFKTIAFASFATLLGLITITLTASFPQLHPASCNSQDPLS--CGGP 165

Query: 509 PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            + +I      L  + +  GG +PC   FG DQFD +  +  K  +SF
Sbjct: 166 NKLQIGVLLLGLCFLSVGSGGIRPCSIPFGVDQFDQRTEEGVKGVASF 213



>gb:OSJN00129_1695376 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNba0093F12, complete sequence.
          Length = 575

 Score =  100 bits (250), Expect = 2e-20
 Identities = 59/168 (35%), Positives = 89/168 (52%), Gaps = 1/168 (0%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTA 331
           P I+ +    ++   ++G E  E  A+ GI  NL+ YL   L  S+  +A NV  W GT+
Sbjct: 31  PLIQDKKSGSKAPAVVLGFECLESTAFNGIATNLVVYLETVLHGSSLASASNVTTWFGTS 90

Query: 332 SLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP 511
            L P+ GA +A +F G Y TI+ + V Y+LG+  +T SA L + ++ C  A  + +C  P
Sbjct: 91  YLTPVFGAIIADTFFGNYNTILVSLVFYLLGMVLVTFSAFLPT-TALCAVA-GSTSCQQP 148

Query: 512 QFEI-IFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            F      F  LYLV    GG +  +  FGA+QFD  +  + + K SF
Sbjct: 149 VFGAQTIAFVGLYLVAFGSGGVRAALLPFGAEQFDDDNAVDRERKMSF 196



>gb:AP004778_1844948 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0459B01.
          Length = 574

 Score = 99.0 bits (245), Expect = 6e-20
 Identities = 55/162 (33%), Positives = 85/162 (52%)
 Frame = +2

Query: 167 RSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPL 346
           + G  ++   ++G E  E  A+ GI  NL+ YL   L  S   +A NV  W GT+ L P+
Sbjct: 38  KRGGSKAPAIVLGFECLESTAFNGISTNLVVYLETVLHGSNLASASNVTTWYGTSYLTPI 97

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEII 526
            GA VA +FLG Y TI+ +  +Y+LG+  +T SA L + ++ C       T +     + 
Sbjct: 98  FGAIVADTFLGNYNTILISLAVYLLGMMLVTFSAFLPATAALCAAGATCGTGAAAAQTVA 157

Query: 527 FFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             F  LYLV +  GG +  +  FGA+QFD     + + K++F
Sbjct: 158 --FVGLYLVAVGSGGVRSSLLPFGAEQFDDDSAADRERKAAF 197



>gb:OSJN00129_1695377 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNba0093F12, complete sequence.
          Length = 593

 Score = 99.0 bits (245), Expect = 6e-20
 Identities = 59/168 (35%), Positives = 85/168 (50%), Gaps = 1/168 (0%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTA 331
           P I  +  R ++   ++G E  E  A+ GI  NL+ YL   L  S   +A NV  W GT+
Sbjct: 52  PFILDKKARSKAPTVVLGFECLESTAFNGIATNLVVYLETLLHGSNLASASNVTTWFGTS 111

Query: 332 SLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP 511
            L P+ GA +A +F G Y TI+ + V Y+LG+  +T SA L + ++ C       +C  P
Sbjct: 112 YLTPVFGAIIADTFWGNYNTILVSLVFYLLGMMLVTFSAFLPT-TALC--TVVGSSCQQP 168

Query: 512 QFEI-IFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                   F  LYLV    GG +  +  FGADQFD  +  + + K SF
Sbjct: 169 LLGAQTIAFLGLYLVAFGSGGVRAALLPFGADQFDDDNTADRERKMSF 216



>gb:AC130729_1740928 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668F02, complete sequence.
          Length = 598

 Score = 98.6 bits (244), Expect = 8e-20
 Identities = 58/159 (36%), Positives = 87/159 (54%), Gaps = 8/159 (5%)
 Frame = +2

Query: 161 RSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLL 340
           + + G +R+  FI+  +  +R A  G   NLI+YLT  L      A+  +  + GTA+L 
Sbjct: 19  KPKQGGFRTMPFILANDFCDRLANVGFSSNLITYLTLQLHLPLVDASNTLTNFHGTANLT 78

Query: 341 PLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS--------KSSNCQDATNND 496
           PL+G  +A SF GR+ TI   SV+Y LG+ FLTLSA L S         +++CQ A+++ 
Sbjct: 79  PLVGGLIADSFAGRFWTITFGSVIYQLGMVFLTLSAALPSLRPPPCAKHAADCQRASSS- 137

Query: 497 TCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFD 613
                  +I   + SL    +  GG +PC+ AFGADQ +
Sbjct: 138 -------QIAVLYASLLFTSIGTGGTRPCIMAFGADQLE 169



>gb:CSNITR1_1674000 Cucumis sativus mRNA for nitrite transporter
           (NiTR1 gene).
          Length = 604

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 60/174 (34%), Positives = 94/174 (54%), Gaps = 1/174 (0%)
 Frame = +2

Query: 95  ETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGP 274
           + + L+ +  +   + K +  ++ + G  ++  FI+G E+ +RFA  G   N+I+YLT  
Sbjct: 11  DEKVLKDEEKNEKEEMKMKMKMKRKLGGVKTMPFILGNEVCDRFASSGFHSNIITYLTQD 70

Query: 275 LGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL 454
           L      A+  +  +  T+S   L+GA +A SF GR+ TI  AS++Y LG+  +T+SA+L
Sbjct: 71  LNMPLVPASNILTNFAATSSFTSLIGALIADSFAGRFWTITIASIIYELGMVTITISAIL 130

Query: 455 HS-KSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFD 613
            S     C    N    S  Q  I+  + +L L  L  GG +PCV AF ADQFD
Sbjct: 131 PSLHPPPCPTQINCTQASGTQLMIL--YLALLLTSLGAGGIRPCVVAFAADQFD 182



>gb:AY035037_1559815 Arabidopsis thaliana putative oligopeptide
           transporter protein (At1g59740) mRNA, complete
           cds.>gb:AY051041_1562517 Arabidopsis thaliana putative
           oligopeptide transporter protein (At1g59740) mRNA,
           complete cds.
          Length = 591

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 58/175 (33%), Positives = 93/175 (53%), Gaps = 1/175 (0%)
 Frame = +2

Query: 131 SVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENV 310
           SVD++GRP+  ++ G  R+A F++G++  E      +G NLI+Y+   +    + AA  V
Sbjct: 29  SVDWRGRPSNPNKHGGMRAALFVLGLQAFEIMGIAAVGNNLITYVINEMHFPLSKAANIV 88

Query: 311 NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQDAT 487
             + GT  +  LLG +++ +FLG + TII    + + G   L++ A L   K   C    
Sbjct: 89  TNFVGTIFIFALLGGYLSDAFLGSFWTIIIFGFVELSGFILLSVQAHLPQLKPPKCNPLI 148

Query: 488 NNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           +        F+ + FF +LYLV L  G  KP + A GADQF    P+++K  SS+
Sbjct: 149 DQTCEEAKGFKAMIFFMALYLVALGSGCVKPNMIAHGADQFSQSHPKQSKRLSSY 203



>gb:AC092779_1735702 Oryza sativa chromosome 3 BAC OSJNBb0024N19
           genomic sequence, complete sequence.
          Length = 587

 Score = 97.8 bits (242), Expect = 1e-19
 Identities = 63/187 (33%), Positives = 95/187 (50%), Gaps = 3/187 (1%)
 Frame = +2

Query: 101 QFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLG 280
           Q L+   VD   +   +PA++     WR+  FIIG E  E+    G   NL+ YLT    
Sbjct: 17  QKLKSMDVDKLENGGDKPALKYHG--WRAMPFIIGNETFEKLGTLGTSANLLVYLTQVFH 74

Query: 281 QSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAV--- 451
             +  AA  +N   GT SL P++GAF++ ++LGRY  +  ASV  ++G+  LT++A    
Sbjct: 75  MRSVDAATLLNGLNGTTSLAPIIGAFLSDAYLGRYLALAIASVASLIGMFLLTMTAAADG 134

Query: 452 LHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
           LH       +  +  T    QF ++F  F+  ++G A  G +PC   FGADQFD      
Sbjct: 135 LHPAECGVGETCSKATSG--QFAVLFMSFAFLVLGSA--GIRPCSMPFGADQFDPHTESG 190

Query: 632 NKAKSSF 652
            +  +SF
Sbjct: 191 KRGINSF 197



>gb:AB009053_1510684 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQB2.
          Length = 558

 Score = 97.8 bits (242), Expect = 1e-19
 Identities = 60/176 (34%), Positives = 89/176 (50%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G VD++ RPA+R R G   +A F++ VE+ E  A+     NL+ YL+  +G S + AA 
Sbjct: 11  NGYVDWRSRPALRGRHGGMLAASFVLVVEVLENLAFLANASNLVLYLSTKMGFSPSGAAN 70

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
            V A+ GTA  L LLG F+A +F   +   + ++ +  LGL  LT+ A  HS        
Sbjct: 71  AVTAFMGTAFFLALLGGFLADAFFTTFHIYLVSAAIEFLGLMVLTVQAHEHSTE------ 124

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                     +  +F F  LYLV L  GG K  +   GA+QFD +     + +S F
Sbjct: 125 ---------PWSRVFLFVGLYLVALGVGGIKGSLPPHGAEQFDEETSSGRRQRSFF 171



>gb:AP003857_1834399 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1014_E06.
          Length = 509

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 66/178 (37%), Positives = 90/178 (50%), Gaps = 4/178 (2%)
 Frame = +2

Query: 128 GSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGP--LGQSTATAA 301
           G  D++GRP  R+ SG WRSA F+            G+ L L+  +  P  L    A A 
Sbjct: 27  GVSDFRGRPVYRATSGGWRSALFVAN----------GLQLLLLRRVGEPDQLPDGAAGAI 76

Query: 302 ENVNAW--TGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNC 475
           E V      G  +  P          LGRY  I+ A  LY++GLG LT+++ L + ++  
Sbjct: 77  ERVGGERVVGDGAHAPSPRRRPRRLLLGRYPFILLACTLYVMGLGMLTVASSLPACAATA 136

Query: 476 QDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSS 649
             A     C P   ++IF + SLYLV  AQG  KPC  AFGA+QFD   P+E+ A+SS
Sbjct: 137 AAAA---ACRPSMAQVIFVYVSLYLVAFAQGFDKPCGLAFGAEQFDPGHPRESAARSS 191



>gb:AY305030_1597541 Oryza sativa (japonica cultivar-group) nitrate
           transporter NRT1;2 mRNA, complete cds.
          Length = 593

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 58/168 (34%), Positives = 84/168 (50%), Gaps = 1/168 (0%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTA 331
           P I  +  R ++   ++G E  E  A+ GI  NL+ YL   L  S   +A NV  W GT+
Sbjct: 52  PFILDKKARSKAPTVVLGFEFLESTAFNGIATNLVVYLETLLHGSNLASASNVTTWFGTS 111

Query: 332 SLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP 511
              P+ GA +A +F G Y TI+ + V Y+LG+  +T SA L + ++ C       +C  P
Sbjct: 112 YHTPVFGAIIADTFWGNYNTILVSLVFYLLGMMLVTFSAFLPT-TALC--TVVGSSCQQP 168

Query: 512 QFEI-IFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                   F  LYLV    GG +  +  FGADQFD  +  + + K SF
Sbjct: 169 LLGAQTIAFLGLYLVAFGSGGVRAALLPFGADQFDDDNTADRERKMSF 216



>gb:OSJN00261_1697580 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 557

 Score = 95.1 bits (235), Expect = 9e-19
 Identities = 60/187 (32%), Positives = 91/187 (48%), Gaps = 10/187 (5%)
 Frame = +2

Query: 122 VDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAA 301
           V G VD++G P  R   G  R+A+F+  + +          LNL++YL G +    +++A
Sbjct: 3   VGGFVDWRGNPIDRKVHGGVRAAWFMFFLSVVTNMENIPNMLNLVTYLHGTMHMGVSSSA 62

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS------- 460
             V  + G  S   LLGAF++ S++ R RTI+    L  L LG L L A L S       
Sbjct: 63  TTVTNFIGATSGFALLGAFLSDSYITRSRTILLFGPLEFLALGLLALQAYLPSLHPPPCN 122

Query: 461 ---KSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
              + SNC++           F  +     LY    ++G  + C  + GADQFD +DP E
Sbjct: 123 IEAELSNCEEVHG--------FNTVILHIGLYTWAFSEGCIRACTPSLGADQFDHEDPSE 174

Query: 632 NKAKSSF 652
           ++ +SSF
Sbjct: 175 SRQQSSF 181



>gb:BT000720_1634993 Arabidopsis thaliana clone RAFL09-73-M24
           (R19648) putative nitrate transporter (NTL1) (At1g69850)
           mRNA, complete cds.
          Length = 585

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/176 (32%), Positives = 93/176 (52%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G  D++ R A++ R G   +A F++ VE+ E  AY     NL+ YL   +  S + +A 
Sbjct: 11  EGYADWRNRAAVKGRHGGMLAASFVLVVEILENLAYLANASNLVLYLREYMHMSPSKSAN 70

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  + GTA LL LLG F++ +F   ++  + ++ +  LGL  LT+ A   S      D+
Sbjct: 71  DVTNFMGTAFLLALLGGFLSDAFFSTFQIFLISASIEFLGLIILTIQARTPSLMPPSCDS 130

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              +  S  +  ++  F  LYLV L  GG K  + + GA+QFD   P+  K +S+F
Sbjct: 131 PTCEEVSGSKAAML--FVGLYLVALGVGGIKGSLASHGAEQFDESTPKGRKQRSTF 184



>pir|T51361|T51361 nitrate transporter NTL1 [validated] -
           Arabidopsis thaliana>gb:AF073361_1765921 Arabidopsis
           thaliana nitrate transporter NTL1 (NRT1:2) mRNA,
           complete cds.
          Length = 585

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/176 (32%), Positives = 93/176 (52%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G  D++ R A++ R G   +A F++ VE+ E  AY     NL+ YL   +  S + +A 
Sbjct: 11  EGYADWRNRAAVKGRHGGMLAASFVLVVEILENLAYLANASNLVLYLREYMHMSPSKSAN 70

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  + GTA LL LLG F++ +F   ++  + ++ +  LGL  LT+ A   S      D+
Sbjct: 71  DVTNFMGTAFLLALLGGFLSDAFFSTFQIFLISASIEFLGLIILTIQARTPSLMPPSCDS 130

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              +  S  +  ++  F  LYLV L  GG K  + + GA+QFD   P+  K +S+F
Sbjct: 131 PTCEEVSGSKAAML--FVGLYLVALGVGGIKGSLASHGAEQFDESTPKGRKQRSTF 184



>pir|G96720|G96720 nitrate transporter (NTL1), 53025-56402
           [imported] - Arabidopsis thaliana>gb:AE005173_894569
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537005 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 600

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/176 (32%), Positives = 93/176 (52%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G  D++ R A++ R G   +A F++ VE+ E  AY     NL+ YL   +  S + +A 
Sbjct: 26  EGYADWRNRAAVKGRHGGMLAASFVLVVEILENLAYLANASNLVLYLREYMHMSPSKSAN 85

