BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7879
         (1422 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY007225_1557862 Lycopersicon esculentum transaldolase ToTAL2...   602   e-171   
gb:AY335817_1600220 Gossypium hirsutum transaldolase mRNA, compl...   540   e-152   
pir|D86257|D86257 hypothetical protein [imported] - Arabidopsis ...   522   e-147   Arabidopsis thaliana [mouse-ear cress]
gb:AY088530_1573548 Arabidopsis thaliana clone 7590 mRNA, comple...   521   e-146   
gb:AP003940_1835550 Oryza sativa (japonica cultivar-group) genom...   481   e-134   
gb:AY062427_1565090 Arabidopsis lyrata cultivar CE RFL1 gene, co...   478   e-133   
gb:AY062398_1565057 Arabidopsis thaliana cultivar KAS RFL1 gene,...   478   e-133   
gb:AY062396_1565054 Arabidopsis thaliana cultivar FM RFL1 pseudo...   478   e-133   
gb:AY062395_1565053 Arabidopsis thaliana cultivar AB RFL1 pseudo...   476   e-133   
gb:AY062394_1565052 Arabidopsis thaliana cultivar TSU RFL1 gene,...   476   e-133   
gb:AY062393_1565050 Arabidopsis thaliana cultivar ZU RFL1 pseudo...   476   e-133   
gb:AY062384_1565035 Arabidopsis thaliana cultivar ANG RFL1 gene,...   476   e-133   
gb:AY062403_1565064 Arabidopsis thaliana cultivar CVI RFL1 gene,...   476   e-133   
gb:AY062388_1565042 Arabidopsis thaliana cultivar KZ RFL1 pseudo...   475   e-133   
pir|D64167|D64167 transaldolase (EC 2.2.1.2) - Haemophilus influ...   180   7e-44   Haemophilus influenzae
gb:AE016827_343984 Mannheimia succiniciproducens MBEL55E, comple...   179   1e-43   
sp|P45055|TAL_HAEIN|TAL_HAEIN Transaldolase (EC 2.2.1.2).                       179   1e-43   Haemophilus influenzae
sp|Q9CKL0|TALA_PASMU|TALA_PASMU Transaldolase A (EC 2.2.1.2).>gb:AE006198_2...   173   9e-42   Pasteurella multocida
gb:AE016755_324081 Escherichia coli CFT073 section 1 of 18 of th...   171   3e-41   
pir|S40535|S40535 transaldolase (EC 2.2.1.2) B - Escherichia col...   170   6e-41   Escherichia coli K-12
pir|AH0502|AH0502 transaldolase B [imported] - Salmonella enteri...   169   1e-40   Salmonella enterica subsp. enterica serovar Typhi
sp|P30148|TALB_ECOLI|TALB_ECOLI Transaldolase B (EC 2.2.1.2).                    169   1e-40   Escherichia coli [E. coli]
sp|Q8FLD1|TALB_ECOL6|TALB_ECOL6 Transaldolase B (EC 2.2.1.2).                    169   1e-40   
sp|Q8XG45|TALB_SALTY|TALB_SALTY Transaldolase B (EC 2.2.1.2).                    169   2e-40   Salmonella enterica subsp. enterica serovar Typhimurium
gb:AY144880_1583671 Saccharomyces bayanus clone Contig3892 YGR04...   168   3e-40   
sp|P58561|TAL_ANASP|TAL_ANASP Transaldolase (EC 2.2.1.2).>pir|AD2126|AD212...   167   4e-40   Anabaena sp.
sp|Q8Y014|TAL_RALSO|TAL_RALSO Transaldolase (EC 2.2.1.2).>gb:AL646063_5461...   166   8e-40   Ralstonia solanacearum
sp|Q7V6B8|TAL_PROMM|TAL_PROMM Transaldolase (EC 2.2.1.2).>gb:BX572098_7985...   166   8e-40   Prochlorococcus marinus
gb:AF424665_1799000 Phytophthora infestans clone MY-11-C-10 tran...   166   1e-39   
gb:CR378675_96907 Photobacterium profundum SS9 chromosome 2; seg...   166   1e-39   
gb:CP000021_873436 Vibrio fischeri ES114 chromosome II, complete...   165   2e-39   
gb:BX936398_835251 Yersinia pseudotuberculosis IP32953 genome, c...   165   2e-39   
gb:AE013974_302002 Yersinia pestis KIM section 374 of 415 of the...   165   2e-39   
sp|Q8ZIN2|TAL_YERPE|TAL_YERPE Transaldolase (EC 2.2.1.2).>pir|AD0057|AD005...   165   2e-39   Yersinia pestis
sp|Q8D6H9|TAL_VIBVU|TAL_VIBVU Transaldolase (EC 2.2.1.2).>gb:AE016810_3382...   164   3e-39   Vibrio vulnificus
sp|Q7V2G1|TAL_PROMP|TAL_PROMP Transaldolase (EC 2.2.1.2).>gb:BX572091_7961...   164   3e-39   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
gb:AJ720046_2502233 Gallus gallus mRNA for hypothetical protein,...   164   4e-39   
sp|Q7MDD5|TAL_VIBVY|TAL_VIBVY Transaldolase (EC 2.2.1.2).>gb:BA000038_7251...   163   7e-39   Vibrio vulnificus
sp|Q9CKH9|TALB_PASMU|TALB_PASMU Transaldolase B (EC 2.2.1.2).>gb:AE006201_2...   163   7e-39   Pasteurella multocida
sp|P51778|TAL_ANAVA|TAL_ANAVA Transaldolase (EC 2.2.1.2).>pir|S72517|S7251...   163   9e-39   
sp|Q87GY5|TAL_VIBPA|TAL_VIBPA Transaldolase (EC 2.2.1.2).>gb:BA000032_7097...   162   1e-38   
gb:AE017282_429729 Methylococcus capsulatus str. Bath, complete ...   162   2e-38   
sp|Q7U5E8|TAL_SYNPX|TAL_SYNPX Transaldolase (EC 2.2.1.2).>gb:BX569693_7766...   162   2e-38   Synechococcus sp.
gb:BX908798_831247 Parachlamydia-related symbiont UWE25, complet...   160   5e-38   
sp|Q8DLL7|TAL_SYNEL|TAL_SYNEL Transaldolase (EC 2.2.1.2).>gb:BA000039_7262...   160   6e-38   Synechococcus elongatus
sp|Q884H4|TAL_PSESM|TAL_PSESM Transaldolase (EC 2.2.1.2).>gb:AE016863_3515...   159   1e-37   Pseudomonas syringae pv. tomato
sp|Q7VD64|TAL_PROMA|TAL_PROMA Transaldolase (EC 2.2.1.2).>gb:AE017162_3949...   159   1e-37   Prochlorococcus marinus
gb:BC084118_2563523 Xenopus laevis hypothetical LOC495027, mRNA ...   159   2e-37   
gb:BX950851_842622 Erwinia carotovora subsp. atroseptica SCRI104...   158   2e-37   
sp|Q7NK81|TAL_GLOVI|TAL_GLOVI Transaldolase (EC 2.2.1.2).>gb:BA000045_7416...   158   3e-37   Gloeobacter violaceus
sp|Q7N8Z1|TAL_PHOLL|TAL_PHOLL Transaldolase (EC 2.2.1.2).>gb:BX571860_7854...   157   4e-37   Photorhabdus laumondii subsp. laumondii
gb:AY658919_2147929 Synthetic construct Peudomonas aeruginosa cl...   156   9e-37   
sp|Q9I047|TAL_PSEAE|TAL_PSEAE Transaldolase (EC 2.2.1.2).>pir|D83295|D8329...   156   9e-37   Pseudomonas aeruginosa
gb:SCTAL1_1709611 Saccharomyces cerevisiae TAL1 gene for transal...   155   1e-36   
pir|S51462|S51462 transaldolase (EC 2.2.1.2) TAL1 - yeast (Sacch...   155   1e-36   Saccharomyces cerevisiae [brewer's yeast]
sp|Q9KLW8|TAL_VIBCH|TAL_VIBCH Transaldolase (EC 2.2.1.2).>pir|B82437|B8243...   155   1e-36   
sp|P15019|TAL1_YEAST|TAL1_YEAST Transaldolase (EC 2.2.1.2).                      155   1e-36   Saccharomyces cerevisiae [brewer's yeast]
gb:CP000010_866147 Burkholderia mallei ATCC 23344 chromosome 1, ...   155   2e-36   
gb:BX571965_790876 Burkholderia pseudomallei strain K96243, chro...   154   4e-36   
sp|Q8EBH2|TAL_SHEON|TAL_SHEON Transaldolase (EC 2.2.1.2).>gb:AE015791_3178...   154   4e-36   Shewanella oneidensis
sp|P53228|TAL2_YEAST|TAL2_YEAST Putative transaldolase (EC 2.2.1.2).>pir|S6...   154   4e-36   Saccharomyces cerevisiae [brewer's yeast]
gb:AY557832_1614059 Saccharomyces cerevisiae clone FLH002950.01X...   154   6e-36   
gb:BX950851_839611 Erwinia carotovora subsp. atroseptica SCRI104...   154   6e-36   
sp|Q88KX1|TAL_PSEPK|TAL_PSEPK Transaldolase (EC 2.2.1.2).>gb:AE016782_3315...   154   6e-36   Pseudomonas putida
sp|Q7VP02|TAL_HAEDU|TAL_HAEDU Transaldolase (EC 2.2.1.2).>gb:AE017151_3918...   154   6e-36   [Haemophilus] ducreyi
gb:AY144881_1583672 Saccharomyces bayanus clone Contig4169 TAL1 ...   153   7e-36   
gb:BX640441_814097 Bordetella bronchiseptica strain RB50, comple...   153   7e-36   
sp|Q7WME6|TAL_BORBR|TAL_BORBR Transaldolase (EC 2.2.1.2).>sp|Q7WAY2|TAL_BO...   153   7e-36   Bordetella bronchiseptica
sp|Q7VY99|TAL_BORPE|TAL_BORPE Transaldolase (EC 2.2.1.2).>gb:BX640415_8058...   153   1e-35   Bordetella pertussis
gb:AP008231_581498 Synechococcus elongatus PCC 6301 DNA, complet...   152   1e-35   
gb:CR382138_1671590 Debaryomyces hansenii chromosome F of strain...   152   2e-35   
gb:AY144981_1583772 Saccharomyces castellii clone Contig1500 TAL...   152   2e-35   
gb:BC061957_2553337 Danio rerio transaldolase 1, mRNA (cDNA clon...   150   5e-35   
gb:AY144980_1583771 Saccharomyces castellii clone Contig2026 TAL...   150   5e-35   
gb:BC068191_2554997 Danio rerio transaldolase 1, mRNA (cDNA clon...   149   1e-34   
sp|Q93092|TAL1_MOUSE|TAL1_MOUSE Transaldolase (EC 2.2.1.2).>gb:BC004754_208...   149   1e-34   Mus musculus [mouse]
gb:BC018847_1976646 Homo sapiens transaldolase 1, mRNA (cDNA clo...   149   1e-34   
pir|S39870|S39870 transaldolase (EC 2.2.1.2) - yeast (Kluyveromy...   149   1e-34   Kluyveromyces lactis
sp|P34214|TAL1_KLULA|TAL1_KLULA Transaldolase (EC 2.2.1.2).                      149   1e-34   Kluyveromyces lactis
sp|P37837|TAL1_HUMAN|TAL1_HUMAN Transaldolase (EC 2.2.1.2).>gb:AF058913_187...   149   1e-34   Homo sapiens [man]
gb:BC059126_2103645 Rattus norvegicus transaldolase 1, mRNA (cDN...   149   2e-34   
sp|Q8VI73|TAL1_CRIGR|TAL1_CRIGR Transaldolase (EC 2.2.1.2).>gb:AF128242_205...   148   3e-34   Cricetulus griseus [Chinese hamsters]
sp|Q9S0X4|TAL_METAM|TAL_METAM Transaldolase (EC 2.2.1.2).>gb:AB026428_4375...   147   4e-34   Methylomonas aminofaciens
sp|P78258|TALA_ECOLI|TALA_ECOLI Transaldolase A (EC 2.2.1.2).>pir|F91044|F9...   147   4e-34   Escherichia coli [E. coli]
sp|O42700|TAL1_SCHPO|TAL1_SCHPO Transaldolase (EC 2.2.1.2).>pir|T40834|T408...   147   5e-34   Schizosaccharomyces pombe
gb:AY145032_1583823 Saccharomyces kluyveri clone Contig2283 TAL1...   146   9e-34   
gb:BC009680_1972171 Homo sapiens transaldolase 1, mRNA (cDNA clo...   146   1e-33   
gb:CR380948_1649332 Candida glabrata strain CBS138 chromosome B ...   145   2e-33   
sp|P72797|TAL_SYNY3|TAL_SYNY3 Transaldolase (EC 2.2.1.2).>pir|S74660|S7466...   145   2e-33   Synechocystis sp.
sp|Q8Z4T0|TALA_SALTI|TALA_SALTI Transaldolase A (EC 2.2.1.2).>pir|AE0815|AE...   145   2e-33   Salmonella enterica subsp. enterica serovar Typhi
gb:AE016986_372273 Shigella flexneri 2a str. 2457T section 9 of ...   145   3e-33   
sp|Q83QM8|TALA_SHIFL|TALA_SHIFL Transaldolase A (EC 2.2.1.2).>gb:AE005674_7...   145   3e-33   Shigella flexneri
sp|Q9EQS0|TAL1_RAT|TAL1_RAT Transaldolase (EC 2.2.1.2).>gb:AF069306_20532...   145   3e-33   Rattus norvegicus [brown rat]
gb:AE017351_1759582 Cryptococcus neoformans var. neoformans JEC2...   144   3e-33   
gb:AE016835_344571 Salmonella enterica subsp. enterica serovar T...   144   6e-33   
gb:AC006729_1203886 Caenorhabditis elegans cosmid Y24D9A, comple...   143   8e-33   
gb:CP000026_75291 Salmonella enterica subsp. enterica serovar Pa...   143   1e-32   
sp|Q8ZN83|TALA_SALTY|TALA_SALTY Transaldolase A (EC 2.2.1.2).>gb:AE008811_2...   143   1e-32   Salmonella enterica subsp. enterica serovar Typhimurium
gb:AY850336_1180306 Magnaporthe grisea transaldolase-like protei...   140   5e-32   
gb:AE016816_1746496 Ashbya gossypii (= Eremothecium gossypii) AT...   140   6e-32   
pir|A49985|A49985 transaldolase (EC 2.2.1.2) - human                  139   1e-31   Homo sapiens [man]
gb:CR382132_1665593 Yarrowia lipolytica chromosome F of strain C...   139   1e-31   
gb:CR380957_1652696 Candida glabrata strain CBS138 chromosome K ...   138   2e-31   
sp|Q8U7I5|TAL_AGRT5|TAL_AGRT5 Transaldolase (EC 2.2.1.2).>pir|H98181|H9818...   138   3e-31   Agrobacterium tumefaciens
gb:AE013599_1133647 Drosophila melanogaster chromosome 2R, compl...   137   5e-31   
sp|Q9W1G0|TAL1_DROME|TAL1_DROME Probable transaldolase (EC 2.2.1.2).>gb:AY1...   137   5e-31   Drosophila melanogaster
sp|Q8PNY6|TAL_XANAC|TAL_XANAC Transaldolase (EC 2.2.1.2).>gb:AE011721_2758...   137   7e-31   Xanthomonas citri
sp|P57194|TAL_BUCAI|TAL_BUCAI Transaldolase (EC 2.2.1.2).>pir|D84940|D8494...   137   7e-31   
gb:AF404121_507780 Xanthomonas campestris pv. phaseoli transaldo...   136   9e-31   
sp|Q9PK80|TAL_CHLMU|TAL_CHLMU Transaldolase (EC 2.2.1.2).>pir|E81686|E8168...   136   9e-31   Chlamydia muridarum [agent of mouse pneumonitis]
gb:AE013598_297350 Xanthomonas oryzae pv. oryzae KACC10331, comp...   134   4e-30   
gb:CR543861_103901 Acinetobacter sp. ADP1 complete genome.            133   8e-30   
sp|O84315|TAL_CHLTR|TAL_CHLTR Transaldolase (EC 2.2.1.2).>pir|G71531|G7153...   131   4e-29   Chlamydia trachomatis
sp|Q8PCA4|TAL_XANCP|TAL_XANCP Transaldolase (EC 2.2.1.2).>gb:AE012182_2801...   127   4e-28   Xanthomonas campestris pv. campestris
sp|Q8D1X3|TAL_WIGBR|TAL_WIGBR Transaldolase (EC 2.2.1.2).>gb:BA000021_6873...   127   4e-28   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
pir|D81550|D81550 transaldolase CP0692 [imported] - Chlamydophil...   127   6e-28   Chlamydia pneumoniae
sp|Q9Z998|TAL_CHLPN|TAL_CHLPN Transaldolase (EC 2.2.1.2).>pir|E72120|E7212...   127   6e-28   Chlamydia pneumoniae
sp|Q7VRT4|TAL_CANBF|TAL_CANBF Transaldolase (EC 2.2.1.2).>gb:BX248586_7641...   127   7e-28   Candidatus Blochmannia floridanus
sp|Q8KA27|TAL_BUCAP|TAL_BUCAP Transaldolase (EC 2.2.1.2).>gb:AE014084_3030...   127   7e-28   
sp|Q822J3|TAL_CHLCV|TAL_CHLCV Transaldolase (EC 2.2.1.2).>gb:AE016996_3747...   126   1e-27   Chlamydia caviae
sp|Q89AY3|TAL_BUCBP|TAL_BUCBP Transaldolase (EC 2.2.1.2).>gb:AE014016_3025...   119   2e-25   
gb:D89215_1675332 Schizosaccharomyces pombe mRNA, partial cds, c...   115   2e-24   
pir|T43036|T43036 probable transaldolase (EC 2.2.1.2) - fission ...   115   2e-24   Schizosaccharomyces pombe
gb:AY872138_2150302 Synthetic construct hypothetical protein (FT...   107   6e-22   
gb:AJ749949_531550 Francisella tularensis subsp. tularensis comp...   107   6e-22   
gb:AY232008_1177301 Drosophila yakuba clone yak-ad_CG2827 mRNA s...   103   1e-20   
gb:AF481103_514487 Candidatus Tremblaya princeps transaldolase (...   103   1e-20   
gb:AB010049_1510829 Schizosaccharomyces pombe mRNA for transaldo...    97   1e-18   
pir|T43308|T43308 transaldolase (EC 2.2.1.-) - fission yeast  (S...    97   1e-18   Schizosaccharomyces pombe
gb:AF211124_488685 Carsonella ruddii country USA tryptophanyl-tR...    90   1e-16   
gb:MMU63159_2122848 Mus musculus transaldolase mRNA, partial cds.      77   7e-13   
gb:AF211135_488697 Carsonella ruddii natural-host Ctenarytaina s...    77   1e-12   
gb:AF211141_488702 Carsonella ruddii natural-host Pachypsylla ce...    74   1e-11   
gb:AF211133_488691 Carsonella ruddii natural-host Ctenarytaina e...    73   1e-11   
sp|Q9WYD1|TAL_THEMA|TAL_THEMA Transaldolase (EC 2.2.1.2).>pir|G72394|G7239...    68   4e-10   Thermotoga maritima
gb:AF544969_1151042 Ctenopharyngodon idella transaldolase mRNA, ...    68   5e-10   
gb:AC006729_1203887 Caenorhabditis elegans cosmid Y24D9A, comple...    67   9e-10   
gb:BX957222_844561 Methanococcus maripaludis S2 complete genome;...    64   8e-09   
gb:BC046011_2549522 Danio rerio zgc:56232, mRNA (cDNA clone MGC:...    63   1e-08   
gb:AF211134_488694 Carsonella ruddii natural-host Ctenarytaina l...    62   4e-08   
sp|Q58370|TAL_METJA|TAL_METJA Probable transaldolase (EC 2.2.1.2).>pir|H64...    59   2e-07   Methanocaldococcus jannaschii
sp|Q88S98|TAL_LACPL|TAL_LACPL Probable transaldolase (EC 2.2.1.2).>gb:AL93...    59   3e-07   Lactobacillus plantarum
gb:AE017180_401266 Geobacter sulfurreducens PCA, complete genome.      58   4e-07   
sp|O66520|TAL_AQUAE|TAL_AQUAE Probable transaldolase (EC 2.2.1.2).>pir|E70...    56   2e-06   Aquifex aeolicus
sp|Q8R8S6|TAL_THETN|TAL_THETN Probable transaldolase (EC 2.2.1.2).>gb:AE01...    56   2e-06   
sp|Q7MXG0|TAL_PORGI|TAL_PORGI Probable transaldolase (EC 2.2.1.2).>gb:AE01...    55   3e-06   Porphyromonas gingivalis
sp|Q8XMJ6|TAL_CLOPE|TAL_CLOPE Probable transaldolase (EC 2.2.1.2).>gb:BA00...    55   5e-06   Clostridium perfringens
sp|Q97JD9|TAL_CLOAB|TAL_CLOAB Probable transaldolase (EC 2.2.1.2).>pir|H97...    54   6e-06   Clostridium acetobutylicum
gb:BA000043_739962 Geobacillus kaustophilus HTA426 DNA, complete...    54   8e-06   
pir|G75407|G75407 transaldolase - Deinococcus radiodurans (strai...    54   8e-06   Deinococcus radiodurans
sp|Q9RUP6|TAL_DEIRA|TAL_DEIRA Probable transaldolase (EC 2.2.1.2).               54   8e-06   Deinococcus radiodurans
gb:BX897700_829428 Bartonella quintana str. Toulouse, complete g...    53   1e-05   
gb:BX897699_828117 Bartonella henselae strain Houston-1, complet...    53   2e-05   
gb:CP000031_87129 Silicibacter pomeroyi DSS-3, complete genome.        53   2e-05   
sp|Q9K6E4|TAL_BACHD|TAL_BACHD Probable transaldolase (EC 2.2.1.2).>pir|A84...    53   2e-05   Bacillus halodurans
sp|Q9A2F1|TAL_CAUCR|TAL_CAUCR Probable transaldolase (EC 2.2.1.2).>pir|D87...    51   7e-05   Caulobacter vibrioides
gb:BX842646_823100 Bdellovibrio bacteriovorus complete genome, s...    50   1e-04   
gb:AP006627_566197 Bacillus clausii KSM-K16 DNA, complete genome.      50   1e-04   
gb:AP006618_559971 Nocardia farcinica IFM 10152 DNA, complete ge...    49   2e-04   
gb:AE017331_445146 Listeria monocytogenes str. 4b F2365, section...    49   3e-04   
sp|Q8FYQ9|TAL_BRUSU|TAL_BRUSU Probable transaldolase (EC 2.2.1.2).>gb:AE01...    49   3e-04   Brucella suis bv. 1
sp|Q8YJ42|TAL_BRUME|TAL_BRUME Probable transaldolase (EC 2.2.1.2).>pir|AG3...    49   3e-04   
sp|Q927A3|TAL1_LISIN|TAL1_LISIN Probable transaldolase 1 (EC 2.2.1.2).>pir|...    49   3e-04   
gb:AE017231_411882 Mycobacterium avium subsp. paratuberculosis s...    48   4e-04   
sp|O06812|TAL_MYCTU|TAL_MYCTU Transaldolase (EC 2.2.1.2).>pir|C70917|C7091...    48   4e-04   Mycobacterium tuberculosis
sp|P59955|TAL_MYCBO|TAL_MYCBO Transaldolase (EC 2.2.1.2).>gb:AE000516_2153...    48   4e-04   Mycobacterium tuberculosis variant bovis
gb:BX251411_764626 Tropheryma whipplei TW08/27, complete genome;...    48   6e-04   
gb:AE016851_348865 Tropheryma whipplei str. Twist, section 2 of ...    48   6e-04   
gb:AE017355_464462 Bacillus thuringiensis serovar konkukian str....    47   7e-04   
sp|P55193|TAL_MYCLE|TAL_MYCLE Transaldolase (EC 2.2.1.2).>pir|T11020|T1102...    47   7e-04   Mycobacterium leprae
sp|Q81MY9|TAL2_BACAN|TAL2_BACAN Probable transaldolase 2 (EC 2.2.1.2).>gb:A...    47   7e-04   Bacillus anthracis [anthrax]
sp|Q8KGF8|TAL_CHLTE|TAL_CHLTE Probable transaldolase (EC 2.2.1.2).>gb:AE01...    47   0.001   Chlorobaculum tepidum
sp|Q8Y3T8|TAL1_LISMO|TAL1_LISMO Probable transaldolase 1 (EC 2.2.1.2).>pir|...    47   0.001   
gb:AF417540_509429 Bifidobacterium infantis strain ATCC 15702 tr...    47   0.001   
sp|Q8E3B1|TAL_STRA3|TAL_STRA3 Probable transaldolase (EC 2.2.1.2).>sp|Q8DX...    46   0.002   
gb:AF087301_478162 Chlamydia trachomatis 344 transaldolase (tal)...    46   0.002   
sp|Q99YJ2|TAL_STRPY|TAL_STRPY Probable transaldolase (EC 2.2.1.2).>gb:AE00...    46   0.002   Streptococcus pyogenes
gb:AE014295_311109 Bifidobacterium longum NCC2705, complete genome.    45   0.003   
sp|Q92EU7|TAL2_LISMO|TAL2_LISMO Probable transaldolase 2 (EC 2.2.1.2).>pir|...    45   0.003   
sp|Q81B21|TAL2_BACCR|TAL2_BACCR Probable transaldolase 2 (EC 2.2.1.2).>gb:A...    45   0.004   Bacillus cereus
gb:HUMTALH_2036816 Homo sapiens transaldolase (TALH) gene, exons...    45   0.005   
gb:AP008226_578523 Thermus thermophilus HB8 genomic DNA, complet...    45   0.005   
gb:AE017303_436341 Thermus thermophilus HB27 section 3 of 7 of t...    44   0.006   
gb:CP000009_863688 Gluconobacter oxydans 621H, complete genome.        44   0.008   
gb:BA000040_735018 Bradyrhizobium japonicum USDA 110 DNA, comple...    43   0.014   
gb:AE017342_1755171 Cryptococcus neoformans var. neoformans JEC2...    43   0.018   
gb:BX248357_762580 Corynebacterium diphtheriae gravis NCTC13129,...    43   0.018   
gb:BA000045_743452 Gloeobacter violaceus PCC 7421 DNA, complete ...    43   0.018   
gb:CP000027_80378 Dehalococcoides ethenogenes 195, complete genome.    43   0.018   
gb:AB106333_13200 Gluconobacter oxydans tkt, tal-pgi, gnd genes ...    43   0.018   
gb:AE016822_340236 Leifsonia xyli subsp. xyli str. CTCB07, compl...    42   0.024   
sp|O88018|TAL1_STRCO|TAL1_STRCO Transaldolase 1 (EC 2.2.1.2).>pir|T35161|T3...    42   0.024   
gb:BA000030_699654 Streptomyces avermitilis MA-4680 genomic DNA,...    42   0.031   
gb:AX973017_1488326 Sequence 3820 from Patent EP1104808.               42   0.041   
gb:AX973016_1488325 Sequence 3819 from Patent EP1104808.               42   0.041   
gb:AE017283_430238 Propionibacterium acnes KPA171202, complete g...    41   0.053   
sp|Q9XAC0|TAL2_STRCO|TAL2_STRCO Transaldolase 2 (EC 2.2.1.2).>pir|T36008|T3...    41   0.053   
gb:BA000030_704200 Streptomyces avermitilis MA-4680 genomic DNA,...    41   0.069   
gb:AE005674_70357 Shigella flexneri 2a str. 301, complete genome...    41   0.069   
pir|A64820|A64820 transaldolase-like protein (EC 2.2.1.-) - Esch...    41   0.069   Escherichia coli K-12
sp|P78055|FSAA_ECOLI|FSAA_ECOLI Fructose-6-phosphate aldolase 1 (EC 4.1.2.-...    41   0.069   Escherichia coli [E. coli]
gb:BA000035_716478 Corynebacterium efficiens YS-314 DNA, complet...    40   0.091   
gb:AE017258_418312 Wolbachia endosymbiont of Drosophila melanoga...    40   0.091   
pir|B85592|B85592 probable transaldolase mipB [imported] - Esche...    40   0.12    Escherichia coli O157:H7
sp|P58423|FSAA_ECO57|FSAA_ECO57 Fructose-6-phosphate aldolase 1 (EC 4.1.2.-).     40   0.12    Escherichia coli O157:H7
gb:BA000036_719302 Corynebacterium glutamicum ATCC 13032 DNA, co...    40   0.15    
gb:APU33282_582377 Anabaena PCC7120 zwf region, fructose 1,6-bis...    39   0.20    
gb:AE016918_357208 Chromobacterium violaceum ATCC 12472 section ...    39   0.20    
gb:AE016757_324952 Escherichia coli CFT073 section 3 of 18 of th...    39   0.20    
sp|P48993|TAL2_ANASP|TAL2_ANASP Transaldolase 2 (EC 2.2.1.2).>pir|AE2308|AE...    39   0.20    Anabaena sp.
sp|P48983|TAL2_NOSPU|TAL2_NOSPU Transaldolase 2 (EC 2.2.1.2).>gb:NOSFTZOOP_...    39   0.26    Nostoc punctiforme
gb:AF087310_478170 Chlamydia trachomatis 463 transaldolase B (ta...    39   0.34    
gb:AE004969_61267 Neisseria gonorrhoeae FA 1090, complete genome.      38   0.45    
sp|Q9K139|TAL_NEIMB|TAL_NEIMB Transaldolase (EC 2.2.1.2).>pir|E81210|E8121...    38   0.45    Neisseria meningitidis serogroup B
sp|Q9JSU1|TAL_NEIMA|TAL_NEIMA Transaldolase (EC 2.2.1.2).>pir|E81785|E8178...    38   0.45    
gb:BA000032_710109 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    38   0.59    
gb:AE016911_355525 Chromobacterium violaceum ATCC 12472 section ...    37   0.77    
gb:U00013_198795 Mycobacterium leprae cosmid B1496.                    37   0.77    
gb:CR555306_108051 Azoarcus sp. EbN1 complete genome.                  37   0.77    
sp|P56108|TAL_HELPY|TAL_HELPY Transaldolase (EC 2.2.1.2).>pir|G64706|G6470...    37   0.77    Helicobacter pylori
gb:AE010778_266475 Methanosarcina acetivorans str. C2A, section ...    37   1.0     
gb:CP000002_859425 Bacillus licheniformis ATCC 14580, complete g...    36   1.7     
gb:AE017333_449639 Bacillus licheniformis DSM 13, complete genome.     36   1.7     
gb:AE016770_328871 Escherichia coli CFT073 section 16 of 18 of t...    36   2.2     
sp|P32669|FSAB_ECOLI|FSAB_ECOLI Fructose-6-phosphate aldolase 2 (EC 4.1.2.-...    36   2.2     Escherichia coli [E. coli]
gb:AY070515_1294660 Drosophila melanogaster GH20378 full length ...    35   2.9     
gb:AE014297_1139052 Drosophila melanogaster chromosome 3R, compl...    35   2.9     
sp|Q8ZKM8|FSA_SALTY|FSA_SALTY Probable fructose-6-phosphate aldolase (EC 4...    35   2.9     Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q8Z305|FSA_SALTI|FSA_SALTI Probable fructose-6-phosphate aldolase (EC 4...    35   2.9     Salmonella enterica subsp. enterica serovar Typhi
sp|P58424|FSAB_ECO57|FSAB_ECO57 Fructose-6-phosphate aldolase 2 (EC 4.1.2.-...    35   3.8     Escherichia coli O157:H7
pir|C64594|C64594 hypothetical protein HP0595 - Helicobacter pyl...    35   5.0     Helicobacter pylori
gb:AJ628768_1494503 Bacteriophage S-RSM2 ORF1, omp1 gene, psbA g...    34   8.5     
gb:BX908798_831539 Parachlamydia-related symbiont UWE25, complet...    34   8.5     
sp|P27206|SRF1_BACSU|SRF1_BACSU Surfactin synthetase subunit 1.>pir|I40485|...    34   8.5     Bacillus subtilis


>gb:AY007225_1557862 Lycopersicon esculentum transaldolase ToTAL2
            mRNA, complete cds.
          Length = 397

 Score =  602 bits (1553), Expect = e-171
 Identities = 300/395 (75%), Positives = 332/395 (84%)
 Frame = +3

Query: 30   MSTTLHXXXXXXXXXXXXXXXXQERKLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLD 209
            MS++LH                Q+RKL+ A    KP+L F  +  FP+IRASAGFSSSLD
Sbjct: 1    MSSSLHSPLYSSLSSSSAL---QDRKLRNAVNFAKPNLIFKPRRSFPLIRASAGFSSSLD 57

Query: 210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL 389
            TGL+TELDAV N+SEIVPDTV+FDDFEKFPPTA T SSSLLLGIC LPDTKFKSAVD AL
Sbjct: 58   TGLSTELDAVANHSEIVPDTVIFDDFEKFPPTAGTASSSLLLGICGLPDTKFKSAVDRAL 117

Query: 390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL 569
            +D ECYGLE  D +MSCFFNKAL +VGGDLAKLVPGRVSTEVDARLAYDTHGIV KVHDL
Sbjct: 118  SDSECYGLESSDLQMSCFFNKALAHVGGDLAKLVPGRVSTEVDARLAYDTHGIVRKVHDL 177

Query: 570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVI 749
            LK Y  IE+PPERLLFKIPATWQGIEASR+LEAEGIQTHLTFVYSFC          SVI
Sbjct: 178  LKAYTEIEVPPERLLFKIPATWQGIEASRVLEAEGIQTHLTFVYSFCQAAAAAQAGASVI 237

Query: 750  QIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQ 929
            QIFVGRLRDW+RNH+GDSEVE ALRRGEDPG ALVTK YNYIHKYGHK+KLMAAA+RNK 
Sbjct: 238  QIFVGRLRDWSRNHTGDSEVESALRRGEDPGLALVTKTYNYIHKYGHKTKLMAAAVRNKP 297

Query: 930  DVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYS 1109
            DV+++LG  YI+TPLK+LQSLKESVT  DEKYSF RRLSPQSAAA+NFT++E+  WDQYS
Sbjct: 298  DVFNLLGGGYIITPLKVLQSLKESVTLLDEKYSFTRRLSPQSAAAFNFTQDELQKWDQYS 357

Query: 1110 FASAMGPAAVELLTAGMEGYSNQAKRVEELFGKIW 1214
            F+SAMGPA+VELLT G++GY NQAKRVEELFGKIW
Sbjct: 358  FSSAMGPASVELLTIGLDGYINQAKRVEELFGKIW 392



>gb:AY335817_1600220 Gossypium hirsutum transaldolase mRNA, complete
            cds.
          Length = 396

 Score =  540 bits (1390), Expect = e-152
 Identities = 270/371 (72%), Positives = 303/371 (81%), Gaps = 1/371 (0%)
 Frame = +3

Query: 105  KLKFAAQSTKPSLSFNSKPCFPVIRASAGFSSSLDTGLTTELDAVTNYSEIVPDTVVFDD 284
            +L FA      SL F     FP IRAS+GFSSSLDTGL TELDAV+ +SEIVPDTV+FDD
Sbjct: 21   RLGFANGCPSSSLLFKFNASFPAIRASSGFSSSLDTGLRTELDAVSTFSEIVPDTVIFDD 80

Query: 285  FEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVN 464
            FEKFPPTAATVSSSLLLGI SLPDT F++AVD ALAD  C  L++ + R++CFFNKALVN
Sbjct: 81   FEKFPPTAATVSSSLLLGILSLPDTIFRNAVDLALADSTCSRLDNPELRLACFFNKALVN 140

Query: 465  VGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGI 644
            VGGDLAKLVPGRVSTEVDARLAYDTHGI+ +VHDLLKLYN I++PPERLLFKIP TWQGI
Sbjct: 141  VGGDLAKLVPGRVSTEVDARLAYDTHGIIRRVHDLLKLYNEIDVPPERLLFKIPXTWQGI 200

Query: 645  EASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALR 824
            EASRLLE+EGIQTHLTFVYSF           SVIQIFVGR+RDWARNHSGD E+E A++
Sbjct: 201  EASRLLESEGIQTHLTFVYSFAQAAAAAQAGASVIQIFVGRVRDWARNHSGDPEIEAAIQ 260

Query: 825  RGEDPGSALVTKAYNYIHKYGHKSKLMA-AAIRNKQDVYSILGVDYIVTPLKILQSLKES 1001
            RGEDPG  LVTKAYNYIHKYGHK K         KQD++S LGVDYI+ PLKILQSLKES
Sbjct: 261  RGEDPGLGLVTKAYNYIHKYGHKXKAYGLQQFETKQDLFSXLGVDYIIAPLKILQSLKES 320

Query: 1002 VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQA 1181
            +T PDEKYS+ RRLSPQSAA ++FT EE+  WDQ S ASAMGPA+++LL AG+EGY NQA
Sbjct: 321  ITAPDEKYSYIRRLSPQSAANHDFTAEELTKWDQLSLASAMGPASMQLLAAGLEGYVNQA 380

Query: 1182 KRVEELFGKIW 1214
             RVEEL  KIW
Sbjct: 381  NRVEELLDKIW 391



>pir|D86257|D86257 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890234 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC022522_1539100 Arabidopsis thaliana
            chromosome I BAC T28K15 genomic sequence, complete
            sequence.>gb:BT002036_1635639 Arabidopsis thaliana
            expressed protein (At1g12230) mRNA, complete
            cds.>gb:BT008487_1639704 Arabidopsis thaliana At1g12230
            gene, complete cds.
          Length = 405

 Score =  522 bits (1345), Expect = e-147
 Identities = 256/366 (69%), Positives = 309/366 (84%), Gaps = 6/366 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAASQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEE 1196
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+VELL+AG+EGY+NQAKRVEE
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLASSMGPASVELLSAGVEGYANQAKRVEE 394

Query: 1197 LFGKIW 1214
            LFGKIW
Sbjct: 395  LFGKIW 400



>gb:AY088530_1573548 Arabidopsis thaliana clone 7590 mRNA, complete
            sequence.
          Length = 405

 Score =  521 bits (1341), Expect = e-146
 Identities = 255/366 (69%), Positives = 309/366 (84%), Gaps = 6/366 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E++ A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAASQAGASVIQIFVGRLRDWARNHSGDTEIKSAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVEE 1196
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+VELL+AG+EGY+NQAKRVEE
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLASSMGPASVELLSAGVEGYANQAKRVEE 394

Query: 1197 LFGKIW 1214
            LFGKIW
Sbjct: 395  LFGKIW 400



>gb:AP003940_1835550 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1066_B03.
          Length = 399

 Score =  481 bits (1238), Expect = e-134
 Identities = 247/369 (66%), Positives = 291/369 (78%), Gaps = 3/369 (0%)
 Frame = +3

Query: 117  AAQSTKPSLSFNSKPCFPVIRASAGF---SSSLDTGLTTELDAVTNYSEIVPDTVVFDDF 287
            AA S +P ++F+ +      R +AG    SSS+D  + TELDAV ++SEIVPDTVVFDDF
Sbjct: 28   AAMSARP-VAFSLRRPVLAARVAAGGNAPSSSVDE-VVTELDAVASFSEIVPDTVVFDDF 85

Query: 288  EKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNV 467
            EKF PTAATVSSSLLLGI  LPDTKFKSA+DTALAD EC  +E  + RMSCF  KAL NV
Sbjct: 86   EKFAPTAATVSSSLLLGIAGLPDTKFKSAIDTALADGECNTMEKPEDRMSCFLTKALANV 145

Query: 468  GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE 647
            G ++A LVPGRVSTE+DARLAYDT GI+ +VH+LLKLY+  ++  ERLLFKIPATWQGIE
Sbjct: 146  GAEMAHLVPGRVSTEIDARLAYDTQGIIQRVHELLKLYSDHDVLSERLLFKIPATWQGIE 205

Query: 648  ASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRR 827
            ASRLLE+EGIQTHLTFVYSF           SV+QIFVGR+RDWAR HSGD E++ AL++
Sbjct: 206  ASRLLESEGIQTHLTFVYSFAQAAAAAQAGASVVQIFVGRVRDWARTHSGDPEIDEALKK 265

Query: 828  GEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVT 1007
            GED G AL  K Y YIHK G+K+KLMAAAIRNKQDV+S+LG+DYI+ PLKILQSL+ESVT
Sbjct: 266  GEDAGLALAKKVYAYIHKNGYKTKLMAAAIRNKQDVFSLLGIDYIIAPLKILQSLEESVT 325

Query: 1008 PPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVELLTAGMEGYSNQAKR 1187
              D KY +  RL+P     YNFT+EE+V WDQ S A+AMGPAA ELL +G+EGY NQA+R
Sbjct: 326  DTDVKYGYVPRLTPALGKTYNFTEEELVKWDQLSLAAAMGPAAEELLASGLEGYVNQARR 385

Query: 1188 VEELFGKIW 1214
            VEELFGKIW
Sbjct: 386  VEELFGKIW 394



>gb:AY062427_1565090 Arabidopsis lyrata cultivar CE RFL1 gene,
            complete cds; and transaldolase-like protein gene,
            partial cds.
          Length = 375

 Score =  478 bits (1230), Expect = e-133
 Identities = 235/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSIRRSIPRILASASSSSSPSSSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSSSLLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSSLLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPGD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E++ WDQ S ASAMGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELIKWDQLSLASAMGPASV 375



>gb:AY062398_1565057 Arabidopsis thaliana cultivar KAS RFL1 gene,
            complete cds; and transaldolase-like protein gene,
            partial cds.>gb:AY062399_1565059 Arabidopsis thaliana
            cultivar MT RFL1 gene, complete cds; and
            transaldolase-like protein gene, partial
            cds.>gb:AY062400_1565060 Arabidopsis thaliana cultivar
            NFC RFL1 pseudogene, complete sequence; and
            transaldolase-like protein gene, partial
            cds.>gb:AY062401_1565061 Arabidopsis thaliana cultivar UP
            RFL1 pseudogene, complete sequence; and
            transaldolase-like protein gene, partial cds.
          Length = 375

 Score =  478 bits (1229), Expect = e-133
 Identities = 235/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPSSSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P ERLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHERLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDNEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPED 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLASSMGPASV 375



>gb:AY062396_1565054 Arabidopsis thaliana cultivar FM RFL1 pseudogene,
            complete sequence; and transaldolase-like protein gene,
            partial cds.>gb:AY062397_1565055 Arabidopsis thaliana
            cultivar HS RFL1 pseudogene, complete sequence; and
            transaldolase-like protein gene, partial cds.
          Length = 375

 Score =  478 bits (1229), Expect = e-133
 Identities = 235/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P ERLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHERLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDNEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPED 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLASSMGPASV 375



>gb:AY062395_1565053 Arabidopsis thaliana cultivar AB RFL1 pseudogene,
            complete sequence; and transaldolase-like protein gene,
            partial cds.>gb:AY062402_1565062 Arabidopsis thaliana
            cultivar RF RFL1 pseudogene, complete sequence; and
            transaldolase-like protein gene, partial cds.
          Length = 375

 Score =  476 bits (1226), Expect = e-133
 Identities = 234/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAASQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLASSMGPASV 375



>gb:AY062394_1565052 Arabidopsis thaliana cultivar TSU RFL1 gene,
            complete cds; and transaldolase-like protein gene,
            partial cds.
          Length = 375

 Score =  476 bits (1226), Expect = e-133
 Identities = 234/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAASQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLASSMGPASV 375



>gb:AY062393_1565050 Arabidopsis thaliana cultivar ZU RFL1 pseudogene,
            complete sequence; and transaldolase-like protein gene,
            partial cds.
          Length = 375

 Score =  476 bits (1226), Expect = e-133
 Identities = 234/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAASQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATYYHFTNKELVKWDQLSLASSMGPASV 375



>gb:AY062384_1565035 Arabidopsis thaliana cultivar ANG RFL1 gene,
            complete cds; and transaldolase-like protein gene,
            partial cds.>gb:AY062385_1565037 Arabidopsis thaliana
            cultivar BLA RFL1 gene, complete cds; and
            transaldolase-like protein gene, partial
            cds.>gb:AY062386_1565039 Arabidopsis thaliana cultivar
            BUR RFL1 gene, complete cds; and transaldolase-like
            protein gene, partial cds.>gb:AY062387_1565041
            Arabidopsis thaliana cultivar CT RFL1 gene, complete cds;
            and transaldolase-like protein gene, partial
            cds.>gb:AY062390_1565045 Arabidopsis thaliana cultivar
            POG RFL1 gene, complete cds; and transaldolase-like
            protein gene, partial cds.>gb:AY062391_1565047
            Arabidopsis thaliana cultivar TAMM RFL1 gene, complete
            cds; and transaldolase-like protein gene, partial
            cds.>gb:AY062392_1565049 Arabidopsis thaliana cultivar WU
            RFL1 gene, complete cds; and transaldolase-like protein
            gene, partial cds.
          Length = 375

 Score =  476 bits (1226), Expect = e-133
 Identities = 234/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAASQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V WDQ S AS+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLASSMGPASV 375



>gb:AY062403_1565064 Arabidopsis thaliana cultivar CVI RFL1 gene,
            complete cds; and transaldolase-like protein gene,
            partial cds.>gb:AY062404_1565066 Arabidopsis thaliana
            cultivar LER RFL1 gene, complete cds; and
            transaldolase-like protein gene, partial cds.
          Length = 375

 Score =  476 bits (1224), Expect = e-133
 Identities = 234/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPSSSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P ERLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHERLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHITFVYSFAQAAAAAQAGASVIQIFVGRLRDWARNHSGDNEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPED 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V W+Q S AS+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWNQLSLASSMGPASV 375



>gb:AY062388_1565042 Arabidopsis thaliana cultivar KZ RFL1 pseudogene,
            complete sequence; and transaldolase-like protein gene,
            partial cds.>gb:AY062389_1565043 Arabidopsis thaliana
            cultivar LIP RFL1 pseudogene, complete sequence; and
            transaldolase-like protein gene, partial cds.
          Length = 375

 Score =  475 bits (1223), Expect = e-133
 Identities = 233/341 (68%), Positives = 284/341 (83%), Gaps = 6/341 (1%)
 Frame = +3

Query: 135  PSLSFNSKPCFPVIRASAGFSSS-----LDTGLTTELDAVTNYSEIVPDTVVFDDFEKFP 299
            P+++F+ +   P I ASA  SSS     L+ G   EL+AV+ +SEIVPDTVVFDDFE+FP
Sbjct: 35   PAVNFSLRRSIPRILASASSSSSPASSSLEAGENNELNAVSAFSEIVPDTVVFDDFERFP 94

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PTAATVSS+LLLGIC LPDT F++AVD ALAD  C GLE  ++R+SCFFNKA+VNVGGDL
Sbjct: 95   PTAATVSSALLLGICGLPDTIFRNAVDMALADSSCAGLETTESRLSCFFNKAIVNVGGDL 154

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             KLVPGRVSTEVDARLAYDT+GI+ KVHDLL+LYN I++P +RLLFKIPATWQGIEA+RL
Sbjct: 155  VKLVPGRVSTEVDARLAYDTNGIIRKVHDLLRLYNEIDVPHDRLLFKIPATWQGIEAARL 214

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE+EGIQTH+TFVYSF           SVIQIFVGRLRDWARNHSGD+E+E A++ GEDP
Sbjct: 215  LESEGIQTHMTFVYSFAQAAAASQAGASVIQIFVGRLRDWARNHSGDTEIESAIKSGEDP 274

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKES-VTPPD 1016
            G ALV ++YNYIHKYG+KSKLMAAA+RNKQD++S+LGVDY++ PLK+LQSLK+S   P D
Sbjct: 275  GLALVKRSYNYIHKYGYKSKLMAAAVRNKQDLFSLLGVDYVIAPLKVLQSLKDSPAIPDD 334

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAV 1139
            EKYSF R+L+P++A  Y+FT +E+V WDQ S +S+MGPA+V
Sbjct: 335  EKYSFVRKLTPETATHYHFTNKELVKWDQLSLSSSMGPASV 375



>pir|D64167|D64167 transaldolase (EC 2.2.1.2) - Haemophilus influenzae
            (strain Rd KW20)>gb:U32792_204790 Haemophilus influenzae
            Rd KW20 section 107 of 163 of the complete
            genome.>gb:L42023_1097339 Haemophilus influenzae Rd KW20
            complete genome.
          Length = 317

 Score =  180 bits (456), Expect = 7e-44
 Identities = 115/330 (34%), Positives = 174/330 (52%), Gaps = 2/330 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A 
Sbjct: 1    MTTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAY 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ 
Sbjct: 59   AKAQSA-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIA 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  +R+L KI +TWQGI A+ +LE EGI  +LT ++S             +I  
Sbjct: 118  LYNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLFSEAQARACAEAGVYLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + +S   E   A    EDPG   VTK YNY  +YG+ + +M A+ RN  ++
Sbjct: 178  FVGRILDWYKANSDKKEYAPA----EDPGVISVTKIYNYYKEYGYNTVVMGASFRNVGEI 233

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEK--YSFERRLSPQSAAAYNFTKEEVVTWDQYS 1109
              + G D +     +L+ L+E+ T    K  Y  E +  PQ      F       W   S
Sbjct: 234  TELAGCDRLTIAPALLKELQENSTALVRKLEYKGEVKAKPQPLTEAEF------YWQHNS 287

Query: 1110 FASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
             A      AVE L  G+  ++   +++E +
Sbjct: 288  DA-----MAVEKLAEGIRKFAIDQEKLETM 312



>gb:AE016827_343984 Mannheimia succiniciproducens MBEL55E, complete
            genome.
          Length = 317

 Score =  179 bits (454), Expect = 1e-43
 Identities = 108/328 (32%), Positives = 176/328 (53%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +TT+LDA+ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+  
Sbjct: 1    MTTQLDALRNMTVVVADTGDIEAIKKYQPQDATTNPSLILSASALP--QYASLIDDAINY 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+K
Sbjct: 59   AKAKST-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTAATVEKARKLIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  +R+L K+ +TWQGI A+ +LE EGI  +LT ++S             +I  
Sbjct: 118  LYNEAGINNDRILIKVASTWQGIRAAEILEKEGINCNLTLLFSQAQARACAEAGVYLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + ++   E        EDPG   VT  YNY  +YG+++ +M A+ RN  ++
Sbjct: 178  FVGRILDWYKANTDKKEYV----PNEDPGVISVTSIYNYYKQYGYQTVVMGASFRNIGEI 233

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L+ES      K  ++  + P+ A          +T  Q+ + 
Sbjct: 234  TELAGCDRLTIAPALLKELQESNADLPRKLDYKGEVKPKPAP---------LTESQFYWE 284

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                P AV+ L  G+  ++   +++E +
Sbjct: 285  HNNDPMAVDKLAEGIRKFAADIEKLEAM 312



>sp|P45055|TAL_HAEIN Transaldolase (EC 2.2.1.2).
          Length = 316

 Score =  179 bits (454), Expect = 1e-43
 Identities = 115/329 (34%), Positives = 173/329 (52%), Gaps = 2/329 (0%)
 Frame = +3

Query: 219  TTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ 398
            TT+LD++ N + +V DT   D  +K+ P  AT + SL+L   +LP  ++   +D A+A  
Sbjct: 1    TTQLDSLRNMTVVVADTGDIDAIKKYQPQDATTNPSLILSASALP--QYAPLIDEAVAYA 58

Query: 399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
            +     DK  ++    +K  VN+G ++ K+VPGR+STEVDARL+YDT   V K   L+ L
Sbjct: 59   KAQSA-DKAQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATVEKARKLIAL 117

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
            YN   I  +R+L KI +TWQGI A+ +LE EGI  +LT ++S             +I  F
Sbjct: 118  YNAAGISNDRILIKIASTWQGIRAAEILEKEGINCNLTLLFSEAQARACAEAGVYLISPF 177

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW + +S   E   A    EDPG   VTK YNY  +YG+ + +M A+ RN  ++ 
Sbjct: 178  VGRILDWYKANSDKKEYAPA----EDPGVISVTKIYNYYKEYGYNTVVMGASFRNVGEIT 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEK--YSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
             + G D +     +L+ L+E+ T    K  Y  E +  PQ      F       W   S 
Sbjct: 234  ELAGCDRLTIAPALLKELQENSTALVRKLEYKGEVKAKPQPLTEAEF------YWQHNSD 287

Query: 1113 ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            A      AVE L  G+  ++   +++E +
Sbjct: 288  A-----MAVEKLAEGIRKFAIDQEKLETM 311



>sp|Q9CKL0|TALA_PASMU Transaldolase A (EC 2.2.1.2).>gb:AE006198_216490
            Pasteurella multocida subsp. multocida str. Pm70 section
            165 of 204 of the complete genome.>gb:AE004439_1119220
            Pasteurella multocida subsp. multocida str. Pm70,
            complete genome.
          Length = 317

 Score =  173 bits (438), Expect = 9e-42
 Identities = 112/334 (33%), Positives = 175/334 (52%), Gaps = 6/334 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA- 392
            +TT+LD++ N + +V DT   +  +K+ P  AT + SL+L   +LP  ++ S +D A+A 
Sbjct: 1    MTTQLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALP--QYASLIDEAIAY 58

Query: 393  ---DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH 563
                  C   +  DA      +K  VN+G ++ K+VPGR+STEVDARL+YDT   + K  
Sbjct: 59   AKSKSNCSKQQLIDAE-----DKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAK 113

Query: 564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXS 743
             L+ LYN   I  +R+L KI +TWQGI A+  LE +GI  +LT ++S             
Sbjct: 114  KLIALYNEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLFSEAQARACAEAGVY 173

Query: 744  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN 923
            +I  FVGR+ DW + +S   +   A    EDPG   VTK YNY  ++G+ + +M A+ RN
Sbjct: 174  LISPFVGRILDWYKANSDKKDYAPA----EDPGVISVTKIYNYYKQHGYNTIVMGASFRN 229

Query: 924  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSF--ERRLSPQSAAAYNFTKEEVVTW 1097
              ++  + G D +     +L+ L+E+  P + K S+  E +  PQ      F       W
Sbjct: 230  VGEITELAGCDRLTIAPALLKELQENNAPLERKLSYTGEVKAKPQPLTEAEF------YW 283

Query: 1098 DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
               S A      AVE L  G+  ++   +++E +
Sbjct: 284  QHNSDA-----MAVEKLADGIRKFAADQEKLEAM 312



>gb:AE016755_324081 Escherichia coli CFT073 section 1 of 18 of the
            complete genome.>gb:AE014075_954665 Escherichia coli
            CFT073 complete genome.
          Length = 338

 Score =  171 bits (433), Expect = 3e-41
 Identities = 102/335 (30%), Positives = 177/335 (52%)
 Frame = +3

Query: 207  DTGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTA 386
            +T +T +L ++  Y+ +V DT      + + P  AT + SL+L    +P+  ++  +D A
Sbjct: 19   NTIMTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDA 76

Query: 387  LADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD 566
            +A  +     D+  ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   
Sbjct: 77   VAWAKQQS-NDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKR 135

Query: 567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSV 746
            L+KLYN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +
Sbjct: 136  LIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFL 195

Query: 747  IQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNK 926
            I  FVGR+ DW + ++   E   A    EDPG   V++ Y Y  ++G+++ +M A+ RN 
Sbjct: 196  ISPFVGRILDWYKANTDKKEYAPA----EDPGVVSVSEIYQYYKEHGYETVVMGASFRNI 251

Query: 927  QDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQY 1106
             ++  + G D +     +L+ L ES    + K S+   +  + A          +T  ++
Sbjct: 252  GEILELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPAR---------ITESEF 302

Query: 1107 SFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
             +     P AV+ L  G+  ++   +++E++ G +
Sbjct: 303  LWQHNQDPMAVDKLAEGIRKFAVDQEKLEKMIGDL 337



>pir|S40535|S40535 transaldolase (EC 2.2.1.2) B - Escherichia coli
            (strain K-12)>pir|H90629|H90629 transaldolase B
            [imported] - Escherichia coli (strain O157:H7, substrain
            RIMD 0509952)>pir|H85480|H85480 transaldolase B
            [imported] - Escherichia coli (strain O157:H7, substrain
            EDL933)>gb:AE005174_64241 Escherichia coli O157:H7
            EDL933, complete genome.>gb:AE005674_69591 Shigella
            flexneri 2a str. 301, complete genome.>gb:D13161_119915
            Escherichia coli talB gene for transaldolase, complete
            cds.>gb:ECO110K_126830 Escherichia coli genomic DNA. (0.0
            - 2.4 min).>gb:S80045_169192 talB=transaldolase B
            [Escherichia coli, K-12, Genomic, 1139
            nt].>gb:U00096_199113 Escherichia coli K-12 MG1655
            complete genome.>gb:AE016978_370002 Shigella flexneri 2a
            str. 2457T section 1 of 16 of the complete
            genome.>gb:BA000007_658020 Escherichia coli O157:H7 DNA,
            complete genome.>gb:AE014073_994752 Shigella flexneri 2a
            str. 2457T complete genome.
          Length = 317

 Score =  170 bits (431), Expect = 6e-41
 Identities = 101/332 (30%), Positives = 175/332 (52%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T +L ++  Y+ +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct: 1    MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDAVAW 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     D+  ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   L+K
Sbjct: 59   AKQQS-NDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRLIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  
Sbjct: 118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + ++   E   A    EDPG   V++ Y Y  ++G+++ +M A+ RN  ++
Sbjct: 178  FVGRILDWYKANTDKKEYAPA----EDPGVVSVSEIYQYYKEHGYETVVMGASFRNIGEI 233

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L ES    + K S+   +  + A          +T  ++ + 
Sbjct: 234  LELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPAR---------ITESEFLWQ 284

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
                P AV+ L  G+  ++   +++E++ G +
Sbjct: 285  HNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDL 316



>pir|AH0502|AH0502 transaldolase B [imported] - Salmonella enterica
            subsp. enterica serovar Typhi (strain
            CT18)>gb:CP000026_74929 Salmonella enterica subsp.
            enterica serovar Paratypi A str. ATCC
            9150.>gb:AE008693_241743 Salmonella typhimurium LT2,
            section 1 of 220 of the complete
            genome.>gb:AE016834_344208 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, section 1 of 16 of the
            complete genome.>gb:AL627265_540335 Salmonella enterica
            serovar Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 1/20.>gb:AE014613_981540 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.>gb:AE006468_998825 Salmonella typhimurium LT2,
            complete genome.
          Length = 317

 Score =  169 bits (429), Expect = 1e-40
 Identities = 100/332 (30%), Positives = 175/332 (52%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T +L ++  ++ +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct: 1    MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDAVAW 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     D+  ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   ++K
Sbjct: 59   AKQQS-SDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRIIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  
Sbjct: 118  LYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVYLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + ++   +   A    EDPG   VT+ Y Y  ++G+++ +M A+ RN  ++
Sbjct: 178  FVGRILDWYKANTDKKDYAPA----EDPGVVSVTEIYEYYKQHGYETVVMGASFRNVGEI 233

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L ES    + K SF   +           + E +T  ++ + 
Sbjct: 234  LELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVK---------ARPERITEAEFLWQ 284

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
                P AV+ L  G+  ++   +++E++ G +
Sbjct: 285  HHQDPMAVDKLADGIRKFAVDQEKLEKMIGDL 316



>sp|P30148|TALB_ECOLI Transaldolase B (EC 2.2.1.2).
          Length = 316

 Score =  169 bits (429), Expect = 1e-40
 Identities = 101/331 (30%), Positives = 174/331 (52%)
 Frame = +3

Query: 219  TTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ 398
            T +L ++  Y+ +V DT      + + P  AT + SL+L    +P+  ++  +D A+A  
Sbjct: 1    TDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDAVAWA 58

Query: 399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
            +     D+  ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   L+KL
Sbjct: 59   KQQS-NDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRLIKL 117

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
            YN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  F
Sbjct: 118  YNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISPF 177

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW + ++   E   A    EDPG   V++ Y Y  ++G+++ +M A+ RN  ++ 
Sbjct: 178  VGRILDWYKANTDKKEYAPA----EDPGVVSVSEIYQYYKEHGYETVVMGASFRNIGEIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
             + G D +     +L+ L ES    + K S+   +  + A          +T  ++ +  
Sbjct: 234  ELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPAR---------ITESEFLWQH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
               P AV+ L  G+  ++   +++E++ G +
Sbjct: 285  NQDPMAVDKLAEGIRKFAIDQEKLEKMIGDL 315



>sp|Q8FLD1|TALB_ECOL6 Transaldolase B (EC 2.2.1.2).
          Length = 316

 Score =  169 bits (429), Expect = 1e-40
 Identities = 101/331 (30%), Positives = 174/331 (52%)
 Frame = +3

Query: 219  TTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ 398
            T +L ++  Y+ +V DT      + + P  AT + SL+L    +P+  ++  +D A+A  
Sbjct: 1    TDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDAVAWA 58

Query: 399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
            +     D+  ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   L+KL
Sbjct: 59   KQQS-NDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRLIKL 117

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
            YN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  F
Sbjct: 118  YNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISPF 177

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW + ++   E   A    EDPG   V++ Y Y  ++G+++ +M A+ RN  ++ 
Sbjct: 178  VGRILDWYKANTDKKEYAPA----EDPGVVSVSEIYQYYKEHGYETVVMGASFRNIGEIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
             + G D +     +L+ L ES    + K S+   +  + A          +T  ++ +  
Sbjct: 234  ELAGCDRLTIAPALLKELAESEGAIERKLSYTGEVKARPAR---------ITESEFLWQH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
               P AV+ L  G+  ++   +++E++ G +
Sbjct: 285  NQDPMAVDKLAEGIRKFAVDQEKLEKMIGDL 315



>sp|Q8XG45|TALB_SALTY Transaldolase B (EC 2.2.1.2).
          Length = 316

 Score =  169 bits (427), Expect = 2e-40
 Identities = 100/331 (30%), Positives = 174/331 (52%)
 Frame = +3