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  + GTA LL LLG F++ +F   ++  + ++ +  LGL  LT+ A   S      D+
Sbjct: 86  DVTNFMGTAFLLALLGGFLSDAFFSTFQIFLISASIEFLGLIILTIQARTPSLMPPSCDS 145

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              +  S  +  ++  F  LYLV L  GG K  + + GA+QFD   P+  K +S+F
Sbjct: 146 PTCEEVSGSKAAML--FVGLYLVALGVGGIKGSLASHGAEQFDESTPKGRKQRSTF 199



>gb:RATPCDC_2133348 Rattus norvegicus mRNA for proton-coupled
           dipeptide cotransporter, complete cds.
          Length = 710

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 54/160 (33%), Positives = 84/160 (52%), Gaps = 4/160 (2%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   L+ Y    LG     +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDDLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQ---FEIIFFF 535
            S+LG+++TI+S S++Y +G   +++S++         D T++D    P      +    
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVISVSSI--------NDLTDHDHDGSPNNLPLHVALSM 126

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
             L L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 127 IGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>sp|P51574|PET1_RAT Oligopeptide transporter, small intestine
           isoform (Peptide transporter 1) (Intestinal H+/peptide
           cotransporter) (Proton-coupled dipeptide
           cotransporter).>pir|S72497|S72497 oligopeptide transport
           protein PepT1 - rat>gb:RATPEPT1_2133372 Rattus
           norvegicus mRNA for oligopeptide transporter, complete
           cds.
          Length = 710

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 54/160 (33%), Positives = 84/160 (52%), Gaps = 4/160 (2%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   L+ Y    LG     +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDDLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQ---FEIIFFF 535
            S+LG+++TI+S S++Y +G   +++S++         D T++D    P      +    
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVISVSSI--------NDLTDHDHDGSPNNLPLHVALSM 126

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
             L L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 127 IGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>gb:AY634368_1957812 Homo sapiens macrophage oligopeptide
           transporter PEPT1 mRNA, complete cds.
          Length = 705

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y T  +      +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G    ++S++     ++  D  ++ T       ++     L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVTSVSSI-----NDLTDHNHDGTPDSLPVHVVLSLIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>gb:AF043233_1878539 Homo sapiens Caco-2 oligopeptide transporter
           (PEPT1) mRNA, complete cds.
          Length = 708

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y T  +      +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G    ++S++     ++  D  ++ T       ++     L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVTSVSSI-----NDLTDHNHDGTPDSLPVHVVLSLIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>gb:OSJN00175_1696208 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064D20, complete sequence.
          Length = 611

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 59/164 (35%), Positives = 88/164 (53%), Gaps = 2/164 (1%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           D +VD++GRP    R G  R+A F++G++  E  A   +G NLI+Y+ G +    + AA 
Sbjct: 14  DAAVDWRGRPCEPRRHGGMRAAVFVLGIQAFEIMAIAAVGNNLITYVFGEMHFPLSQAAN 73

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQD 481
            V  + GT  LL LLG F++ S+LG + T++    + + G   L++ A L   K   C  
Sbjct: 74  VVTNFVGTIFLLSLLGGFLSDSYLGCFWTMLIFGFVELSGFILLSVQAHLPQLKPPPCNM 133

Query: 482 ATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQF 610
           A  +  C   +  +   FF +LYLV L  G  KP + A GADQF
Sbjct: 134 AATDGGCEQARGIKASIFFAALYLVALGSGCLKPNMIAHGADQF 177



>gb:AY062453_1565109 Arabidopsis thaliana nitrate transporter (NTL1)
           (At1g69850; T17F3.12) mRNA, complete
           cds.>gb:BT002561_1636164 Arabidopsis thaliana nitrate
           transporter (NTL1) (At1g69850) mRNA, complete cds.
          Length = 585

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 57/176 (32%), Positives = 93/176 (52%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G  D++ R A++ R G   +A F++ VE+ E  AY     NL+ YL   +  S + +A 
Sbjct: 11  EGYADWRNRAAVKGRHGGVLAASFVLVVEILENLAYLANASNLVLYLREYMHMSPSKSAN 70

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
           +V  + GTA LL LLG F++ +F   ++  + ++ +  LGL  LT+ A   S      D+
Sbjct: 71  DVTNFMGTAFLLALLGGFLSDAFFSTFQIFLISASIEFLGLIILTIQARTPSLMPPSCDS 130

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
              +  S  +  ++  F  LYLV L  GG K  + + GA+QFD   P+  K +S+F
Sbjct: 131 PTCEEVSGSKAAML--FVGLYLVALGVGGIKGSLASHGAEQFDESTPKGRKQRSTF 184



>pir|JC5638|JC5638 pH-sensing regulatory factor -
           human>gb:AB001328_1863546 Homo sapiens mRNA for
           pH-sensing regulatory factor of peptide transporter,
           complete cds.
          Length = 208

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y T  +      +    + +     L P+LGA +A
Sbjct: 25  SIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIA 84

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G    ++S++     ++  D  ++ T       ++     L
Sbjct: 85  DSWLGKFKTIVSLSIVYTIGQAVTSVSSI-----NDLTDHNHDGTPDSLPVHVVLSLIGL 139

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 140 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 176



>sp|P46059|PET1_HUMAN Oligopeptide transporter, small intestine
           isoform (Peptide transporter 1) (Intestinal H+/peptide
           cotransporter) (Solute carrier family 15, member
           1).>pir|A56163|A56163 peptide transport protein hPEPT1 -
           human>gb:AL353574_1922729 Human DNA sequence from clone
           RP11-551M18 on chromosome 13 Contains the 5' end of the
           SLC15A1 gene for solute carrier family 15 (oligopeptide
           transporter) member 1 and a CpG island, complete
           sequence.>gb:AL391670_1926996 Human DNA sequence from
           clone RP11-130L10 on chromosome 13 Contains the 3' end
           of the SLC15A1 gene for solute carrier family 15
           (oligopeptide transporter) member 1, complete
           sequence.>gb:HSU13173_2022223 Human intestinal
           H+/peptide cotransporter (Hpept1) gene, complete
           cds.>gb:HSU21936_2022829 Human peptide transporter
           (HPEPT1) mRNA, complete cds.
          Length = 708

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y T  +      +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G    ++S++     ++  D  ++ T       ++     L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVTSVSSI-----NDLTDHNHDGTPDSLPVHVVLSLIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>gb:F205832S16_2112839 Mus musculus intestinal peptide transporter
           PEPT1 (Pept1) gene, exon 23 and complete cds.
          Length = 701

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   L+ Y    LG     +    + +     L P+LGA +A
Sbjct: 13  SIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDNLSTAIYHTFVALCYLTPILGALIA 72

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   +++S++     ++  D  +N +       +      L
Sbjct: 73  DSWLGKFKTIVSLSIVYTIGQAVISVSSI-----NDLTDHDHNGSPDSLPVHVALSMVGL 127

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 128 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 164



>gb:AF205540_2059006 Mus musculus intestinal low-affinity peptide
           transporter protein PEPT1 (Pept1) mRNA, complete cds.
          Length = 709

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   L+ Y    LG     +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDNLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   +++S++     ++  D  +N +       +      L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVISVSSI-----NDLTDHDHNGSPDSLPVHVALSMVGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>gb:AP003630_1831755 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0566A10.
          Length = 590

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 58/177 (32%), Positives = 89/177 (50%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G VD++ RPA+R R G   +A F++ VE+ E  A+     NL++YL   +  S + +A 
Sbjct: 14  EGYVDWRNRPAVRGRHGGMLAASFVLVVEVLENLAFLANASNLVTYLMNFMHYSPSQSAT 73

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
            V  + GTA LL LLG F++ +F   Y   + ++ +  LGL  LT+ A   S        
Sbjct: 74  TVTNFMGTAFLLALLGGFLSDAFFTTYAIYLISAFVEFLGLVVLTIQARTPSLMPPGCAK 133

Query: 485 TNNDTCSPPQF-EIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                C P    +    F  LY+  L  GG K  + + GA+QFD   P+  K +S+F
Sbjct: 134 VAGAACEPVSGPKKAMLFAGLYVTALGIGGIKGSLPSHGAEQFDEHAPRGRKGRSTF 190



>gb:AP003256_1826468 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0460E08.>gb:AP003274_1826980 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0512C01.
          Length = 590

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 51/150 (34%), Positives = 79/150 (52%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G  R+  FII  E+ E+ A +G+  N+I YLT     + AT    +  W   ++ LP+ G
Sbjct: 18  GGLRTIPFIISNEVFEKVATFGLHANMILYLTERYHMTAATGTVVLYFWNALSNFLPIFG 77

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
           A ++ S LGR+R I   SV+ + G+  L L+A+L +     +     D C    +++   
Sbjct: 78  AVLSDSCLGRFRVIALGSVVSLAGMCLLWLTAILPADRRTPECEARRDDCQLVPWQLPLL 137

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQFDTQD 622
           F S  L+ +  GG +PC  AFGADQ D +D
Sbjct: 138 FASFVLMSVGSGGIRPCALAFGADQLDRRD 167



>gb:AY180903_1426820 Sus scrofa peptide transporter 1 mRNA, complete
           cds.
          Length = 708

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 53/157 (33%), Positives = 85/157 (54%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y    +G +   +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLILYFRLFIGWNDNLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   + +S++     ++  D  +N T +     +      L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQVVMAVSSI-----NDLTDFDHNGTPNSMSVHVALSMIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>gb:AP003566_1830924 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 115

 Score = 92.4 bits (228), Expect = 6e-18
 Identities = 48/109 (44%), Positives = 61/109 (55%)
 Frame = +2

Query: 95  ETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGP 274
           E+  L H         K       R G WR+A F+I V   ER  + G+  NL+ YL GP
Sbjct: 2   ESGLLAHSDEPCDAGSKPDADADGRRGGWRAARFLIAVGFLERVGFNGVQSNLVMYLAGP 61

Query: 275 LGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYIL 421
           +G STA AA   NAW GT  +L L+GA  A S LGRYR I++A VL++L
Sbjct: 62  MGMSTAAAAAGANAWAGTVLVLTLVGALAADSRLGRYRAIVAAGVLHLL 110



>gb:AP003235_1825913 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843002 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 112

 Score = 92.4 bits (228), Expect = 6e-18
 Identities = 48/109 (44%), Positives = 61/109 (55%)
 Frame = +2

Query: 95  ETQFLQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGP 274
           E+  L H         K       R G WR+A F+I V   ER  + G+  NL+ YL GP
Sbjct: 2   ESGLLAHSDEPCDAGSKPDADADGRRGGWRAARFLIAVGFLERVGFNGVQSNLVMYLAGP 61

Query: 275 LGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYIL 421
           +G STA AA   NAW GT  +L L+GA  A S LGRYR I++A VL++L
Sbjct: 62  MGMSTAAAAAGANAWAGTVLVLTLVGALAADSRLGRYRAIVAAGVLHLL 110



>gb:AY027496_1424079 Ovis aries proton-dependent gastrointestinal
           peptide transporter mRNA, complete cds.
          Length = 707

 Score = 92.4 bits (228), Expect = 6e-18
 Identities = 53/157 (33%), Positives = 84/157 (53%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y    LG +        + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLILYFQRFLGWNDNLGTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   + +S++     ++  D  ++ T +     +      L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQVVIAVSSI-----NDLTDFNHDGTPNNISVHVALSMIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 VLIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>pir|T51439|T51439 oligopeptide transporter-like protein -
           Arabidopsis thaliana>gb:ATF2G14_1550442 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F2G14 (ESSA
           project).
          Length = 552

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 57/161 (35%), Positives = 83/161 (51%)
 Frame = +2

Query: 167 RSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPL 346
           R G  +S   +I +   ER+A+ G+  NL++YLT  +  S + AA  VN W+G   +LPL
Sbjct: 7   RRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGFTFMLPL 66

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEII 526
             A  A S+  R+ TI+++S LY +GL  LT +A   S+S+                 + 
Sbjct: 67  FSAPFADSYWDRFFTILASSSLYFVGLVGLTFTAFAGSRSTT------------KTISLY 114

Query: 527 FFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSS 649
           F + SL LV L  G   P +QAFGADQ D     +N  + S
Sbjct: 115 FLYTSLSLVALGLGVLNPSLQAFGADQLDYDLDHDNDHEPS 155



>gb:AY289936_1942820 Macaca fascicularis proton-dependent dipeptide
           transporter PEPT1 mRNA, complete cds.
          Length = 708

 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 51/157 (32%), Positives = 83/157 (52%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y T         +    + +     L P+LGA +A
Sbjct: 15  SIFFIVANEFCERFSYYGMRGILILYFTNFFSWDDNMSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   +++S++     ++  D  ++ T       +      L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVISVSSI-----NDLTDHNHDGTPDSLPVHVALSMIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ + N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKRRNRFFSMF 166



>gb:AY289934_1942818 Macaca mulatta proton-dependent dipeptide
           transporter PEPT1 mRNA, complete cds.
          Length = 708

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 51/157 (32%), Positives = 83/157 (52%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y T         +    + +     L P+LGA +A
Sbjct: 15  SIFFIVANEFCERFSYYGMRGILILYFTNFFSWDDNMSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   +++S++     ++  D  ++ T       +      L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVISVSSI-----NDLTDHNHDGTPDSLPAHVALSMIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ + N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKRRNRFFSMF 166



>gb:OSJN00292_1698070 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: P0076O17, complete sequence.
          Length = 621

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 62/174 (35%), Positives = 89/174 (51%), Gaps = 12/174 (6%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           D +VD++GRP    R G  R+A F++G++  E  A   +G NLI+Y+ G +    + AA 
Sbjct: 14  DAAVDWRGRPCEPRRHGGMRAAVFVLGIQAFEIMAIAAVGNNLITYVFGEMHFPLSQAAN 73

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTI-----ISASVLY---ILGLGFLTLSAVLH- 457
            V  + GT  LL LLG F++ S+LG + T+     +  SV +       GF+ LS   H 
Sbjct: 74  VVTNFVGTIFLLSLLGGFLSDSYLGCFWTMLIFGFVELSVEFNDDTAATGFILLSVQAHL 133

Query: 458 --SKSSNCQDATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQF 610
              K   C  A  +  C   +  +   FF +LYLV L  G  KP + A GADQF
Sbjct: 134 PQLKPPPCNMAATDGGCEQARGIKASIFFAALYLVALGSGCLKPNMIAHGADQF 187



>gb:AF461733_1420736 Canis familiaris proton-coupled peptide
           cotransporter PepT1 mRNA, complete cds.
          Length = 708

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 52/157 (33%), Positives = 81/157 (51%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y    +G     +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLILYFRRFIGWDDNLSTAIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G     +S++     ++  D   + T       +      L
Sbjct: 75  DSWLGKFKTIVSLSIVYTIGQAVTAVSSI-----NDLTDYNKDGTPDNLSVHVALSMIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 ALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>pir|G86322|G86322 hypothetical protein F6A14.2 - Arabidopsis
           thaliana>gb:AE005172_890845 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC011809_1537478 Arabidopsis thaliana
           chromosome I BAC F6A14 genomic sequence, complete
           sequence.>gb:AY070054_1566697 Arabidopsis thaliana
           putative peptide transporter protein (At1g18880) mRNA,
           complete cds.>gb:AY117308_1579349 Arabidopsis thaliana
           putative peptide transporter protein (At1g18880) mRNA,
           complete cds.
          Length = 587