Query: 219  TTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ 398
            T +L ++  ++ +V DT      + + P  AT + SL+L    +P+  ++  +D A+A  
Sbjct: 1    TDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDDAVAWA 58

Query: 399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
            +     D+  ++    +K  VN+G ++ KLVPGR+STEVDARL+YDT   + K   ++KL
Sbjct: 59   KQQS-SDRAQQVVDATDKLAVNIGLEILKLVPGRISTEVDARLSYDTEASIAKAKRIIKL 117

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
            YN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  F
Sbjct: 118  YNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVYLISPF 177

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW + ++   +   A    EDPG   VT+ Y Y  ++G+++ +M A+ RN  ++ 
Sbjct: 178  VGRILDWYKANTDKKDYAPA----EDPGVVSVTEIYEYYKQHGYETVVMGASFRNVGEIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
             + G D +     +L+ L ES    + K SF   +           + E +T  ++ +  
Sbjct: 234  ELAGCDRLTIAPALLKELAESEGAIERKLSFSGEVK---------ARPERITEAEFLWQH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
               P AV+ L  G+  ++   +++E++ G +
Sbjct: 285  HQDPMAVDKLADGIRKFAVDQEKLEKMIGDL 315



>gb:AY144880_1583671 Saccharomyces bayanus clone Contig3892 YGR043C
            gene, complete cds.
          Length = 333

 Score =  168 bits (425), Expect = 3e-40
 Identities = 107/332 (32%), Positives = 178/332 (53%), Gaps = 3/332 (0%)
 Frame = +3

Query: 222  TELDAVTNY-SEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ 398
            + LD + N  + +V D+  F+   K+ P  +T + SL+L    L   K++  +D A+   
Sbjct: 14   SSLDQLKNAGTHVVADSGDFESISKYEPQDSTTNPSLILAASKLE--KYEKLIDAAVEFG 71

Query: 399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
              +G  D + ++    +K LV  G  + K+VPGRVSTEVDARL++D    V K   ++KL
Sbjct: 72   RKHGKTDHE-KVENAMDKILVEFGSQILKIVPGRVSTEVDARLSFDKKATVKKALHIIKL 130

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            Y  + +P ER+L KI +TW+GI+A++ LEA+ GI  ++T ++SF           ++I  
Sbjct: 131  YKDMGVPKERVLIKIASTWEGIQAAKELEAKHGIHCNMTLLFSFTQAVACAEANVTLISP 190

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGE-DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
            FVGR+ D+ +  SG+         GE DPG   V K Y+Y  ++G+K+++MAA+ RN  +
Sbjct: 191  FVGRIMDFYKERSGEDYT------GETDPGVLSVRKIYSYYKRHGYKTEVMAASFRNLDE 244

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
            + ++ G+D +  PL +LQ L ES  P + K + E     +     +F  +E      + +
Sbjct: 245  LKALAGIDDMTLPLNLLQQLHESTDPIENKLNAE-TAKQEGVEKVSFINDE----PHFRY 299

Query: 1113 ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
                   A E L+ G+  +S   + + EL  K
Sbjct: 300  VFNEDQMATEKLSDGIRKFSVDIEALYELVEK 331



>sp|P58561|TAL_ANASP Transaldolase (EC 2.2.1.2).>pir|AD2126|AD2126
            transaldolase [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_683552 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 332

 Score =  167 bits (424), Expect = 4e-40
 Identities = 104/331 (31%), Positives = 169/331 (51%), Gaps = 4/331 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL--ADQE 401
            L+ +   + +V DT      EKF P  AT + SL+     +P+  ++  VD  L  A ++
Sbjct: 6    LEQLREMTVVVADTGDIQAIEKFTPRDATTNPSLITAAAKMPE--YQEIVDQTLLQAKKD 63

Query: 402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
                  K   +S  F++  V+ G  + +++PGRVSTEVDARL+YDT   + K  +L+  Y
Sbjct: 64   AGAGASKGQIVSLAFDRLAVSFGLKILQIIPGRVSTEVDARLSYDTEATITKARELIAQY 123

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                I PER+L KI +TW+GI+A+ +LE EGI  +LT ++             ++I  FV
Sbjct: 124  KAAGIGPERVLIKIASTWEGIKAAEILEKEGIHCNLTLLFGLHQAIACAEAGITLISPFV 183

Query: 762  GRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYS 941
            GR+ DW +  +G      A    EDPG   VT  YNY  K+G+K+++M A+ RN  ++  
Sbjct: 184  GRILDWYKKETGRDSYPSA----EDPGVLSVTTIYNYYKKFGYKTEVMGASFRNIGEITE 239

Query: 942  ILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VTWDQYSFA 1115
            + G D +     +L  L+ ++          R+L P  AA  +  K  +   T+D+   A
Sbjct: 240  LAGSDLLTISPGLLGELQATIG------ELPRKLDPAKAATLDIDKISIDKATFDKMHAA 293

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
              M   A + L  G++G++   + +E L  +
Sbjct: 294  DRM---AYDKLDEGIKGFTKALEELETLLAE 321



>sp|Q8Y014|TAL_RALSO Transaldolase (EC 2.2.1.2).>gb:AL646063_546159
            Ralstonia solanacearum GMI1000 chromosome, complete
            sequence; segment 7/19.
          Length = 319

 Score =  166 bits (421), Expect = 8e-40
 Identities = 105/334 (31%), Positives = 170/334 (50%), Gaps = 4/334 (1%)
 Frame = +3

Query: 222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE 401
            T+LD +  ++ +V DT  F     + P  AT + SL+L   ++   +++  ++ A+ D  
Sbjct: 2    TQLDQLKQFTTVVADTGDFQAMRAYAPHDATTNPSLILK--AVQKAEYRPLLEQAVRDAR 59

Query: 402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
               +ED         +  LV  G ++  ++PGRVSTEVDARL++DT   V K   L+ LY
Sbjct: 60   SDSVED-------IIDAVLVAFGCEILSIIPGRVSTEVDARLSFDTAATVAKARHLIALY 112

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                +P ER+L KI +TW+GI A+  L AEGI+ ++T ++S             +I  FV
Sbjct: 113  EARGVPRERVLIKIASTWEGIRAADQLRAEGIRCNMTLLFSLIQAVACAEAGVQLISPFV 172

Query: 762  GRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYS 941
            GR+ DW +  +G +    A     DPG   V + YNY  ++G+ +++M A+ RN   +  
Sbjct: 173  GRIYDWYKKDAGAAWDPIAQGGANDPGVQSVVRIYNYYKRFGYTTEVMGASFRNTSQIIE 232

Query: 942  ILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTK----EEVVTWDQYS 1109
            + G D +    ++L  L++S  P       ER+LSP+ A A N  +    E    W  + 
Sbjct: 233  LAGCDLLTISPELLAQLQQSDAP------VERKLSPEHAHATNLVRLPADEAAFRW--HM 284

Query: 1110 FASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
             A AM   A E L  G+  ++  A ++E L G +
Sbjct: 285  NADAM---ATEKLAEGIRLFAADAVKLEGLIGPL 315



>sp|Q7V6B8|TAL_PROMM Transaldolase (EC 2.2.1.2).>gb:BX572098_798590
            Prochlorococcus marinus MIT9313 complete genome; segment
            4/7.
          Length = 390

 Score =  166 bits (421), Expect = 8e-40
 Identities = 108/332 (32%), Positives = 169/332 (50%), Gaps = 6/332 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + T L+ ++  + +V DT   D   KF P  AT + SL+L    +P   ++S +D AL  
Sbjct: 1    MATLLEQLSTMTVVVADTGDLDAIRKFTPRDATTNPSLILAAAQIP--AYQSLIDEALHS 58

Query: 396  QECYGLEDKDARMSCFFNKALVNV----GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH 563
                 L    A +    ++AL  +    G ++ K+VPGRVSTEVDARL+++T   + K H
Sbjct: 59   SR--QLLGNSAAVEEVVHEALDEICVIFGKEILKIVPGRVSTEVDARLSFNTEATIAKAH 116

Query: 564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXS 743
             L+ LYN   I  +R+L KI +TW+GI+A+ +LE +GI  +LT ++ F           +
Sbjct: 117  KLIGLYNDAGITNDRVLIKIASTWEGIKAAEVLEKDGIHCNLTLLFGFSQAVACAEAGVT 176

Query: 744  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN 923
            +I  FVGR+ DW +  +G     G     EDPG   VTK +NY   Y +K+++M A+ RN
Sbjct: 177  LISPFVGRILDWYKASTGRDSYAGP----EDPGVISVTKIFNYFKTYDYKTEIMGASFRN 232

Query: 924  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ 1103
              ++  + G D +    K+L  L  +  P       +R+L   +  A     E  +  D+
Sbjct: 233  LDEIIELAGCDLLTISPKLLDQLGSTEAP------LKRKLDAVNPVA----AESQIHVDK 282

Query: 1104 YSFASAM--GPAAVELLTAGMEGYSNQAKRVE 1193
             SF S M     A E L  G+ G+S   + +E
Sbjct: 283  ESFESMMRADRMAFEKLDEGIRGFSKAIETLE 314



>gb:AF424665_1799000 Phytophthora infestans clone MY-11-C-10
            transaldolase mRNA, complete cds.
          Length = 334

 Score =  166 bits (419), Expect = 1e-39
 Identities = 105/334 (31%), Positives = 174/334 (52%), Gaps = 8/334 (2%)
 Frame = +3

Query: 222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQE 401
            ++LD +  ++ +V DT  F+   K+ P  AT + SLL     +   ++ + VD A++   
Sbjct: 13   SQLDQLKQFTTVVADTGDFEQINKYKPQDATTNPSLLFKAAQME--QYSALVDDAVS--- 67

Query: 402  CYG------LEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH 563
             YG      L +K+ R+    +K  VN G ++ K+VPG VSTEVDARL++DT   + + H
Sbjct: 68   -YGKGLSADLSEKE-RLGYVIDKLSVNFGLEILKVVPGYVSTEVDARLSFDTESTIARAH 125

Query: 564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXS 743
             ++ LY    I  +R+L KI +TW+GI+A + L+ EGI  ++T ++ F           +
Sbjct: 126  RIIDLYEKAGIKKDRILIKIASTWEGIQACKHLQKEGISCNMTLLFGFAQAVGCAEAGAT 185

Query: 744  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN 923
            +I  FVGR+ DW +  +G S  E      EDPG   VTK Y Y  KY +K+ +M A+ RN
Sbjct: 186  LISPFVGRILDWHKAKTGKSSYES----HEDPGVVSVTKIYQYYKKYDYKTIVMGASFRN 241

Query: 924  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ 1103
              ++  + G D +     +L+ L +S     +K   E        A   +T E+ +++D+
Sbjct: 242  TGEITELAGCDRLTISPALLEELTKSTATLAKKLDAE-------TAGKAYTGEK-LSYDE 293

Query: 1104 YSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL 1199
              F  +M     A E L  G+ G+S    ++E++
Sbjct: 294  KDFRLSMNEDAMATEKLAEGIRGFSADIVKLEQI 327



>gb:CR378675_96907 Photobacterium profundum SS9 chromosome 2; segment
            1/7.
          Length = 316

 Score =  166 bits (419), Expect = 1e-39
 Identities = 101/333 (30%), Positives = 169/333 (50%), Gaps = 2/333 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++T+L+ +   + +V DT   +   K+ P  AT + SL+L    + +  +   +D ++A 
Sbjct: 1    MSTKLEQLRALTTVVADTGDIEAISKYQPEDATTNPSLILKAAQIAE--YAPLIDASIAY 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     DK  +++   +   VN+G ++ K+VPGR+STEVDARL+YDT G V+K   L+K
Sbjct: 59   AKAQS-NDKTQQVADTCDMLAVNIGKEILKVVPGRISTEVDARLSYDTEGSVIKARQLIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            +YN   I  +R+L K+ +TW+GI A+ +LE EGI  +LT ++SF            +I  
Sbjct: 118  MYNDAGITNDRILIKLASTWEGIRAAEVLEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +   G           EDPG   VT  Y+Y   YG+ + +M A+ RN  ++
Sbjct: 178  FVGRIMDWYKAKEGRD-----FESSEDPGVVSVTGIYDYYKTYGYNTVVMGASFRNIGEI 232

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEE--VVTWDQYS 1109
              + G D +     +LQ L+++     EK               N TKE    +T  ++ 
Sbjct: 233  LELAGCDRLTISPNLLQELEDATGEVVEK-----------LIDTNGTKERPAAMTHAEFL 281

Query: 1110 FASAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
            +     P AVE L  G+  ++    ++E +  +
Sbjct: 282  WEHNQDPMAVEKLADGIRNFAVDQGKLEVMIAE 314



>gb:CP000021_873436 Vibrio fischeri ES114 chromosome II, complete
            sequence.
          Length = 316

 Score =  165 bits (417), Expect = 2e-39
 Identities = 104/328 (31%), Positives = 166/328 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +TT+L+ +   + +V DT   +   K+ P  AT + SL+L    +  T++   +D ++  
Sbjct: 1    MTTKLEQLRKLTTVVADTGDIEAIAKYTPEDATTNPSLILKAAEI--TEYAPLIDASIEY 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     DK  ++    +   VN+G ++ K+VPGR+STEVDARL+YDT G V K   L+K
Sbjct: 59   AKAQS-NDKAQQVQDTCDMLAVNIGKEILKVVPGRISTEVDARLSYDTEGSVAKARQLIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            +YN   I  +R+L K+ +TW+GI A+ +LE EGI  +LT ++SF            +I  
Sbjct: 118  MYNDAGITNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVYLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +   G           EDPG   VT  YNY  ++G+ + +M A+ RN  ++
Sbjct: 178  FVGRIMDWYKAKEGRD-----FEPSEDPGVVSVTGIYNYYKEHGYNTVVMGASFRNIGEI 232

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +LQ L+E+     EK         + AA    T  E + WD    A
Sbjct: 233  LELAGCDRLTISPNLLQELEEATGEVVEKLVDTNGNKARPAA---MTHAEFL-WDHNQDA 288

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                  AVE L  G+  ++    ++E +
Sbjct: 289  -----MAVEKLAEGIRNFAVDQGKLEAM 311



>gb:BX936398_835251 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 317

 Score =  165 bits (417), Expect = 2e-39
 Identities = 100/332 (30%), Positives = 169/332 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T +L ++   + +V DT      + + P  AT + S++L    +P+  ++  +D A+A 
Sbjct: 1    MTDKLTSLRQITTVVADTGDIAAMKLYQPQDATTNPSIILNAAQIPE--YRKLIDEAIAW 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                   D   ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT   V K   L+K
Sbjct: 59   AREQS-SDHAQQIIDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTVASVTKAKRLIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  
Sbjct: 118  LYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + +    E        EDPG   VT+ Y Y  K+G+K+ +M A+ RN  ++
Sbjct: 178  FVGRILDWYKANGDQKE----FAPSEDPGVVSVTEIYQYYKKHGYKTVVMGASFRNLGEI 233

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L ES  P + K ++   +  + A          +T  ++ + 
Sbjct: 234  IELAGCDRLTIAPSLLKELAESEGPVERKLAYTGEIQAKPAP---------LTEAEFYWQ 284

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
                P AV+ L  G+  ++    ++E++   +
Sbjct: 285  HNQDPMAVDKLADGIRKFAIDQGKLEKMISDL 316



>gb:AE013974_302002 Yersinia pestis KIM section 374 of 415 of the
            complete genome.>gb:AE017141_389443 Yersinia pestis
            biovar Medievalis str. 91001 section 15 of 16 of the
            complete genome.>gb:AE009952_932185 Yersinia pestis KIM
            complete genome.>gb:AE017042_1146009 Yersinia pestis
            biovar Medievalis str. 91001 complete genome.
          Length = 330

 Score =  165 bits (417), Expect = 2e-39
 Identities = 100/332 (30%), Positives = 169/332 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T +L ++   + +V DT      + + P  AT + S++L    +P+  ++  +D A+A 
Sbjct: 14   MTDKLTSLRQITTVVADTGDIAAMKLYQPQDATTNPSIILNAAQIPE--YRKLIDEAIAW 71

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                   D   ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT   V K   L+K
Sbjct: 72   AREQS-SDHAQQIVDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTVASVAKAKRLIK 130

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  
Sbjct: 131  LYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISP 190

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + +    E        EDPG   VT+ Y Y  K+G+K+ +M A+ RN  ++
Sbjct: 191  FVGRILDWYKANGDQKE----FAPSEDPGVVSVTEIYQYYKKHGYKTVVMGASFRNLGEI 246

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L ES  P + K ++   +  + A          +T  ++ + 
Sbjct: 247  IELAGCDRLTIAPSLLKELAESEGPVERKLAYTGEIQAKPAP---------LTEAEFYWQ 297

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
                P AV+ L  G+  ++    ++E++   +
Sbjct: 298  HNQDPMAVDKLADGIRKFAIDQGKLEKMISDL 329



>sp|Q8ZIN2|TAL_YERPE Transaldolase (EC 2.2.1.2).>pir|AD0057|AD0057
            transaldolase (EC 2.2.1.2) [imported] - Yersinia pestis
            (strain CO92)>gb:AJ414142_522312 Yersinia pestis strain
            CO92 complete genome; segment 2/20.
          Length = 317

 Score =  165 bits (417), Expect = 2e-39
 Identities = 100/332 (30%), Positives = 169/332 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T +L ++   + +V DT      + + P  AT + S++L    +P+  ++  +D A+A 
Sbjct: 1    MTDKLTSLRQITTVVADTGDIAAMKLYQPQDATTNPSIILNAAQIPE--YRKLIDEAIAW 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                   D   ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT   V K   L+K
Sbjct: 59   AREQS-SDHAQQIVDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTVASVAKAKRLIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  
Sbjct: 118  LYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + +    E        EDPG   VT+ Y Y  K+G+K+ +M A+ RN  ++
Sbjct: 178  FVGRILDWYKANGDQKE----FAPSEDPGVVSVTEIYQYYKKHGYKTVVMGASFRNLGEI 233

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L ES  P + K ++   +  + A          +T  ++ + 
Sbjct: 234  IELAGCDRLTIAPSLLKELAESEGPVERKLAYTGEIQAKPAP---------LTEAEFYWQ 284

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
                P AV+ L  G+  ++    ++E++   +
Sbjct: 285  HNQDPMAVDKLADGIRKFAIDQGKLEKMISDL 316



>sp|Q8D6H9|TAL_VIBVU Transaldolase (EC 2.2.1.2).>gb:AE016810_338290
            Vibrio vulnificus CMCP6 chromosome II section 3 of 6 of
            the complete sequence.>gb:AE016796_1048014 Vibrio
            vulnificus CMCP6 chromosome II complete sequence.
          Length = 316

 Score =  164 bits (416), Expect = 3e-39
 Identities = 100/329 (30%), Positives = 169/329 (51%), Gaps = 1/329 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++ +L+ +   + +V DT   D  +K+ P  AT + SL+L    + +  +   +D ++  
Sbjct: 1    MSNKLEQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAE--YAPLIDASIEY 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +    +DK  ++    +   VN+G ++ K +PGR+STEVDARL+YD  G V K   L+K
Sbjct: 59   AKTQS-DDKAQQIQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYDMEGSVAKARQLVK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            +YN   I  +R+L K+ +TW+GI A+ +LE EGI  +LT ++SF            +I  
Sbjct: 118  MYNDAGITNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSG-DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
            FVGR+ DW +   G D E +      EDPG   VTK YNY  +YG+K+ +M A+ RN  +
Sbjct: 178  FVGRIMDWYKAKEGRDFEAQ------EDPGVLSVTKIYNYYKEYGYKTVVMGASFRNIGE 231

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
            +  + G D +     +L  L+ +     EK    +  + + AA         +T  ++ +
Sbjct: 232  ILELAGCDRLTIAPALLAELEAAEGEVVEKLVDSKGAAERPAA---------MTHAEFLW 282

Query: 1113 ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 P AVE L  G+  ++    ++E +
Sbjct: 283  EHNQDPMAVEKLAEGIRNFAVDQGKLEAM 311



>sp|Q7V2G1|TAL_PROMP Transaldolase (EC 2.2.1.2).>gb:BX572091_796145
            Prochlorococcus marinus MED4 complete genome; segment
            2/5.
          Length = 333

 Score =  164 bits (416), Expect = 3e-39
 Identities = 107/336 (31%), Positives = 167/336 (49%), Gaps = 9/336 (2%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQ--- 398
            L+ +++ + +V DT   D  +KF P  AT + SL+L     PD  +   +D AL      
Sbjct: 5    LEQLSSITVVVADTGDLDAIKKFQPRDATTNPSLILAAAKNPD--YIKLIDQALESSRKS 62

Query: 399  ------ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV 560
                  E   +++   ++S FF K ++N       L+ GRVSTEVDARL++DT   V K 
Sbjct: 63   LPAGFSESELIKETIDQVSVFFGKEILN-------LISGRVSTEVDARLSFDTEATVTKA 115

Query: 561  HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXX 740
              L+  Y    I  ER+L KI +TW+GI+A+ +LE EGI+ +LT +++FC          
Sbjct: 116  RKLINHYKSFGINKERILIKIASTWEGIKAAEILEKEGIKCNLTLLFNFCQAVACANAKI 175

Query: 741  SVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR 920
            ++I  FVGR+ DW +  +G     G     EDPG   VTK YNY  + G K+++M A+ R
Sbjct: 176  TLISPFVGRILDWHKAKTGKDNFAGC----EDPGVISVTKIYNYFKEKGFKTEVMGASFR 231

Query: 921  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD 1100
            N  ++  + G D +    K L  L        +K   +     QS+  Y F +++     
Sbjct: 232  NIDEIKELAGCDLLTIAPKFLDELNREEGELIKK--LDEDTQSQSSIDYKFDEKD----- 284

Query: 1101 QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
             +  +      A E L+ G+ G+S   + +EEL  K
Sbjct: 285  -FRLSMLEDQMASEKLSEGITGFSKAIEELEELLLK 319



>gb:AJ720046_2502233 Gallus gallus mRNA for hypothetical protein,
            clone 9n21.
          Length = 337

 Score =  164 bits (415), Expect = 4e-39
 Identities = 106/334 (31%), Positives = 178/334 (53%), Gaps = 6/334 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA- 392
            + + L+ + +++ +V DT  F+  +++ P  AT + SL+L    +P   ++  VD A+A 
Sbjct: 11   MESALEQLKHHTTVVADTGDFNAIDEYKPLDATTNPSLILVAAQMP--AYQKLVDDAVAY 68

Query: 393  DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL 572
             ++  G ED+  + +C  +K  V  G ++ K +PGRVSTEVDARL++D  G++ +   L+
Sbjct: 69   GKKLGGSEDEQIQNAC--DKLFVLFGAEILKRIPGRVSTEVDARLSFDKEGMIQRARRLI 126

Query: 573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVI 749
             LY  + I  +R+L K+ +TW+GI+A  +LEAE GI  ++T ++SF           ++I
Sbjct: 127  DLYKEVGIGKDRILIKLSSTWEGIQAGEVLEAEYGIHCNMTLLFSFAQAVACAEAGVTLI 186

Query: 750  QIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQ 929
              FVGR+ DW    +GD +        EDPG   VTK YNY  K+G+K+ +M A+ RN  
Sbjct: 187  SPFVGRILDW-HVANGDKK---TYEPSEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTG 242

Query: 930  DVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTK----EEVVTW 1097
            ++ ++ G DY+    K+L  L +      E       LS + A A +  K    E+   W
Sbjct: 243  EIKALTGCDYLTISPKLLAELSK------EHVKLTPTLSVKEAQACDLEKIHLDEKAFRW 296

Query: 1098 DQYSFASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                        AVE L+ G+  ++  A ++E +
Sbjct: 297  HHNE-----DQMAVEKLSDGIRKFAADAIKLERM 325



>sp|Q7MDD5|TAL_VIBVY Transaldolase (EC 2.2.1.2).>gb:BA000038_725189
            Vibrio vulnificus YJ016 DNA, chromosome II, complete
            sequence.
          Length = 316

 Score =  163 bits (413), Expect = 7e-39
 Identities = 100/329 (30%), Positives = 170/329 (51%), Gaps = 1/329 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++ +L+ +   + +V DT   D  +K+ P  AT + SL+L    + +  +   +D ++  
Sbjct: 1    MSNKLEQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAE--YAPLIDASIEY 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +    +DK  ++    +   VN+G ++ K +PGR+STEVDARL+YD  G V K   L+K
Sbjct: 59   AKTQS-DDKAQQIQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYDMEGSVAKARQLVK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            +YN   I  +R+L K+ +TW+GI A+ +LE EGI  +LT ++SF            +I  
Sbjct: 118  MYNDAGITNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSG-DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
            FVGR+ DW +   G D E +      EDPG   VTK YNY  +YG+K+ +M A+ RN  +
Sbjct: 178  FVGRIMDWYKAKEGRDFEAQ------EDPGVLSVTKIYNYYKEYGYKTVVMGASFRNIGE 231

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
            +  + G D +     +L  L+ +     E    E+ +  + AA     +   +T  ++ +
Sbjct: 232  ILELAGCDRLTIAPALLAELEAA-----EGEVVEKLVDSKGAA----ERPAPMTHAEFLW 282

Query: 1113 ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 P AVE L  G+  ++    ++E +
Sbjct: 283  EHNQDPMAVEKLAEGIRNFAVDQGKLEAM 311



>sp|Q9CKH9|TALB_PASMU Transaldolase B (EC 2.2.1.2).>gb:AE006201_216527
            Pasteurella multocida subsp. multocida str. Pm70 section
            168 of 204 of the complete genome.>gb:AE004439_1119257
            Pasteurella multocida subsp. multocida str. Pm70,
            complete genome.
          Length = 316

 Score =  163 bits (413), Expect = 7e-39
 Identities = 101/330 (30%), Positives = 171/330 (51%), Gaps = 4/330 (1%)
 Frame = +3

Query: 222  TELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA--- 392
            T+LD++ + + +V DT   +  +++ P  AT + SL+L   +LP  ++   +D A+A   
Sbjct: 2    TQLDSLRSMTVVVADTGDIEAIKQYQPQDATTNPSLILSASALP--QYAPLIDDAIAYAK 59

Query: 393  -DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL 569
               +C   +  DA      +K  VN+G ++ K++PGR+STEVDARL+YDT   + K   L
Sbjct: 60   TKSDCPRQQLVDAE-----DKLAVNIGLEILKIIPGRISTEVDARLSYDTQATIEKARKL 114

Query: 570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVI 749
            +KLYN   I   R+L KI +TWQGI A+ +LE EGI  +LT ++S             +I
Sbjct: 115  IKLYNEAGIENHRILIKIASTWQGIRAAEVLEKEGINCNLTLLFSEAQARACAEAGVYLI 174

Query: 750  QIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQ 929
              FVGR+ DW + ++G  +   A    EDPG   VT+ YNY  ++ +K+ +M A+ RN  
Sbjct: 175  SPFVGRILDWHKANTGRQDYPAA----EDPGVISVTQIYNYYKQHNYKTVVMGASFRNVD 230

Query: 930  DVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYS 1109
            ++  + G D +     +L  L+        K +F   L           + + +T  ++ 
Sbjct: 231  EIIELAGCDRLTISPTLLSHLQAREGELVRKLAFSGELK---------DRPQPLTESEFY 281

Query: 1110 FASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            +     P AV  L  G+  ++   +++E++
Sbjct: 282  WQHNSDPMAVAKLAEGICKFAEDQEKLEKM 311



>sp|P51778|TAL_ANAVA Transaldolase (EC 2.2.1.2).>pir|S72517|S72517
            transaldolase (EC 2.2.1.2) - Anabaena
            variabilis>gb:ANATAL_553383 Anabaena variabilis
            transaldolase (tal) gene, complete cds.
          Length = 332

 Score =  163 bits (412), Expect = 9e-39
 Identities = 103/331 (31%), Positives = 167/331 (50%), Gaps = 4/331 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL--ADQE 401
            L+ +   + +V DT      EKF P  AT + SL+     +P+  ++  VD  L  A ++
Sbjct: 6    LEQLREMTVVVADTGDIQAIEKFTPRDATTNPSLITAAAKMPE--YQEIVDQTLLQAKKD 63

Query: 402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
                  K   +S  F++  V+ G  + +++PGRVSTEVDARL+YDT   + K  +L+  Y
Sbjct: 64   AGAGASKGQIVSLAFDRLAVSFGLKILQIIPGRVSTEVDARLSYDTEATITKARELIAQY 123

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                I PER+L KI +TW+GI+A+ +LE EGI  +LT ++             ++I  FV
Sbjct: 124  KAAGIGPERVLIKIASTWEGIKAAEILEKEGIHCNLTLLFGLHQAIACAEAGITLISPFV 183

Query: 762  GRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYS 941
            GR+ DW +  +G      A    E PG   VT  YNY  K+G+ +++M A+ RN  ++  
Sbjct: 184  GRILDWYKKETGRDSYPSA----EYPGVISVTTIYNYYKKFGYTTEVMGASFRNIGEITE 239

Query: 942  ILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV--VTWDQYSFA 1115
            + G D +     +L  L+ ++          R+L P  AA  +  K  +   T+D+   A
Sbjct: 240  LAGSDLLTISPGLLGELQATIG------ELPRKLDPAKAATLDIEKISIDKATFDKMHAA 293

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
              M   A + L  G++G+S   + +E L  +
Sbjct: 294  DRM---AYDKLDEGIKGFSKALEELETLLAE 321



>sp|Q87GY5|TAL_VIBPA Transaldolase (EC 2.2.1.2).>gb:BA000032_709720
            Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 2,
            complete sequence.
          Length = 316

 Score =  162 bits (411), Expect = 1e-38
 Identities = 98/328 (29%), Positives = 166/328 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++ +L+ +   + +V DT   D  +K+ P  AT + SL+L    + +  +   +D ++  
Sbjct: 1    MSNKLEQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAE--YAPLIDASIEY 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     DK  ++    +   VN+G ++ K +PGR+STEVDARL+YD  G V K   L+K
Sbjct: 59   AKAQS-NDKAQQVQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYDMEGSVAKARQLVK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            +YN   I  +R+L K+ +TW+GI A+ +LE EGI  +LT ++SF            +I  
Sbjct: 118  MYNDAGITNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +   G           EDPG   VTK YNY  +YG+K+ +M A+ RN  ++
Sbjct: 178  FVGRIMDWYKAKEGRD-----FEASEDPGVLSVTKIYNYYKEYGYKTVVMGASFRNIGEI 232

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L  L+ +     E    E+ +  + AA     +   +T  ++ + 
Sbjct: 233  LELAGCDRLTIAPALLAELEAA-----EGEVVEKLVDSKGAA----ERPAPMTHAEFLWE 283

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                P AVE L  G+  ++    ++E +
Sbjct: 284  HNQDPMAVEKLAEGIRNFAVDQGKLEAM 311



>gb:AE017282_429729 Methylococcus capsulatus str. Bath, complete
            genome.
          Length = 329

 Score =  162 bits (409), Expect = 2e-38
 Identities = 104/328 (31%), Positives = 172/328 (52%), Gaps = 4/328 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD-QEC 404
            LD +   + +V DT   +  EKF P  AT + SL+     +P  +++  VD  L   ++ 
Sbjct: 6    LDQLREVTVVVADTGDIEAIEKFKPRDATTNPSLITAAAQMP--QYQDIVDDTLKGARQT 63

Query: 405  YGLEDKDARMSC-FFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
             G     A+++   F++  V+ G  + +++ GRVSTEVDARL+YDT G + K  +++K Y
Sbjct: 64   LGPGASAAQVANRAFDRLAVSFGLKILQIIEGRVSTEVDARLSYDTEGTIEKAREIIKQY 123

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                +  ER+L KI ATW+GIEA+ +LE EGI  +LT ++             ++I  FV
Sbjct: 124  EAAGVSKERVLIKIAATWEGIEAAAVLEKEGIHCNLTLLFGLHQAIACAENGITLISPFV 183

Query: 762  GRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYS 941
            GR+ DW +  +G      +    EDPG   VT+ YNY  K+G+K+++M A+ RN  ++  
Sbjct: 184  GRILDWYKKDTG----RESYAPHEDPGVLSVTQIYNYYKKFGYKTEVMGASFRNIGEITE 239

Query: 942  ILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF--A 1115
            + G D +     +L  L+ +      +    R+L P  A  Y   K  V   ++Y+F   
Sbjct: 240  LAGCDLLTIAPSLLAELQAT------EGELPRKLDPAKAKDYPIEKIHV---NKYTFDKM 290

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
             A    A E L  G++G++   +++E+L
Sbjct: 291  HAENRMATEKLEEGIQGFTKALEQLEKL 318



>sp|Q7U5E8|TAL_SYNPX Transaldolase (EC 2.2.1.2).>gb:BX569693_776661
            Synechococcus sp. WH8102 complete genome; segment 5/7.
          Length = 390

 Score =  162 bits (409), Expect = 2e-38
 Identities = 107/332 (32%), Positives = 170/332 (51%), Gaps = 6/332 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + T LD ++  + +V DT   +   KF P  AT + SL+L    +P   ++S +D AL  
Sbjct: 1    MATLLDQLSAMTVVVADTGDLEAIRKFTPRDATTNPSLILAAAQIP--AYQSLIDEALRS 58

Query: 396  QECYGLEDKDARMSCFFNKALVNV----GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVH 563
                 L    A +    ++AL  +    G ++ K+VP RVSTEVDARL+YDT   + K  
Sbjct: 59   SR--KLIGDAAPVEDVVHEALDEISVIFGKEILKIVPRRVSTEVDARLSYDTDATIEKGR 116

Query: 564  DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXS 743
             L++LYN   I  +R+L KI +TW+GI+A+ +LE EGI  +LT ++ F           +
Sbjct: 117  KLIRLYNDAGISNDRVLIKIASTWEGIKAAEVLEKEGIHCNLTLLFGFGQAVACAEAGVT 176

Query: 744  VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN 923
            ++  FVGR+ DW +  +G     G     EDPG   VT+ +NY   YG+K+++M A+ RN
Sbjct: 177  LVSPFVGRILDWYKADTGRDSYPGP----EDPGVISVTRIFNYYKTYGYKTEVMGASFRN 232

Query: 924  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ 1103
              ++  + G D +    K+L  L+ES          +  LS +  A      EE +  D+
Sbjct: 233  LDEITELAGCDLLTISPKLLDQLRES----------DASLSQKLDATNPSGGEEQIHVDR 282

Query: 1104 YSFASAMGP--AAVELLTAGMEGYSNQAKRVE 1193
              F + M     A + L  G++G+S   + +E
Sbjct: 283  ERFDAMMAADRMATDKLGEGIKGFSKAIETLE 314



>gb:BX908798_831247 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 322

 Score =  160 bits (406), Expect = 5e-38
 Identities = 102/329 (31%), Positives = 171/329 (51%), Gaps = 4/329 (1%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +LD + + + IV DT   +  +++ PT AT + SL+L     P      A    + +   
Sbjct: 5    KLDQLKSMTTIVIDTGDIEAIKEYSPTDATTNPSLILSAVEKP------AYKPLMEEAYH 58

Query: 405  YGLEDKDA--RMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
            Y  + K +  ++S F +K  VNVG ++ KL+PGRVSTEVDARL++D  G + K   L+ L
Sbjct: 59   YSQKAKSSGEQISLFLDKLFVNVGCEILKLIPGRVSTEVDARLSFDVEGSIQKAQSLIAL 118

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
            Y  + I  ER+L K+ +TW+G  A++ LE  GI  ++T ++S            ++I  F
Sbjct: 119  YKEMGIEKERILIKLASTWEGGLAAKQLEKMGIHCNMTLLFSMPQAIHCAEAQATLISPF 178

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW + H     V G     EDPG   VT  Y+Y  K+ +K+++M A+ RNK+++ 
Sbjct: 179  VGRILDWYKKH---DNVPG-YAPAEDPGVKSVTTIYHYFKKFSYKTQIMGASFRNKEEIL 234

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
             + G D +      LQ L       D   + E++L    +   N    E +  ++ +F  
Sbjct: 235  ELAGCDLLTISPHFLQELH------DASGNVEQKLDAAKSKQLNI---EPIKMNEKAFRL 285

Query: 1119 AMG--PAAVELLTAGMEGYSNQAKRVEEL 1199
            A+     A E L+ G+  ++  A+++E++
Sbjct: 286  ALNDDAMATEKLSEGIRNFAKDAQKLEKM 314



>sp|Q8DLL7|TAL_SYNEL Transaldolase (EC 2.2.1.2).>gb:BA000039_726251
            Thermosynechococcus elongatus BP-1 DNA, complete genome.
          Length = 391

 Score =  160 bits (405), Expect = 6e-38
 Identities = 104/328 (31%), Positives = 167/328 (50%), Gaps = 4/328 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY 407
            L+ +   + +V DT      +KF P  AT + SL+     + +  ++S VD  L   +  
Sbjct: 4    LEQLRQMTVVVADTGDILAIQKFTPRDATTNPSLITAAAQMKE--YQSIVDETLRQAKAD 61

Query: 408  GLEDKDAR--MSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
                  +R  +S   ++  V  G  + +++PGRVSTEVDARL+YDT   V K  +L+  Y
Sbjct: 62   LGSGATSREIVSLAVDRLAVAFGLKILQIIPGRVSTEVDARLSYDTAATVQKARELISQY 121

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                +  +R+L KI ATW+GI A+ +LE EGI  +LT ++ F           ++I  FV
Sbjct: 122  EAAGVGRDRVLIKIAATWEGIRAAEILEKEGIHCNLTLLFGFHQAVACAEAGVTLISPFV 181

Query: 762  GRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYS 941
            GR+ DW +  +G +E  G     EDPG   VTK YNY  K+G+ +++M A+ RN  ++  
Sbjct: 182  GRILDWYKKKTGRAEYPGP----EDPGVISVTKIYNYYKKFGYPTEVMGASFRNIGEIIE 237

Query: 942  ILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS- 1118
            + G D +     +LQ L+ +          +R+L P  AA  +  K   V  D+ +F   
Sbjct: 238  LAGCDLLTISPALLQELQNTTG------ELKRKLDPAIAATLDIEK---VAMDEATFRKM 288

Query: 1119 -AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
             A    A E L  G++G++   + +E+L
Sbjct: 289  HAADEMASEKLEEGIKGFTKALETLEDL 316



>sp|Q884H4|TAL_PSESM Transaldolase (EC 2.2.1.2).>gb:AE016863_351548
            Pseudomonas syringae pv. tomato str. DC3000 section 8 of
            21 of the complete genome.>gb:AE016853_1036723
            Pseudomonas syringae pv. tomato str. DC3000 complete
            genome.
          Length = 309

 Score =  159 bits (403), Expect = 1e-37
 Identities = 105/328 (32%), Positives = 171/328 (52%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T++LD +  ++ +V DT  F   +   P  AT + SLLL   S        + D  LAD
Sbjct: 1    MTSKLDQLKKFTTVVADTGDFGAIKSLKPQDATTNPSLLLKAAS------SESNDQMLAD 54

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
               +     D  ++C  ++  V +G ++ K+VPGRVSTEVDARL++DT  ++ +   ++ 
Sbjct: 55   --AFSGAKGDIGLAC--DRFAVAIGQEILKVVPGRVSTEVDARLSFDTDALIERSERIIG 110

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY+   I  +R+L K+ ATW+GI A+  LE +GIQT+LT ++SF            +I  
Sbjct: 111  LYDTAGISRDRVLIKLAATWEGIRAAEKLEKDGIQTNLTLLFSFAQAVACAEAGVFLISP 170

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +  SG   V GA    +DPG   VT+ YNY      K+ +M A+ RN   +
Sbjct: 171  FVGRIYDWYKKSSGTDYV-GA----DDPGVQSVTRIYNYYKANDFKTVVMGASFRNLNQI 225

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +    ++L+ L E      +  + E++L+P +A        + +T  Q+ +A
Sbjct: 226  EQLAGCDRLTISTELLKQLAE------DTGTLEQKLAPGNAG----EARQSLTESQFRWA 275

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            S     A E L  G+  ++   +++E L
Sbjct: 276  SNEDAMATEKLAEGIRQFARDQEKLEAL 303



>sp|Q7VD64|TAL_PROMA Transaldolase (EC 2.2.1.2).>gb:AE017162_394976
            Prochlorococcus marinus subsp. marinus str. CCMP1375
            section 2 of 6 of the complete
            genome.>gb:AE017126_1030645 Prochlorococcus marinus
            subsp. marinus str. CCMP1375 complete genome.
          Length = 335

 Score =  159 bits (403), Expect = 1e-37
 Identities = 95/335 (28%), Positives = 171/335 (51%), Gaps = 4/335 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL-- 389
            +T+ LD +++ + +V DT   +    F P  AT + SL+L    +P   +++ +D +L  
Sbjct: 1    MTSLLDQLSSMTVVVADTGDLEAIRTFKPQDATTNPSLILAAAQIP--AYQNLIDKSLQA 58

Query: 390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL 569
            + Q           +    ++  V  G ++ K++PGRVSTEVDARL+++T   + K   +
Sbjct: 59   SRQRVGSFASAKEVVDEALDEVCVTFGKEILKIIPGRVSTEVDARLSFNTQATINKARKI 118

Query: 570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVI 749
            + LY  ++I  ER+L K+ +TW+GI+A+ +LE+EGI  +LT ++ F           ++I
Sbjct: 119  IDLYKKVDISKERVLIKVASTWEGIKAAEVLESEGIHCNLTLLFGFSQAVACAEAGVTLI 178

Query: 750  QIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQ 929
              FVGR+ DW +  +G     G     EDPG   VTK +NY     +K+++M A+ RN  
Sbjct: 179  SPFVGRILDWYKAETGKDSYAGE----EDPGVVSVTKIFNYYKSNNYKTEVMGASFRNID 234

Query: 930  DVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYS 1109
            ++  + G D +    K L+ L+ S          + +L+ +  +      E  +  ++Y 
Sbjct: 235  EILELAGCDLLTIAPKFLEQLENS----------DSKLTRKLDSLKPLPSETKIHLEEYD 284

Query: 1110 FAS--AMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
            F +   +   A E L  G+  +S   +++E+L  K
Sbjct: 285  FRNMLKLDRMATEKLEEGIINFSKAIEQLEQLLSK 319



>gb:BC084118_2563523 Xenopus laevis hypothetical LOC495027, mRNA (cDNA
            clone MGC:85283 IMAGE:6874403), complete cds.
          Length = 338

 Score =  159 bits (401), Expect = 2e-37
 Identities = 100/325 (30%), Positives = 175/325 (53%), Gaps = 1/325 (0%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY 407
            LD +  ++ +V DT  F+  E++ P  AT + SL+L    +PD  ++  V+ A+   +  
Sbjct: 16   LDQLKQHTVVVADTGDFNAIEEYKPQDATTNPSLILAAAQMPD--YQGLVNDAIQYGKNL 73

Query: 408  GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNG 587
            G  +++ +++   +K  V  G ++ K +PGRVSTEVDARL++D  G+V +   L+ LY  
Sbjct: 74   GGSEEE-QINNIMDKLFVLFGVEILKKIPGRVSTEVDARLSFDKDGMVERAKRLIALYKE 132

Query: 588  IEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              I  +R+L K+ +TW+GI+A ++LE E GI  ++T ++SF           ++I  FVG
Sbjct: 133  AGIDKKRILIKLSSTWEGIQAGKILEEEYGIHCNMTLLFSFAQAVACAEAGVTLISPFVG 192

Query: 765  RLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
            R+ DW   +S +   E +    EDPG   V K YNY  K+G+K+ +M A+ RN  ++ ++
Sbjct: 193  RILDWHVANSDNKSYEPS----EDPGVKSVAKIYNYYKKFGYKTIVMGASFRNTGEIKAL 248

Query: 945  LGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAM 1124
             G DY+    K+L  L +      +       L+ + A A N  K  +    ++ +    
Sbjct: 249  TGCDYLTISPKLLSELAK------DNSKLTPALTVKEAQASNLEKVHLEE-KEFRWLHNE 301

Query: 1125 GPAAVELLTAGMEGYSNQAKRVEEL 1199
               AVE L+ G+  ++  A ++E++
Sbjct: 302  DQMAVEKLSDGIRKFAIDAIKLEKM 326



>gb:BX950851_842622 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 317

 Score =  158 bits (400), Expect = 2e-37
 Identities = 98/332 (29%), Positives = 170/332 (51%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct: 1    MTDKLTSLRQVTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIAW 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                   D+  ++    +K  VN+G ++ KL+PGR+STEVDARL+YDT   V K   L+K
Sbjct: 59   AREQS-SDRKQQVVDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASVAKAKHLIK 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I  ER+L K+ +TWQGI A+  LE EGI  +LT ++SF            +I  
Sbjct: 118  LYNDAGISNERILIKLASTWQGICAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + +    E        EDPG   V++ Y+Y  ++G+++ +M A+ RN  ++
Sbjct: 178  FVGRILDWYKANGDKKE----FAPHEDPGVVSVSEIYDYYKEHGYETVVMGASFRNVGEI 233

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L ES      K S+   +  + A          +T  ++ + 
Sbjct: 234  LELAGCDRLTIAPALLKELSESEGEVVRKLSYVGDVKVRPAR---------MTEAEFYWQ 284

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
                P A++ L  G+  ++   +++E++   +
Sbjct: 285  HNQDPMAIDKLADGIRKFAIDQEKLEKMIADL 316



>sp|Q7NK81|TAL_GLOVI Transaldolase (EC 2.2.1.2).>gb:BA000045_741672
            Gloeobacter violaceus PCC 7421 DNA, complete genome.
          Length = 389

 Score =  158 bits (399), Expect = 3e-37
 Identities = 108/329 (32%), Positives = 164/329 (49%), Gaps = 5/329 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC- 404
            LD +   + +V DT      E+F P  AT + SL+     +P  +++  VD  L      
Sbjct: 6    LDQLRQMTIVVADTGDIQAIEQFTPRDATTNPSLITAAAQMP--QYQQIVDDTLKQARAE 63

Query: 405  YGLEDKDARMSCF-FNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
             G E K A ++   F++  V  G  +  +VPGRVSTEVDARL+YDT   + K   L+  Y
Sbjct: 64   LGPEAKAAAVATLAFDRLAVAFGLKILAIVPGRVSTEVDARLSYDTEATIEKGRSLIAQY 123

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                I  ER+L KI +TW+GI A+ +LE EGI  +LT ++             ++I  FV
Sbjct: 124  EAAGISRERVLIKIASTWEGIRAAEILEDEGIHCNLTLLFGVHQAIACAEAGVTLISPFV 183

Query: 762  GRLRDWARNHSG-DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            GR+ DW +  +G D E        EDPG   VT  YNY  K+G+++++M A+ RN  ++ 
Sbjct: 184  GRILDWYKKETGRDYEPH------EDPGVVSVTTIYNYYKKFGYQTQVMGASFRNIGEIV 237

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
             + G D +    K+L+ L+ +           R+L P  AA     K   +  DQ +F  
Sbjct: 238  ELAGCDLLTISPKLLEQLQAT------DAELVRKLDPDQAAGLEIEK---IDMDQATFEK 288

Query: 1119 --AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
              A    A E L  G++G++N    +E+L
Sbjct: 289  RHAEDRMASEKLDEGIKGFTNALVALEKL 317



>sp|Q7N8Z1|TAL_PHOLL Transaldolase (EC 2.2.1.2).>gb:BX571860_785427
            Photorhabdus luminescens subsp. laumondii TTO1 complete
            genome; segment 2/17.
          Length = 317

 Score =  157 bits (398), Expect = 4e-37
 Identities = 102/337 (30%), Positives = 169/337 (50%), Gaps = 5/337 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T +L ++   + +V DT      + + P  AT + SL+L    +P+  ++  +D A+A 
Sbjct: 1    MTDKLTSLRKLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPE--YRKLIDEAIA- 57

Query: 396  QECYGLEDKDARMSCFFN---KALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD 566
               +  E  D+R     +   K  VN+G ++ KL+PGR+STEVDARL+YD+   V K   
Sbjct: 58   ---WAREQSDSREQQIVDASDKLAVNIGLEILKLIPGRISTEVDARLSYDSERSVAKAKR 114

Query: 567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSV 746
            L+KLYN   I  +R+L K+ +TWQGI A+  LE EGI  +LT ++SF            +
Sbjct: 115  LIKLYNEAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVYL 174

Query: 747  IQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNK 926
            I  FVGR+ DW + +S   E        EDPG   VT+ Y Y  ++G+ + +M A+ RN 
Sbjct: 175  ISPFVGRILDWYKANSDQKE----FAPHEDPGVISVTEIYQYYKQHGYDTVVMGASFRNS 230

Query: 927  QDVYSILGVDYIVTPLKILQSLKESVTPPDEK--YSFERRLSPQSAAAYNFTKEEVVTWD 1100
             ++  + G D +     +L+ L E+    + K  Y+ E +  P+         E    W+
Sbjct: 231  GEILELAGCDRLTIAPALLKELSEAQGEVERKLGYAGEIKARPEP------LNEAQFYWE 284

Query: 1101 QYSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
             +  A      A E L  G+  ++    ++E++   +
Sbjct: 285  HHQDA-----MATEKLADGIRKFAIDQGKLEKMISDL 316



>gb:AY658919_2147929 Synthetic construct Peudomonas aeruginosa clone
            FLH047564.01F PA2796 gene, partial cds.
          Length = 308

 Score =  156 bits (395), Expect = 9e-37
 Identities = 104/326 (31%), Positives = 163/326 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct: 1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct: 59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE 110

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY+   I  ER+L KI +TW+GI A+ +LE EGIQT+LT ++SF            +I  
Sbjct: 111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLFSFAQAVACADAGVFLISP 170

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +  S + +  GA    EDPG   V++ Y Y    G+K+ +M A+ RN   +
Sbjct: 171  FVGRIYDWYKK-SENRDYAGA----EDPGVQSVSRIYRYYKANGYKTVVMGASFRNLGQI 225

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +LQ L       D +    R L P          E    W     A
Sbjct: 226  EQLAGCDRLTISPDLLQQL------ADAQGELPRLLLPGEGEPRQVLDESAFRWQMNEDA 279

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVE 1193
                  A E L  G+  ++   +++E
Sbjct: 280  -----MATEKLAEGIRLFARDQEKLE 300



>sp|Q9I047|TAL_PSEAE Transaldolase (EC 2.2.1.2).>pir|D83295|D83295
            transaldolase PA2796 [imported] - Pseudomonas aeruginosa 
            (strain PAO1)>gb:AE004707_57032 Pseudomonas aeruginosa
            PAO1, section 268 of 529 of the complete
            genome.>gb:AE004091_971132 Pseudomonas aeruginosa PAO1,
            complete genome.
          Length = 307

 Score =  156 bits (395), Expect = 9e-37
 Identities = 104/326 (31%), Positives = 163/326 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T++L+ +  Y+ +V DT  FD   +  P  AT + SLLL   +LP  ++   +  A A 
Sbjct: 1    MTSKLEQLKQYTTVVADTGDFDAIARLKPVDATTNPSLLLKAAALP--RYAEHLRQATAG 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                     DA ++C  ++  V VG D+  ++PGR+STEVDARL++D+   + + H L++
Sbjct: 59   S------GGDAGLAC--DRFAVAVGKDILGVIPGRISTEVDARLSFDSEATLARAHRLIE 110

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY+   I  ER+L KI +TW+GI A+ +LE EGIQT+LT ++SF            +I  
Sbjct: 111  LYDEQGIDRERVLIKIASTWEGIRAAEILEREGIQTNLTLLFSFAQAVACADAGVFLISP 170

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +  S + +  GA    EDPG   V++ Y Y    G+K+ +M A+ RN   +
Sbjct: 171  FVGRIYDWYKK-SENRDYAGA----EDPGVQSVSRIYRYYKANGYKTVVMGASFRNLGQI 225

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +LQ L       D +    R L P          E    W     A
Sbjct: 226  EQLAGCDRLTISPDLLQQL------ADAQGELPRLLLPGEGEPRQVLDESAFRWQMNEDA 279

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVE 1193
                  A E L  G+  ++   +++E
Sbjct: 280  -----MATEKLAEGIRLFARDQEKLE 300



>gb:SCTAL1_1709611 Saccharomyces cerevisiae TAL1 gene for
            transaldolase (EC 2.2.1.2).
          Length = 335

 Score =  155 bits (393), Expect = 1e-36
 Identities = 103/321 (32%), Positives = 166/321 (51%), Gaps = 3/321 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F    KF P  +T + SL+L     P   +   +D A+   + +G +  + ++
Sbjct: 26   VVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPT--YAKLIDVAVEYGKKHG-KTTEEQV 82

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                ++ LV  G ++ K+VPGRVSTEVDARL++DT   + K   ++KL+    +  ER+L
Sbjct: 83   ENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQATIEKARHIIKLFEQEGVSKERVL 142

Query: 615  FKIPATWQGIEASR-LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A++ L E +GI  +LT ++SF           ++I  FVGR+ DW ++ 
Sbjct: 143  IKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVACAEAQVTLISPFVGRILDWYKSS 202

Query: 792  SGDSEVEGALRRGE-DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVT 968
            +G         +GE DPG   V K YNY  KYG+K+ +M A+ R+  ++ ++ GVDY+  
Sbjct: 203  TGKD------YKGEADPGVISVKKMYNYYKKYGYKTIVMGASFRSTDEIKNLAGVDYLTI 256

Query: 969  PLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAVEL 1145
               +L  L  S  P      F R L P SA      K   ++ + ++ F       A E 
Sbjct: 257  SPALLDKLMNSTEP------FPRVLDPVSAKKEAGDKISYISDESKFRFDLNEDAMATEK 310

Query: 1146 LTAGMEGYSNQAKRVEELFGK 1208
            L+ G+  +S     + +L  K
Sbjct: 311  LSEGIRKFSADIVTLFDLIEK 331



>pir|S51462|S51462 transaldolase (EC 2.2.1.2) TAL1 - yeast
            (Saccharomyces cerevisiae)>gb:YSCL9638_1729750
            Saccharomyces cerevisiae chromosome XII cosmid 9638.
          Length = 335

 Score =  155 bits (393), Expect = 1e-36
 Identities = 103/321 (32%), Positives = 166/321 (51%), Gaps = 3/321 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F    KF P  +T + SL+L     P   +   +D A+   + +G +  + ++
Sbjct: 26   VVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPT--YAKLIDVAVEYGKKHG-KTTEEQV 82

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                ++ LV  G ++ K+VPGRVSTEVDARL++DT   + K   ++KL+    +  ER+L
Sbjct: 83   ENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQATIEKARHIIKLFEQEGVSKERVL 142

Query: 615  FKIPATWQGIEASR-LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A++ L E +GI  +LT ++SF           ++I  FVGR+ DW ++ 
Sbjct: 143  IKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVACAEAQVTLISPFVGRILDWYKSS 202

Query: 792  SGDSEVEGALRRGE-DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVT 968
            +G         +GE DPG   V K YNY  KYG+K+ +M A+ R+  ++ ++ GVDY+  
Sbjct: 203  TGKD------YKGEADPGVISVKKIYNYYKKYGYKTIVMGASFRSTDEIKNLAGVDYLTI 256

Query: 969  PLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAVEL 1145
               +L  L  S  P      F R L P SA      K   ++ + ++ F       A E 
Sbjct: 257  SPALLDKLMNSTEP------FPRVLDPVSAKKEAGDKISYISDESKFRFDLNEDAMATEK 310

Query: 1146 LTAGMEGYSNQAKRVEELFGK 1208
            L+ G+  +S     + +L  K
Sbjct: 311  LSEGIRKFSADIVTLFDLIEK 331



>sp|Q9KLW8|TAL_VIBCH Transaldolase (EC 2.2.1.2).>pir|B82437|B82437
           transaldolase B VCA0623 [imported] - Vibrio cholerae
           (strain N16961 serogroup O1)>gb:AE004392_53754 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome II,
           section 49 of 93 of the complete
           chromosome.>gb:AE003853_1050700 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome II, complete
           chromosome.
          Length = 316

 Score =  155 bits (393), Expect = 1e-36
 Identities = 87/260 (33%), Positives = 139/260 (53%)
 Frame = +3

Query: 216 LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
           ++ +L  +   + +V DT   D  +K+ P  AT + SL+L    + +  +   +D A+A 
Sbjct: 1   MSNKLAQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAE--YAPLIDQAIAY 58

Query: 396 QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
            +     DK  ++    +   VN+G ++ K +PGR+STEVDARL+YDT   V K   L+K
Sbjct: 59  AKTQS-NDKAQQVQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYDTERSVAKARQLVK 117

Query: 576 LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
           +YN   I  +R+L K+ +TW+GI A+ +LE EGI  +LT ++SF            +I  
Sbjct: 118 MYNDAGISNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISP 177

Query: 756 FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
           FVGR+ DW +   G           EDPG   VTK YNY  ++G+K+ +M A+ RN  ++
Sbjct: 178 FVGRIMDWYKAKEGRD-----FAASEDPGVLSVTKIYNYYKEHGYKTVVMGASFRNIGEI 232

Query: 936 YSILGVDYIVTPLKILQSLK 995
             + G D +     +L  L+
Sbjct: 233 LELAGCDRLTIAPSLLAELE 252



>sp|P15019|TAL1_YEAST Transaldolase (EC 2.2.1.2).
          Length = 334

 Score =  155 bits (393), Expect = 1e-36
 Identities = 103/321 (32%), Positives = 166/321 (51%), Gaps = 3/321 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F    KF P  +T + SL+L     P   +   +D A+   + +G +  + ++
Sbjct: 25   VVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPT--YAKLIDVAVEYGKKHG-KTTEEQV 81

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                ++ LV  G ++ K+VPGRVSTEVDARL++DT   + K   ++KL+    +  ER+L
Sbjct: 82   ENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQATIEKARHIIKLFEQEGVSKERVL 141

Query: 615  FKIPATWQGIEASR-LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A++ L E +GI  +LT ++SF           ++I  FVGR+ DW ++ 
Sbjct: 142  IKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVACAEAQVTLISPFVGRILDWYKSS 201

Query: 792  SGDSEVEGALRRGE-DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVT 968
            +G         +GE DPG   V K YNY  KYG+K+ +M A+ R+  ++ ++ GVDY+  
Sbjct: 202  TGKD------YKGEADPGVISVKKIYNYYKKYGYKTIVMGASFRSTDEIKNLAGVDYLTI 255

Query: 969  PLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAVEL 1145
               +L  L  S  P      F R L P SA      K   ++ + ++ F       A E 
Sbjct: 256  SPALLDKLMNSTEP------FPRVLDPVSAKKEAGDKISYISDESKFRFDLNEDAMATEK 309

Query: 1146 LTAGMEGYSNQAKRVEELFGK 1208
            L+ G+  +S     + +L  K
Sbjct: 310  LSEGIRKFSADIVTLFDLIEK 330



>gb:CP000010_866147 Burkholderia mallei ATCC 23344 chromosome 1,
            complete sequence.
          Length = 317

 Score =  155 bits (392), Expect = 2e-36
 Identities = 96/330 (29%), Positives = 164/330 (49%), Gaps = 2/330 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +TT LD +  Y+ +V DT  F    ++ P  AT + SL+L   ++    ++  ++  + D
Sbjct: 1    MTTALDQLKQYTTVVADTGDFQQLAQYKPQDATTNPSLILK--AVQKDAYRPILEKTVRD 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                        +    ++ L+  G ++ KL+PGRVSTEVDARL++DT   + K  +++K
Sbjct: 59   HA-------GESVGFIIDRLLIAFGTEILKLIPGRVSTEVDARLSFDTQRSIDKGREIIK 111

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY    +  ER+L K+ +TW+GI A+ +L+ EGI+ ++T ++S             +I  
Sbjct: 112  LYEAAGVGRERVLIKLASTWEGIRAAEVLQREGIRCNMTLLFSLVQAAACAEAGAQLISP 171

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW R   G    E       DPG   V + Y Y   +G+++++M A+ R    +
Sbjct: 172  FVGRIYDWYRKQKGADWDEAQDGGANDPGVQSVRRIYTYYKHFGYRTEVMGASFRTTSQI 231

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +    ++LQ L +S        +  R+LSP  A      + E V  D+ SF 
Sbjct: 232  TELAGCDLLTISPELLQKLHDSTE------AVARKLSPDEA---RDARLERVAIDESSFR 282

Query: 1116 SAMG--PAAVELLTAGMEGYSNQAKRVEEL 1199
              +     A E L  G+  +S  A ++E++
Sbjct: 283  FQLNDDAMATEKLAEGIRLFSADAVKLEKM 312



>gb:BX571965_790876 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.
          Length = 317

 Score =  154 bits (389), Expect = 4e-36
 Identities = 95/330 (28%), Positives = 164/330 (49%), Gaps = 2/330 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +TT LD +  Y+ +V DT  F    ++ P  AT + SL+L   ++    ++  ++  + D
Sbjct: 1    MTTALDQLKQYTTVVADTGDFQQLAQYKPQDATTNPSLILK--AVQKDAYRPILEKTVRD 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                        +    ++ L+  G ++ KL+PGRVSTEVDARL++DT   + K  +++K
Sbjct: 59   HA-------GESVGFIIDRLLIAFGTEILKLIPGRVSTEVDARLSFDTQRSIDKGREIIK 111

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY    +  ER+L K+ +TW+GI A+ +L+ EGI+ ++T ++S             +I  
Sbjct: 112  LYEAAGVGRERVLIKLASTWEGIRAAEVLQREGIRCNMTLLFSLVQAAACAEAGAQLISP 171

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +   G    E       DPG   V + Y Y   +G+++++M A+ R    +
Sbjct: 172  FVGRIYDWYKKQKGADWDEAQDGGANDPGVQSVRRIYTYYKHFGYRTEVMGASFRTTSQI 231

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +    ++LQ L +S        +  R+LSP  A      + E V  D+ SF 
Sbjct: 232  TELAGCDLLTISPELLQKLHDSTE------AVARKLSPDEA---RDARLERVAIDESSFR 282