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 52/159 (32%), Positives = 82/159 (51%), Gaps = 1/159 (0%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FIIG E  E+    G   NL+ YLT      + TAA+ VN + GT++   ++ AF
Sbjct: 23  WKVMPFIIGNETFEKLGIVGSSSNLVIYLTTVFNMKSITAAKVVNIYGGTSNFGTIVAAF 82

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNNDTCSPPQFEIIFFF 535
           +  S+ GRY+T+  A +   LG   + L+AV+H    + C     +    P   +I+F  
Sbjct: 83  LCDSYFGRYKTLSFAMIACFLGSVAMDLTAVIHPLHPAQCAKEIGSVCNGPSIGQIMFLA 142

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            ++ L+ +  GG +PC   FGADQFD +  +  +   SF
Sbjct: 143 GAMVLLVIGAGGIRPCNLPFGADQFDPKTKEGKRGIESF 181



>gb:OSJN00261_1697577 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 572

 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 55/180 (30%), Positives = 89/180 (49%), Gaps = 2/180 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           +V G +D++G P  R   G  R+A+F+  + +          LN+++YL G +    +++
Sbjct: 2   AVGGFLDWRGNPINRKVHGGVRAAWFVYFLTVVTSTVNVPNMLNMVTYLYGTMHMGISSS 61

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNC 475
           +  V    G  S   LLGAF++ S++ R RTI+    L  LG G L L A L S +   C
Sbjct: 62  STTVTNVLGATSGFALLGAFLSDSYITRARTILLFGPLEFLGYGLLALQAYLPSLRPPPC 121

Query: 476 QDATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                  +C        +  + +LY+     G  + C+   GADQFD +DP E++ +SSF
Sbjct: 122 NAEAEASSCREVHGRNAVLLYAALYISAFGDGFMRACMPPLGADQFDHEDPSESRQQSSF 181



>gb:AY300011_2525789 Danio rerio peptide transporter PEPT1 (slc15a1)
           mRNA, complete cds.>gb:BC054899_2551115 Danio rerio
           solute carrier family 15 (oligopeptide transporter),
           member 1, mRNA (cDNA clone MGC:63490 IMAGE:2639231),
           complete cds.
          Length = 718

 Score = 89.4 bits (220), Expect = 5e-17
 Identities = 53/156 (33%), Positives = 82/156 (52%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   L+ Y    +G     +    + +     L P++GA +A
Sbjct: 22  SIFFIVVNEFCERFSYYGMKAVLVLYFKYFIGWDDDLSTTIYHTFVALCYLTPIMGAIIA 81

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+  S++Y +G   + +SA+     +N     +N T       I      L
Sbjct: 82  DSWLGKFKTIVYLSIVYTIGQVIMAISAIHDITDANRDGKPDNKT-----LHISLSMLGL 136

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF  +D QE K +S+F
Sbjct: 137 ILIALGTGGIKPCVAAFGGDQF--EDHQE-KQRSTF 169



>gb:OCU13707_1442429 Oryctolagus cuniculus oligopeptide transporter
           mRNA, complete cds.
          Length = 707

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 52/157 (33%), Positives = 81/157 (51%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y    +G     +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLILYFRNFIGWDDNLSTVIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            ++LG+++TI+  S++Y +G    +LS+V     +   D  ++ T       +      L
Sbjct: 75  DAWLGKFKTIVWLSIVYTIGQAVTSLSSV-----NELTDNNHDGTPDSLPVHVAVCMIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 LLIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>sp|P36836|PET1_RABIT Oligopeptide transporter, small intestine
           isoform (Peptide transporter 1) (Intestinal H+/peptide
           cotransporter).>pir|S43297|S43297 oligopeptide transport
           protein - rabbit>gb:OCU06467_1442368 Oryctolagus
           cuniculus oligopeptide transporter (PepT1) mRNA,
           complete cds.
          Length = 707

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 52/157 (33%), Positives = 81/157 (51%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   LI Y    +G     +    + +     L P+LGA +A
Sbjct: 15  SIFFIVVNEFCERFSYYGMRALLILYFRNFIGWDDNLSTVIYHTFVALCYLTPILGALIA 74

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            ++LG+++TI+  S++Y +G    +LS+V     +   D  ++ T       +      L
Sbjct: 75  DAWLGKFKTIVWLSIVYTIGQAVTSLSSV-----NELTDNNHDGTPDSLPVHVAVCMIGL 129

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q N+  S F
Sbjct: 130 LLIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIF 166



>gb:AP003791_1833395 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1065G12.>gb:AP006757_1862931 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551C06.
          Length = 557

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 58/172 (33%), Positives = 87/172 (50%), Gaps = 4/172 (2%)
 Frame = +2

Query: 149 RPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGT 328
           R + + R   W SA+ ++   M +  AY+G+  NL++YL   L + + +AA +V  W GT
Sbjct: 18  RTSKKDRRTTWASAFILVNNFM-QYTAYFGVSTNLVNYLKYRLHEGSKSAANDVTNWQGT 76

Query: 329 ASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLS----AVLHSKSSNCQDATNND 496
            S+ PL+ A++A +FLGRY TI+    + +LG G L  S    A+LH  ++         
Sbjct: 77  GSITPLVAAYLADAFLGRYWTILLFMAISVLGYGVLAASAAAPALLHGGAA--------- 127

Query: 497 TCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                      F+  LYLV L   G    +  FGA QFD  D  E + +SSF
Sbjct: 128 ----------AFYAGLYLVALG-SGLLVVMAPFGAGQFDEADEGERRRQSSF 168



>gb:AY099590_1576615 Arabidopsis thaliana putative transport protein
           (At3g16180) mRNA, partial cds.
          Length = 579

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 55/171 (32%), Positives = 87/171 (50%), Gaps = 3/171 (1%)
 Frame = +2

Query: 149 RPAIRSRS-GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTG 325
           +P  R R+ G   +  FII  E  E+ A YG+  N+I YL              +  W  
Sbjct: 16  QPITRRRTKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYRLGLVKGQTVLFMWVA 75

Query: 326 TASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQDATNNDTC 502
             + +PL+GAF++ S+LGR+ TI+ AS+  +LG+  L L+A+L   K S C      +  
Sbjct: 76  ATNFMPLVGAFLSDSYLGRFLTIVIASLSSLLGMVVLWLTAMLPQVKPSPCVATAGTNCS 135

Query: 503 SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
           S    ++   + +  L+ +  GG +PC  AFGADQ D  ++P+  +   SF
Sbjct: 136 SATSSQLALLYTAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESF 186



>gb:AY072134_1567028 Arabidopsis thaliana putative nitrate
           transporter protein (At1g27040) mRNA, complete
           cds.>gb:AY096445_1575989 Arabidopsis thaliana putative
           nitrate transporter (At1g27040) mRNA, complete cds.
          Length = 567

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 56/177 (31%), Positives = 88/177 (49%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G  D++ + A+R R G   +A F++ VE+ E  A+     NL+ YL   +  S A ++ 
Sbjct: 13  EGYADWRNKAALRGRHGGMLAASFVLAVEILENLAFLANASNLVLYLKNFMHMSLARSSS 72

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
            V  +  TA LL LLG F+A +F   +   + ++ +  LGL  LT+ A   S     C+ 
Sbjct: 73  EVTTFMATAFLLALLGGFLADAFFSTFVIFLISASIEFLGLILLTIQARRPSLMPPPCKS 132

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           +           +  F F  LYLV L  GG K  + + GA+QFD   P+  K +S+F
Sbjct: 133 SAALRCEVVGGSKAAFLFVGLYLVSLGIGGIKGSLPSHGAEQFDEGTPKGRKQRSTF 189



>pir|C86397|C86397 protein T7N9.10 [imported] - Arabidopsis
           thaliana>gb:AE005172_891583 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000348_1530062 Genomic sequence for
           Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 563

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 56/177 (31%), Positives = 88/177 (49%), Gaps = 1/177 (0%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           +G  D++ + A+R R G   +A F++ VE+ E  A+     NL+ YL   +  S A ++ 
Sbjct: 9   EGYADWRNKAALRGRHGGMLAASFVLAVEILENLAFLANASNLVLYLKNFMHMSLARSSS 68

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
            V  +  TA LL LLG F+A +F   +   + ++ +  LGL  LT+ A   S     C+ 
Sbjct: 69  EVTTFMATAFLLALLGGFLADAFFSTFVIFLISASIEFLGLILLTIQARRPSLMPPPCKS 128

Query: 482 ATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           +           +  F F  LYLV L  GG K  + + GA+QFD   P+  K +S+F
Sbjct: 129 SAALRCEVVGGSKAAFLFVGLYLVSLGIGGIKGSLPSHGAEQFDEGTPKGRKQRSTF 185



>gb:AB052785_1521244 Glycine max mRNA for nitrate transporter
           NRT1-2, complete cds.
          Length = 605

 Score = 87.8 bits (216), Expect = 1e-16
 Identities = 58/161 (36%), Positives = 83/161 (51%), Gaps = 3/161 (1%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FIIG E  E+    G   NL+ YLT     S+ TA   +N +TG+ASL  LLGAF
Sbjct: 34  WKVMPFIIGNETFEKLGTIGTLANLLVYLTTVFNLSSLTATNIINIFTGSASLSTLLGAF 93

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP---QFEIIF 529
           +  ++ GRY+T+   ++   LGL  + L+A +  K       + + TC+ P   Q   + 
Sbjct: 94  LCDTYFGRYKTLGFCTIASFLGLLVIQLTAWI-KKMHPPHCGSESITCTGPTTGQMTFLL 152

Query: 530 FFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             F L +VG A  G +PC  AFG DQF+       K  +SF
Sbjct: 153 AGFGLLIVGAA--GIRPCNLAFGVDQFNPNTESGKKGINSF 191



>pir|A96721|A96721 probable peptide transporter T17F3.10 [imported]
           - Arabidopsis thaliana>gb:AE005173_894571 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537003 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 644

 Score = 87.8 bits (216), Expect = 1e-16
 Identities = 58/192 (30%), Positives = 88/192 (45%), Gaps = 27/192 (14%)
 Frame = +2

Query: 158 IRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASL 337
           +  + G WR+  FI+G E  ER    G+  N + YLT         AA  +N W+G  +L
Sbjct: 48  VEKKPGGWRAVSFILGNETLERLGSIGLLANFMVYLTKVFHLEQVDAANVINIWSGFTNL 107

Query: 338 LPLLGAFVAGSFLGRYRTIISASVLYIL------------------------GLGFLTLS 445
            PL+GA+++ +++GR++TI  AS   +L                        GL  +TL+
Sbjct: 108 TPLVGAYISDTYVGRFKTIAFASFATLLLLNYFCIVRKRMNLLRDHAIEDDKGLITITLT 167

Query: 446 A---VLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDT 616
           A    LH  S N QD  +     P + +I      L  + +  GG +PC   FG DQFD 
Sbjct: 168 ASFPQLHPASCNSQDPLS--CGGPNKLQIGVLLLGLCFLSVGSGGIRPCSIPFGVDQFDQ 225

Query: 617 QDPQENKAKSSF 652
           +  +  K  +SF
Sbjct: 226 RTEEGVKGVASF 237



>gb:RATPDPT_2133364 Rattus norvegicus proton-dependent peptide
           transporter mRNA, partial cds.
          Length = 453

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 52/152 (34%), Positives = 78/152 (51%), Gaps = 4/152 (2%)
 Frame = +2

Query: 209 EMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYR 388
           E  ERF+YYG+   L+ Y    LG     +    +       L P+LGA +A S+LG+++
Sbjct: 2   EFCERFSYYGMRALLVLYFRNFLGWDDDLSTAIYHTSVALRYLTPILGALIADSWLGKFK 61

Query: 389 TIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQ---FEIIFFFFSLYLVGL 559
           TI+S S++Y +G   +++S++         D T++D    P      +      L L+GL
Sbjct: 62  TIVSLSIVYTIGQAVISVSSI--------NDLTDHDHDGSPNNLPLHVALSMIGLGLIGL 113

Query: 560 AQGGHKPCVQAFGADQF-DTQDPQENKAKSSF 652
             GG KPCV AFG DQF + Q+ Q N   S F
Sbjct: 114 GTGGIKPCVSAFGGDQFGEGQEKQGNPVFSIF 145



>gb:ATAC010676_1543134 Arabidopsis thaliana chromosome III BAC T22N4
           genomic sequence, complete sequence.
          Length = 563

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 52/147 (35%), Positives = 79/147 (53%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G  +S   +I +   ER+A+ G+  NL++YLT  +  S + AA+ VN W G  S+LPL  
Sbjct: 9   GLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLFS 68

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
           A +A ++  R+ TI+++S +Y +GL  LT +A   S+S+                   F 
Sbjct: 69  APLADTYWDRFFTILASSSVYFVGLVGLTWTAFAGSRSAT------------KTISSYFL 116

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQFD 613
           + SL LV +  G   P +QAFGADQ D
Sbjct: 117 YSSLCLVSIGLGVLNPSLQAFGADQLD 143



>gb:AP003256_1826467 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0460E08.>gb:AP003274_1826979 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0512C01.
          Length = 574

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 48/159 (30%), Positives = 87/159 (54%), Gaps = 2/159 (1%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           G +R+  FII  E+ E+ A +G+ +N I+YL      S A A   +  W   ++  P+ G
Sbjct: 21  GGFRALPFIISNEILEKVAGFGLNINFITYLNMQYHLSHANAGSLLFVWGAVSNFAPIPG 80

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQDATNNDTCSPPQF-EII 526
           A +A  +LGR+  +   S+   +G+ FL LSA++  ++   C  + + + C+PP+   + 
Sbjct: 81  AVIADMYLGRFIVVAIGSIACFVGMVFLWLSAMIPGARPPPCDMSASPELCAPPEARHMA 140

Query: 527 FFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
           +       + +  GG +PC  AFGADQF ++ P+E +++
Sbjct: 141 WLLAGFVFLSVGAGGVRPCSMAFGADQF-SRHPKERRSR 178



>gb:AC105769_1738202 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1301_G07, complete
           sequence.>gb:AC108502_1738515 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1378_A04, complete
           sequence.
          Length = 469

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +2

Query: 416 ILGLGFLTLSAVLHSKSSNCQDAT--NNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQ 589
           + GL  L  S ++ +  + C  A      TC P    + FF+ SLY+V +AQGGHKPCVQ
Sbjct: 15  VQGLAMLAFSTLISTGGNQCSSAAVAGGKTCPPSTLRVAFFYISLYMVAVAQGGHKPCVQ 74

Query: 590 AFGADQFDTQDPQENKAKSSF 652
           AFGADQFD  DP+E+ ++SSF
Sbjct: 75  AFGADQFDPSDPEESVSRSSF 95



>gb:OSJN00129_1695375 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNba0093F12, complete sequence.
          Length = 617

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 2/149 (1%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           ++   I+ ++  E  A+YG+ LNLI YL   L   +A+    V++W GTA L+P+LGA V
Sbjct: 79  KALIIILSLQFLEITAFYGVYLNLIVYLQDVLHGDSASNVATVSSWVGTAYLMPILGAAV 138

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDATNNDTCSPPQF-EIIFFF 535
           A S  G+Y T+++   + ++G+  +T SA L S +  +C  +     C P    + + FF
Sbjct: 139 ADSCWGKYTTVLAGFSIALVGMVTITASATLPSLRPPSCGQSA---YCVPATLSQKLVFF 195