Query: 1116 SAMG--PAAVELLTAGMEGYSNQAKRVEEL 1199
              +     A E L  G+  +S  A ++E++
Sbjct: 283  FQLNDDAMATEKLAEGIRLFSADAVKLEKM 312



>sp|Q8EBH2|TAL_SHEON Transaldolase (EC 2.2.1.2).>gb:AE015791_317876
            Shewanella oneidensis MR-1 section 340 of 457 of the
            complete genome.>gb:AE014299_953473 Shewanella oneidensis
            MR-1 complete genome.
          Length = 318

 Score =  154 bits (389), Expect = 4e-36
 Identities = 95/326 (29%), Positives = 166/326 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +   L+ + +Y+ IV DT   +  +++ P  AT + SL+L    +P+  + + +D A+A 
Sbjct: 1    MANTLEQLKSYTTIVADTGDIEAIKRYQPEDATTNPSLILKAAQIPE--YSALIDNAIAW 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +     D + ++    +K  VN+G ++ KLVPGR+STEVDARL++D    + K H L++
Sbjct: 59   AKLQST-DIEQQIDDASDKLAVNIGVEILKLVPGRISTEVDARLSFDKEKSIAKAHKLVR 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY    +   R+L K+ +TW+GI A++ LE EGI  +LT ++SF            +I  
Sbjct: 118  LYQEAGVDKSRILIKLASTWEGICAAKELEQEGINCNLTLLFSFSQARACAEAGVYLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +  +G            DPG   VT+ YNY  ++G+ + +M A+ RN  ++
Sbjct: 178  FVGRILDWYKKDTGKD-----YDAVNDPGVVSVTEIYNYYKQHGYNTVVMGASFRNIGEI 232

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +     +L+ L  S      + + + +L P S         E +T  Q+ + 
Sbjct: 233  IELAGCDRLTIGPSLLEELANS------QLAIQPKLVPTSTTV---AVAEPLTEAQFRWE 283

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVE 1193
                  AV+ L  G+  ++    ++E
Sbjct: 284  FNQDAMAVDKLAEGIRNFAIDQGKLE 309



>sp|P53228|TAL2_YEAST Putative transaldolase (EC
            2.2.1.2).>pir|S64337|S64337 transaldolase (EC 2.2.1.2)
            YGR043c - yeast (Saccharomyces
            cerevisiae)>gb:SCYGR043C_1712259 S.cerevisiae chromosome
            VII reading frame ORF YGR043c.
          Length = 333

 Score =  154 bits (389), Expect = 4e-36
 Identities = 101/320 (31%), Positives = 168/320 (52%), Gaps = 3/320 (0%)
 Frame = +3

Query: 249  SEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDA 428
            + +V D+  F+   K+ P  +T + SL+L    L   K+   +D A+     +G  D + 
Sbjct: 24   THVVADSGDFEAISKYEPQDSTTNPSLILAASKLE--KYARFIDAAVEYGRKHGKTDHE- 80

Query: 429  RMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPER 608
            ++    +K LV  G  + K+VPGRVSTEVDARL++D    V K   ++KLY    +P ER
Sbjct: 81   KIENAMDKILVEFGTQILKVVPGRVSTEVDARLSFDKKATVKKALHIIKLYKDAGVPKER 140

Query: 609  LLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR 785
            +L KI +TW+GI+A+R LE + GI  ++T ++SF           ++I  FVGR+ D+ +
Sbjct: 141  VLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVTLISPFVGRIMDFYK 200

Query: 786  NHSG-DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYI 962
              SG D   E       DPG   V K Y+Y  ++G+ +++MAA+ RN  ++ ++ G+D +
Sbjct: 201  ALSGKDYTAE------TDPGVLSVKKIYSYYKRHGYATEVMAASFRNLDELKALAGIDNM 254

Query: 963  VTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAV 1139
              PL +L+ L ES  P       E +L+ +SA      K   +  +  + +       A 
Sbjct: 255  TLPLNLLEQLYESTDP------IENKLNSESAKEEGVEKVSFINDEPHFRYVLNEDQMAT 308

Query: 1140 ELLTAGMEGYSNQAKRVEEL 1199
            E L+ G+  +S   + + +L
Sbjct: 309  EKLSDGIRKFSADIEALYKL 328



>gb:AY557832_1614059 Saccharomyces cerevisiae clone FLH002950.01X
            YGR043C gene, complete cds.
          Length = 333

 Score =  154 bits (388), Expect = 6e-36
 Identities = 92/264 (34%), Positives = 148/264 (56%), Gaps = 2/264 (0%)
 Frame = +3

Query: 249  SEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDA 428
            + +V D+  F+   K+ P  +T + SL+L    L   K+   +D A+     +G  D + 
Sbjct: 24   THVVADSGDFEAISKYEPQDSTTNPSLILAASKLE--KYARFIDAAVEYGRKHGKTDHE- 80

Query: 429  RMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPER 608
            ++    +K LV  G  + K+VPGRVSTEVDARL++D    V K   ++KLY    +P ER
Sbjct: 81   KIENAMDKILVEFGTQILKVVPGRVSTEVDARLSFDKKATVKKALHIIKLYKDAGVPKER 140

Query: 609  LLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR 785
            +L KI +TW+GI+A+R LE + GI  ++T ++SF           ++I  FVGR+ D+ +
Sbjct: 141  VLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVTLISPFVGRIMDFYK 200

Query: 786  NHSG-DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYI 962
              SG D   E       DPG   V K Y+Y  ++G+ +++MAA+ RN  ++ ++ G+D +
Sbjct: 201  ALSGKDYTAE------TDPGVLSVKKIYSYYKRHGYATEVMAASFRNLDELKALAGIDNM 254

Query: 963  VTPLKILQSLKESVTPPDEKYSFE 1034
              PL +L+ L ES  P + K + E
Sbjct: 255  TLPLNLLEQLYESTDPIENKLNSE 278



>gb:BX950851_839611 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 316

 Score =  154 bits (388), Expect = 6e-36
 Identities = 97/327 (29%), Positives = 167/327 (51%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +L+A+  ++ +V D+   D   +F P  AT + SL+L   +LP  +++   D A+A    
Sbjct: 3    QLEALKQFTVVVADSGDIDSIRQFSPQDATTNPSLILKAATLP--QYQPLFDDAIAYANL 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             G    + R+    ++  VN+G ++ K +PGR+STEVDARL++D    V K   L+ +Y 
Sbjct: 61   QG-GSPETRLINASDRLAVNIGAEVLKSIPGRISTEVDARLSFDRGMCVAKARKLIGMYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              +IP  R+L K+ ATW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  EKDIPRSRILIKLAATWEGIRAAEELEKEGINCNLTLLFSFAQARACAEAGVFLISPFVG 179

Query: 765  RLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
            R+ DW +     S+ +       DPG   V   Y+Y  ++ +++ +M A+ R  + + ++
Sbjct: 180  RIYDWYQEKQPTSDYQAE----SDPGVISVRDIYDYYKRHRYQTVIMGASFRKVEQILAL 235

Query: 945  LGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAY--NFTKEEVVTWDQYSFAS 1118
             G D +     +L+ LK S  P       ER+L+P + A +  +   E    W+ +  A 
Sbjct: 236  AGCDRLTISPALLEQLKNSSDP------VERQLTPSTEAFHPPSPLSEAEFRWEHHQDA- 288

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AV+ L  G+  ++   +++E L
Sbjct: 289  ----MAVDKLAEGIRLFAADQQKLEAL 311



>sp|Q88KX1|TAL_PSEPK Transaldolase (EC 2.2.1.2).>gb:AE016782_331595
            Pseudomonas putida KT2440 section 9 of 21 of the complete
            genome.>gb:AE015451_946672 Pseudomonas putida KT2440
            complete genome.
          Length = 308

 Score =  154 bits (388), Expect = 6e-36
 Identities = 99/331 (29%), Positives = 167/331 (50%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T++L+ +  ++ +V DT   D   +  P  AT + SLLL   ++P   +   +    AD
Sbjct: 1    MTSKLEQLKQFTTVVADTGDLDAITRLKPVDATTNPSLLLKAAAIPG--YADLLKQVKAD 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +       +  ++C  +K  V VG  + K++PGR+STEVDARL++D   ++ K   L+ 
Sbjct: 59   AK------GNVDLAC--DKFAVAVGSGILKVIPGRISTEVDARLSFDEPALLNKARQLIA 110

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY    +  ER+L K+ +TW+GI A+  LE EGIQT+LT ++SF            +I  
Sbjct: 111  LYEAAGVAKERVLIKLASTWEGIRAAEQLEKEGIQTNLTLLFSFAQAQACADAGVFLISP 170

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +  +G  E  GA    EDPG   VT+ YNY    G+ + +M A+ RN   +
Sbjct: 171  FVGRIYDWYKKSTG-QEYVGA----EDPGVQSVTRIYNYYKANGYNTVVMGASFRNIGQI 225

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
              + G D +    ++LQ L       D++    + L P +A       ++ +   Q+ +A
Sbjct: 226  EQLAGCDRLTISPELLQQLS------DDQGELPQVLKPGNAG----EAKQHLNESQFRWA 275

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
                    E L  G+  ++   +++E+L  +
Sbjct: 276  MNEDAMGTEKLAEGIRQFARDQEKLEKLIAE 306



>sp|Q7VP02|TAL_HAEDU Transaldolase (EC 2.2.1.2).>gb:AE017151_391892
            Haemophilus ducreyi strain 35000HP section 1 of 6 of the
            complete genome.>gb:AE017143_1026154 Haemophilus ducreyi
            strain 35000HP complete genome.
          Length = 315

 Score =  154 bits (388), Expect = 6e-36
 Identities = 99/325 (30%), Positives = 167/325 (51%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +LDA+   + +V DT   +   ++ P  AT + SL+L   +L  +++   +D A+   + 
Sbjct: 3    QLDALREMTVVVADTGDIEAIRQYQPQDATTNPSLILSASAL--SQYAPLIDDAIRYAKS 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
                +K  ++    +K  VN+G ++ K+VPGR+STEVDAR +YDT   + K   L+ LYN
Sbjct: 61   KS-GNKAQQLVDAEDKLAVNIGLEILKIVPGRISTEVDARFSYDTEKTIAKARKLIGLYN 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
               +   R+L KI ATWQGI A+ +LE EGI  +LT ++S             +I  FVG
Sbjct: 120  EAGVANNRILIKIAATWQGIRAAEILEKEGINCNLTLLFSQAQARACAEAGVYLISPFVG 179

Query: 765  RLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
            R+ DW   +  + + E A    EDPG   VT  YNY  +Y +K+ +M A+ RN  ++  I
Sbjct: 180  RILDW---YKANEKKEYA--AAEDPGVISVTAIYNYYKQYNYKTIVMGASFRNVGEITEI 234

Query: 945  LGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAM 1124
             G D +     +L++L ES      K  ++  +  + A          ++  ++ +    
Sbjct: 235  AGCDRLTIAPPLLKALAESNETLVRKLDYQGEILDRPAP---------LSEAEFYWQHNQ 285

Query: 1125 GPAAVELLTAGMEGYSNQAKRVEEL 1199
             P AV+ L  G+  ++   +++EE+
Sbjct: 286  DPMAVDKLAEGIRKFAIDQEKLEEM 310



>gb:AY144881_1583672 Saccharomyces bayanus clone Contig4169 TAL1 gene,
            complete cds.
          Length = 335

 Score =  153 bits (387), Expect = 7e-36
 Identities = 103/320 (32%), Positives = 164/320 (51%), Gaps = 2/320 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F+   KF P  +T + SL+L     P       +D A+A  + +G    + ++
Sbjct: 26   VVADTGDFNSIAKFQPQDSTTNPSLILAAAKQP--AHAKLIDVAVAYGKKHGKTTAE-QV 82

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                ++ LV  G ++ K+VPGRVSTEVDARL++DT   + K   ++KLY    +  ER+L
Sbjct: 83   ESAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQATIDKARHIIKLYEQEGVSRERVL 142

Query: 615  FKIPATWQGIEASR-LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A++ L E +GI  +LT ++SF           ++I  FVGR+ DW +  
Sbjct: 143  IKIASTWEGIQAAKELEEKDGIHCNLTLLFSFGQAVACAEAQVTLISPFVGRILDWYKAS 202

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            +G  E  G      DPG   V   YNY  KYG+K+ +M A+ R+  ++ ++ GVDY+   
Sbjct: 203  TG-KEYAGE----TDPGVVSVKSIYNYYKKYGYKTIVMGASFRSTDEIKNLAGVDYLTIS 257

Query: 972  LKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAVELL 1148
             ++L +L  S  P      F R L P +A      K   +  + ++ F       A E L
Sbjct: 258  PQLLDTLMNSTEP------FPRVLDPATAKKEAGDKISYINDEPKFRFDLNEDAMATEKL 311

Query: 1149 TAGMEGYSNQAKRVEELFGK 1208
            + G+  +S     + +L  K
Sbjct: 312  SEGIRKFSADIVTLFDLIEK 331



>gb:BX640441_814097 Bordetella bronchiseptica strain RB50, complete
            genome; segment 5/16.
          Length = 327

 Score =  153 bits (387), Expect = 7e-36
 Identities = 88/262 (33%), Positives = 141/262 (53%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + ++L+A+  ++ +V DT  F+      PT AT + SL+L      +      V TA A 
Sbjct: 8    MPSQLEALRRHTVVVADTGDFEAMRALRPTDATTNPSLILKAVQ-QEAYRPLLVQTARAH 66

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
            Q     E  D        + LV  G  +  +VPGRVSTEVDARL++DT   V +   L+ 
Sbjct: 67   QGASPAEITD--------RLLVAFGRQILDIVPGRVSTEVDARLSFDTRATVERARGLIA 118

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY    +P ER+L KI +TW+GI+A+R+L+AEGI+ +LT ++              +I  
Sbjct: 119  LYQAAGVPRERVLIKIASTWEGIQAARVLQAEGIRCNLTLLFCLPQAAACADAGVQLISP 178

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + ++G   VE A R   DPG   V++ Y Y  ++G ++++M A+ RN   +
Sbjct: 179  FVGRIYDWHKKNAGAEWVEDARRGANDPGVQSVSRIYRYYKRFGIETEIMGASFRNVDQI 238

Query: 936  YSILGVDYIVTPLKILQSLKES 1001
             ++ G D +    ++L  L ++
Sbjct: 239  LALAGCDLLTISPELLTRLSQT 260



>sp|Q7WME6|TAL_BORBR Transaldolase (EC 2.2.1.2).>sp|Q7WAY2|TAL_BORPA
            Transaldolase (EC 2.2.1.2).>gb:BX640426_809482 Bordetella
            parapertussis strain 12822, complete genome; segment
            4/14.
          Length = 320

 Score =  153 bits (387), Expect = 7e-36
 Identities = 88/262 (33%), Positives = 141/262 (53%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + ++L+A+  ++ +V DT  F+      PT AT + SL+L      +      V TA A 
Sbjct: 1    MPSQLEALRRHTVVVADTGDFEAMRALRPTDATTNPSLILKAVQ-QEAYRPLLVQTARAH 59

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
            Q     E  D        + LV  G  +  +VPGRVSTEVDARL++DT   V +   L+ 
Sbjct: 60   QGASPAEITD--------RLLVAFGRQILDIVPGRVSTEVDARLSFDTRATVERARGLIA 111

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY    +P ER+L KI +TW+GI+A+R+L+AEGI+ +LT ++              +I  
Sbjct: 112  LYQAAGVPRERVLIKIASTWEGIQAARVLQAEGIRCNLTLLFCLPQAAACADAGVQLISP 171

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + ++G   VE A R   DPG   V++ Y Y  ++G ++++M A+ RN   +
Sbjct: 172  FVGRIYDWHKKNAGAEWVEDARRGANDPGVQSVSRIYRYYKRFGIETEIMGASFRNVDQI 231

Query: 936  YSILGVDYIVTPLKILQSLKES 1001
             ++ G D +    ++L  L ++
Sbjct: 232  LALAGCDLLTISPELLTRLSQT 253



>sp|Q7VY99|TAL_BORPE Transaldolase (EC 2.2.1.2).>gb:BX640415_805869
            Bordetella pertussis strain Tohama I, complete genome;
            segment 5/12.
          Length = 320

 Score =  153 bits (386), Expect = 1e-35
 Identities = 88/262 (33%), Positives = 141/262 (53%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + ++L+A+  ++ +V DT  F+      PT AT + SL+L      +      V TA A 
Sbjct: 1    MPSQLEALRRHTVVVADTGDFEAMRALRPTDATTNPSLILKAVQ-QEAYRPLLVQTARAH 59

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
            Q     E  D        + LV  G  +  +VPGRVSTEVDARL++DT   V +   L+ 
Sbjct: 60   QGASPAEITD--------RLLVAFGRQILDIVPGRVSTEVDARLSFDTRATVERARGLIA 111

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LY    +P ER+L KI +TW+GI+A+R+L+AEGI+ +LT ++              +I  
Sbjct: 112  LYQAAGVPRERVLIKIASTWEGIQAARVLQAEGIRCNLTLLFCLPQAAACADAGVQLISP 171

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW + ++G   VE A R   DPG   V++ Y Y  ++G ++++M A+ RN   +
Sbjct: 172  FVGRIYDWHKKNAGAEWVEDARRGANDPGVQSVSRIYRYYKRFGIETEIMGASFRNVDQI 231

Query: 936  YSILGVDYIVTPLKILQSLKES 1001
             ++ G D +    ++L  L ++
Sbjct: 232  LALAGCDLLTISPELLTRLAQT 253



>gb:AP008231_581498 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 397

 Score =  152 bits (385), Expect = 1e-35
 Identities = 101/327 (30%), Positives = 164/327 (50%), Gaps = 3/327 (0%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD--QE 401
            L+ +   + +V DT        F P  AT + SL+     +P  +++S +D  L     E
Sbjct: 6    LEQLRGMTVVVADTGGIQSIATFTPRDATTNPSLITAAAQMP--QYQSIIDDTLRQVRTE 63

Query: 402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
                   +A ++   ++  V  G  + ++VPGRVSTEVDARL+YDT   + K   L+ LY
Sbjct: 64   LGAEAPVEAIVAEAIDELFVAFGLRILEIVPGRVSTEVDARLSYDTEATIAKARKLIGLY 123

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                I  +R+L KI +TW+GI A+ +LE EGI  +LT ++ F           ++I  FV
Sbjct: 124  ERAGIRRDRVLIKIASTWEGIRAAEVLEKEGIHCNLTLLFGFHQAVACAEAGVTLISPFV 183

Query: 762  GRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYS 941
            GR+ DW +  SG     GA    EDPG   VT+ YNY  K+G+ +++M A+ RN  ++  
Sbjct: 184  GRILDWYKKESGRDAFPGA----EDPGVQSVTQIYNYYKKFGYATEVMGASFRNISEIIE 239

Query: 942  ILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV-VTWDQYSFAS 1118
            + G D +     +L+ L+++      +   ER+L P  A A +   E++ +  D+++   
Sbjct: 240  LAGCDLLTISPGLLEELRQT------EALLERKLDP--AIAESLELEQIHLDRDRFAELH 291

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 A E L  G+ G+      +E L
Sbjct: 292  QADRMANEKLDEGIRGFCKAIDTLEGL 318



>gb:CR382138_1671590 Debaryomyces hansenii chromosome F of strain
            CBS767 of Debaryomyces hansenii.
          Length = 323

 Score =  152 bits (383), Expect = 2e-35
 Identities = 99/311 (31%), Positives = 164/311 (52%), Gaps = 5/311 (1%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            IV DT  F+   K+ P  AT + SL+L        ++   +D A+   +  G   K+ + 
Sbjct: 15   IVTDTGEFESIAKYTPQDATTNPSLILAASK--KAEYAKLIDIAIDYAQDKGSNPKE-KA 71

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
            S   ++ LV  G ++ K+VPGRVSTEVDARL+++    + K  +++KLY  + I  +R+L
Sbjct: 72   SIALDRLLVEFGKEILKIVPGRVSTEVDARLSFNKDATIKKAIEIIKLYESVGISKDRIL 131

Query: 615  FKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A+R LE++ GI  +LT ++SF           ++I  FVGR+ DW +  
Sbjct: 132  IKIASTWEGIQAARELESKHGIHCNLTLLFSFVQAVACAEAKVTLISPFVGRILDWFKAS 191

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            +G  E +G      DPG   V K +NY  KYG+ + +M A+ RN  ++ ++ G D++   
Sbjct: 192  TG-KEYDGE----TDPGVISVRKIFNYYKKYGYDTIVMGASFRNTGEIKALAGCDFLTIA 246

Query: 972  LKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTW----DQYSFASAMGPAAV 1139
             K+L+ L  S           ++L   SA   N T EE V++     ++ +       A 
Sbjct: 247  PKLLEELYNS------NEDVPKKLDSSSA---NATDEEKVSYIDNEAEFRYLFNEDAMAT 297

Query: 1140 ELLTAGMEGYS 1172
            E L+ G+  ++
Sbjct: 298  EKLSEGIRNFA 308



>gb:AY144981_1583772 Saccharomyces castellii clone Contig1500 TAL1
            gene, complete cds.
          Length = 339

 Score =  152 bits (383), Expect = 2e-35
 Identities = 107/306 (34%), Positives = 158/306 (51%), Gaps = 22/306 (7%)
 Frame = +3

Query: 180  ASAGFSSSLD----TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICS 347
            A+AG S+SLD    TG T           +V DT  F   +K+ P  AT + SL+L    
Sbjct: 12   ANAGGSTSLDLLKKTGTT-----------VVADTGDFATIDKYKPQDATTNPSLILAASK 60

Query: 348  LPDTKFKSAVDTALADQECYGLEDK---DARMSCFFNKALVNVGGDLAKLVPGRVSTEVD 518
              D  + S VD A+A    YG E+    D ++ C  +K LV  G ++ K+VPG+VSTEVD
Sbjct: 61   KED--YSSLVDNAVA----YGKENGETIDEQVECAIDKLLVEFGTEILKIVPGKVSTEVD 114

Query: 519  ARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTF 695
            ARL++D    + K   L+ LY    I  +R+  K+ +TW+GI+A+++LE E GI T+LT 
Sbjct: 115  ARLSFDKDATIKKALQLIHLYEKAGISKDRVYIKVASTWEGIQAAKVLEQEHGITTNLTL 174

Query: 696  VYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSG-DSEVEGALRRGEDPGSALVTKAYNY 872
            ++SF           S+I  FV R+ D+ +  +G D   E      +DPG   V K YNY
Sbjct: 175  LFSFTQAVACAEAGVSLISPFVARITDYYKAQTGKDYSPE------DDPGIHSVKKIYNY 228

Query: 873  IHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSL-------------KESVTPP 1013
              K+G+ + +MAA++R    V  + G+D +    K+L  L             K++    
Sbjct: 229  YKKHGYHTIIMAASLRTTGQVKQLAGIDNLTLSPKVLDELVASTDEVPKLLDPKKAAKQG 288

Query: 1014 DEKYSF 1031
            DEK SF
Sbjct: 289  DEKISF 294



>gb:BC061957_2553337 Danio rerio transaldolase 1, mRNA (cDNA clone
            MGC:66054 IMAGE:6795131), complete cds.
          Length = 337

 Score =  150 bits (380), Expect = 5e-35
 Identities = 101/331 (30%), Positives = 172/331 (51%), Gaps = 3/331 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + L+ +  ++ +V DT  F+  E++ P  AT + SL+L    +P   ++  VD A+  
Sbjct: 11   MESALEQIKKFTVVVADTGDFNAIEEYKPQDATTNPSLILAAAKMP--AYQPLVDQAIKY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                G   +D +++   +K  VN G ++ K VPGRVSTEVDARL++D   +V +   L+ 
Sbjct: 69   GTANG-GTEDEQVTNAMDKLFVNFGLEILKKVPGRVSTEVDARLSFDKDAMVSRARRLIS 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASR-LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  ER+L K+ +TW+GI+A R L E  GI  ++T ++SF           ++I 
Sbjct: 128  LYEDAGISKERILIKLSSTWEGIQAGRELEEIHGIHCNMTLLFSFAQAVACAEARVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW + ++     E      EDPG   VTK YNY  K+ +++ +M A+ RN  +
Sbjct: 188  PFVGRILDWYKENTERKTYE----PHEDPGVLSVTKIYNYYKKFDYRTVVMGASFRNIGE 243

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
            V ++ G D +     +L+ L +      +  +    L+PQ+A      + ++   D+ SF
Sbjct: 244  VKALAGCDLLTISPALLEELSQ------DHSAITCTLTPQTARECVLERLQL---DEKSF 294

Query: 1113 ASAMGP--AAVELLTAGMEGYSNQAKRVEEL 1199
                     AVE L+ G+  ++  A ++E +
Sbjct: 295  RWLHNEDRMAVEKLSDGIRKFAADAVKLETM 325



>gb:AY144980_1583771 Saccharomyces castellii clone Contig2026 TAL1
            gene, complete cds.
          Length = 335

 Score =  150 bits (380), Expect = 5e-35
 Identities = 87/250 (34%), Positives = 139/250 (55%), Gaps = 1/250 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F    KF P  +T + SL+L     P   +   +D A++  +  G +  D ++
Sbjct: 26   VVADTGDFASIAKFTPQDSTTNPSLILAAAKQP--AYAKLIDVAVSYGKKNG-KTTDEKV 82

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                ++ LV  G ++ K+VPGRVSTEVDARL++D    + K  +++KLY  + I  ER+L
Sbjct: 83   ELAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDKEATIAKALEIIKLYEDLGISRERVL 142

Query: 615  FKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A+R LE++  I  +LT ++SF           ++I  FVGR+ DW +  
Sbjct: 143  IKIASTWEGIQAARELESKHKIHCNLTLLFSFSQAVACAEAKVTLISPFVGRIMDWYKAK 202

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            +G++          DPG   V K YNY  K+G+K+ +M A+ RN  ++ ++ GVDY+   
Sbjct: 203  TGET-----YNGRNDPGVLSVHKIYNYYKKHGYKTIVMGASFRNVDEIKNLAGVDYLTIS 257

Query: 972  LKILQSLKES 1001
              +L  L  S
Sbjct: 258  PNLLDELLNS 267



>gb:BC068191_2554997 Danio rerio transaldolase 1, mRNA (cDNA clone
            MGC:76974 IMAGE:6525548), complete cds.
          Length = 337

 Score =  149 bits (377), Expect = 1e-34
 Identities = 98/329 (29%), Positives = 171/329 (51%), Gaps = 1/329 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + L+ +  ++ +V DT  F+  E++ P  AT + SL+L    +P   ++  VD A+  
Sbjct: 11   MESALEQIKKFTVVVADTGDFNAIEEYKPQDATTNPSLILAAAKMP--AYQPLVDQAIKY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                G   +D +++   +K  VN G ++ K VPGRVSTEVDARL++D   +V +   L+ 
Sbjct: 69   GTANG-GTEDEQVTNAMDKLFVNFGLEILKKVPGRVSTEVDARLSFDKDAMVSRARRLIS 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASR-LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  ER+L K+ +TW+GI+A R L E  GI  ++T ++SF           ++I 
Sbjct: 128  LYEDAGISKERILIKLSSTWEGIQAGRELEEIHGIHCNMTLLFSFAQAVACAEARVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW + ++     E      EDPG   VTK YNY  K+ +++ +M A+ RN  +
Sbjct: 188  PFVGRILDWYKENTERKTYE----PHEDPGVLSVTKIYNYYKKFDYRTVVMGASFRNIGE 243

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
            V ++ G D +     +L+ L +      +  +    L+PQ+A      + + +   ++ +
Sbjct: 244  VKALAGCDLLTISPALLEELSQ------DHSAITCTLTPQTARECVLERLQ-LDEKRFRW 296

Query: 1113 ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                   AVE L+ G+  ++  A ++E +
Sbjct: 297  LHNEDRMAVEKLSDGIRKFAADAVKLETM 325



>sp|Q93092|TAL1_MOUSE Transaldolase (EC 2.2.1.2).>gb:BC004754_2089763
            Mus musculus transaldolase 1, mRNA (cDNA clone MGC:7954
            IMAGE:3584511), complete cds.>gb:U67611_2140229 Mouse
            transaldolase gene mRNA, complete cds.
          Length = 337

 Score =  149 bits (377), Expect = 1e-34
 Identities = 97/332 (29%), Positives = 176/332 (53%), Gaps = 4/332 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + LD +  ++ +V DT  F+  +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 11   MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +  G   ++ ++    +K  V  G ++ K +PGRVSTEVDARL++D   +V +   L++
Sbjct: 69   GKKLG-GPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIE 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    +  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 128  LYKEAGVGKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW   H  +++ + +    EDPG   VTK YNY  K+G+K+ +M A+ RN  +
Sbjct: 188  PFVGRILDW---HVANTD-KKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGE 243

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQ-SAAAYNFTKEEVVTWDQYS 1109
            + ++ G D++    K+L  L +             +L+P  S  A   +  E +  D+ +
Sbjct: 244  IKALAGCDFLTISPKLLGELLKD----------NSKLAPALSVKAAQTSDSEKIHLDEKA 293

Query: 1110 F--ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            F         AVE L+ G+  ++  A ++E +
Sbjct: 294  FRWLHNEDQMAVEKLSDGIRKFAADAIKLERM 325



>gb:BC018847_1976646 Homo sapiens transaldolase 1, mRNA (cDNA clone
            IMAGE:3140635), partial cds.
          Length = 336

 Score =  149 bits (376), Expect = 1e-34
 Identities = 100/332 (30%), Positives = 170/332 (51%), Gaps = 4/332 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + LD +  ++ +V DT  F   +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 10   MESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 67

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                G   +D ++    +K  V  G ++ K +PGRVSTEVDARL++D   +V +   L++
Sbjct: 68   GRKLGGSQED-QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIE 126

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 127  LYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 186

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW   ++     E      EDPG   VTK YNY  K+ +K+ +M A+ RN  +
Sbjct: 187  PFVGRILDWHVANTDKKSYEPL----EDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGE 242

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSP-QSAAAYNFTKEEVVTWDQYS 1109
            + ++ G D++    K+L  L +             +L P  SA A   +  E +  D+ S
Sbjct: 243  IKALAGCDFLTISPKLLGELLQD----------NAKLVPVLSAKAAQASDLEKIHLDEKS 292

Query: 1110 F--ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            F         AVE L+ G+  ++  A ++E +
Sbjct: 293  FRWLHNEDQMAVEKLSDGIRKFAADAVKLERM 324



>pir|S39870|S39870 transaldolase (EC 2.2.1.2) - yeast (Kluyveromyces
            marxianus var. lactis)>gb:CR382121_1654376 Kluyveromyces
            lactis strain NRRL Y-1140 chromosome A of strain NRRL
            Y-1140 of Kluyveromyces lactis.>gb:KLTRANAL_1683680
            Kluyveromyces lactis for gene encoding transaldolase.
          Length = 334

 Score =  149 bits (376), Expect = 1e-34
 Identities = 98/308 (31%), Positives = 158/308 (51%), Gaps = 2/308 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F+   KF P  AT + SL+L         +   +D+A+   +  G ++ D ++
Sbjct: 25   VVADTGDFESIAKFTPQDATTNPSLILAAAK--QQAYAKLIDSAVQYGKKQG-QNIDEQV 81

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                +K LV  G  + K+VPGRVSTEVDARL++D    V K  +++KLY    I  +R+L
Sbjct: 82   EIAVDKLLVEFGTAILKVVPGRVSTEVDARLSFDKDATVKKALEIIKLYEAEGISKDRVL 141

Query: 615  FKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A++ LE E  I  +LT ++SF           ++I  FVGR+ DW +  
Sbjct: 142  IKIASTWEGIQAAQELEKEHDIHVNLTLLFSFAQAVAAAEANVTLISPFVGRILDWYKAS 201

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            +G++          DPG   V   YNY  K+G+ + +M A+ RN  ++ ++ GVD++   
Sbjct: 202  TGETYTAET-----DPGVISVKSIYNYYKKHGYNTIVMGASFRNVGEIKALAGVDFLTIS 256

Query: 972  LKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAVELL 1148
             K+L  L  S  P        + L P+SA A    +   +  + ++ F       A E L
Sbjct: 257  PKLLDELLSSDEP------VAKILDPESAKAEGSERVSFINDEPKFRFELNEDAMATEKL 310

Query: 1149 TAGMEGYS 1172
            + G+  +S
Sbjct: 311  SEGIRKFS 318



>sp|P34214|TAL1_KLULA Transaldolase (EC 2.2.1.2).
          Length = 333

 Score =  149 bits (376), Expect = 1e-34
 Identities = 98/308 (31%), Positives = 158/308 (51%), Gaps = 2/308 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F+   KF P  AT + SL+L         +   +D+A+   +  G ++ D ++
Sbjct: 24   VVADTGDFESIAKFTPQDATTNPSLILAAAK--QQAYAKLIDSAVQYGKKQG-QNIDEQV 80

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                +K LV  G  + K+VPGRVSTEVDARL++D    V K  +++KLY    I  +R+L
Sbjct: 81   EIAVDKLLVEFGTAILKVVPGRVSTEVDARLSFDKDATVKKALEIIKLYEAEGISKDRVL 140

Query: 615  FKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A++ LE E  I  +LT ++SF           ++I  FVGR+ DW +  
Sbjct: 141  IKIASTWEGIQAAQELEKEHDIHVNLTLLFSFAQAVAAAEANVTLISPFVGRILDWYKAS 200

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            +G++          DPG   V   YNY  K+G+ + +M A+ RN  ++ ++ GVD++   
Sbjct: 201  TGETYTAET-----DPGVISVKSIYNYYKKHGYNTIVMGASFRNVGEIKALAGVDFLTIS 255

Query: 972  LKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAVELL 1148
             K+L  L  S  P        + L P+SA A    +   +  + ++ F       A E L
Sbjct: 256  PKLLDELLSSDEP------VAKILDPESAKAEGSERVSFINDEPKFRFELNEDAMATEKL 309

Query: 1149 TAGMEGYS 1172
            + G+  +S
Sbjct: 310  SEGIRKFS 317



>sp|P37837|TAL1_HUMAN Transaldolase (EC 2.2.1.2).>gb:AF058913_1879715
            Homo sapiens transaldolase (TALDO1) gene, complete
            cds.>gb:BC010103_1972488 Homo sapiens transaldolase 1,
            mRNA (cDNA clone MGC:19718 IMAGE:3536661), complete
            cds.>gb:HSTALDR3_2020634 Homo sapiens
            transaldolase-related protein gene, exons 3-8 and
            complete cds.>gb:HUMTRNSAL_2037889 Homo sapiens
            transaldolase mRNA, complete cds.
          Length = 337

 Score =  149 bits (376), Expect = 1e-34
 Identities = 100/332 (30%), Positives = 170/332 (51%), Gaps = 4/332 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + LD +  ++ +V DT  F   +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 11   MESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                G   +D ++    +K  V  G ++ K +PGRVSTEVDARL++D   +V +   L++
Sbjct: 69   GRKLGGSQED-QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIE 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 128  LYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW   ++     E      EDPG   VTK YNY  K+ +K+ +M A+ RN  +
Sbjct: 188  PFVGRILDWHVANTDKKSYEPL----EDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGE 243

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSP-QSAAAYNFTKEEVVTWDQYS 1109
            + ++ G D++    K+L  L +             +L P  SA A   +  E +  D+ S
Sbjct: 244  IKALAGCDFLTISPKLLGELLQD----------NAKLVPVLSAKAAQASDLEKIHLDEKS 293

Query: 1110 F--ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            F         AVE L+ G+  ++  A ++E +
Sbjct: 294  FRWLHNEDQMAVEKLSDGIRKFAADAVKLERM 325



>gb:BC059126_2103645 Rattus norvegicus transaldolase 1, mRNA (cDNA
            clone MGC:72759 IMAGE:6889440), complete cds.
          Length = 337

 Score =  149 bits (375), Expect = 2e-34
 Identities = 99/333 (29%), Positives = 179/333 (53%), Gaps = 5/333 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + LD +  ++ +V DT  F+  +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 11   MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +  G   ++ ++    +K  V  G ++ K +PGRVSTEVDARL++D   +V +   +++
Sbjct: 69   GKKLG-GPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRIIE 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 128  LYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW   H  +++ + +    EDPG   VTK YNY  K+G+K+ +M A+ RN  +
Sbjct: 188  PFVGRILDW---HVANTD-KKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGE 243

Query: 933  VYSILGVDYIVTPLKIL-QSLKESVTPPDEKYSFERRLSPQ-SAAAYNFTKEEVVTWDQY 1106
            + ++ G D++    K+L + LK+S            +L+P  S  A   +  E +  D+ 
Sbjct: 244  IKALAGCDFLTISPKLLGELLKDS-----------SKLAPTLSVKAAQTSDLEKIHLDEK 292

Query: 1107 SF--ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            +F         AVE L+ G+  ++  A ++E +
Sbjct: 293  AFRWLHNEDQMAVEKLSDGIRKFAADAIKLERM 325



>sp|Q8VI73|TAL1_CRIGR Transaldolase (EC 2.2.1.2).>gb:AF128242_2055603
            Cricetulus griseus transaldolase mRNA, complete cds.
          Length = 337

 Score =  148 bits (373), Expect = 3e-34
 Identities = 85/265 (32%), Positives = 150/265 (56%), Gaps = 1/265 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + LD +  ++ +V DT  F+  +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 11   MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +  G   ++ ++    +K  V  G ++ K +PGRVSTEVDARL++D   +V +   L++
Sbjct: 69   GKKLG-GPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARAKRLIE 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 128  LYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW   H  +++ + +    EDPG   VTK YNY  K+G+K+ +M A+ RN  +
Sbjct: 188  PFVGRILDW---HVANTD-KKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGE 243

Query: 933  VYSILGVDYIVTPLKILQSLKESVT 1007
            + ++ G D++    K+L  L +  T
Sbjct: 244  IKALAGCDFLTISPKLLGELLKDNT 268



>sp|Q9S0X4|TAL_METAM Transaldolase (EC 2.2.1.2).>gb:AB026428_4375
            Methylomonas aminofaciens ribulose monophosphate pathway
            genes (rmpD, rmpA, IS10-R rmpI, rmpB), complete cds.
          Length = 316

 Score =  147 bits (372), Expect = 4e-34
 Identities = 97/324 (29%), Positives = 162/324 (50%), Gaps = 2/324 (0%)
 Frame = +3

Query: 231  DAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYG 410
            D +  ++ IV DT   +  +   P  AT + SLLL   +LP  ++   +D A+A  +   
Sbjct: 6    DQLKEFTTIVADTGDVEAIKSVKPYDATTNPSLLLKASTLP--QYAPLIDEAIAYAKSQS 63

Query: 411  LEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGI 590
              DK  ++    +K  V +G ++ K +PG++STEVDARL++DT  +V K   L+KLY   
Sbjct: 64   -GDKAQQIEDAADKLAVLIGQEILKHIPGKISTEVDARLSFDTDAMVQKGRKLIKLYADA 122

Query: 591  EIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRL 770
             I  +R+L K+ +TW+GI+A  +LE EGI  +LT ++SF            +I  FVGR+
Sbjct: 123  GISKDRVLIKLASTWEGIKAGEILEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGRI 182

Query: 771  RDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILG 950
             DW +  +G++          DPG   V K Y Y  ++G+K+ +M A+ RN  ++ ++ G
Sbjct: 183  LDWYKAKTGENYTSET-----DPGVLSVRKIYAYYKEHGYKTVVMGASFRNTGEITALAG 237

Query: 951  VDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEE--VVTWDQYSFASAM 1124
             D +     +L           E+    RR  P+       TK+   ++T  ++ F    
Sbjct: 238  CDRLTVSPNLL-----------ERAEGYRRYLPRVLVDNGATKQRPALLTEKEFRFDQNE 286

Query: 1125 GPAAVELLTAGMEGYSNQAKRVEE 1196
               A E L  G+ G+     ++E+
Sbjct: 287  DAMATEKLAEGIRGFVVDQNKLEK 310



>sp|P78258|TALA_ECOLI Transaldolase A (EC 2.2.1.2).>pir|F91044|F91044
            transaldolase A [imported] - Escherichia coli (strain
            O157:H7, substrain RIMD 0509952)>pir|A85889|A85889
            transaldolase A [imported] - Escherichia coli (strain
            O157:H7, substrain EDL933)>pir|G65021|G65021
            transaldolase (EC 2.2.1.2) b2464 - Escherichia coli
            (strain K-12)>gb:AE005174_67572 Escherichia coli O157:H7
            EDL933, complete genome.>gb:D13159_119914 Escherichia
            coli talA gene for transaldolase, complete
            cds.>gb:D90875_123776 E.coli genomic DNA, Kohara clone
            #422(55.5-55.8 min.).>gb:U00096_201503 Escherichia coli
            K-12 MG1655 complete genome.>gb:AE016764_326983
            Escherichia coli CFT073 section 10 of 18 of the complete
            genome.>gb:BA000007_661338 Escherichia coli O157:H7 DNA,
            complete genome.>gb:AE014075_957567 Escherichia coli
            CFT073 complete genome.
          Length = 316

 Score =  147 bits (372), Expect = 4e-34
 Identities = 97/327 (29%), Positives = 168/327 (51%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            ELD +  ++ +V D+   +    + P  AT + SLLL    L  ++++  +D A+A  + 
Sbjct: 3    ELDGIKQFTTVVADSGDIESIRHYHPQDATTNPSLLLKAAGL--SQYEHLIDDAIAWGKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             G + ++ ++    +K  VN G ++ K+VPGRVSTEVDARL++D    + K   L+ LY 
Sbjct: 61   NG-KTQEQQVVAACDKLAVNFGAEILKIVPGRVSTEVDARLSFDKEKSIEKARHLVDLYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
               +   R+L K+ +TW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  QQGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFAQARACAEAGVFLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  AR       VE      EDPG   V   Y+Y  ++ +++ +M A+ R  + + 
Sbjct: 180  RIYDWYQARKPMDPYVVE------EDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ L+E V+P        R+L P S     F +   ++  ++ +  
Sbjct: 234  ALTGCDRLTIAPNLLKELQEKVSP------VVRKLIPPS---QTFPRPAPMSEAEFRWEH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AVE L+ G+  ++   +++E+L
Sbjct: 285  NQDAMAVEKLSEGIRLFAVDQRKLEDL 311



>sp|O42700|TAL1_SCHPO Transaldolase (EC 2.2.1.2).>pir|T40834|T40834
            transaldolase - fission yeast (Schizosaccharomyces
            pombe)>gb:SPCC1020_1720757 S.pombe chromosome III cosmid
            c1020.
          Length = 322

 Score =  147 bits (371), Expect = 5e-34
 Identities = 95/311 (30%), Positives = 163/311 (52%), Gaps = 2/311 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F+   K+ P  AT + SL+L     P  ++ + VD A+   +  G    ++++
Sbjct: 14   VVSDTGDFESIAKYKPQDATTNPSLILAASKKP--QYAALVDAAVDYAKAKG-GSINSQI 70

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
               F++ L+  G  +  +VPGRVSTEVDAR ++DT   + K   L+KLY    I  ER+L
Sbjct: 71   EIAFDRLLIEFGTKILAIVPGRVSTEVDARYSFDTQTTIEKARHLIKLYEAEGIGRERVL 130

Query: 615  FKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR-NH 791
             KI +T++GI+A++ LE EGI  +LT ++SF           ++I  FVGR+ D+ +  +
Sbjct: 131  IKIASTYEGIQAAKQLEEEGIHCNLTLLFSFVQAVACAEANVTLISPFVGRILDFYKAKN 190

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            + D   +      EDPG   V+  +NY  K+G+K+ +M A+ RN  ++  + GVD++   
Sbjct: 191  NRDYTAQ------EDPGVVSVSNIFNYYKKFGYKTIVMGASFRNVGEIKELAGVDFLTIS 244

Query: 972  LKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-QYSFASAMGPAAVELL 1148
              +L+ L  S        +  ++L    A++ N  K   +T + ++ F       AV  L
Sbjct: 245  PALLEQLNNSTD------AVPKKLDASKASSLNLEKVSYLTDEPKFRFDFNNDEMAVVKL 298

Query: 1149 TAGMEGYSNQA 1181
            + G+  ++  A
Sbjct: 299  STGIAAFAKDA 309



>gb:AY145032_1583823 Saccharomyces kluyveri clone Contig2283 TAL1
            gene, complete cds.
          Length = 334

 Score =  146 bits (369), Expect = 9e-34
 Identities = 105/322 (32%), Positives = 160/322 (49%), Gaps = 4/322 (1%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYG--LEDKDA 428
            +V DT  F+   K+ P  AT + SL+L      +  +   +DTA+   +  G  LEDK  
Sbjct: 25   VVSDTGDFESIAKYTPQDATTNPSLILAAAKKEN--YAKLIDTAVEYGKKQGKTLEDK-- 80

Query: 429  RMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPER 608
             +    +  LV  G  +  +VPGRVSTEVDARL++D    V K   ++KLY    I  ER
Sbjct: 81   -VDQAVDMLLVEFGKAILNIVPGRVSTEVDARLSFDKDATVAKALHIIKLYEDAGISRER 139

Query: 609  LLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR 785
            +L KI +TW+GI+A++ LE + GI  +LT ++SF           ++I  FVGR+ DW +
Sbjct: 140  VLIKIASTWEGIQAAKELEEKHGIHVNLTLLFSFSQAVAAAEAKVTLISPFVGRILDWYK 199

Query: 786  NHSG-DSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYI 962
              +G D   E       DPG   V K +NY  KYG+ + +M A+ RN  ++ ++ GVD++
Sbjct: 200  ASTGKDYTAE------TDPGVKSVRKIFNYYKKYGYDTIVMGASFRNVGEIKALAGVDFL 253

Query: 963  VTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGPAAVE 1142
                 +L  L  S  P  +    E   S +  A  +F  +E     ++ F       A E
Sbjct: 254  TISPGLLDELMSSEDPVPQVLDAEAAKS-EDLAKVSFISDEA----KFRFELNEDAMATE 308

Query: 1143 LLTAGMEGYSNQAKRVEELFGK 1208
             L+ G+  +S     + EL  K
Sbjct: 309  KLSEGIRKFSADIVTLFELIEK 330



>gb:BC009680_1972171 Homo sapiens transaldolase 1, mRNA (cDNA clone
           MGC:8922 IMAGE:3898596), complete cds.
          Length = 318

 Score =  146 bits (368), Expect = 1e-33
 Identities = 84/260 (32%), Positives = 142/260 (54%), Gaps = 1/260 (0%)
 Frame = +3

Query: 216 LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
           + + LD +  ++ +V DT  F   +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 11  MESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 68

Query: 396 QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
               G   +D ++    +K  V  G ++ K +PGRVSTEVDARL++D   +V +   L++
Sbjct: 69  GRKLGGSQED-QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIE 127

Query: 576 LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
           LY    I  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 128 LYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 187

Query: 753 IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
            FVGR+ DW   ++     E      EDPG   VTK YNY  K+ +K+ +M A+ RN  +
Sbjct: 188 PFVGRILDWHVANTDKKSYEPL----EDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGE 243

Query: 933 VYSILGVDYIVTPLKILQSL 992
           + ++ G D++    K+L  L
Sbjct: 244 IKALAGCDFLTISPKLLGEL 263



>gb:CR380948_1649332 Candida glabrata strain CBS138 chromosome B
            complete sequence.
          Length = 334

 Score =  145 bits (367), Expect = 2e-33
 Identities = 87/254 (34%), Positives = 139/254 (54%), Gaps = 2/254 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F+   KF P  +T + SL+L     P   +   +D A+   + +G +  + + 
Sbjct: 25   VVADTGDFESIAKFQPQDSTTNPSLILAAAKQP--AYAKLIDVAVEYGKKHG-KTVEEQT 81

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                ++ LV  G ++ K+VPGRVSTEVDARL++D    + K   ++KLY    I   R+L
Sbjct: 82   EAAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDKEATIAKALQIIKLYEEQGISKSRVL 141

Query: 615  FKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A+R LE++ GI  +LT +++F           ++I  FVGR+ D+ +  
Sbjct: 142  IKIASTWEGIQAARELESKHGIHCNLTLLFNFAQAVACAEANITLISPFVGRIMDYYKAK 201

Query: 792  SGDSEVEGALRRGE-DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVT 968
            +G++        GE DPG   V   YNY  KYG+K+ +M A+ RN  ++ ++ GVDY+  
Sbjct: 202  TGETYT------GETDPGVKSVRAIYNYYKKYGYKTIVMGASFRNIDEIKALAGVDYLTI 255

Query: 969  PLKILQSLKESVTP 1010
               +L  L  S  P
Sbjct: 256  SPNLLDQLLNSNDP 269



>sp|P72797|TAL_SYNY3 Transaldolase (EC 2.2.1.2).>pir|S74660|S74660
            transaldolase (EC 2.2.1.2) talB - Synechocystis sp.
            (strain PCC 6803)>gb:SYCTAL_195519 Synechocystis sp. PCC
            6803 transaldolase (tal) gene, complete
            cds.>gb:BA000022_687591 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 391

 Score =  145 bits (366), Expect = 2e-33
 Identities = 95/328 (28%), Positives = 162/328 (49%), Gaps = 4/328 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY 407
            L+ +  ++ +V DT      E F P  +T + SL+     +P  +++  VD+ L   +  
Sbjct: 6    LEQLRQFTVVVADTGDIQAIETFTPRDSTTNPSLITAAAQMP--QYQEIVDSTLLKAKDE 63

Query: 408  GLEDKDAR--MSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
              E+   +  +   F++  V  G  + +++PGRVSTEVDARL+YDT   + K   L+  Y
Sbjct: 64   AGENASIKDIVRLAFDRLAVAFGLKILQIIPGRVSTEVDARLSYDTEATIAKARYLIGEY 123

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFV 761
                I  +R+L KI +TW+GI+A+ +LE EGI  +LT ++             ++I  FV
Sbjct: 124  AKAGIDKKRILIKIASTWEGIKAAEVLEQEGIHCNLTLLFGLHQAIACAEAKVTLISPFV 183

Query: 762  GRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYS 941
            GR+ DW +  +G           EDPG   VT  YNY  ++G+K+++M A+ RN  ++  
Sbjct: 184  GRILDWYKKSTGKE-----YDSHEDPGVQSVTTIYNYYKRFGYKTEVMGASFRNIGEIIE 238

Query: 942  ILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF--A 1115
            + G D +    ++L  L+ +      +    R+L P +         E +  D+ +F   
Sbjct: 239  LAGCDLLTISPQLLDQLRNT------EGDLPRKLDPATVP----QDIEKIVMDKATFDKM 288

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
             A  P A E L  G+ G++   + +E L
Sbjct: 289  HAEDPMASEKLAEGIAGFTKALEVLEHL 316



>sp|Q8Z4T0|TALA_SALTI Transaldolase A (EC 2.2.1.2).>pir|AE0815|AE0815
            transaldolase (EC 2.2.1.2) - Salmonella enterica subsp.
            enterica serovar Typhi (strain CT18)>gb:AL627274_542837
            Salmonella enterica serovar Typhi (Salmonella typhi)
            strain CT18, complete chromosome; segment 10/20.
          Length = 316

 Score =  145 bits (366), Expect = 2e-33
 Identities = 96/327 (29%), Positives = 166/327 (50%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +LD +  ++ +V D+   +    + P  AT + SLLL    L   ++   ++ A+A  + 
Sbjct: 3    QLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLE--QYGHLIEDAIAWGKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
            +G   ++ +++   +K  VN G ++ K +PGRVSTEVDARL++D    + K   L+ LY 
Sbjct: 61   HG-GTQEQQVAAASDKLAVNFGAEILKSIPGRVSTEVDARLSFDKEKSIEKARHLVDLYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              ++   R+L K+ ATW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  QQDVDKSRILIKLAATWEGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVYLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  AR+      VE      EDPG   V   Y+Y  ++ +++ +M A+ R  + + 
Sbjct: 180  RIYDWYQARSPLEPYVVE------EDPGVKSVRNIYDYFKQHRYETIVMGASFRRTEQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ LKE   P        R+L P S     F +   +T  ++ +  
Sbjct: 234  ALTGCDRLTISPNLLKELKEKEEP------VIRKLVPSSQM---FHRPTPMTEAEFRWEH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AVE L+ G+  ++   +++E+L
Sbjct: 285  NQDAMAVEKLSEGIRLFAVDQRKLEDL 311



>gb:AE016986_372273 Shigella flexneri 2a str. 2457T section 9 of 16 of
            the complete genome.>gb:AE014073_997023 Shigella flexneri
            2a str. 2457T complete genome.
          Length = 316

 Score =  145 bits (365), Expect = 3e-33
 Identities = 96/327 (29%), Positives = 167/327 (51%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            ELD +  ++ +V D+   +    + P  AT + SLLL    L  ++++  +D A+A  + 
Sbjct: 3    ELDGIKQFTTVVADSCDIESIRHYHPQDATTNPSLLLKAAGL--SQYEHLIDDAIAWGKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             G + ++ ++    +K  VN G ++ K+VPG VSTEVDARL++D    + K   L+ LY 
Sbjct: 61   NG-KTQEQQVVAACDKLAVNFGAEILKIVPGCVSTEVDARLSFDKEKSIEKARHLVDLYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
               +   R+L K+ +TW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  QQGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFTQARACAEAGVFLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  AR       VE      EDPG   V   Y+Y  ++ +++ +M A+ R  + + 
Sbjct: 180  RIYDWYQARKPMDPYVVE------EDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ L+E V+P        R+L P S     F +   ++  ++ +  
Sbjct: 234  ALTGCDRLTIAPNLLKELQEKVSP------VVRKLIPPS---QTFPRPAPMSEAEFRWEH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AVE L+ G+  ++   +++E+L
Sbjct: 285  NQDAMAVEKLSEGIRLFAVDQRKLEDL 311



>sp|Q83QM8|TALA_SHIFL Transaldolase A (EC 2.2.1.2).>gb:AE005674_72088
            Shigella flexneri 2a str. 301, complete genome.
          Length = 316

 Score =  145 bits (365), Expect = 3e-33
 Identities = 96/327 (29%), Positives = 167/327 (51%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            ELD +  ++ +V D+   +    + P  AT + SLLL    L  ++++  +D A+A  + 
Sbjct: 3    ELDGIKQFTTVVADSCDIESIRHYHPQDATANPSLLLKAAGL--SQYEHLIDDAIAWGKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             G + ++ ++    +K  VN G ++ K+VPG VSTEVDARL++D    + K   L+ LY 
Sbjct: 61   NG-KTQEQQVVAACDKLAVNFGAEILKIVPGCVSTEVDARLSFDKEKSIEKARHLVDLYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
               +   R+L K+ +TW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  QQGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFTQARACAEAGVFLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  AR       VE      EDPG   V   Y+Y  ++ +++ +M A+ R  + + 
Sbjct: 180  RIYDWYQARKPMDPYVVE------EDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ L+E V+P        R+L P S     F +   ++  ++ +  
Sbjct: 234  ALTGCDRLTIAPNLLKELQEKVSP------VVRKLIPPS---QTFPRPAPMSEAEFRWEH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AVE L+ G+  ++   +++E+L
Sbjct: 285  NQDAMAVEKLSEGIRLFAVDQRKLEDL 311



>sp|Q9EQS0|TAL1_RAT Transaldolase (EC 2.2.1.2).>gb:AF069306_2053259
            Rattus norvegicus transaldolase mRNA, complete cds.
          Length = 337

 Score =  145 bits (365), Expect = 3e-33
 Identities = 98/333 (29%), Positives = 178/333 (53%), Gaps = 5/333 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + LD +  ++ +V DT  F+  +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 11   MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
             +  G   ++ ++    +K  V  G ++ K + GRVSTEVDARL++D   +V +   +++
Sbjct: 69   GKKLG-GPQEEQIKNAIDKLFVLFGAEILKKILGRVSTEVDARLSFDKDAMVARARRIIE 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 128  LYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW   H  +++ + +    EDPG   VTK YNY  K+G+K+ +M A+ RN  +
Sbjct: 188  PFVGRILDW---HVANTD-KKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGE 243

Query: 933  VYSILGVDYIVTPLKIL-QSLKESVTPPDEKYSFERRLSPQ-SAAAYNFTKEEVVTWDQY 1106
            + ++ G D++    K+L + LK+S            +L+P  S  A   +  E +  D+ 
Sbjct: 244  IKALAGCDFLTISPKLLGELLKDS-----------SKLAPTLSVKAAQTSDLEKIHLDEK 292

Query: 1107 SF--ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            +F         AVE L+ G+  ++  A ++E +
Sbjct: 293  AFRWLHNEDQMAVEKLSDGIRKFAADAIKLERM 325



>gb:AE017351_1759582 Cryptococcus neoformans var. neoformans JEC21
            chromosome 11, complete sequence.
          Length = 323

 Score =  144 bits (364), Expect = 3e-33
 Identities = 92/329 (27%), Positives = 163/329 (49%), Gaps = 1/329 (0%)
 Frame = +3

Query: 216  LTTELDAV-TNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALA 392
            + T L+A+  + + +V DT  F   ++F P  AT + SL+L    +P   +   ++ A+ 
Sbjct: 1    MPTSLEALKASGTTVVADTGDFSSIDEFKPQDATTNPSLILAAVKMP--AYAKLLEPAIK 58

Query: 393  DQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLL 572
              +  G  D + +     ++ LV  G ++ K++PGRVSTEVDA+ ++DT   + K H ++
Sbjct: 59   YAKSKG-GDIEVQSENAMDRLLVEFGTEILKIIPGRVSTEVDAKFSFDTQATINKAHQII 117

Query: 573  KLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
             LY    I   R+L KI +T++GI A++ LE+EGI  +LT ++ F           ++I 
Sbjct: 118  ALYKEQGIDKNRVLIKIASTYEGILAAKQLESEGIHCNLTLLFGFGQAVACAEAGVTLIS 177

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
             FVGR+ DW +  + D+          DPG   V K YNY  ++G+K+ +M A+ RN  +
Sbjct: 178  PFVGRILDWYKKANPDTTYTAE----TDPGVQSVQKIYNYYKQHGYKTIVMGASFRNTGE 233

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
            + ++ G D++    K+L  L +S     +K        P    +Y    E    W  +  
Sbjct: 234  IAALAGCDFLTISPKLLDELNKSQDDLPKKLDASSTGEPIPKTSY-LDDEAKFRWALFED 292

Query: 1113 ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
              A      + L  G+ G++     ++++
Sbjct: 293  VMAF-----DKLHEGIRGFAKDGASLKQM 316



>gb:AE016835_344571 Salmonella enterica subsp. enterica serovar Typhi
            Ty2, section 2 of 16 of the complete
            genome.>gb:AE014613_981903 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, complete genome.
          Length = 316

 Score =  144 bits (362), Expect = 6e-33
 Identities = 95/327 (29%), Positives = 165/327 (50%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +LD +  ++ +V D+   +    + P  AT + SLLL    L   ++   ++ A+A  + 
Sbjct: 3    QLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLE--QYGHLIEDAIAWGKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
            +G   ++ +++   +K  VN G ++ K +PGRVSTEVD RL++D    + K   L+ LY 
Sbjct: 61   HG-GTQEQQVAAASDKLAVNFGAEILKSIPGRVSTEVDVRLSFDKEKSIEKARHLVDLYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              ++   R+L K+ ATW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  QQDVDKSRILIKLAATWEGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVYLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  AR+      VE      EDPG   V   Y+Y  ++ +++ +M A+ R  + + 
Sbjct: 180  RIYDWYQARSPLEPYVVE------EDPGVKSVRNIYDYFKQHRYETIVMGASFRRTEQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ LKE   P        R+L P S     F +   +T  ++ +  
Sbjct: 234  ALTGCDRLTISPNLLKELKEKEEP------VIRKLVPSSQM---FHRPTPMTEAEFRWEH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AVE L+ G+  ++   +++E+L
Sbjct: 285  NQDAMAVEKLSEGIRLFAVDQRKLEDL 311



>gb:AC006729_1203886 Caenorhabditis elegans cosmid Y24D9A, complete
            sequence.
          Length = 319

 Score =  143 bits (361), Expect = 8e-33
 Identities = 95/328 (28%), Positives = 174/328 (53%), Gaps = 4/328 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY 407
            L+ +   S +V DT  F+  ++F PT AT + SL+L    +   ++ + +D ++A  + +
Sbjct: 4    LEQLKGASVVVADTGDFNAIKEFQPTDATTNPSLILAASKME--QYAALIDQSVAYAKEH 61

Query: 408  GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNG 587
                ++  +    ++  V  G ++ K +PGRVSTEVDARL++DT   + +   L+  Y  
Sbjct: 62   ASGHQEV-LQAAMDRLFVVFGKEILKTIPGRVSTEVDARLSFDTQASIDRALGLIAQYEK 120

Query: 588  IEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              I  +R+L K+ +TW+GI A++ LE++ GI  ++T +++F           ++I  FVG
Sbjct: 121  EGISKDRILIKLASTWEGIRAAKFLESKHGIHCNMTLLFNFEQAVACAESGVTLISPFVG 180

Query: 765  RLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
            R+ DW   ++     + A  R +DPG   VT+ +NY  KY +K+++MAA+ RN +++  +
Sbjct: 181  RIMDWFVKNTD----QKAYTRKDDPGVVSVTRIFNYYKKYDYKTQVMAASFRNTEEIKGL 236

Query: 945  LGVDYI-VTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASA 1121
            +G D + ++P  + Q   E+   P         LS   A   +  K   V+ D+ +F  A
Sbjct: 237  VGCDLLTISPALLKQLAAETELAPVV-------LSTSHAKTLDLPK---VSIDEKAFRWA 286

Query: 1122 MG--PAAVELLTAGMEGYSNQAKRVEEL 1199
            +     A E L  G+  ++  A+ +E+L
Sbjct: 287  LNEDAMATEKLAEGIRNFAKDARTLEKL 314