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDTQD 622
             +YL  L  GG K  + AFG +Q D  D
Sbjct: 196 TGIYLCALGIGGAKAVLIAFGPEQLDDDD 224



>gb:AY084631_1569719 Arabidopsis thaliana clone 113723 mRNA,
           complete sequence.
          Length = 292

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 54/156 (34%), Positives = 80/156 (51%), Gaps = 3/156 (1%)
 Frame = +2

Query: 194 FIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSF 373
           FII  E  E+ A YG+  N+I YL        A     +  W+  ++  PLLGAF++ S+
Sbjct: 30  FIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVLFMWSAASNFTPLLGAFLSDSY 89

Query: 374 LGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQDATNNDTC-SPPQFEIIFFFFSLY 547
           LGR+ TI  AS+   LG+  L L+A+L   K S C        C S    ++   + +  
Sbjct: 90  LGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTAAGSHCGSSTASQLALLYSAFA 149

Query: 548 LVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
           L+ +  GG +PC  AFGADQ D  ++P+  +   SF
Sbjct: 150 LISIGSGGIRPCSLAFGADQLDNKENPKNERVLESF 185



>gb:AE014298_1124221 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1124222 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003429_1209403
           Drosophila melanogaster chromosome X, section 13 of 74
           of the complete sequence.>gb:AE003429_1209404 Drosophila
           melanogaster chromosome X, section 13 of 74 of the
           complete sequence.
          Length = 810

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 57/158 (36%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S +FII  E  ERF YYG+   L+ YL+  LG S  TA    + +T     L + GA +
Sbjct: 126 KSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAII 185

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEI-IFFFF 538
           + S+LG+++TI+  S++YI G   LTL A+                  P    +  F   
Sbjct: 186 SDSWLGKFKTILYLSLVYICGSVLLTLGAI-----------------GPLNLPMETFTML 228

Query: 539 SLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            L L+ L  GG KPCV AFG DQF    P++ K  +SF
Sbjct: 229 GLALIALGSGGIKPCVSAFGGDQFKV--PEQVKQITSF 264



>gb:AE014298_1124220 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003429_1209402 Drosophila melanogaster
           chromosome X, section 13 of 74 of the complete sequence.
          Length = 803

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 57/158 (36%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S +FII  E  ERF YYG+   L+ YL+  LG S  TA    + +T     L + GA +
Sbjct: 126 KSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAII 185

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEI-IFFFF 538
           + S+LG+++TI+  S++YI G   LTL A+                  P    +  F   
Sbjct: 186 SDSWLGKFKTILYLSLVYICGSVLLTLGAI-----------------GPLNLPMETFTML 228

Query: 539 SLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            L L+ L  GG KPCV AFG DQF    P++ K  +SF
Sbjct: 229 GLALIALGSGGIKPCVSAFGGDQFKV--PEQVKQITSF 264



>pir|H96561|H96561 probable peptide transporter [imported] -
           Arabidopsis thaliana>gb:AE005173_893132 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC022354_1538914 Arabidopsis thaliana
           chromosome 1 BAC F9I5 genomic sequence, complete
           sequence.
          Length = 607

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 54/156 (34%), Positives = 80/156 (51%), Gaps = 3/156 (1%)
 Frame = +2

Query: 194 FIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSF 373
           FII  E  E+ A YG+  N+I YL        A     +  W+  ++  PLLGAF++ S+
Sbjct: 30  FIIANEAFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVLFMWSAASNFTPLLGAFLSDSY 89

Query: 374 LGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQDATNNDTC-SPPQFEIIFFFFSLY 547
           LGR+ TI  AS+   LG+  L L+A+L   K S C        C S    ++   + +  
Sbjct: 90  LGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTAAGSHCGSSTASQLALLYSAFA 149

Query: 548 LVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
           L+ +  GG +PC  AFGADQ D  ++P+  +   SF
Sbjct: 150 LISIGSGGIRPCSLAFGADQLDNKENPKNERVLESF 185



>gb:AF181635_1248302 Drosophila melanogaster BcDNA.GH06717
           (BcDNA.GH06717) mRNA, complete cds.
          Length = 810

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 58/157 (36%), Positives = 80/157 (50%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S +FII  E  ERF YYG+   L+ YL+  LG S  TA    + +T     L + GA +
Sbjct: 126 KSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAII 185

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           + S+LG+++TI+  S++YI G   LTL A+      N    T             F    
Sbjct: 186 SDSWLGKFKTILYLSLVYICGSVLLTLGAI---GRLNLPMET-------------FTMLG 229

Query: 542 LYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           L L+ L  GG KPCV AFG DQF    P++ K  +SF
Sbjct: 230 LALIALGSGGIKPCVSAFGGDQFKV--PEQVKQITSF 264



>gb:AP003791_1833396 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1065G12.>gb:AP006757_1862932 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551C06.
          Length = 545

 Score = 85.5 bits (210), Expect = 7e-16
 Identities = 56/166 (33%), Positives = 85/166 (51%), Gaps = 3/166 (1%)
 Frame = +2

Query: 164 SRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLP 343
           +R  RW +  FI+     +  AY+G+  NL++YL   L + + +AA NV  W GT S+ P
Sbjct: 21  NRRNRW-ACTFILANNFFQNMAYFGVSTNLVNYLKYRLHEGSKSAANNVTNWEGTGSIAP 79

Query: 344 LLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATN--NDTCSPPQF 517
           L+  ++A +FLGRY TI+ + V          +SAV+ S              + S  + 
Sbjct: 80  LVAGYLADAFLGRYWTIVLSMV----------ISAVVRSSPPPAMQGYGVLAASASVIRL 129

Query: 518 EIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
           E    +  +YLV L  G  +P +  FGADQFD  +D Q  + +SSF
Sbjct: 130 ESAALYAGMYLVALG-GVLEPIMAPFGADQFDDGEDDQRGRRQSSF 174



>gb:AY157977_2516019 Meleagris gallopavo peptide transporter PepT1
           mRNA, complete cds.
          Length = 714

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 51/157 (32%), Positives = 79/157 (50%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   L+ Y    L      +    + +     L P+LGA +A
Sbjct: 21  SIFFIVINEFCERFSYYGMRAVLVLYFKYFLRWDDNLSTAIYHTFVALCYLTPILGALIA 80

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   + +S++      N     +N         I      L
Sbjct: 81  DSWLGKFKTIVSLSIVYTIGQAVMAISSINDMTDQNRDGNPDNIA-----VHIALSVTGL 135

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q ++  S F
Sbjct: 136 ILIALGTGGIKPCVSAFGGDQFEEHQEKQRSRFFSIF 172



>gb:AY029615_2508674 Gallus gallus peptide transporter PepT1 mRNA,
           complete cds.
          Length = 714

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 51/157 (32%), Positives = 79/157 (50%), Gaps = 1/157 (0%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S +FI+  E  ERF+YYG+   L+ Y    L      +    + +     L P+LGA +A
Sbjct: 21  SIFFIVINEFCERFSYYGMRAVLVLYFKYFLRWDDNFSTAIYHTFVALCYLTPILGALIA 80

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TI+S S++Y +G   + +S++      N     +N         I      L
Sbjct: 81  DSWLGKFKTIVSLSIVYTIGQAVMAVSSINDMTDQNRDGNPDNIA-----VHIALSMTGL 135

Query: 545 YLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
            L+ L  GG KPCV AFG DQF+  Q+ Q ++  S F
Sbjct: 136 ILIALGTGGIKPCVSAFGGDQFEEHQEKQRSRFFSIF 172



>gb:AP005173_1848761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0003E08.
          Length = 618

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 56/173 (32%), Positives = 84/173 (48%), Gaps = 6/173 (3%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTA 331
           P +R R   W++  F+IG E  E+    G   NL+ YLT     S+  AA  +N + GT 
Sbjct: 40  PELRYRG--WKAMPFVIGNETFEKLGSIGTAANLMVYLTTVFHMSSLDAAVALNVFAGTT 97

Query: 332 SLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA---VLHSK---SSNCQDATNN 493
           +L  ++GAF +  +LGRY T+ +  V   +G+  LT++A    LH        C  AT  
Sbjct: 98  NLATVVGAFASDLYLGRYATVAAGCVSTFIGMVILTMTAGVPALHPPPCGEGRCLGATRG 157

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                 Q  ++   F+  + G   GG +PC   FGADQFD +     +  +SF
Sbjct: 158 ------QLAVLGLAFAFIVAG--AGGIRPCSLPFGADQFDPRTESGRRGINSF 202



>gb:AP003076_1824650 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0481E12.
          Length = 595

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 58/180 (32%), Positives = 90/180 (50%), Gaps = 3/180 (1%)
 Frame = +2

Query: 122 VDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAA 301
           V+G VD++GRPAIR   G   +++FI+     E  A   + +NLI Y    +       +
Sbjct: 20  VEGKVDWRGRPAIRGSHGGVANSFFILVNFGLENLASLSLAVNLIIYFMTVMHIGLTDGS 79

Query: 302 ENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS---KSSN 472
             +  + GT+ ++ +L +  A +F+GRY+T+I +SV+ ++GL  LTL A  HS   K   
Sbjct: 80  NLLTNYMGTSYMVAVLISVFADTFIGRYKTVIISSVIELVGLLILTLQA--HSNKLKPPY 137

Query: 473 CQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           C    +    +         +  LYLV +   G K  + A  ADQFD + P E    SSF
Sbjct: 138 CVFPFDPKCETVSGDGRTHLYVGLYLVAIGSAGIKAALPAHCADQFDEKHPTEKLQMSSF 197



>gb:DMU97114_1381143 Drosophila melanogaster opt1 (opt) gene,
           alternative splice products, complete cds; and
           non-coding nuclear RNA roX1, complete sequence.
          Length = 737

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/143 (36%), Positives = 73/143 (51%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 28  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 87

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 88  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 131

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG KPCV AFG DQF
Sbjct: 132 LLLIAIGTGGIKPCVSAFGGDQF 154



>gb:DMU97114_1381142 Drosophila melanogaster opt1 (opt) gene,
           alternative splice products, complete cds; and
           non-coding nuclear RNA roX1, complete sequence.
          Length = 743

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/143 (36%), Positives = 73/143 (51%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 34  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 93

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 94  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 137

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG KPCV AFG DQF
Sbjct: 138 LLLIAIGTGGIKPCVSAFGGDQF 160



>gb:AE014298_1124219 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003429_1209401 Drosophila melanogaster
           chromosome X, section 13 of 74 of the complete sequence.
          Length = 737

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/143 (36%), Positives = 73/143 (51%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 28  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 87

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 88  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 131

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG KPCV AFG DQF
Sbjct: 132 LLLIAIGTGGIKPCVSAFGGDQF 154



>gb:AE014298_1124218 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003429_1209400 Drosophila melanogaster
           chromosome X, section 13 of 74 of the complete sequence.
          Length = 734

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/143 (36%), Positives = 73/143 (51%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 25  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 84

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 85  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 128

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG KPCV AFG DQF
Sbjct: 129 LLLIAIGTGGIKPCVSAFGGDQF 151



>gb:AE014298_1124217 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003429_1209399 Drosophila melanogaster
           chromosome X, section 13 of 74 of the complete sequence.
          Length = 743

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/143 (36%), Positives = 73/143 (51%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 34  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 93

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 94  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 137

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG KPCV AFG DQF
Sbjct: 138 LLLIAIGTGGIKPCVSAFGGDQF 160



>pir|T13674|T13674 hypothetical protein EG0002.1 - fruit fly
           (Drosophila melanogaster)>gb:DMCEG0002_1378530
           Drosophila melanogaster sequence EG0002: concatenation
           of cosmids 170B5:1-5779, 163A7:1-41145.
          Length = 734

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/143 (36%), Positives = 73/143 (51%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 25  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 84

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 85  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 128

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG KPCV AFG DQF
Sbjct: 129 LLLIAIGTGGIKPCVSAFGGDQF 151



>pir|T13673|T13673 hypothetical protein EG0002.1 - fruit fly
           (Drosophila melanogaster)>gb:DMCEG0002_1378529
           Drosophila melanogaster sequence EG0002: concatenation
           of cosmids 170B5:1-5779, 163A7:1-41145.
          Length = 743

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/143 (36%), Positives = 73/143 (51%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 34  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 93

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 94  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 137

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG KPCV AFG DQF
Sbjct: 138 LLLIAIGTGGIKPCVSAFGGDQF 160



>gb:AF370202_1792090 Arabidopsis thaliana putative peptide
           transporter protein (At3g47960) mRNA, complete cds.
          Length = 606

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 52/159 (32%), Positives = 80/159 (50%), Gaps = 1/159 (0%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FIIG E  E+    G   NL+ YLT      + TAA  +NA++GT +    + AF
Sbjct: 35  WKVMPFIIGNETFEKLGIIGTLSNLLVYLTSVFNLKSYTAATIINAFSGTINFGTFIAAF 94

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQF-EIIFFF 535
           +  ++ GRY+T+  A +   LG   + L+A +   S +     N  +C  P   +I+F  
Sbjct: 95  LCDTYFGRYKTLSVAVIACFLGSFVILLTAAI--PSLHPVACGNKISCEGPSVGQILFLL 152

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             L  + +  GG +PC  AFGADQF+ +     K  +SF
Sbjct: 153 MGLGFLVVGAGGIRPCNLAFGADQFNPKSESGKKGINSF 191



>gb:AF083746_1766976 Arabidopsis thaliana clone sps492-2 unknown
           mRNA.
          Length = 499

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 52/159 (32%), Positives = 80/159 (50%), Gaps = 1/159 (0%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FIIG E  E+    G   NL+ YLT      + TAA  +NA++GT +    + AF
Sbjct: 35  WKVMPFIIGNETFEKLGIIGTLSNLLVYLTSVFNLKSYTAATIINAFSGTINFGTFIAAF 94

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQF-EIIFFF 535
           +  ++ GRY+T+  A +   LG   + L+A +   S +     N  +C  P   +I+F  
Sbjct: 95  LCDTYFGRYKTLSVAVIACFLGSFVILLTAAI--PSLHPVACGNKISCEGPSVGQILFLL 152

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             L  + +  GG +PC  AFGADQF+ +     K  +SF
Sbjct: 153 MGLGFLVVGAGGIRPCNLAFGADQFNPKSESGKKGINSF 191



>gb:AB020751_1514667 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRG21.
          Length = 616

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 56/180 (31%), Positives = 85/180 (47%), Gaps = 1/180 (0%)
 Frame = +2

Query: 116 DSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTAT 295
           DSV+  V  + +   R     W+   FIIG E  E+    G   NL+ YLT      + T
Sbjct: 30  DSVEEDVQNQKKVVYRG----WKVMPFIIGNETFEKLGIIGTLSNLLVYLTAVFNLKSIT 85

Query: 296 AAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILG-LGFLTLSAVLHSKSSN 472
           AA  +NA++GT +    + AF+  ++ GRY+T+  A +   LG    L  +AV     + 
Sbjct: 86  AATIINAFSGTINFGTFVAAFLCDTYFGRYKTLSVAVIACFLGSFVILLTAAVPQLHPAA 145

Query: 473 CQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           C  A ++    P   +I F    L  + +  GG +PC  AFGADQF+ +     +   SF
Sbjct: 146 CGTAADSICNGPSGGQIAFLLMGLGFLVVGAGGIRPCNLAFGADQFNPKSESGKRGIDSF 205



>gb:BX294154_771789 Pirellula sp. strain 1 complete genome; segment
           22/24.
          Length = 686

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 55/167 (32%), Positives = 80/167 (47%), Gaps = 10/167 (5%)
 Frame = +2

Query: 140 YKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPL----------GQST 289
           Y  RP  ++ +G      +IIG E AERF++YG+   L  ++   L          G S 
Sbjct: 12  YNDRP--QATTGMPPGIPYIIGNEAAERFSFYGMKAILTVFMVDYLHWMSSAATNQGMSN 69

Query: 290 ATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSS 469
           A A E+ + +T  A   P++GA ++  FLG+YRTI+  S++Y +G G L L         
Sbjct: 70  AEATEHYHTFTAAAYFFPVIGALLSDIFLGKYRTILYLSIVYCIGHGALALMG------- 122

Query: 470 NCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQF 610
                      SPP    ++ F  L L+ +  GG KPCV A   DQF
Sbjct: 123 -----------SPPMSAGMWLFAGLLLISIGSGGIKPCVSAHVGDQF 158



>pir|T06687|T06687 probable peptide transport protein T17F15.170 -
           Arabidopsis thaliana>gb:ATT17F15_1554708 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T17F15.
          Length = 636

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 52/159 (32%), Positives = 80/159 (50%), Gaps = 1/159 (0%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FIIG E  E+    G   NL+ YLT      + TAA  +NA++GT +    + AF
Sbjct: 65  WKVMPFIIGNETFEKLGIIGTLSNLLVYLTSVFNLKSYTAATIINAFSGTINFGTFIAAF 124

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQF-EIIFFF 535
           +  ++ GRY+T+  A +   LG   + L+A +   S +     N  +C  P   +I+F  
Sbjct: 125 LCDTYFGRYKTLSVAVIACFLGSFVILLTAAI--PSLHPVACGNKISCEGPSVGQILFLL 182

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             L  + +  GG +PC  AFGADQF+ +     K  +SF
Sbjct: 183 MGLGFLVVGAGGIRPCNLAFGADQFNPKSESGKKGINSF 221



>pir|H96720|H96720 probable peptide transporter T17F3.11 [imported]
           - Arabidopsis thaliana>gb:AE005173_894570 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537004 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 555

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 2/160 (1%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W++  +IIG E  ER A +G+  N + Y+          A   +N W+   +  P++GAF
Sbjct: 22  WKAMPYIIGNETLERLATFGLMANFMVYMVREYHMDQVQAVTLINTWSALTNFAPIIGAF 81

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTL-SAVLHSKSSNCQDATNNDTCSPPQFEIIFFF 535
           ++ S+ G++ TI+  S+  +LG+  LT  S V + +   C        C P  +  ++  
Sbjct: 82  ISDSYTGKFNTIVFGSIAELLGMLVLTFTSLVPNLRPPPCTADQITGQCIPYSYSQLYVL 141

Query: 536 FS-LYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            S L+L+ +  GG + C   F  DQFD    +  +   SF
Sbjct: 142 LSGLFLLSVGTGGIRSCSVPFSLDQFDDSTEEGREGSRSF 181



>gb:AB026647_1517211 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJL12.
          Length = 521

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 52/174 (29%), Positives = 83/174 (47%)
 Frame = +2

Query: 107 LQHDSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQS 286
           +++D  +   D+KG+ AI  + G  R+A  +  V M E   +   G N + Y  G +  +
Sbjct: 1   MENDMEEKFEDWKGKEAIPGKHGGIRAASIVCVVVMMENIVFIANGFNFVKYFMGSMHYT 60

Query: 287 TATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS 466
            ATAA  V  + GT+ LL L G F+A SF+  + T I    + ++GL  LT  A      
Sbjct: 61  PATAANMVTNFMGTSFLLTLFGGFIADSFVTHFTTFIVFCCIELMGLILLTFQA------ 114

Query: 467 SNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQ 628
            N +     D  +P   +    F  LY + +  GG K  + + G DQ D ++P+
Sbjct: 115 HNPKLLPEKDK-TPSTLQSAILFTGLYAMAIGTGGLKASLPSHGGDQIDRRNPR 167



>gb:AP003436_1829384 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0470A12.
          Length = 600

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 52/161 (32%), Positives = 77/161 (47%), Gaps = 3/161 (1%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FII  E  E+ A  G+  NL  YL          AA   N + GT +  PLLGAF
Sbjct: 28  WKCMPFIIATETFEKVATIGVVANLTVYLVKRFNIGQIEAANITNIFFGTLNFAPLLGAF 87

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQDAT--NNDTCSPPQFEIIF 529
           ++  +LGR++T+       +LG+  +TL A L + K   C + T       SP   ++  
Sbjct: 88  ISDVYLGRFKTLAYGCFASLLGMLGMTLYASLPALKPPICHEKTRLGGGCNSPSTLQLSV 147

Query: 530 FFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            + SL  + +  G  +PC   FG DQFD  D +  K  +S+
Sbjct: 148 LYLSLGFLIIGGGAIRPCSLPFGVDQFDKTDEEGRKGLNSY 188



>gb:AB052788_1521247 Glycine max mRNA for nitrate transporter
           NRT1-5, partial cds.
          Length = 572

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 58/180 (32%), Positives = 84/180 (46%), Gaps = 4/180 (2%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           D  +DY+G          W++  FIIG E  E+    G   NL+ YLT        TA  
Sbjct: 3   DPKIDYRG----------WKAMPFIIGNETFEKLGAIGTLANLLVYLTTVFNLKNITATN 52

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSSNCQD 481
            +N + G+ +    +GAF++ ++ GRY+TI   +    LGL  + L+AV  +    +C  
Sbjct: 53  IINIFNGSTNFATFIGAFLSDTYFGRYKTIGFCTFTSFLGLLVIQLTAVFKNLHPPHC-- 110

Query: 482 ATNNDTCSPP---QFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
                TC  P   Q   +   F L L+G A  G +PC  AFGADQF+       K  +SF
Sbjct: 111 GKEMKTCKGPTAGQMAFLVSGFGLLLIGAA--GVRPCNLAFGADQFNPNTDSGKKGINSF 168



>gb:AB052784_1521243 Glycine max mRNA for nitrate transporter
           NRT1-1, complete cds.
          Length = 597

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 3/161 (1%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FIIG E  E+    G   NL+ YLT     S+  A   VN + G+ASL  LLGAF
Sbjct: 26  WKVMPFIIGNETFEKLGTIGTLANLLVYLTTVFNLSSLAATNIVNIFNGSASLSTLLGAF 85

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP---QFEIIF 529
           +  ++ GRY+T+  +++   LGL  + L+A +  K        ++ TC  P   Q   + 
Sbjct: 86  LCDTYFGRYKTLGFSTMASFLGLLVIQLTAWI-KKMHPPHCGRDSITCIGPTTGQMGFLL 144

Query: 530 FFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             F L +VG A  G +PC  AFG DQF+       K  +SF
Sbjct: 145 AGFGLLIVGAA--GIRPCNLAFGVDQFNPNTESGKKGINSF 183



>pir|E86397|E86397 protein T7N9.14 [imported] - Arabidopsis
           thaliana>gb:AE005172_891587 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000348_1530066 Genomic sequence for
           Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 700

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 47/149 (31%), Positives = 71/149 (47%), Gaps = 1/149 (0%)
 Frame = +2

Query: 209 EMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYR 388
           E  E+    G+  N + YL          A      W G  +  PLLGA ++ +++GR++
Sbjct: 152 ETLEKLGSIGVSANFMLYLRNVFHMEPVEAFNVYYLWMGLTNFAPLLGALISDAYIGRFK 211

Query: 389 TIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP-QFEIIFFFFSLYLVGLAQ 565
           TI  AS+  ILGL  +TL+A L        +  + D C  P + ++   F  L  + +  
Sbjct: 212 TIAYASLFSILGLMTVTLTACLPQLHPPPCNNPHPDECDDPNKLQLGILFLGLGFLSIGS 271

Query: 566 GGHKPCVQAFGADQFDTQDPQENKAKSSF 652
           GG +PC   FG DQFD +  Q  K  +SF
Sbjct: 272 GGIRPCSIPFGVDQFDQRTEQGLKGVASF 300



>gb:AF428467_1799397 Arabidopsis thaliana AT3g47960/T17F15_170 mRNA,
           complete cds.
          Length = 606

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 51/159 (32%), Positives = 79/159 (49%), Gaps = 1/159 (0%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAF 358
           W+   FIIG E  E+    G   NL+  LT      + TAA  +NA++GT +    + AF
Sbjct: 35  WKVMPFIIGNETFEKLGIIGTLSNLLVCLTSVFNLKSYTAATIINAFSGTINFGTFIAAF 94

Query: 359 VAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQF-EIIFFF 535
           +  ++ GRY+T+  A +   LG   + L+A +   S +     N  +C  P   +I+F  
Sbjct: 95  LCDTYFGRYKTLSVAVIACFLGSFVILLTAAI--PSLHPVACGNKISCEGPSVGQILFLL 152

Query: 536 FSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
             L  + +  GG +PC  AFGADQF+ +     K  +SF
Sbjct: 153 MGLGFLVVGAGGIRPCNLAFGADQFNPKSESGKKGINSF 191



>sp|P91679|OPT1_DROME Oligopeptide transporter 1 (YIN
           protein).>gb:DMU85982_1381090 Drosophila melanogaster
           oligopeptide transporter 1 (opt1) mRNA, complete cds.
          Length = 737

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 49/143 (34%), Positives = 71/143 (49%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFV 361
           +S  FII  E  ERF YYG+   L+ YLT  LG +  TA    + +T    + PL+GA +
Sbjct: 28  KSVAFIISNEFCERFNYYGMRTILVLYLTNKLGYNEETATVLFHTFTMLVYIFPLIGALI 87

Query: 362 AGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFS 541
           A  +LG+Y+TI+  S++Y LG   ++  AV  S               P +   +     
Sbjct: 88  ADGWLGKYKTILYLSLVYSLGAMVVSFGAVPLSG-------------MPTKAVTV---VG 131

Query: 542 LYLVGLAQGGHKPCVQAFGADQF 610
           L L+ +  GG  PCV  FG +QF
Sbjct: 132 LLLIAIGNGGINPCVSPFGGEQF 154



>gb:BC085327_2109193 Rattus norvegicus solute carrier family 15
           (H+/peptide transporter), member 2, mRNA (cDNA clone
           MGC:91625 IMAGE:7098404), complete cds.
          Length = 740

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 56  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 115

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 116 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 161

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 162 SLIALGTGGIKPCVAAFGGDQFEEE 186



>gb:BC051199_2100679 Mus musculus mRNA similar to solute carrier
           family 15 (H+/peptide transporter), member 2 (cDNA clone
           MGC:62902 IMAGE:1511439), complete cds.
          Length = 259

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 56  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 115

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 116 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 161

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 162 SLIALGTGGIKPCVAAFGGDQFEEE 186



>gb:BC018335_2092659 Mus musculus solute carrier family 15
           (H+/peptide transporter), member 2, mRNA (cDNA clone
           IMAGE:3583898), complete cds.
          Length = 248

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 105 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 150

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 151 SLIALGTGGIKPCVAAFGGDQFEEE 175



>gb:AF257711_2060757 Mus musculus proton-dependent high affinity
           oligopeptide transporter (Pept2) gene, complete cds.
          Length = 729

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 105 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 150

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 151 SLIALGTGGIKPCVAAFGGDQFEEE 175



>gb:AF111811_2054910 Mus musculus proton-dependent high affinity
           oligopeptide transporter PepT2 mRNA, complete cds.
          Length = 740

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 56  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 115

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 116 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 161

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 162 SLIALGTGGIKPCVAAFGGDQFEEE 186



>gb:AF083745_1766975 Arabidopsis thaliana clone sps492 unknown mRNA.
          Length = 211

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 55/177 (31%), Positives = 83/177 (46%), Gaps = 11/177 (6%)
 Frame = +2

Query: 116 DSVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTAT 295
           DSV+  V  + +   R     W+   FIIG E  E+    G   NL+ YLT      + T
Sbjct: 30  DSVEEDVQNQKKVVYRG----WKVMPFIIGNETFEKLGIIGTLSNLLVYLTAVFNLKSIT 85

Query: 296 AAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAV---LHSKS 466
           AA  +NA++GT +    + AF+  ++ GRY+T+  A +   LG   + L+A    LH  +
Sbjct: 86  AATIINAFSGTINFGTFVAAFLCDTYFGRYKTLSVAVIACFLGSFVILLTAAVPQLHPAA 145

Query: 467 SN--------CQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFD 613
                     C  A ++    P   +I F    L  + +  GG +PC  AFGADQF+
Sbjct: 146 CGTAADSICACGTAADSICNGPSGGQIAFLLMGLGFLVVGAGGIRPCNLAFGADQFN 202



>gb:AK018393_1159553 Mus musculus 16 days embryo lung cDNA, RIKEN
           full-length enriched library, clone:8430408C16
           product:solute carrier family 15 (H+/peptide
           transporter), member 2, full insert sequence.
          Length = 259

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 56  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 115

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 116 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 161

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 162 SLIALGTGGIKPCVAAFGGDQFEEE 186



>pir|JC7501|JC7501 oligopeptide transporter PEPT2, kidney isoform -
           mouse
          Length = 729

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 105 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 150

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 151 SLIALGTGGIKPCVAAFGGDQFEEE 175



>sp|Q63424|PET2_RAT Oligopeptide transporter, kidney isoform
           (Peptide transporter 2) (Kidney H+/peptide
           cotransporter).>gb:RATPEPT2_2133373 Rattus norvegicus
           mRNA for proton-coupled peptide transporter PEPT2,
           complete cds.
          Length = 729

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/145 (33%), Positives = 71/145 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG  F +L A+                        I     L
Sbjct: 105 DSWLGKFKTIIYLSLVYVLGHVFKSLGAI--------------PILGGKMLHTILSLVGL 150

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQ 619
            L+ L  GG KPCV AFG DQF+ +
Sbjct: 151 SLIALGTGGIKPCVAAFGGDQFEEE 175



>gb:BC044572_1983484 Homo sapiens solute carrier family 15
           (H+/peptide transporter), member 2, mRNA (cDNA clone
           MGC:57148 IMAGE:5288920), complete cds.
          Length = 729

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 49/149 (32%), Positives = 73/149 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   LI Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG    +L A+                        +     L
Sbjct: 105 DSWLGKFKTIIYLSLVYVLGHVIKSLGAL--------------PILGGQVVHTVLSLIGL 150

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
            L+ L  GG KPCV AFG DQF+ +  +E
Sbjct: 151 SLIALGTGGIKPCVAAFGGDQFEEKHAEE 179



>gb:AB026647_1517209 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJL12.
          Length = 515

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 52/162 (32%), Positives = 76/162 (46%)
 Frame = +2

Query: 137 DYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNA 316
           D++G+ AI  + G  ++A+    VE  E   +     N + Y T  +  ST  AA  V  
Sbjct: 11  DWRGKEAISGKHGGIKAAFIACVVETMENMVFLACSTNFMMYFTKSMNYSTPKAATMVTN 70

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNND 496
           + GT+ LL + G FVA SFL R+   +    + +LGL  LTL A  H      Q      
Sbjct: 71  FVGTSFLLTIFGGFVADSFLTRFAAFVLFGSIELLGLIMLTLQA--HITKLQPQGGKKPS 128