>gb:CP000026_75291 Salmonella enterica subsp. enterica serovar
            Paratypi A str. ATCC 9150.
          Length = 316

 Score =  143 bits (360), Expect = 1e-32
 Identities = 97/327 (29%), Positives = 165/327 (50%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +LD +  ++ +V D+   +    + P  AT + SLLL    L   ++   ++ A+A  + 
Sbjct: 3    QLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLE--QYGHLIEDAIAWGKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
            +G   ++ +++   +K  VN G ++ K +PGRVSTEVDARL++D    + K   L+ LY 
Sbjct: 61   HG-GTQEQQVAAASDKLAVNFGAEILKSIPGRVSTEVDARLSFDKEKSIEKARHLVGLYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
               I   R+L K+ ATW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  QQGIDKSRILIKLAATWEGIRAAGQLEKEGINCNLTLLFSFAQARACAEAGVYLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  AR+      VE      EDPG   V   Y+Y  ++ +++ +M A+ R  + + 
Sbjct: 180  RIYDWYQARSPLEPYVVE------EDPGVKSVRNIYDYFKQHRYETIVMGASFRRTEQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ LKE   P        R+L P S     F +   +T  ++ +  
Sbjct: 234  ALTGCDRLTISPNLLKELKEKEEP------VIRKLVPSSQM---FHRPTSMTEAEFRWEH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AVE L+ G+  ++   +++E+L
Sbjct: 285  NQDAMAVEKLSEGIRLFAVDQRKLEDL 311



>sp|Q8ZN83|TALA_SALTY Transaldolase A (EC 2.2.1.2).>gb:AE008811_244139
            Salmonella typhimurium LT2, section 115 of 220 of the
            complete genome.>gb:AE006468_1001221 Salmonella
            typhimurium LT2, complete genome.
          Length = 316

 Score =  143 bits (360), Expect = 1e-32
 Identities = 96/327 (29%), Positives = 165/327 (50%), Gaps = 2/327 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +LD +  ++ +V D+   +    + P  AT + SLLL    L   ++   ++ A+A  + 
Sbjct: 3    QLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLE--QYGHLIEDAIAWGKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
            +G   ++ +++   +K  VN G ++ K +PGRVSTEVDARL++D    + K   L+ LY 
Sbjct: 61   HG-GTQEQQVAAASDKLAVNFGAEILKSIPGRVSTEVDARLSFDKEKSIEKARHLVDLYQ 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
               +   R+L K+ ATW+GI A+  LE EGI  +LT ++SF            +I  FVG
Sbjct: 120  QQGVDKSRILIKLAATWEGIRAAGQLEKEGINCNLTLLFSFAQARACAEAGVYLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  AR+      VE      EDPG   V   Y+Y  ++ +++ +M A+ R  + + 
Sbjct: 180  RIYDWYQARSPLEPYVVE------EDPGVKSVRNIYDYFKQHRYETIVMGASFRRTEQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ LKE   P        R+L P S     F +   +T  ++ +  
Sbjct: 234  ALTGCDRLTISPNLLKELKEKEEP------VIRKLVPSSQM---FHRPTPMTEAEFRWEH 284

Query: 1119 AMGPAAVELLTAGMEGYSNQAKRVEEL 1199
                 AVE L+ G+  ++   +++E+L
Sbjct: 285  NQDAMAVEKLSEGIRLFAVDQRKLEDL 311



>gb:AY850336_1180306 Magnaporthe grisea transaldolase-like protein
            mRNA, complete cds.
          Length = 324

 Score =  140 bits (354), Expect = 5e-32
 Identities = 92/311 (29%), Positives = 158/311 (50%), Gaps = 2/311 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V D+  F    K+ P  AT + SL+L        ++   +D A+A  +  G    D ++
Sbjct: 15   VVCDSGDFATIGKYKPQDATTNPSLILAASK--KAEYAKLIDDAIAYAKKQG-GSVDDQV 71

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
                ++ LV  G ++ K++PG+VSTEVDAR ++DT   V K   ++KLY    I  +R+L
Sbjct: 72   DASLDRLLVEFGKEILKIIPGKVSTEVDARFSFDTKASVDKALHIIKLYEAEGISKDRVL 131

Query: 615  FKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +TW+GI+A+ +L+ + GI  +LT ++S             +I  FVGR+ DW +  
Sbjct: 132  IKIASTWEGIKAAEILQRDHGINCNLTLMFSLVQAIAAAEADAFLISPFVGRILDWYK-- 189

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
               +  +   ++ EDPG   V   +NY  K+G+K+ +M A+ RN  ++  + G DY+   
Sbjct: 190  ---AAHKKEYKKEEDPGVESVKNIFNYYKKFGYKTIVMGASFRNTGEITELAGCDYLTIS 246

Query: 972  LKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ-YSFASAMGPAAVELL 1148
              +L+ L  S        +  ++L  Q AAA +  K+  ++ +  + F       AVE L
Sbjct: 247  PNLLEELLNS------SEAVPKKLDAQGAAALDIQKKTYISDEPLFRFDFNEDQMAVEKL 300

Query: 1149 TAGMEGYSNQA 1181
              G+  ++  A
Sbjct: 301  REGISKFAADA 311



>gb:AE016816_1746496 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 334

 Score =  140 bits (353), Expect = 6e-32
 Identities = 98/312 (31%), Positives = 155/312 (49%), Gaps = 6/312 (1%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLE---DKD 425
            +V DT  F    K+ P  AT + SL+L         +++ +D A+     YG       +
Sbjct: 25   VVADTGDFQAIAKYAPQDATTNPSLILAAARKEG--YQALIDRAVE----YGRSRDGSVE 78

Query: 426  ARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPE 605
             +     ++ LV  G ++ K+VPGRVSTEVDARL++D    V K  +++ LY    +  +
Sbjct: 79   QQTEAAVDRLLVEFGKEILKVVPGRVSTEVDARLSFDKDATVRKALEIISLYEQQGVSKD 138

Query: 606  RLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWA 782
            R+L KI +TW+GI+A+R LE++ GI  + T ++SFC          ++I  FVGR+ DW 
Sbjct: 139  RVLIKIASTWEGIQAARELESQHGIHVNCTLLFSFCQAVAAAEAGVTLISPFVGRILDWY 198

Query: 783  RNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYI 962
            +  +G +         EDPG   V + YNY  K+ + + +M A+ RN  ++ ++ GVD++
Sbjct: 199  KASTGKT-----YSGDEDPGVLSVRRIYNYFKKHDYPTIVMGASFRNLDEIKALAGVDFL 253

Query: 963  VTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMG--PAA 1136
                  L  L  S  P  +       L P SA A    K   V  D+ +F  A+     A
Sbjct: 254  TFWPASLNQLMTSADPVPQV------LDPASAKAQGDDKVSYVE-DEPAFRFALNDDAMA 306

Query: 1137 VELLTAGMEGYS 1172
             E L  G+  +S
Sbjct: 307  TEKLAEGIRKFS 318



>pir|A49985|A49985 transaldolase (EC 2.2.1.2) - human
          Length = 336

 Score =  139 bits (351), Expect = 1e-31
 Identities = 97/335 (28%), Positives = 168/335 (50%), Gaps = 7/335 (2%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            + + LD +  ++ +V DT  F   +++ P  AT + SL+L    +P   ++  V+ A+A 
Sbjct: 11   MESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAY 68

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                G   +D ++    +K  V  G ++ K +PGRVSTEVDARL++D   +V +   L++
Sbjct: 69   GRKLGGSQED-QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIE 127

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQ 752
            LY    I  +R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I 
Sbjct: 128  LYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLIS 187

Query: 753  IFVGRLRDWARNHSGDSEVEGALRRGEDPGSA---LVTKAYNYIHKYGHKSKLMAAAIRN 923
             FVGR+ DW         V    ++  +P       VTK YNY  K+ +K+ +M A+ RN
Sbjct: 188  PFVGRILDW--------HVANTDKKSYEPWKTWVKSVTKIYNYYKKFSYKTIVMGASFRN 239

Query: 924  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSP-QSAAAYNFTKEEVVTWD 1100
              ++ ++ G D++    K+L  L +             +L P  SA A   +  E +  D
Sbjct: 240  TGEIKALAGCDFLTISPKLLGELLQD----------NAKLVPVLSAKAAQASDLEKIHLD 289

Query: 1101 QYSF--ASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            + SF         AVE L+ G+  ++  A ++E +
Sbjct: 290  EKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERM 324



>gb:CR382132_1665593 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 325

 Score =  139 bits (350), Expect = 1e-31
 Identities = 80/257 (31%), Positives = 140/257 (54%), Gaps = 1/257 (0%)
 Frame = +3

Query: 255  IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
            +V DT  F+   K+ P  AT + SL+L     P+  +   +D A++  +    + K+ ++
Sbjct: 16   VVTDTGEFESIAKYKPQDATTNPSLILAASKKPE--YAKLIDEAVSFAKTKSSDPKE-QV 72

Query: 435  SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
            +   ++ L+  G ++ K+VPGRVSTEVDARL++D    + K   L+ LY    I  +R+L
Sbjct: 73   NIALDQLLIEFGSEILKIVPGRVSTEVDARLSFDKDATIKKALQLIDLYKAKGISSDRIL 132

Query: 615  FKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNH 791
             KI +T++GI+A++ LE++ GI  +LT ++SF           ++I  FVGR+ DW +  
Sbjct: 133  IKIASTYEGIQAAKELESKHGIHCNLTLLFSFVQAVACAEAKVTLISPFVGRILDWHKAA 192

Query: 792  SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            +G +         EDPG   V   ++Y  K+ +K+ +M A+ RN  ++  + G D++   
Sbjct: 193  TGKT-----YDAAEDPGVISVKNIFDYYKKFDYKTIVMGASFRNTGEIKELAGCDFLTIS 247

Query: 972  LKILQSLKESVTPPDEK 1022
              +L+ L  S  P  +K
Sbjct: 248  PGLLEELLNSTDPVPQK 264



>gb:CR380957_1652696 Candida glabrata strain CBS138 chromosome K
            complete sequence.
          Length = 332

 Score =  138 bits (348), Expect = 2e-31
 Identities = 98/339 (28%), Positives = 169/339 (49%), Gaps = 6/339 (1%)
 Frame = +3

Query: 201  SLDTGLTTELDAVTNY-SEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAV 377
            S + G  + L+ + N  + +V DT  F+   KF P  +T + SL+L     P+  + S +
Sbjct: 2    STENGGNSTLENLRNAGTNVVTDTGEFELISKFKPRDSTTNPSLILAATKNPN--YASLI 59

Query: 378  DTALADQECYG--LEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIV 551
            D A+   +  G  +E +    +   ++ LV  G  +  L+PG VSTEVDARL++D  G V
Sbjct: 60   DVAIDYAKAKGGTIEQQTNNAA---DRLLVEFGKRITDLIPGVVSTEVDARLSFDKKGTV 116

Query: 552  LKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXX 728
             K   ++KLY    +  +R+L KI +TW+GI+A+R LEA+ GI  +LT +++F       
Sbjct: 117  DKALQIIKLYEENGVSKDRVLIKIASTWEGIQAARELEAQHGIHCNLTLLFNFTQAVACA 176

Query: 729  XXXXSVIQIFVGRLRDWAR-NHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLM 905
                ++I  F+ R+ DW + N   D  +E        PG   V K YNY  K+G+K+ +M
Sbjct: 177  EANVTLISPFIARVLDWYKANTKNDYNIE------NHPGVLFVKKTYNYYKKHGYKTIIM 230

Query: 906  AAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEE 1085
             A+ R   ++ ++ G+D     + +L++L+ S          +R L+P+ A         
Sbjct: 231  GASFRTLDEIRALAGLDNATLGIPLLENLQNSTE------KIDRVLTPEGAQKDGVDMIT 284

Query: 1086 VVTWD-QYSFASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            ++  + +Y +       AVE L  G+  ++     +  L
Sbjct: 285  LIDDEAKYRYEFNSDAMAVEKLADGIRTFAKDTNTLYSL 323



>sp|Q8U7I5|TAL_AGRT5 Transaldolase (EC 2.2.1.2).>pir|H98181|H98181
            transaldolase PA2796 [imported] - Agrobacterium
            tumefaciens  (strain C58, Cereon)>pir|AD3105|AD3105
            transaldolase talB [imported] - Agrobacterium tumefaciens
             (strain C58, Dupont)>gb:AE008240_234919 Agrobacterium
            tumefaciens str. C58 linear chromosome, section 44 of 187
            of the complete sequence.>gb:AE009374_251285
            Agrobacterium tumefaciens str. C58 linear chromosome,
            section 144 of 187 of the complete
            sequence.>gb:AE007870_1080032 Agrobacterium tumefaciens
            str. C58 linear chromosome, complete
            sequence.>gb:AE008689_1089128 Agrobacterium tumefaciens
            str. C58 linear chromosome, complete sequence.
          Length = 321

 Score =  138 bits (347), Expect = 3e-31
 Identities = 96/333 (28%), Positives = 164/333 (49%), Gaps = 2/333 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +T++L+ +   + +V DT   +   +  P   T + +++L     P   F  AV  A+A 
Sbjct: 1    MTSKLEQLRAITTVVADTGDIEAVARLKPVDCTTNPTIVLKALGTP--AFADAVKEAVAW 58

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                G +  DA ++   ++  ++VG  LA LVPGRVSTEVDA L++DT   + K   ++ 
Sbjct: 59   GRKQGGQS-DAVVAAVADRLAISVGAALAGLVPGRVSTEVDADLSFDTQASITKARHIIA 117

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
             Y    I  ER+L K+ +TW+GI+A+ +L++EGI  +LT ++S             +I  
Sbjct: 118  SYKERGIERERILIKLASTWEGIKAAEVLQSEGIDCNLTLLFSQAQAIACAEAKAFLISP 177

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGR+ DW +  +G++          DPG   V   YNY    G  + +M A+ RN  ++
Sbjct: 178  FVGRILDWYKKSTGETYTAET-----DPGVVSVRSIYNYYKANGIGTVVMGASFRNVGEI 232

Query: 936  YSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFA 1115
             ++ G D +     +L+ L +      +    ER+LSP +  A     E + + D+ +F 
Sbjct: 233  EALAGCDRLTISPALLEELDK------DNGKLERKLSPDNVKA-----EALQSLDEKAFR 281

Query: 1116 SAMG--PAAVELLTAGMEGYSNQAKRVEELFGK 1208
             AM     A E L+ G+  ++     + E+  K
Sbjct: 282  WAMNEDAMATEKLSEGIRLFAKDLVTLREMVRK 314



>gb:AE013599_1133647 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003462_1210946 Drosophila melanogaster
            chromosome 2R, section 70 of 74 of the complete sequence.
          Length = 331

 Score =  137 bits (345), Expect = 5e-31
 Identities = 98/329 (29%), Positives = 165/329 (50%), Gaps = 5/329 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTK--FKSAVDTALADQE 401
            L  +   + IV DT  F+    + PT AT + SL+L   S+   +   + AV+ A   + 
Sbjct: 15   LQELKKITTIVADTGDFEAINIYKPTDATTNPSLILSASSMERYQPLVQKAVEYAKGKKG 74

Query: 402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
                +  +A      +   V  G ++ K+VPGRVSTE+DARL++DT   V K   L+ LY
Sbjct: 75   SVSEQVAEA-----MDYLCVLFGTEILKVVPGRVSTEIDARLSFDTKKSVEKALKLIALY 129

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
              + +  ER+L K+ +TW+GI+A+ +LE E G+  +LT ++SF           ++I  F
Sbjct: 130  KSLGVDKERILIKLASTWEGIKAAEILENEHGVHCNLTLLFSFAQAVACAEAGVTLISPF 189

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW   ++   + E      +DPG   VT  YNY  K+G+K+ +M A+ RN  ++ 
Sbjct: 190  VGRILDWYVANTDTKKFEAL----KDPGVISVTNIYNYYKKFGYKTLVMGASFRNVGEIK 245

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ L+      +E  S    LS  +A   +  K   +T D+  F  
Sbjct: 246  ALAGCDLLTISPALLKELE------NETESVVTYLSVSNAKLQDIEK---ITVDESRFRW 296

Query: 1119 AMG--PAAVELLTAGMEGYSNQAKRVEEL 1199
             +     A + L+ G+  ++    ++E L
Sbjct: 297  LLNEDAMATDKLSEGIRKFAVDTVKLENL 325



>sp|Q9W1G0|TAL1_DROME Probable transaldolase (EC
            2.2.1.2).>gb:AY118920_1300642 Drosophila melanogaster
            LD23608 full insert cDNA.
          Length = 320

 Score =  137 bits (345), Expect = 5e-31
 Identities = 98/329 (29%), Positives = 165/329 (50%), Gaps = 5/329 (1%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTK--FKSAVDTALADQE 401
            L  +   + IV DT  F+    + PT AT + SL+L   S+   +   + AV+ A   + 
Sbjct: 4    LQELKKITTIVADTGDFEAINIYKPTDATTNPSLILSASSMERYQPLVQKAVEYAKGKKG 63

Query: 402  CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
                +  +A      +   V  G ++ K+VPGRVSTE+DARL++DT   V K   L+ LY
Sbjct: 64   SVSEQVAEA-----MDYLCVLFGTEILKVVPGRVSTEIDARLSFDTKKSVEKALKLIALY 118

Query: 582  NGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
              + +  ER+L K+ +TW+GI+A+ +LE E G+  +LT ++SF           ++I  F
Sbjct: 119  KSLGVDKERILIKLASTWEGIKAAEILENEHGVHCNLTLLFSFAQAVACAEAGVTLISPF 178

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW   ++   + E      +DPG   VT  YNY  K+G+K+ +M A+ RN  ++ 
Sbjct: 179  VGRILDWYVANTDTKKFEAL----KDPGVISVTNIYNYYKKFGYKTLVMGASFRNVGEIK 234

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFAS 1118
            ++ G D +     +L+ L+      +E  S    LS  +A   +  K   +T D+  F  
Sbjct: 235  ALAGCDLLTISPALLKELE------NETESVVTYLSVSNAKLQDIEK---ITVDESRFRW 285

Query: 1119 AMG--PAAVELLTAGMEGYSNQAKRVEEL 1199
             +     A + L+ G+  ++    ++E L
Sbjct: 286  LLNEDAMATDKLSEGIRKFAVDTVKLENL 314



>sp|Q8PNY6|TAL_XANAC Transaldolase (EC 2.2.1.2).>gb:AE011721_275861
            Xanthomonas axonopodis pv. citri str. 306, section 99 of
            469 of the complete genome.>gb:AE008923_917636
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 322

 Score =  137 bits (344), Expect = 7e-31
 Identities = 92/321 (28%), Positives = 155/321 (48%)
 Frame = +3

Query: 210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL 389
            T   ++L  +   S +V DT  +D  ++  P   T + +L+     LP   +   ++  L
Sbjct: 2    TASPSKLAQLRELSVVVADTGDYDAIKRLKPVDCTTNPTLVKKALDLP--VYADLIEREL 59

Query: 390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL 569
            A    +G +D+ A ++   ++  + VG  LA+LVPGRVSTEVDA LA+DT   + K    
Sbjct: 60   AWGREHGGDDRTATVNEVADRLTIGVGVKLAELVPGRVSTEVDADLAHDTQATIAKARKF 119

Query: 570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVI 749
            + +Y    +  +++L KI ATW+GIEA+R L+ EGI  +LT +++             +I
Sbjct: 120  IAMYAERGVSKDKILIKIAATWEGIEAARQLQKEGIDCNLTLIFNRSQALACAEAGVFLI 179

Query: 750  QIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQ 929
              FVGR+ D+   +    +   ++   EDPG   V   YN   + G  + +M A+ R+  
Sbjct: 180  SPFVGRILDY---YVAQGQTPASI--DEDPGVVFVRTVYNEFKQRGSSTVVMGASFRSTA 234

Query: 930  DVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYS 1109
             + ++ G D +     +L+ L        E     R+LSP  A    FT    +  D ++
Sbjct: 235  QIEALAGCDRLTISPDLLEKLDA------EHGELPRKLSPAQADNAQFTP---IDSDSFA 285

Query: 1110 FASAMGPAAVELLTAGMEGYS 1172
               A  P A E L  G++ ++
Sbjct: 286  SGLAADPMATEKLAGGIDTFA 306



>sp|P57194|TAL_BUCAI Transaldolase (EC 2.2.1.2).>pir|D84940|D84940
            transaldolase (EC 2.2.1.2) A [imported] - Buchnera sp.
            (strain APS)>gb:BA000003_653466 Buchnera aphidicola str.
            APS (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 316

 Score =  137 bits (344), Expect = 7e-31
 Identities = 101/332 (30%), Positives = 164/332 (49%), Gaps = 4/332 (1%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +L A+  +S IV DT       K+ P  AT + SL+L   S      ++ VD A+   + 
Sbjct: 3    QLSALKQFSIIVADTSDIKSICKYQPEDATTNPSLILQAVS--SNTNQNFVDQAVQYAKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             G   KD  ++   +K LV++G ++ K +PG +S+EVDARL++ T   +LK   ++ LY 
Sbjct: 61   KGGLYKDQIINAS-DKILVDLGIEILKKIPGYISSEVDARLSFSTEASILKAKKIIDLYE 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
               I   R+L K+ ATW+ I+A+  L+ + I  +LT ++SF            +I  FVG
Sbjct: 120  EQGISRNRVLIKLAATWECIKAAEELKKDSILCNLTLLFSFAQARACAESNVFLISPFVG 179

Query: 765  RLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            R+ DW  ++N    S +      G+DPG   V K Y Y  KYG+K+ +M A+ RN Q + 
Sbjct: 180  RIYDWYISQNLLSKSFL------GKDPGVISVCKIYEYYKKYGYKTIIMGASFRNIQQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYN--FTKEEVVTWDQYSF 1112
             + G D +     +L+ L+ +          +R L+P S  +       EE   W+    
Sbjct: 234  YLSGCDRLTISPVLLKELESNTA------KIDRNLAPPSFISVPPVALSEEEFRWEHNQD 287

Query: 1113 ASAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
            A      AV+ L+ G+  +     R+E++F K
Sbjct: 288  A-----MAVQKLSDGIRNFGKDQLRLEKIFSK 314



>gb:AF404121_507780 Xanthomonas campestris pv. phaseoli transaldolase
            (talA) gene, complete cds.
          Length = 322

 Score =  136 bits (343), Expect = 9e-31
 Identities = 92/321 (28%), Positives = 155/321 (48%)
 Frame = +3

Query: 210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL 389
            T   ++L  +   S +V DT  +D  ++  P   T + +L+     LP   +   ++  L
Sbjct: 2    TASPSKLAQLRELSVVVADTGDYDAIKRLQPVDCTTNPTLVKKALDLP--VYADLIEREL 59

Query: 390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL 569
            A    +G +D+ A ++   ++  + VG  LA LVPGRVSTEVDA LA+DT   + K    
Sbjct: 60   AWGREHGGDDRTATVNEVADRLTIGVGVKLAGLVPGRVSTEVDADLAHDTQATIAKARKF 119

Query: 570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVI 749
            + +Y    +  +++L KI ATW+GIEA+R L+ EGI  +LT +++             +I
Sbjct: 120  IAMYAERGVSKDKILIKIAATWEGIEAARQLQKEGIDCNLTLIFNRSQALACAEAGVFLI 179

Query: 750  QIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQ 929
              FVGR+ D+   + G  +   ++   EDPG   V   YN   + G+ + +M A+ R+  
Sbjct: 180  SPFVGRILDY---YVGKGQTPASI--DEDPGVVFVRTVYNEFKQRGYSTVVMGASFRSTA 234

Query: 930  DVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYS 1109
             + ++   D +     +L+ L        E     R+LSP  A    FT    +  D ++
Sbjct: 235  QIEALASCDRLTISPDLLEKLDA------EHGELPRKLSPAKADNAQFTP---IDSDSFA 285

Query: 1110 FASAMGPAAVELLTAGMEGYS 1172
               A  P A E L  G++ ++
Sbjct: 286  SGLAADPMATEKLAGGIDTFA 306



>sp|Q9PK80|TAL_CHLMU Transaldolase (EC 2.2.1.2).>pir|E81686|E81686
            transaldolase TC0587 [imported] - Chlamydia muridarum
            (strain Nigg)>gb:AE002327_45173 Chlamydia muridarum Nigg
            section 57 of 85 of the complete
            genome.>gb:AE002160_1149313 Chlamydia muridarum Nigg,
            complete genome.
          Length = 327

 Score =  136 bits (343), Expect = 9e-31
 Identities = 96/331 (29%), Positives = 169/331 (51%), Gaps = 5/331 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++++ D +  +S +V D+   D  +      AT + SL+L +   P  K++S +  A++ 
Sbjct: 1    MSSQFDQLKLWSVLVGDSGDPDLIKTLDVQDATTNPSLILKVAQEP--KYQSMLTEAIS- 57

Query: 396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD 566
               +G+    D    ++   +K  VN+G ++ K VPGRVS E+DARL+++T  +V +   
Sbjct: 58   ---WGIRQNGDDVQTLTFVLDKIQVNLGLEILKYVPGRVSLEIDARLSFNTEAMVQRAIF 114

Query: 567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSV 746
            L +L+  +    +RLL KIP TW+GI A+ +LE +GI  ++T ++S            ++
Sbjct: 115  LSQLFEKMGGDKKRLLIKIPGTWEGIRAAEVLENQGIACNVTLIFSLVQAIAAAKAKVTL 174

Query: 747  IQIFVGRLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR 920
            +  FVGR+ DW  A   +    +E       DPG A V   Y+Y  K+   +++MAA+ R
Sbjct: 175  VSPFVGRIYDWWIAAYGAEGYSIEA------DPGVASVANIYSYYKKFDIPTQIMAASFR 228

Query: 921  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD 1100
             K+ V ++ G D++    KIL+ LK+      E+   ER+LS + A   +    E ++  
Sbjct: 229  TKEQVLALAGCDFLTISPKILEELKK------EQQPVERKLSVEEAKKLDIQPVE-LSES 281

Query: 1101 QYSFASAMGPAAVELLTAGMEGYSNQAKRVE 1193
             + F       A E L  G+  +S   + +E
Sbjct: 282  VFRFLMNEDAMATEKLAEGIRIFSGDTQILE 312



>gb:AE013598_297350 Xanthomonas oryzae pv. oryzae KACC10331, complete
            genome.
          Length = 322

 Score =  134 bits (338), Expect = 4e-30
 Identities = 92/323 (28%), Positives = 155/323 (47%), Gaps = 2/323 (0%)
 Frame = +3

Query: 210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL 389
            T   ++L  +   S +V DT  +D  ++  P   T + +L+     LP   +   ++  L
Sbjct: 2    TASPSKLAQLRELSVVVADTGDYDAIKRLQPVDCTTNPTLVKKALDLP--VYADLLEREL 59

Query: 390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL 569
                 +G +D+   +    ++  + VG  L+ LVPGRVSTEVDA LA+DT   + K    
Sbjct: 60   TWGRAHGGDDRTTTVDEVADRLTIGVGVKLSALVPGRVSTEVDADLAHDTQATIAKARKF 119

Query: 570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVI 749
            + +Y    +P +++L KI ATW+GIEA+R L+ EGI  +LT +++             +I
Sbjct: 120  VAMYAERGVPKDKILIKIAATWEGIEAARQLQLEGIDCNLTLIFNRAQALACAEANVFLI 179

Query: 750  QIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQ 929
              FVGR+ D+   +    +   ++   EDPG   V   YN   + G  + +M A+ R+  
Sbjct: 180  SPFVGRILDY---YVAQGQTPASI--DEDPGVVFVRTVYNAFKQRGSSTVVMGASFRSTA 234

Query: 930  DVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYS 1109
             + ++ G D +     +L+ L        E     R+LSP +A        ++   D  S
Sbjct: 235  QIEALAGCDRLTISPDLLEKLDA------EHGELPRKLSPGNA-----NNAQITPIDSDS 283

Query: 1110 FAS--AMGPAAVELLTAGMEGYS 1172
            FAS  A  P A E L +G++ ++
Sbjct: 284  FASGLAADPMATEKLASGIDTFA 306



>gb:CR543861_103901 Acinetobacter sp. ADP1 complete genome.
          Length = 329

 Score =  133 bits (335), Expect = 8e-30
 Identities = 92/324 (28%), Positives = 151/324 (46%)
 Frame = +3

Query: 228  LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY 407
            LD +   + +V D+   +   KF P  AT + SL+    S+P+ K         A QE Y
Sbjct: 6    LDQLKKLTTVVADSSDIEAIRKFLPLDATTNPSLITAAASIPENKALIEDAFNQAHQEGY 65

Query: 408  GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNG 587
               + D  +    +   V  G ++ KL+ GRVSTEVDA L+Y+T   + K  +L KLY  
Sbjct: 66   ---ENDLLIERTIDILTVKFGVEILKLIQGRVSTEVDASLSYNTEATIEKARELSKLYKE 122

Query: 588  IEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGR 767
              I   R+L KI +TWQGI+A+++LEAEGI  +LT ++             ++I  FVGR
Sbjct: 123  YGIDQSRILIKIASTWQGIQAAKVLEAEGIPCNLTLLFGLHQAQACADAKVTLISPFVGR 182

Query: 768  LRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL 947
            + DW +     +E        +DPG   V K + Y  + G  +++M A+ R+   V  + 
Sbjct: 183  ILDWYKK----AENVDHYPIEKDPGVVSVKKIFTYYKQQGTPTQVMGASFRSIDQVLGLA 238

Query: 948  GVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMG 1127
            G D +     +L  L++      +  + E  L+ + A           T   +       
Sbjct: 239  GSDLLTISPALLSELEQ------DHRTVEATLTIEEAKQAEIIHRAAQTEQSFKDELEHD 292

Query: 1128 PAAVELLTAGMEGYSNQAKRVEEL 1199
              A +LL +G++G+    +++  L
Sbjct: 293  LMAFQLLQSGIDGFIKAREQLSTL 316



>sp|O84315|TAL_CHLTR Transaldolase (EC 2.2.1.2).>pir|G71531|G71531
            probable transaldolase - Chlamydia trachomatis (serotype
            D, strain UW3/Cx)>gb:AE001303_34241 Chlamydia trachomatis
            D/UW-3/CX section 30 of 87 of the complete
            genome.>gb:AE001273_1098267 Chlamydia trachomatis
            D/UW-3/CX, complete genome.
          Length = 327

 Score =  131 bits (329), Expect = 4e-29
 Identities = 94/331 (28%), Positives = 168/331 (50%), Gaps = 5/331 (1%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++++ D +  +S +V DT      +      AT + SL+L +   P  K++S +  A++ 
Sbjct: 1    MSSQFDQLKLWSVLVGDTGDPALIKTLGVQDATTNPSLILKVAQEP--KYQSMLTEAIS- 57

Query: 396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD 566
               +G+    D    ++   +K  VN+G ++ K VPGRVS E+DARL+++T  +V +   
Sbjct: 58   ---WGIRQNGDDVQTLTFVLDKIQVNLGLEILKHVPGRVSLEIDARLSFNTEAMVQRAIF 114