Query: 497 TCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQD 622
           T   PQ  ++  F  LY + +  GG K  + A G DQ  T++
Sbjct: 129 T---PQSTVL--FTGLYAIAIGVGGVKGSLPAHGGDQIGTRN 165



>sp|Q16348|PET2_HUMAN Oligopeptide transporter, kidney isoform
           (Peptide transporter 2) (Kidney H+/peptide
           cotransporter) (Solute carrier family 15, member
           2).>pir|I52481|I52481 PEPT 2 - human>gb:S78203_2041724
           PEPT 2=H+/peptide cotransporter [human, kidney, mRNA
           Partial, 2685 nt].
          Length = 729

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 49/149 (32%), Positives = 73/149 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   LI Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG    +L A+                        +     L
Sbjct: 105 DSWLGKFKTIIYLSLVYVLGHVIKSLGAL--------------PILGGQVVHTVLSLIGL 150

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
            L+ L  GG KPCV AFG DQF+ +  +E
Sbjct: 151 SLIALGTGGIKPCVAAFGGDQFEEKHAEE 179



>gb:AY289935_1942819 Macaca mulatta proton-dependent dipeptide
           transporter PEPT2 mRNA, complete cds.
          Length = 729

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 49/149 (32%), Positives = 73/149 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   LI Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S+LG+++TII  S++Y+LG    +L A+                        +     L
Sbjct: 105 DSWLGKFKTIIYLSLVYVLGHVIKSLGAL--------------PILGGQVVHTVLSLVGL 150

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
            L+ L  GG KPCV AFG DQF+ +  +E
Sbjct: 151 SLIALGTGGIKPCVAAFGGDQFEEKHAEE 179



>pir|T37329|T37329 probable oligopeptide transport protein -
           Caenorhabditis elegans>gb:CEAF000417_1359611
           Caenorhabditis elegans high-affinity peptide transporter
           (CPTA) mRNA, complete cds.
          Length = 785

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 48/146 (32%), Positives = 74/146 (50%), Gaps = 1/146 (0%)
 Frame = +2

Query: 176 RW-RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           +W +  + I+G E+ ERF++YG+   L  Y    L  S + +    +A+T      PLLG
Sbjct: 29  KWPKQTFLIVGNELCERFSFYGMRAVLTLYFFNILNFSQSFSTVLFHAFTVICYSSPLLG 88

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
           + +A  ++G++ TI   S+ Y  G   L  S++  S SS+            P  +++  
Sbjct: 89  SILADGYIGKFWTIFFISIFYACGQILLAFSSIAPSGSSH-----------HPLLDLL-- 135

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQF 610
              L +VGL  GG KPCV AFG DQF
Sbjct: 136 --GLLIVGLGTGGIKPCVSAFGGDQF 159



>pir|T19017|T19017 hypothetical protein C06G8.2 - Caenorhabditis
           elegans
          Length = 786

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 48/146 (32%), Positives = 74/146 (50%), Gaps = 1/146 (0%)
 Frame = +2

Query: 176 RW-RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           +W +  + I+G E+ ERF++YG+   L  Y    L  S + +    +A+T      PLLG
Sbjct: 29  KWPKQTFLIVGNELCERFSFYGMRAVLTLYFFNILNFSQSFSTVLFHAFTVICYSSPLLG 88

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
           + +A  ++G++ TI   S+ Y  G   L  S++  S SS+            P  +++  
Sbjct: 89  SILADGYIGKFWTIFFISIFYACGQILLAFSSIAPSGSSH-----------HPLLDLL-- 135

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQF 610
              L +VGL  GG KPCV AFG DQF
Sbjct: 136 --GLLIVGLGTGGIKPCVSAFGGDQF 159



>sp|Q17758|CPTA_CAEEL Di-/tri-peptide transporter
           CPTA.>gb:CEC06G8_1360131 Caenorhabditis elegans cosmid
           C06G8, complete sequence.
          Length = 785

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 48/146 (32%), Positives = 74/146 (50%), Gaps = 1/146 (0%)
 Frame = +2

Query: 176 RW-RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLG 352
           +W +  + I+G E+ ERF++YG+   L  Y    L  S + +    +A+T      PLLG
Sbjct: 29  KWPKQTFLIVGNELCERFSFYGMRAVLTLYFFNILNFSQSFSTVLFHAFTVICYSSPLLG 88

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
           + +A  ++G++ TI   S+ Y  G   L  S++  S SS+            P  +++  
Sbjct: 89  SILADGYIGKFWTIFFISIFYACGQILLAFSSIAPSGSSH-----------HPLLDLL-- 135

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQF 610
              L +VGL  GG KPCV AFG DQF
Sbjct: 136 --GLLIVGLGTGGIKPCVSAFGGDQF 159



>pir|B86458|B86458 probable protein nitrate transporter NTL1
           54085-51470 [imported] - Arabidopsis
           thaliana>gb:AE005172_892158 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC051630_1540096 Arabidopsis thaliana
           chromosome 1 BAC F10C21 genomic sequence, complete
           sequence.
          Length = 596

 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 52/166 (31%), Positives = 83/166 (50%)
 Frame = +2

Query: 125 DGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAE 304
           D  VD++GRP   S+ G  R+A F++G +  E  A   +G NLI+Y+   +    + +A 
Sbjct: 24  DLCVDFRGRPCRPSKHGGTRAALFVLGFQAFEMMAIAAVGNNLITYVFNEMHFPLSKSAN 83

Query: 305 NVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA 484
            V  + GT  LL LLG F++ S+LG +RT++   V+ I    F      L     N +  
Sbjct: 84  LVTNFIGTVFLLSLLGGFLSDSYLGSFRTMLVFGVIEI--SVFQAHLPELRPPECNMKST 141

Query: 485 TNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQD 622
           T +       ++    + +L LV L  G  KP + + GA+QF  +D
Sbjct: 142 TIH-CVEANGYKAATLYTALCLVALGSGCLKPNIISHGANQFQRKD 186



>gb:AB012247_1511830 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MSL1.
          Length = 541

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 39/114 (34%), Positives = 64/114 (56%), Gaps = 2/114 (1%)
 Frame = +2

Query: 317 WTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQDATNN 493
           W    + +PL+GAF++ S+LGR+ TI+ AS+  +LG+  L L+A+L   K S C      
Sbjct: 23  WVAATNFMPLVGAFLSDSYLGRFLTIVIASLSSLLGMVVLWLTAMLPQVKPSPCVATAGT 82

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDT-QDPQENKAKSSF 652
           +  S    ++   + +  L+ +  GG +PC  AFGADQ D  ++P+  +   SF
Sbjct: 83  NCSSATSSQLALLYTAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESF 136



>gb:BC054967_2551172 Xenopus laevis solute carrier family 15
           (H+/peptide transporter), member 2, mRNA (cDNA clone
           MGC:64416 IMAGE:6879523), complete cds.
          Length = 682

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 44/146 (30%), Positives = 68/146 (46%)
 Frame = +2

Query: 194 FIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSF 373
           FI+  E  ERF+YYG+   L  Y    L      +    +A++G     PL+GA +A ++
Sbjct: 2   FIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAW 61

Query: 374 LGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLV 553
           LG++ TI   S+LY++G    ++ A+               T    +  +      L  +
Sbjct: 62  LGKFNTIFYLSILYVIGHIIKSVGAI--------------PTVGSTEVHVALSVIGLIAI 107

Query: 554 GLAQGGHKPCVQAFGADQFDTQDPQE 631
               GG KPCV AFG DQF+ +  QE
Sbjct: 108 AFGTGGIKPCVAAFGGDQFEEEHAQE 133



>pir|T48516|T48516 probable oligopeptide transporter protein -
           Arabidopsis thaliana>gb:ATF15N18_1548744 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F15N18 (ESSA
           project).
          Length = 481

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 46/141 (32%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = +2

Query: 194 FIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSF 373
           FI+  +  E+ AY+G+  N+I +LT   G  TA AA  +  W+   +  PL+GAF+A S+
Sbjct: 22  FILASQALEKLAYFGLVPNMILFLTVEYGMGTAEAANILFLWSAATNFFPLVGAFIADSY 81

Query: 374 LGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPP---QFEIIFFFFSL 544
            GR+  I   S + + G+  L L+ ++  +   C   TN   C P    +  +++ FF+L
Sbjct: 82  TGRFPLIGFGSSISLTGMVLLWLTTIIRPE---CDKLTN--VCQPTTLLKSVLLYSFFAL 136

Query: 545 YLVGLAQGGHKPCVQAFGADQ 607
             +G   GG +    AF ADQ
Sbjct: 137 TAIG--AGGVRSSCLAFAADQ 155



>gb:AL353574_1922730 Human DNA sequence from clone RP11-551M18 on
           chromosome 13 Contains the 5' end of the SLC15A1 gene
           for solute carrier family 15 (oligopeptide transporter)
           member 1 and a CpG island, complete sequence.
          Length = 282

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 42/135 (31%), Positives = 70/135 (51%), Gaps = 1/135 (0%)
 Frame = +2

Query: 251 LISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLG 430
           LI Y T  +      +    + +     L P+LGA +A S+LG+++TI+S S++Y +G  
Sbjct: 5   LILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQA 64

Query: 431 FLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQF 610
             ++S++     ++  D  ++ T       ++     L L+ L  GG KPCV AFG DQF
Sbjct: 65  VTSVSSI-----NDLTDHNHDGTPDSLPVHVVLSLIGLALIALGTGGIKPCVSAFGGDQF 119

Query: 611 DT-QDPQENKAKSSF 652
           +  Q+ Q N+  S F
Sbjct: 120 EEGQEKQRNRFFSIF 134



>gb:CNS07EGH_1374281 chromosome XI of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 477

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 44/147 (29%), Positives = 65/147 (44%)
 Frame = +2

Query: 191 YFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGS 370
           + II  E  ERF +YG+   L S+     G +   +  N++ +   + L  L G  ++  
Sbjct: 10  FLIICNEFCERFCFYGLKSLLFSFTRSEYGFTIKESTVNLHFFISMSYLFTLFGGLLSDM 69

Query: 371 FLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYL 550
           FLGRY TI+  S LY+ G   LT  +++                            SL +
Sbjct: 70  FLGRYSTIVLLSSLYLTGTSLLTYCSIVSGSPG-------------------LMVGSLLM 110

Query: 551 VGLAQGGHKPCVQAFGADQFDTQDPQE 631
           + +  GG KPCV AFG DQF   D Q+
Sbjct: 111 IAVGTGGIKPCVAAFGGDQFGPDDAQD 137



>sp|P46029|PET2_RABIT Oligopeptide transporter, kidney isoform
           (Peptide transporter 2) (Kidney H+/peptide
           cotransporter).>gb:OCU32507_1442591 Oryctolagus
           cuniculus oligopeptide transporter mRNA, complete cds.
          Length = 729

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 50/151 (33%), Positives = 74/151 (49%), Gaps = 2/151 (1%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+  E  ERF+YYG+   L  Y    L  +  T+    +A++      P+LGA +A
Sbjct: 45  SIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIA 104

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSA--VLHSKSSNCQDATNNDTCSPPQFEIIFFFF 538
            S+LG+++TII  S++ +LG    +LSA  +L  K                    +    
Sbjct: 105 DSWLGKFKTIIYLSLVNVLGHVIKSLSAFPILGGK----------------VVHTVLSLV 148

Query: 539 SLYLVGLAQGGHKPCVQAFGADQFDTQDPQE 631
            L L+ L  GG KPCV AFG DQF+ +  +E
Sbjct: 149 GLCLIALGTGGIKPCVAAFGGDQFEEKHAEE 179



>gb:U39666_1403025 Caenorhabditis elegans cosmid K04E7, complete
           sequence.
          Length = 835

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 46/139 (33%), Positives = 69/139 (49%)
 Frame = +2

Query: 197 IIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFL 376
           I+  E  ERF+YYG+   L  YL   L  + + +    N +T      PLLG+ VA  ++
Sbjct: 51  IVSNEFCERFSYYGMRTVLTFYLLNVLKFTDSQSTIFFNGFTVLCYTTPLLGSIVADGYI 110

Query: 377 GRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVG 556
           G++ TI S S+LY +G   L L++  + +SS             P  ++      L ++ 
Sbjct: 111 GKFWTIFSVSILYAIGQVVLALASTKNFQSS-----------VHPWMDL----SGLLIIA 155

Query: 557 LAQGGHKPCVQAFGADQFD 613
              GG KPCV AFG DQF+
Sbjct: 156 FGTGGIKPCVSAFGGDQFE 174



>pir|T37330|T37330 probable low-affinity oligopeptide transport
           protein - Caenorhabditis elegans>gb:CEAF000418_1359612
           Caenorhabditis elegans low-affinity peptide transporter
           (CPTB) mRNA, complete cds.
          Length = 796

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 46/139 (33%), Positives = 69/139 (49%)
 Frame = +2

Query: 197 IIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFL 376
           I+  E  ERF+YYG+   L  YL   L  + + +    N +T      PLLG+ VA  ++
Sbjct: 12  IVSNEFCERFSYYGMRTVLTFYLLNVLKFTDSQSTIFFNGFTVLCYTTPLLGSIVADGYI 71

Query: 377 GRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLYLVG 556
           G++ TI S S+LY +G   L L++  + +SS             P  ++      L ++ 
Sbjct: 72  GKFWTIFSVSILYAIGQVVLALASTKNFQSS-----------VHPWMDL----SGLLIIA 116

Query: 557 LAQGGHKPCVQAFGADQFD 613
              GG KPCV AFG DQF+
Sbjct: 117 FGTGGIKPCVSAFGGDQFE 135



>gb:BC079971_2561410 Xenopus laevis MGC80026 protein, mRNA (cDNA
           clone MGC:80026 IMAGE:3401976), complete cds.
          Length = 569

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 50/178 (28%), Positives = 87/178 (48%), Gaps = 16/178 (8%)
 Frame = +2

Query: 152 PAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPL-GQSTATAAENVNAWTGT 328
           PA    SGR  +   ++  E+ ER A+YGI  NL+ +L G + G     A++ +  + G 
Sbjct: 22  PAGSVFSGRGLACAAVLLSELLERVAFYGITSNLVLFLNGQIFGWEGTQASQALLLFMGI 81

Query: 329 ASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQD--------- 481
             L+     ++A + LGR+  I+ + VLY+LG+    + +   ++++ C D         
Sbjct: 82  TYLVSPFAGWLADALLGRFYVILGSMVLYLLGMLLFPMVSYSGTRTAFCGDIQWAQIENC 141

Query: 482 ----ATNNDTCSPP--QFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
               A+++DTC  P  ++     F  L +VGL  G  K  +  FGADQ   + P+  +
Sbjct: 142 SRSNASSDDTCPEPSRRYCAPALFLGLIIVGLGVGSVKANITPFGADQVKDRGPEATR 199



>gb:AF142441_1244368 Caenorhabditis elegans H+/oligopeptide
           symporter OPT-3 (opt-3) mRNA, complete cds.
          Length = 701

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 49/153 (32%), Positives = 78/153 (50%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           + +F++G E  ERF++YG+   L  YL      S + A    + +T  A L PL+G+ +A
Sbjct: 16  AVFFMLGNEFCERFSFYGMKTILFIYLITEHEFSPSKATFIYHLFTCIAYLTPLIGSIMA 75

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S  GR++ I+  S +Y++G   L+L AV                 S P       F  L
Sbjct: 76  DSVFGRFKVILYGSSIYVVGHVLLSLGAV--------------PFLSYP-IRSSLDFSGL 120

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
           +++  A G  KPCV AF ADQF T+D ++ +++
Sbjct: 121 FVIAFATGCIKPCVSAFAADQF-TEDQKDLRSQ 152



>sp|O01840|OPT2_CAEEL Hypothetical oligopeptide transporter
           F56F4.5.>pir|T15235|T15235 hypothetical protein F56F4.5
           - Caenorhabditis elegans>gb:AF003146_1230877
           Caenorhabditis elegans cosmid F56F4, complete sequence.
          Length = 701

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 49/153 (32%), Positives = 78/153 (50%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           + +F++G E  ERF++YG+   L  YL      S + A    + +T  A L PL+G+ +A
Sbjct: 16  AVFFMLGNEFCERFSFYGMKTILFIYLITEHEFSPSKATFIYHLFTCIAYLTPLIGSIMA 75

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            S  GR++ I+  S +Y++G   L+L AV                 S P       F  L
Sbjct: 76  DSVFGRFKVILYGSSIYVVGHVLLSLGAV--------------PFLSYP-IRSSLDFSGL 120

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
           +++  A G  KPCV AF ADQF T+D ++ +++
Sbjct: 121 FVIAFATGCIKPCVSAFAADQF-TEDQKDLRSQ 152



>gb:OSJN00056_1694025 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0015K02, complete sequence.
          Length = 574

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 43/121 (35%), Positives = 64/121 (52%), Gaps = 4/121 (3%)
 Frame = +2

Query: 296 AAENV-NAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHS-KSS 469
           AA NV N ++GT S  P++GAFVA +F GR+ T++  +V   + +  +TLSA +   K  
Sbjct: 24  AATNVANVFSGTYSFSPVVGAFVADAFCGRFWTLLFGAVAAFVAMVVITLSATIRQLKPP 83

Query: 470 NCQD-ATNNDTCSPPQ-FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAK 643
           +C D A    TC+ P        +  + L+ +A GG  P    FGADQFD  D     + 
Sbjct: 84  SCSDVARQAGTCAGPSGLHRAVLYIGMALLVVATGGANPTSLPFGADQFDHDDASSGSSS 143

Query: 644 S 646
           +
Sbjct: 144 N 144



>gb:AC115680_1206001 Dictyostelium discoideum chromosome 2 map
           4915084-5005461 strain AX4, complete sequence.
          Length = 582

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 43/142 (30%), Positives = 69/142 (48%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  +I+G E+ ER++YY +   L +YL   +G S   A+   + +   A +  L+GA+VA
Sbjct: 56  SIKYIMGNEICERYSYYALRGILTNYLISFMGYSEKNASSIGHGFNAGAYIFSLVGAYVA 115

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
              LG+Y+TI+  S+LY  G    +++A+              D  SP +         L
Sbjct: 116 DGVLGKYKTILYFSILYCFGAAIFSITAI---------PGITGD--SPGERSPWGLIVGL 164

Query: 545 YLVGLAQGGHKPCVQAFGADQF 610
             + +  GG KP V +F  DQF
Sbjct: 165 TCIAIGTGGIKPVVSSFCGDQF 186



>gb:AF446367_1800500 Arabidopsis thaliana At1g69870/T17F3_10 mRNA,
           complete cds.
          Length = 145

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 31/88 (35%), Positives = 50/88 (56%)
 Frame = +2

Query: 158 IRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASL 337
           +  + G WR+  FI+G E  ER    G+  N + YLT         AA  +N W+G  +L
Sbjct: 48  VEKKPGGWRAVSFILGNETLERLGSIGLLANFMVYLTKVFHLEQVDAANVINIWSGFTNL 107

Query: 338 LPLLGAFVAGSFLGRYRTIISASVLYIL 421
            PL+GA+++ +++GR++TI  AS   +L
Sbjct: 108 TPLVGAYISDTYVGRFKTIAFASFATLL 135



>gb:AC116963_1206896 Dictyostelium discoideum chromosome 2 map
           4657875-4914984 strain AX4, complete sequence.
          Length = 748

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 44/155 (28%), Positives = 78/155 (50%)
 Frame = +2

Query: 185 SAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVA 364
           S  FI+G E+ ER++Y+ +   L +YL   +G ++ TA    + +  +A    L GA++A
Sbjct: 80  SIKFILGNEIGERYSYFAMKSILNNYLIMFMGYNSKTAETIGHIFNASAYFFTLFGAYIA 139

Query: 365 GSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSL 544
            + LG+++TI+  SV+Y  G G  +++A+           T +   S   + +I     L
Sbjct: 140 DARLGKFKTILLFSVIYCFGAGIFSITAI--------PGVTGSGPGSRSPWGLI---LGL 188

Query: 545 YLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSS 649
             + +  GG KP + +F  DQF    P + K  +S
Sbjct: 189 GGIAIGTGGIKPLISSFCGDQF---GPHQKKLLTS 220



>sp|Q9P380|PTR2_SCHPO Probable peptide transporter Ptr2 (Peptide
           permease Ptr2).>gb:SPBC13A2_1718936 S.pombe chromosome
           II cosmid c13A2.
          Length = 618

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 53/166 (31%), Positives = 80/166 (48%), Gaps = 10/166 (6%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLT-GP---------LGQSTATAAENVNAWTGT 328
           W+ A+ II VE+ ERFAYYG+ +   +Y+  GP         LG+S A    N   +T  
Sbjct: 83  WK-AFIIIIVELCERFAYYGLTVPFQNYMQFGPKDATPGALNLGESGADGLSNF--FTFW 139

Query: 329 ASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSP 508
             + P+  A +A  FLGRY TI+ ++V+Y +G+  LT +A+      +  DA  +     
Sbjct: 140 CYVTPVGAALIADQFLGRYNTIVCSAVIYFIGILILTCTAI-----PSVIDAGKS----- 189

Query: 509 PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKS 646
               +  F  SL ++GL  GG K  V    A+Q     P     K+
Sbjct: 190 ----MGGFVVSLIIIGLGTGGIKSNVSPLMAEQLPKIPPYVKTKKN 231



>gb:AB091539_1525054 Carica papaya mRNA for peptide transporter,
           partial cds.
          Length = 101

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 33/96 (34%), Positives = 51/96 (53%)
 Frame = +2

Query: 128 GSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAEN 307
           G VD    P + S++GRW++  F++G E  ER A  GI    ++YL   L     ++  N
Sbjct: 6   GXVDIXRPPXLASKTGRWKACAFLVGNEAFERMALXGIASXXVNYLXTQLHXDPVSSVXN 65

Query: 308 VNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLY 415
           V   +G+  +  + GA +A S LGR  T   +SV+Y
Sbjct: 66  VXXXSGSVWIXXIXGAXIADSDLGRXXTFXISSVIY 101



>gb:AE017282_428868 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 478

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 48/147 (32%), Positives = 62/147 (42%), Gaps = 8/147 (5%)
 Frame = +2

Query: 194 FIIGVEMAERFAYYGIGLNLISYLT--------GPLGQSTATAAENVNAWTGTASLLPLL 349
           FIIG E+AERF+YYG+   L+ ++T         P       A    + +       P L
Sbjct: 55  FIIGNELAERFSYYGMRAILVVFMTRYLVDAAGNPAPMQEGEAKGYFHLFVSLTYFTPFL 114

Query: 350 GAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIF 529
           GA +A   LG+YRTII+ S++Y LG   L L            D T              
Sbjct: 115 GALLADGVLGKYRTIIALSLVYCLGHFALAL------------DDTRTG----------- 151

Query: 530 FFFSLYLVGLAQGGHKPCVQAFGADQF 610
                 L+ L  GG KPCV A   DQF
Sbjct: 152 LLLGQSLIALGAGGIKPCVSAHVGDQF 178



>gb:AE015452_314428 Shewanella oneidensis MR-1 section 1 of 457 of
           the complete genome.>gb:AE014299_950025 Shewanella
           oneidensis MR-1 complete genome.
          Length = 516

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 48/162 (29%), Positives = 73/162 (45%), Gaps = 7/162 (4%)
 Frame = +2

Query: 176 RW-RSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQST------ATAAENVNAWTGTAS 334
           +W R   +II  E  ERF++YG+   L  +L   L  S       A A +  +++     
Sbjct: 9   KWPRQIPYIIASEACERFSFYGMRNILTPFLMTALLLSIPEELRGAVAKDVFHSFVIGVY 68

Query: 335 LLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQ 514
             PLLG ++A  F G+Y TI+  S++Y +G  FL +                       +
Sbjct: 69  FFPLLGGWIADRFFGKYNTILWLSLIYCVGHAFLAIF----------------------E 106

Query: 515 FEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKA 640
             +  F+  L+L+ L  GG KP V +F  DQFD    Q NK+
Sbjct: 107 HSVQGFYTGLFLIALGSGGIKPLVSSFMGDQFD----QSNKS 144



>pir|T47509|T47509 probable transporter protein - Arabidopsis
           thaliana>gb:ATT6D9_1556275 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6D9.
          Length = 516

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 42/157 (26%), Positives = 78/157 (49%), Gaps = 2/157 (1%)
 Frame = +2

Query: 164 SRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTASLLP 343
           S+ G W++  F+I   +    A +G  +NL+ +L       +  A +N N   G  S+LP
Sbjct: 17  SKRGGWKTFPFMIATLLGLSIASFGWVMNLVVFLIKEFNIKSIAATQNSNIVNGCVSMLP 76

Query: 344 LLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNCQDATNNDTC-SPPQF 517
           ++ A +A SF G    I  ++ + +LG+  LT+   L H +   C+  T +  C SP + 
Sbjct: 77  VVAAILADSFFGNIPVISVSAFISLLGIILLTMITSLDHLRPPPCE--TGSILCESPSKL 134

Query: 518 EIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQ 628
           ++   + +L LV +   G +  + + GA+Q++    Q
Sbjct: 135 QLGILYIALALVIIGSAGTRFTLASAGANQYEKPKEQ 171



>gb:BC016233_2092243 Mus musculus solute carrier family 15, member
           4, mRNA (cDNA clone MGC:28803 IMAGE:4502184), complete
           cds.
          Length = 574

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 55/183 (30%), Positives = 82/183 (44%), Gaps = 20/183 (10%)
 Frame = +2

Query: 149 RPAIRSRS----GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTG-PLGQSTATAAENVN 313
           RPA+ + S    GR  +   ++  E+ ER A+YG+  NL+ +L G P     A A++ + 
Sbjct: 13  RPAVSAASAVFAGRRAACGAVLLAELLERAAFYGVTANLVLFLNGAPFDWEGAQASQALL 72

Query: 314 AWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS--------- 466
            + G   L    G ++A + LGR R I+ +  LY+LGL    L A   S+S         
Sbjct: 73  LFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGLLAFPLLAAPRSRSFLCGDPRPE 132

Query: 467 --SNCQDATNNDTCSPPQFE----IIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQ 628
              NC     N + S P+          F  L LVGL     K  +  FGADQ   + P+
Sbjct: 133 LVRNCSAPFPNGSASCPENAARRCAPATFAGLVLVGLGVATVKANITPFGADQVKDRGPE 192

Query: 629 ENK 637
             +
Sbjct: 193 ATR 195



>gb:AY050630_2074568 Mus musculus peptide/histidine transporter
           mRNA, complete cds.
          Length = 576

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 55/183 (30%), Positives = 82/183 (44%), Gaps = 20/183 (10%)
 Frame = +2

Query: 149 RPAIRSRS----GRWRSAYFIIGVEMAERFAYYGIGLNLISYLTG-PLGQSTATAAENVN 313
           RPA+ + S    GR  +   ++  E+ ER A+YG+  NL+ +L G P     A A++ + 
Sbjct: 13  RPAVSAASAVFAGRRAACGAVLLAELLERAAFYGVTANLVLFLNGAPFDWEGAQASQALL 72

Query: 314 AWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS--------- 466
            + G   L    G ++A + LGR R I+ +  LY+LGL    L A   S+S         
Sbjct: 73  LFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGLLAFPLLAAPRSRSFLCGDPRPE 132

Query: 467 --SNCQDATNNDTCSPPQFE----IIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQ 628
              NC     N + S P+          F  L LVGL     K  +  FGADQ   + P+
Sbjct: 133 LVRNCSAPFPNGSASCPENAARRCAPATFAGLVLVGLGVATVKANITPFGADQVKDRGPE 192

Query: 629 ENK 637
             +
Sbjct: 193 ATR 195



>gb:BC037974_1982267 Homo sapiens solute carrier family 15, member
           3, mRNA (cDNA clone MGC:46085 IMAGE:5213632), complete
           cds.
          Length = 581

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 49/158 (31%), Positives = 75/158 (47%), Gaps = 14/158 (8%)
 Frame = +2

Query: 176 RWRSAY--FIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVN-AWTGTASLLPL 346
           RWR A    ++ VEM ER A++G+  NL+ YL       T   A      + G + LL  
Sbjct: 29  RWRRAAGAAVLLVEMLERAAFFGVTANLVLYLNSTNFNWTGEQATRAALVFLGASYLLAP 88

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQD--------ATNNDTC 502
           +G ++A  +LGRYR +  + +LY+   G L  +A    +SS C +        A  +  C
Sbjct: 89  VGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLGPACPSAGC 148

Query: 503 ---SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQ 607
              SP  +     +  L L+GLA    +  + +FGADQ
Sbjct: 149 PRSSPSPYCAPVLYAGLLLLGLAASSVRSNLTSFGADQ 186



>gb:AB020598_1865221 Homo sapiens mRNA for peptide transporter 3,
           complete cds.
          Length = 581

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 49/158 (31%), Positives = 75/158 (47%), Gaps = 14/158 (8%)
 Frame = +2

Query: 176 RWRSAY--FIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVN-AWTGTASLLPL 346
           RWR A    ++ VEM ER A++G+  NL+ YL       T   A      + G + LL  
Sbjct: 29  RWRRAAGAAVLLVEMLERAAFFGVTANLVLYLNSTNFNWTGEQATRAALVFLGASYLLAP 88

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQD--------ATNNDTC 502
           +G ++A  +LGRYR +  + +LY+   G L  +A    +SS C +        A  +  C
Sbjct: 89  VGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLGPACPSAGC 148

Query: 503 ---SPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQ 607
              SP  +     +  L L+GLA    +  + +FGADQ
Sbjct: 149 PRSSPSPYCAPVLYAGLLLLGLAASSVRSNLTSFGADQ 186



>sp|P46031|PT2A_ARATH Peptide transporter PTR2-A.>gb:ATHPTR2_1553332
           Arabidopsis thaliana peptide transporter (ptr2) mRNA,
           complete cds.
          Length = 610

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 10/166 (6%)
 Frame = +2

Query: 179 WRSAYFIIGVEMAERFAYYGIGLNLISYLT-GP---------LGQSTATAAENVNAWTGT 328
           W+ A+ II VE+ ERFAYYG+ +   +Y+  GP         LG++ A    N   +T  
Sbjct: 83  WK-AFIIIIVELCERFAYYGLTVPFQNYMQFGPKDATPGALNLGETGADGLSNF--FTFW 139

Query: 329 ASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSP 508
             + P+  A +A  FLGRY TI+ ++V+Y +G+  LT +A+      +  DA  +     
Sbjct: 140 CYVTPVGAALIADQFLGRYNTIVCSAVIYFIGILILTCTAI-----PSVIDAGKS----- 189

Query: 509 PQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKS 646
               +  F  SL ++GL  GG K  V    A+Q     P     K+
Sbjct: 190 ----MGGFVVSLIIIGLGTGGIKSNVSPLMAEQLPKIPPYVKTKKN 231



>gb:CR378671_95999 Photobacterium profundum SS9; segment 9/12.
          Length = 461

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 47/165 (28%), Positives = 73/165 (44%), Gaps = 5/165 (3%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLT-----GPLGQSTATAAENVNAWTGTASL 337
           G  +  + + G E+ ERF+YY +   L+ YLT     G LG ST  A      +TG   +
Sbjct: 11  GHPKGLFLLFGTELWERFSYYAMRAILVLYLTDKTINGGLGWSTQDALNLYGIYTGLVYI 70

Query: 338 LPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQF 517
            PL+G ++A +FLG+ R+II   VL  LG   L L   +   ++                
Sbjct: 71  TPLIGGWIADNFLGQRRSIIIGGVLMALGQFTLALPHSMIDLNA---------------- 114

Query: 518 EIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENKAKSSF 652
            I  F+  L L+ +  G  KP +     D +   D + + A + F
Sbjct: 115 -ITAFYLGLALLIVGNGLFKPNISTMVGDLYQDGDHRRDGAFTIF 158



>pir|T47508|T47508 probable transporter protein - Arabidopsis
           thaliana>gb:ATT6D9_1556274 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6D9.
          Length = 558

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 47/172 (27%), Positives = 81/172 (47%), Gaps = 2/172 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           S D      G P   S+ G W +  F++   +      +G  +NLI +L       +  A
Sbjct: 6   SGDKEAQISGDPG--SKRGGWITFPFMLATLLGLSVTSFGWVMNLIVFLIEEFNIKSIAA 63

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNC 475
           A+  N   G  S+LP++ A +A SF G    I ++S + +LG+  LTL A L + +   C
Sbjct: 64  AQISNVANGCLSMLPVVAAILADSFFGNIPVIAASSFISLLGIVLLTLIASLDYLRPRPC 123

Query: 476 QDATNNDTCSPP-QFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQ 628
           +    +  C+PP +  +   + +L LV    GG +  + + GA+Q++    Q
Sbjct: 124 E--AGSVLCTPPSKLHLGILYTALALVTTGAGGTRFTMASAGANQYEKPKEQ 173



>gb:AK117660_1815682 Arabidopsis thaliana At3g45680 mRNA for
           putative transporter protein, complete cds, clone:
           RAFL17-32-D16.
          Length = 558

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 47/172 (27%), Positives = 81/172 (47%), Gaps = 2/172 (1%)
 Frame = +2

Query: 119 SVDGSVDYKGRPAIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATA 298
           S D      G P   S+ G W +  F++   +      +G  +NLI +L       +  A
Sbjct: 6   SGDKEAQISGDPG--SKRGGWITFPFMLATLLGLSVTSFGWVMNLIVFLIEEFNIKSIAA 63

Query: 299 AENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVL-HSKSSNC 475
           A+  N   G  S+LP++ A +A SF G    I ++S + +LG+  LTL A L + +   C
Sbjct: 64  AQISNVANGCLSVLPVVAAILADSFFGNIPVIAASSFISLLGIVLLTLIASLDYLRPRPC 123

Query: 476 QDATNNDTCSPP-QFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQ 628
           +    +  C+PP +  +   + +L LV    GG +  + + GA+Q++    Q
Sbjct: 124 E--AGSVLCTPPSKLHLGILYTALALVTTGAGGTRFTMASAGANQYEKPKEQ 173



>gb:AE016961_367775 Coxiella burnetii strain RSA 493, section 2 of 7
           of the complete genome.>gb:AE016828_1008511 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 504

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 34/99 (34%), Positives = 54/99 (54%)
 Frame = +2

Query: 155 AIRSRSGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTGPLGQSTATAAENVNAWTGTAS 334
           ++RS +G+ +  Y I  +E+ ERF YYG+   L+ Y+   LG   + A     A++    
Sbjct: 2   SVRSLTGQPKPFYLIFFIEIWERFGYYGVQALLVLYMVERLGYQDSHADFLFAAFSALVF 61

Query: 335 LLPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAV 451
           LLP LG +V    LG  RTI+  +++  LG   L+L A+
Sbjct: 62  LLPCLGGYVGDKLLGTKRTILLGAIVLALGYLLLSLPAI 100



>gb:AY050629_1935247 Homo sapiens peptide/histidine transporter
           mRNA, complete cds.
          Length = 633

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 50/168 (29%), Positives = 76/168 (45%), Gaps = 12/168 (7%)
 Frame = +2

Query: 170 SGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTG-PLGQSTATAAENVNAWTGTASLLPL 346
           +GR  +   ++  E+ ER A+YGI  NL+ +L G P     A A+E +  + G   L   
Sbjct: 31  AGRLLACGAVLLTELLERAAFYGITSNLVLFLNGAPFCWEGAQASEALLLFMGLTYLGSP 90

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA-----------TNN 493
            G ++A + LGR R I+ +  LY+LG+    L A   ++++ C  A              
Sbjct: 91  FGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAA 150

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
             CSP  F        L LVGL     K  +  FGADQ   + P+  +
Sbjct: 151 RCCSPATFA------GLVLVGLGVATVKANITPFGADQVKDRGPEATR 192



>gb:AY038999_1934821 Homo sapiens peptide/histidine transporter
           (PTR4) mRNA, complete cds.
          Length = 577

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 50/168 (29%), Positives = 76/168 (45%), Gaps = 12/168 (7%)
 Frame = +2

Query: 170 SGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTG-PLGQSTATAAENVNAWTGTASLLPL 346
           +GR  +   ++  E+ ER A+YGI  NL+ +L G P     A A+E +  + G   L   
Sbjct: 31  AGRRAACGAVLLTELLERAAFYGITSNLVLFLNGAPFCWEGAQASEALLLFMGLTYLGSP 90

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDA-----------TNN 493
            G ++A + LGR R I+ +  LY+LG+    L A   ++++ C  A              
Sbjct: 91  FGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAA 150

Query: 494 DTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
             CSP  F        L LVGL     K  +  FGADQ   + P+  +
Sbjct: 151 RCCSPATFA------GLVLVGLGVATVKANITPFGADQVKDRGPEATR 192



>gb:AE012240_280659 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 148 of 460 of the complete
           genome.>gb:AE008922_913941 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 620

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 48/159 (30%), Positives = 69/159 (43%), Gaps = 7/159 (4%)
 Frame = +2

Query: 182 RSAYFIIGVEMAERFAYYGIGLNLISYLTGPL-------GQSTATAAENVNAWTGTASLL 340
           R   FIIG E  ERF++YG+   L+ +L   L        +  A A   ++++       
Sbjct: 116 RQIPFIIGNEACERFSFYGMRNILVQFLITSLLLQEVGAPERDAEAKHILHSFMIGVFFF 175

Query: 341 PLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFE 520
           PLLG ++A  F G+Y TII  S++Y  G   L L           +D+ +          
Sbjct: 176 PLLGGWLADRFFGKYTTIIWFSLIYCAGHACLAL----------FEDSRSG--------- 216

Query: 521 IIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
              FF  L L+    GG KP V +F  DQFD  +    K
Sbjct: 217 ---FFVGLGLIAFGAGGIKPLVASFMGDQFDQSNKHRAK 252



>gb:BC087709_2110176 Rattus norvegicus peptide/histidine
           transporter, mRNA (cDNA clone MGC:105315 IMAGE:7315369),
           complete cds.
          Length = 572

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 51/178 (28%), Positives = 77/178 (43%), Gaps = 22/178 (12%)
 Frame = +2

Query: 170 SGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTG-PLGQSTATAAENVNAWTGTASLLPL 346
           +GR  +   ++  E+ ER A+YG+  NL+ +L G P     A A++ +  + G   L   
Sbjct: 22  AGRRAACGAVLLAELLERAAFYGVTANLVLFLNGAPFNWEGAQASQALLLFMGLTYLGSP 81

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS-----------SNCQDATNN 493
            G ++A + LGR R I+ +  LY+LG+    L A   S+S            NC     N
Sbjct: 82  FGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPRSRSFLCGDPHPELVRNCSAPFPN 141

Query: 494 DT----------CSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
            T          C+P  F        L LVGL     K  +  FGADQ   + P+  +
Sbjct: 142 GTAVCPDAAARRCAPATFA------GLVLVGLGVATVKANITPFGADQVKDRGPEATR 193



>gb:AB000280_2042987 Rattus norvegicus mRNA for peptide/histidine
           transporter, complete cds.
          Length = 572

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 51/178 (28%), Positives = 77/178 (43%), Gaps = 22/178 (12%)
 Frame = +2

Query: 170 SGRWRSAYFIIGVEMAERFAYYGIGLNLISYLTG-PLGQSTATAAENVNAWTGTASLLPL 346
           +GR  +   ++  E+ ER A+YG+  NL+ +L G P     A A++ +  + G   L   
Sbjct: 22  AGRRAACGAVLLAELLERAAFYGVTANLVLFLNGAPFNWEGAQASQALLLFMGLTYLGSP 81

Query: 347 LGAFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKS-----------SNCQDATNN 493
            G ++A + LGR R I+ +  LY+LG+    L A   S+S            NC     N
Sbjct: 82  FGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPRSRSFLCGDPHPELVRNCSAPFPN 141

Query: 494 DT----------CSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
            T          C+P  F        L LVGL     K  +  FGADQ   + P+  +
Sbjct: 142 GTAVCPDAAARRCAPATFA------GLVLVGLGVATVKANITPFGADQVKDRGPEATR 193



>gb:AC149302_1745014 Solanum demissum chromosome 11 clone PGEC400L14
           map MAP_LOC, complete sequence.
          Length = 375

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 38/123 (30%), Positives = 63/123 (51%), Gaps = 1/123 (0%)
 Frame = +2

Query: 248 NLISYLTGPLGQSTATAAENVNAWTGTASLLPLLGAFVAGSFLGRYRTIISASVLYILGL 427
           NLI +L       +  AA+  N   G  ++ P++G  +A S+LG +  I  +S++  LG+
Sbjct: 14  NLIVFLINEFNMKSIAAAKVFNVVNGLTTIFPIVGGIIADSYLGCFSVIWISSLISALGI 73

Query: 428 GFLTLSAVLHS-KSSNCQDATNNDTCSPPQFEIIFFFFSLYLVGLAQGGHKPCVQAFGAD 604
             L L+ V+ + +   C D ++  T SP   + +F + SL L  +  GG +  V   GA 
Sbjct: 74  LLLLLTVVIDALRPLACGDGSSLCT-SPSTNQYVFLYVSLALASIGVGGTRFTVAPMGAY 132

Query: 605 QFD 613
           QFD
Sbjct: 133 QFD 135



>gb:BA000031_706284 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 462

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 5/97 (5%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLT-----GPLGQSTATAAENVNAWTGTASL 337
           G  R  + + G E+ ERF+YY +   L+ YLT     G LG ST  A +    +TG   +
Sbjct: 9   GHPRGLFLLFGTELWERFSYYAMRAILVLYLTDTTMNGGLGWSTKDALDLYGIYTGLVYI 68

Query: 338 LPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA 448
            PL+G ++A ++LG+ R+I+    L  +G   L L A
Sbjct: 69  TPLIGGYLADNYLGQRRSILLGGALMAIGQFTLALPA 105



>gb:AY170828_2516511 Chionodraco hamatus intestinal peptide
           transporter mRNA, partial cds.
          Length = 190

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 368 SFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFFFFSLY 547
           S+LGR++TI+  S++Y+LG   + +SA+     +N     +N T       +      L 
Sbjct: 2   SWLGRFKTIVYLSIVYMLGQVVMAISAIHDLTDANMDGTPDNMT-----LHVALSMVGLI 56

Query: 548 LVGLAQGGHKPCVQAFGADQF-DTQDPQENKAKSSF 652
           L+ L  GG KPCV AFG DQF D Q+ Q +   S F
Sbjct: 57  LIALGTGGIKPCVAAFGGDQFLDHQEKQRSTFFSIF 92



>gb:BA000037_721831 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 462

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 5/97 (5%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLT-----GPLGQSTATAAENVNAWTGTASL 337
           G  R  + + G E+ ERF+YY +   L+ YLT     G LG +T  A +    +TG   +
Sbjct: 9   GHPRGLFLLFGTELWERFSYYAMRAILVLYLTDTTINGGLGWTTKDALDLYGTYTGLVYI 68

Query: 338 LPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA 448
            PL+G ++A ++LG+ R+I+    L  +G   L L A
Sbjct: 69  TPLIGGYLADNYLGQRRSILIGGALMAIGQFTLALPA 105



>gb:AE016797_334975 Vibrio vulnificus CMCP6 chromosome I section 1
           of 11 of the complete sequence.>gb:AE016795_1044699
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 462

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 5/97 (5%)
 Frame = +2

Query: 173 GRWRSAYFIIGVEMAERFAYYGIGLNLISYLT-----GPLGQSTATAAENVNAWTGTASL 337
           G  R  + + G E+ ERF+YY +   L+ YLT     G LG +T  A +    +TG   +
Sbjct: 9   GHPRGLFLLFGTELWERFSYYAMRAILVLYLTDTTINGGLGWTTKDALDLYGTYTGLVYI 68

Query: 338 LPLLGAFVAGSFLGRYRTIISASVLYILGLGFLTLSA 448
            PL+G ++A ++LG+ R+I+    L  +G   L L A
Sbjct: 69  TPLIGGYLADNYLGQRRSILIGGALMAIGQFTLALPA 105



>gb:AE011777_276391 Xanthomonas axonopodis pv. citri str. 306,
           section 155 of 469 of the complete
           genome.>gb:AE008923_918166 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 537

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 49/155 (31%), Positives = 69/155 (44%), Gaps = 7/155 (4%)
 Frame = +2

Query: 194 FIIGVEMAERFAYYGIGLNLISYLTGPL------GQSTATAAENV-NAWTGTASLLPLLG 352
           FIIG E  ERF++YG+   L+ +L   L      G      A+++ +++       PLLG
Sbjct: 37  FIIGNEACERFSFYGMRNILVQFLITSLLLQEISGPGREAEAKHILHSFMIGVYFFPLLG 96

Query: 353 AFVAGSFLGRYRTIISASVLYILGLGFLTLSAVLHSKSSNCQDATNNDTCSPPQFEIIFF 532
            ++A  F G+Y TI+  S++Y  G   L L           +D                F
Sbjct: 97  GWLADRFSGKYNTILWFSLVYCAGHACLAL-------FEGSRDG---------------F 134

Query: 533 FFSLYLVGLAQGGHKPCVQAFGADQFDTQDPQENK 637
           F  L L+ L  GG KP V +F  DQFD    Q NK
Sbjct: 135 FLGLGLIALGAGGIKPLVASFMGDQFD----QSNK 165


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 758,551,751
Number of Sequences: 1806583
Number of extensions: 16456288
Number of successful extensions: 46316
Number of sequences better than 10.0: 452
Number of HSP's better than 10.0 without gapping: 44563
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45996
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 35417417455
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)