Query: 567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSV 746
            L +L+  +    +RLL KIP TW+GI A+ +LE++GI  ++T +++            ++
Sbjct: 115  LSQLFEKMGGDKKRLLVKIPGTWEGICAAEVLESQGIACNVTLIFNLVQAIAAAKAKVTL 174

Query: 747  IQIFVGRLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIR 920
            +  FVGR+ DW  A   +    +E       DPG A V   Y+Y  K+   +++MAA+ R
Sbjct: 175  VSPFVGRIYDWWIAAYGAEGYSIEA------DPGVASVANIYSYYKKFDIPTQIMAASFR 228

Query: 921  NKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD 1100
             K+ V ++ G D++    K+L+ LK+   P       ER+LS + A   +    E ++  
Sbjct: 229  TKEQVLALAGCDFLTISPKLLEELKKDQQP------VERKLSVEEAKKLDIQPVE-LSES 281

Query: 1101 QYSFASAMGPAAVELLTAGMEGYSNQAKRVE 1193
             + F       A E L  G+  +S   + +E
Sbjct: 282  VFRFLMNEDAMATEKLAEGIRIFSGDTQILE 312



>sp|Q8PCA4|TAL_XANCP Transaldolase (EC 2.2.1.2).>gb:AE012182_280101
            Xanthomonas campestris pv. campestris str. ATCC 33913,
            section 90 of 460 of the complete
            genome.>gb:AE008922_913383 Xanthomonas campestris pv.
            campestris str. ATCC 33913, complete genome.
          Length = 322

 Score =  127 bits (320), Expect = 4e-28
 Identities = 90/331 (27%), Positives = 160/331 (48%), Gaps = 2/331 (0%)
 Frame = +3

Query: 210  TGLTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTAL 389
            T   ++L  + + S +V DT  +D  ++  P   T + +L+     LP   +   ++  L
Sbjct: 2    TASPSKLAQLRDLSVVVADTGDYDAIKRLKPVDCTTNPTLVKKALDLP--VYADLIEREL 59

Query: 390  ADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDL 569
            A    +G ED+++ ++   ++  V VG  L++LVPGRVSTEVDA LA+DT   + K    
Sbjct: 60   AWGRAHGGEDRNSTINEVADRLTVGVGTMLSELVPGRVSTEVDADLAHDTQATIAKARKF 119

Query: 570  LKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVI 749
            + +Y    +  +++L KI ATW+GIEA+R L+ EGI  +LT +++             +I
Sbjct: 120  IAMYAERGVSKDKILIKIAATWEGIEAARQLQQEGIDCNLTLIFNRSQALACAEAGVFLI 179

Query: 750  QIFVGRLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN 923
              FVGR+ D+  A+  +  S         EDPG   V   Y+   + G  + +M A+ R+
Sbjct: 180  SPFVGRILDFFVAKGQTPAS-------IDEDPGVVFVRGVYDEFKRRGSSTVVMGASFRS 232

Query: 924  KQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ 1103
               + ++ G D +     +L+ L        +     R+LSP +A     T    +  D 
Sbjct: 233  TAQIEALAGCDRLTISPDLLEKLDA------DHGDLPRKLSPLNADNAAITP---INSDS 283

Query: 1104 YSFASAMGPAAVELLTAGMEGYSNQAKRVEE 1196
            ++   A    A E L +G++ ++   + + +
Sbjct: 284  FATDLAADDMATEKLASGIDTFAKDLEALRK 314



>sp|Q8D1X3|TAL_WIGBR Transaldolase (EC 2.2.1.2).>gb:BA000021_687329
            Wigglesworthia glossinidia endosymbiont of Glossina
            brevipalpis DNA, complete genome.
          Length = 319

 Score =  127 bits (320), Expect = 4e-28
 Identities = 93/335 (27%), Positives = 158/335 (47%), Gaps = 7/335 (2%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +LD +  ++ +V D+      +K+ P   T + SL+L      ++K K      L D   
Sbjct: 3    QLDYIKKFTNVVIDSGNIKYIKKYSPKDVTTNPSLILR-----ESKSKHYYPL-LMDAIS 56

Query: 405  YGLEDKDARMSCFFN---KALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
            Y  +      S   N   K LVN+G ++ K++ GR+S E+D RL++    ++++   ++ 
Sbjct: 57   YAKKKGGNLNSYIINANDKLLVNIGREILKIIDGRISIEIDVRLSFSYLDLIIRAKKIIS 116

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            LYN   I   R+L KI ATW+GI+A++ LE  GI  +LT ++S             +I  
Sbjct: 117  LYNSYGIENNRILIKIAATWEGIQAAKFLEKSGINCNLTLIFSLVQAIACAESNVYLISP 176

Query: 756  FVGRLRDWARNH---SGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNK 926
            FVGR+ DW   +   + +S++        DPG  LV K + +  KYG+K+ +M A+ RN 
Sbjct: 177  FVGRVNDWYIKNFKLNKNSKI--------DPGVKLVYKIFYFYQKYGYKTFVMGASFRNI 228

Query: 927  QDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWD-Q 1103
              + SI+G D I      +  L        + +    R++ +S    N   E+   W   
Sbjct: 229  DQIISIIGCDAITISPDFVNKLNNLKLKKIKNFI---RVNLESKIKKNKLLEKEFRWKFN 285

Query: 1104 YSFASAMGPAAVELLTAGMEGYSNQAKRVEELFGK 1208
             +F       AVE L+ G+  +    K+++  F K
Sbjct: 286  QNF------MAVEKLSEGIRLFLRDQKKIDSFFLK 314



>pir|D81550|D81550 transaldolase CP0692 [imported] - Chlamydophila
            pneumoniae  (strain AR39)>gb:AE002227_44169 Chlamydophila
            pneumoniae AR39, section 55 of 94 of the complete
            genome.>gb:AE002161_886294 Chlamydophila pneumoniae AR39,
            complete genome.
          Length = 329

 Score =  127 bits (319), Expect = 6e-28
 Identities = 93/329 (28%), Positives = 157/329 (47%), Gaps = 3/329 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++ + D +   S IV D+   +  +      AT + SL+L +   P  KF+  ++ A+  
Sbjct: 3    MSNQFDQLKKLSTIVCDSGDPELVKASGSQDATTNPSLILKVAQEP--KFQELLNEAVV- 59

Query: 396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD 566
               +G+    D    +S   +K  VN   ++ K +PGR+S E+DARL+++   +V +   
Sbjct: 60   ---WGIRQNGDDLQTLSFILDKIQVNFALEIIKNIPGRISLEIDARLSFNVEAMVQRAVF 116

Query: 567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSV 746
            L +L+  +    +RLL KIP TW+GI A   LEA+GI  ++T +++            ++
Sbjct: 117  LSQLFEAMGGDKKRLLVKIPGTWEGIRAVEFLEAKGIACNVTLIFNLVQAIAAAKAKATL 176

Query: 747  IQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNK 926
            I  FVGR+ DW     GD           DPG A V+  Y Y  K+G  +++MAA+ R K
Sbjct: 177  ISPFVGRIYDWWIAAYGDE----GYSIDADPGVASVSNIYAYYKKFGIPTQIMAASFRTK 232

Query: 927  QDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQY 1106
            + V ++ G D +    K+L  LK+S  P       ++ L P  A   +    E +T   +
Sbjct: 233  EQVLALAGCDLLTISPKLLDELKKSQHP------VKKELDPAEAKKLDVQPIE-LTESFF 285

Query: 1107 SFASAMGPAAVELLTAGMEGYSNQAKRVE 1193
             F       A E L  G+  ++   + +E
Sbjct: 286  RFLMNEDAMATEKLAEGIRIFAGDTQILE 314



>sp|Q9Z998|TAL_CHLPN Transaldolase (EC 2.2.1.2).>pir|E72120|E72120
            transaldolase - Chlamydophila pneumoniae (strain
            CWL029)>pir|C86501|C86501 transaldolase [imported] -
            Chlamydophila pneumoniae (strain J138)>gb:AE001594_36948
            Chlamydia pneumoniae section 10 of 103 of the complete
            genome.>gb:AE017157_393428 Chlamydophila pneumoniae
            TW-183, section 1 of 4 of the complete
            genome.>gb:BA000008_663456 Chlamydophila pneumoniae J138
            genomic DNA, complete sequence.>gb:AE001363_941505
            Chlamydia pneumoniae, complete
            genome.>gb:AE009440_1027690 Chlamydophila pneumoniae
            TW-183, complete genome.
          Length = 327

 Score =  127 bits (319), Expect = 6e-28
 Identities = 93/329 (28%), Positives = 157/329 (47%), Gaps = 3/329 (0%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            ++ + D +   S IV D+   +  +      AT + SL+L +   P  KF+  ++ A+  
Sbjct: 1    MSNQFDQLKKLSTIVCDSGDPELVKASGSQDATTNPSLILKVAQEP--KFQELLNEAVV- 57

Query: 396  QECYGLE---DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHD 566
               +G+    D    +S   +K  VN   ++ K +PGR+S E+DARL+++   +V +   
Sbjct: 58   ---WGIRQNGDDLQTLSFILDKIQVNFALEIIKNIPGRISLEIDARLSFNVEAMVQRAVF 114

Query: 567  LLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSV 746
            L +L+  +    +RLL KIP TW+GI A   LEA+GI  ++T +++            ++
Sbjct: 115  LSQLFEAMGGDKKRLLVKIPGTWEGIRAVEFLEAKGIACNVTLIFNLVQAIAAAKAKATL 174

Query: 747  IQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNK 926
            I  FVGR+ DW     GD           DPG A V+  Y Y  K+G  +++MAA+ R K
Sbjct: 175  ISPFVGRIYDWWIAAYGDE----GYSIDADPGVASVSNIYAYYKKFGIPTQIMAASFRTK 230

Query: 927  QDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQY 1106
            + V ++ G D +    K+L  LK+S  P       ++ L P  A   +    E +T   +
Sbjct: 231  EQVLALAGCDLLTISPKLLDELKKSQHP------VKKELDPAEAKKLDVQPIE-LTESFF 283

Query: 1107 SFASAMGPAAVELLTAGMEGYSNQAKRVE 1193
             F       A E L  G+  ++   + +E
Sbjct: 284  RFLMNEDAMATEKLAEGIRIFAGDTQILE 312



>sp|Q7VRT4|TAL_CANBF Transaldolase (EC 2.2.1.2).>gb:BX248586_764115
            Blochmannia floridanus complete genome; segment 3/3.
          Length = 323

 Score =  127 bits (318), Expect = 7e-28
 Identities = 92/331 (27%), Positives = 160/331 (48%), Gaps = 6/331 (1%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLG--ICSLPDTKFKSAVDTALADQ 398
            +LD +  +S+I  DT   D    +    AT + SL+L   + +     F  A+D A   Q
Sbjct: 3    QLDNLKKFSKISADTGDVDLIRTYQIQHATTNPSLILKSPLFTTYLKLFNDAIDYA---Q 59

Query: 399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
            +  G  +++ +++   ++ +VN+G ++   + G +STE+DA+L+++T   + K H L+ +
Sbjct: 60   KIGG--NQNTKITNASDRLIVNIGSEILANISGYISTEIDAQLSFNTDLTIKKAHKLITM 117

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
            Y    I   R+L KI ATW+GI+A+  LE  GI+ +LT V+SF            +I  F
Sbjct: 118  YQKKNIDTSRVLIKIAATWEGIQAAEELEKSGIKCNLTLVFSFAQARACAERNIYLISPF 177

Query: 759  VGRLRDW--ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQD 932
            +GR+ DW   RN    S +       +DPG   + K Y+Y   YG+ + +M A+ R  + 
Sbjct: 178  IGRIYDWYNQRNLIKTSYI------NDDPGIQSIKKIYHYYKTYGYNTIIMGASFRRLEQ 231

Query: 933  VYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQYSF 1112
            + ++ G DY+      L+ L ++        S  R+L P            +   DQ  F
Sbjct: 232  ILALSGCDYLTISPHFLKQLYQNTN------SVTRQLFPPK----TIISHHIPVLDQSEF 281

Query: 1113 ASA--MGPAAVELLTAGMEGYSNQAKRVEEL 1199
                     AVE L  G++ +S   +++ +L
Sbjct: 282  FQEHNKNQMAVEKLNEGIQQFSIDQQKLHKL 312



>sp|Q8KA27|TAL_BUCAP Transaldolase (EC 2.2.1.2).>gb:AE014084_303015
            Buchnera aphidicola str. Sg (Schizaphis graminum) section
            9 of 57 of the complete genome.>gb:AE013218_934993
            Buchnera aphidicola str. Sg (Schizaphis graminum)
            complete genome.
          Length = 316

 Score =  127 bits (318), Expect = 7e-28
 Identities = 91/332 (27%), Positives = 161/332 (48%), Gaps = 3/332 (0%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTK--FKSAVDTALADQ 398
            +L+A+  ++ IV DT   +   K+ P  AT + SL+L   S    K     A++ A    
Sbjct: 3    QLNALKQFTTIVADTSDIESICKYKPQDATTNPSLILKAVSSSVNKRFIDQAIEYARKKG 62

Query: 399  ECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKL 578
              Y  +  +A      +K LV++G ++ K +PG +S+EVDARL+++    +LK   ++ +
Sbjct: 63   GSYNYKIVNAS-----DKILVDLGVEILKHIPGYISSEVDARLSFNKEKCILKAKKIIDM 117

Query: 579  YNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
            Y    I   R+L K+ ATW+ I+A+  L+   I  +LT ++SF            +I  F
Sbjct: 118  YEEKGISRNRVLIKLAATWECIKAAEELKKNNIACNLTLLFSFAQARACAESNVFLISPF 177

Query: 759  VGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY 938
            VGR+ DW  + +   +        +DPG   V K Y++  KY +K+ +M A+ RN Q + 
Sbjct: 178  VGRIYDWYLSQNLILKNPA----DQDPGVLSVCKIYDFYKKYNYKTIIMGASFRNVQQIL 233

Query: 939  SILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEV-VTWDQYSFA 1115
            S+ G D +     +L+ L+ S           R+L P +    +F    V +T  ++ + 
Sbjct: 234  SLSGCDRLTISPVLLKELESS------NKELNRKLCPPT----SFLNPPVPLTEAEFRWE 283

Query: 1116 SAMGPAAVELLTAGMEGYSNQAKRVEELFGKI 1211
                  AV+ L+ G+  +      +E++F K+
Sbjct: 284  HNQDEMAVQKLSEGIRNFGKDQLSLEKIFSKL 315



>sp|Q822J3|TAL_CHLCV Transaldolase (EC 2.2.1.2).>gb:AE016996_374746
            Chlamydophila caviae GPIC section 3 of 4 of the complete
            genome.>gb:AE015925_994425 Chlamydophila caviae GPIC
            complete genome.
          Length = 327

 Score =  126 bits (316), Expect = 1e-27
 Identities = 88/299 (29%), Positives = 146/299 (48%), Gaps = 4/299 (1%)
 Frame = +3

Query: 309  ATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLE---DKDARMSCFFNKALVNVGGDL 479
            AT + SL+L +   P  K++  +  A+A    +G+    D    ++   +K  VN G ++
Sbjct: 32   ATTNPSLILKVAQEP--KYQELLTEAIA----WGIRQNGDDIQTLTFVLDKIQVNFGLEI 85

Query: 480  AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
             K +PGRVS E+DARL+++T  ++ +   L +L+       +RLL KIP TW+GI A  +
Sbjct: 86   LKCIPGRVSLEIDARLSFNTEAMIQRAIFLSELFAATGGDKKRLLVKIPGTWEGIRAVEV 145

Query: 660  LEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDP 839
            LE +GI  ++T +++            ++I  FVGR+ DW     GD           DP
Sbjct: 146  LEKQGIACNVTLIFNLIQAIAAAKANATLISPFVGRIYDWWIAAYGDE----GYSIDADP 201

Query: 840  GSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDE 1019
            G A V+  Y Y  K+   +++MAA+ R+K+ V ++ G D +    K+L  LK+  +P  +
Sbjct: 202  GVASVSNIYTYYKKFDIPTQIMAASFRSKEQVLALAGCDLLTVSPKLLDELKKDQSPVAK 261

Query: 1020 KYSFERRLSPQSAAAYNFTKEEV-VTWDQYSFASAMGPAAVELLTAGMEGYSNQAKRVE 1193
            K           AAA     + V +T   + F       A E L  G+  +S   + +E
Sbjct: 262  KLDV--------AAAKKLDVQPVELTESVFRFLMNEDAMATEKLAEGIRIFSGDTQILE 312



>sp|Q89AY3|TAL_BUCBP Transaldolase (EC 2.2.1.2).>gb:AE014016_302506
            Buchnera aphidicola str. Bp (Baizongia pistaciae),
            section 1 of 2 of the complete genome.>gb:AE016826_981107
            Buchnera aphidicola str. Bp (Baizongia pistaciae),
            complete genome.
          Length = 316

 Score =  119 bits (297), Expect = 2e-25
 Identities = 88/332 (26%), Positives = 162/332 (48%), Gaps = 7/332 (2%)
 Frame = +3

Query: 225  ELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQEC 404
            +L+ +  Y++IV D+       KF     T + SL+  + SL   K++  +  ++   + 
Sbjct: 3    QLECLKKYTDIVVDSGDLVSINKFKLGDVTTNPSLIRQVMSLQ--KYQYIIYDSIRYAKK 60

Query: 405  YGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             G   K  ++    +K  V +G ++ K + G++STE+D+RL+++T+  + +   L+ +Y 
Sbjct: 61   KGGSHK-FKLENAIDKVSVILGSEILKNISGKISTEIDSRLSFNTNLCIERAKKLISMYE 119

Query: 585  GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              +I  +R+L K+ ATW+ + A++ L+ E IQ++LT ++SF            +I  FVG
Sbjct: 120  EHDIHRDRVLIKLAATWESVSAAKELKKENIQSNLTLLFSFAQAKICAEAGVFLISPFVG 179

Query: 765  RLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
            R+ DW   +   S ++ A+   +DPG   V K Y Y  +YG+ + +M A+ RN   V ++
Sbjct: 180  RIYDW---YKSKSLIKSAM-IDDDPGVNAVRKIYQYYKEYGYHTIIMGASFRNVDQVLAL 235

Query: 945  LGVDYIVTPLKILQSLKES-------VTPPDEKYSFERRLSPQSAAAYNFTKEEVVTWDQ 1103
             G D +     +L  L+ S       + PP  K     +L P   +   F       W  
Sbjct: 236  SGCDRLTISPNLLHKLQLSDDLVIRKLIPPKHK-----KLQPVCMSKSEF------CW-- 282

Query: 1104 YSFASAMGPAAVELLTAGMEGYSNQAKRVEEL 1199
            +    AM   AVE L+ G+  +    + +E +
Sbjct: 283  FHNEDAM---AVEKLSEGIRQFGKDQQELENI 311



>gb:D89215_1675332 Schizosaccharomyces pombe mRNA, partial cds,
           clone: SY 1195.
          Length = 245

 Score =  115 bits (288), Expect = 2e-24
 Identities = 71/207 (34%), Positives = 114/207 (55%), Gaps = 1/207 (0%)
 Frame = +3

Query: 255 IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
           +V DT  F+   K+ P  AT + SL+L     P  ++ + VD A+   +  G    ++++
Sbjct: 19  VVSDTGDFESIAKYKPQDATTNPSLILAASKKP--QYAALVDAAVDYAKAKG-GSINSQI 75

Query: 435 SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
              F++ L+  G  +  +VPGRVSTEVDAR ++DT   + K   L+KLY    I  ER+L
Sbjct: 76  EIAFDRLLIEFGTKILAIVPGRVSTEVDARYSFDTQTTIEKARHLIKLYEAEGIGRERVL 135

Query: 615 FKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR-NH 791
            KI +T++GI+A++ LE EGI  +LT ++SF           ++I  FVGR+ D+ +  +
Sbjct: 136 IKIASTYEGIQAAKQLEEEGIHCNLTLLFSFVQAVACAEANVTLISPFVGRILDFYKAKN 195

Query: 792 SGDSEVEGALRRGEDPGSALVTKAYNY 872
           + D   +      EDPG   V+  +NY
Sbjct: 196 NRDYTAQ------EDPGVVSVSNIFNY 216



>pir|T43036|T43036 probable transaldolase (EC 2.2.1.2) - fission
           yeast  (Schizosaccharomyces pombe) (fragment)
          Length = 245

 Score =  115 bits (288), Expect = 2e-24
 Identities = 71/207 (34%), Positives = 114/207 (55%), Gaps = 1/207 (0%)
 Frame = +3

Query: 255 IVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARM 434
           +V DT  F+   K+ P  AT + SL+L     P  ++ + VD A+   +  G    ++++
Sbjct: 19  VVSDTGDFESIAKYKPQDATTNPSLILAASKKP--QYAALVDAAVDYAKAKG-GSINSQI 75

Query: 435 SCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLL 614
              F++ L+  G  +  +VPGRVSTEVDAR ++DT   + K   L+KLY    I  ER+L
Sbjct: 76  EIAFDRLLIEFGTKILAIVPGRVSTEVDARYSFDTQTTIEKARHLIKLYEAEGIGRERVL 135

Query: 615 FKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR-NH 791
            KI +T++GI+A++ LE EGI  +LT ++SF           ++I  FVGR+ D+ +  +
Sbjct: 136 IKIASTYEGIQAAKQLEEEGIHCNLTLLFSFVQAVACAEANVTLISPFVGRILDFYKAKN 195

Query: 792 SGDSEVEGALRRGEDPGSALVTKAYNY 872
           + D   +      EDPG   V+  +NY
Sbjct: 196 NRDYTAQ------EDPGVVSVSNIFNY 216



>gb:AY872138_2150302 Synthetic construct hypothetical protein
           (FTT1093) gene, complete cds.
          Length = 374

 Score =  107 bits (267), Expect = 6e-22
 Identities = 68/257 (26%), Positives = 128/257 (49%), Gaps = 1/257 (0%)
 Frame = +3

Query: 228 LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY 407
           L+ +   + +V DT  F+  +K+ P  AT + SL+L   ++ + K+ + V   ++  +  
Sbjct: 50  LEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILK--AVKEQKYSNLVAETISKVKAN 107

Query: 408 GLE-DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             + + D  +     + LV+ G  +  ++ G+VS+EVDAR+++++   +     ++  Y 
Sbjct: 108 NPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYE 167

Query: 585 GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              IP +R+L KI ATW+GI+A++LL+ EGI  +LT ++              ++  FVG
Sbjct: 168 SNGIPKDRVLIKIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVG 227

Query: 765 RLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
           R+ DW    +            +D G   V   Y     +G K+ +M A+ RN + V ++
Sbjct: 228 RITDWQMQQNNLKTFPAI---ADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIAL 284

Query: 945 LGVDYIVTPLKILQSLK 995
            G D +     +L+ LK
Sbjct: 285 AGCDALTISPVLLEELK 301



>gb:AJ749949_531550 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 321

 Score =  107 bits (267), Expect = 6e-22
 Identities = 68/257 (26%), Positives = 128/257 (49%), Gaps = 1/257 (0%)
 Frame = +3

Query: 228 LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECY 407
           L+ +   + +V DT  F+  +K+ P  AT + SL+L   ++ + K+ + V   ++  +  
Sbjct: 6   LEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILK--AVKEQKYSNLVAETISKVKAN 63

Query: 408 GLE-DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYN 584
             + + D  +     + LV+ G  +  ++ G+VS+EVDAR+++++   +     ++  Y 
Sbjct: 64  NPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYE 123

Query: 585 GIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVG 764
              IP +R+L KI ATW+GI+A++LL+ EGI  +LT ++              ++  FVG
Sbjct: 124 SNGIPKDRVLIKIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVG 183

Query: 765 RLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
           R+ DW    +            +D G   V   Y     +G K+ +M A+ RN + V ++
Sbjct: 184 RITDWQMQQNNLKTFPAI---ADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIAL 240

Query: 945 LGVDYIVTPLKILQSLK 995
            G D +     +L+ LK
Sbjct: 241 AGCDALTISPVLLEELK 257



>gb:AY232008_1177301 Drosophila yakuba clone yak-ad_CG2827 mRNA
           sequence.
          Length = 190

 Score =  103 bits (256), Expect = 1e-20
 Identities = 64/187 (34%), Positives = 101/187 (54%), Gaps = 3/187 (1%)
 Frame = +3

Query: 228 LDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTK--FKSAVDTALADQE 401
           L  +   + IV DT  F+    + PT AT + SL+L   S+   +   + AV+ A   + 
Sbjct: 4   LQELKKITTIVADTGDFEAINIYKPTDATTNPSLILSASSMERYQPLVQKAVEYAKGKKG 63

Query: 402 CYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLY 581
               +  +A      +   V  G ++ K+VPGRVSTE+DARL++DT   V K   L+ LY
Sbjct: 64  SVSEQVAEA-----MDYLCVLFGTEILKVVPGRVSTEIDARLSFDTKKSVEKALKLIALY 118

Query: 582 NGIEIPPERLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIF 758
             + +  ER+L K+ +TW+GI+A+ +LE E G+  +LT ++SF           ++I  F
Sbjct: 119 KSLGVDKERILIKLASTWEGIKAAEILENEHGVHCNLTLLFSFAQAVACAEAGVTLISPF 178

Query: 759 VGRLRDW 779
           VGR+ DW
Sbjct: 179 VGRILDW 185



>gb:AF481103_514487 Candidatus Tremblaya princeps transaldolase (tal),
            phosphoribosylpyrophosphate synthetase (prs), and
            ribosomal protein S15 (rpS15) genes, complete cds; 16S
            ribosomal RNA, 23S ribosomal RNA, and 5S ribosomal RNA
            genes, complete sequence; ribosomal protein L11 (rpL11),
            ribosomal protein L10 (rpL10), ribosomal protein L7/L12
            (rpL7/12), RNA polymerase beta-subunit (rpoB), RNA
            polymerase beta prime-subunit (rpoC), ribosomal protein
            S12 (rpS12), ribosomal protein S7 (rpS7), elongation
            factor G (fus), elongation factor Tu (tuf), ribosomal
            protein S10 (rpS10), ribosomal protein L3 (rpL3),
            ribosomal protein L4 (rpL4), and ribosomal protein L2
            (rpL2) genes, complete cds; and unknown genes.
          Length = 311

 Score =  103 bits (256), Expect = 1e-20
 Identities = 78/300 (26%), Positives = 138/300 (46%), Gaps = 18/300 (6%)
 Frame = +3

Query: 216  LTTELDAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALAD 395
            +++ L  ++ +SE+  D+  F +  +F PT AT + SL+L  C   + ++ S V+  +  
Sbjct: 2    VSSALQFLSQHSELSMDSARFLEALRFRPTHATTNPSLILSACQ--NNEYNSLVNETIRL 59

Query: 396  QECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLK 575
                G  +    +   F   L++        +PG VS E+DA  A++    +     +++
Sbjct: 60   HRNEGYRNIADHIRLRFCTELLD-------RIPGMVSVEIDACCAFNVDASIAHARRIVQ 112

Query: 576  LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
            L    +   +R+L KIPATWQG++A+  L AEG+Q ++T V+S             +I  
Sbjct: 113  LCRPTDAR-DRILVKIPATWQGVQAAAALRAEGVQCNMTLVFSMLQALVCARNGAYLISP 171

Query: 756  FVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV 935
            FVGRL D      G S         +D G AL  + Y+ + + GH +++MAA+ R +Q V
Sbjct: 172  FVGRLSDRMPAMQGSSAT-------QDQGVALALRIYSRLRQEGHATRVMAASFRGEQQV 224

Query: 936  YSILGVDYIVTP---LKILQSLKESVTP---------------PDEKYSFERRLSPQSAA 1061
                    +      ++ L +++ S  P               P + ++FER L+    A
Sbjct: 225  IMASACGMVTVGEHIMRRLAAMRASAMPKPCQQFSEAMQHCPTPRDLHAFERALAQNRTA 284



>gb:AB010049_1510829 Schizosaccharomyces pombe mRNA for transaldolase,
            partial cds.
          Length = 212

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 62/211 (29%), Positives = 108/211 (51%), Gaps = 2/211 (0%)
 Frame = +3

Query: 555  KVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXX 734
            K   L+KLY    I  ER+L KI +T++GI+A++ LE EGI  +LT ++SF         
Sbjct: 1    KARHLIKLYEAEGIGRERVLIKIASTYEGIQAAKQLEEEGIHCNLTLLFSFVQAVACAEA 60

Query: 735  XXSVIQIFVGRLRDWAR-NHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAA 911
              ++I  FVGR+ D+ +  ++ D   +      EDPG   V+  +NY  K+G+K+ +M A
Sbjct: 61   NVTLISPFVGRILDFYKAKNNRDYTAQ------EDPGVVSVSNIFNYYKKFGYKTIVMGA 114

Query: 912  AIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVV 1091
            + RN  ++  + GVD++     +L+ L  S        +  ++L    A++ N  K   +
Sbjct: 115  SFRNVGEIKELAGVDFLTISPALLEQLNNSTD------AVPKKLDASKASSLNLEKVSYL 168

Query: 1092 TWD-QYSFASAMGPAAVELLTAGMEGYSNQA 1181
            T + ++ F       AV  L+ G+  ++  A
Sbjct: 169  TDEPKFRFDFNNDEMAVVKLSTGIAAFAKDA 199



>pir|T43308|T43308 transaldolase (EC 2.2.1.-) - fission yeast
            (Schizosaccharomyces pombe) (fragment)
          Length = 212

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 62/211 (29%), Positives = 108/211 (51%), Gaps = 2/211 (0%)
 Frame = +3

Query: 555  KVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXX 734
            K   L+KLY    I  ER+L KI +T++GI+A++ LE EGI  +LT ++SF         
Sbjct: 1    KARHLIKLYEAEGIGRERVLIKIASTYEGIQAAKQLEEEGIHCNLTLLFSFVQAVACAEA 60

Query: 735  XXSVIQIFVGRLRDWAR-NHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAA 911
              ++I  FVGR+ D+ +  ++ D   +      EDPG   V+  +NY  K+G+K+ +M A
Sbjct: 61   NVTLISPFVGRILDFYKAKNNRDYTAQ------EDPGVVSVSNIFNYYKKFGYKTIVMGA 114

Query: 912  AIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRLSPQSAAAYNFTKEEVV 1091
            + RN  ++  + GVD++     +L+ L  S        +  ++L    A++ N  K   +
Sbjct: 115  SFRNVGEIKELAGVDFLTISPALLEQLNNSTD------AVPKKLDASKASSLNLEKVSYL 168

Query: 1092 TWD-QYSFASAMGPAAVELLTAGMEGYSNQA 1181
            T + ++ F       AV  L+ G+  ++  A
Sbjct: 169  TDEPKFRFDFNNDEMAVVKLSTGIAAFAKDA 199



>gb:AF211124_488685 Carsonella ruddii country USA tryptophanyl-tRNA
            synthetase (trpS) gene, partial cds; 16S ribosomal RNA,
            23S ribosomal RNA, and 5S ribosomal RNA genes, complete
            sequence; transaldolase (tal) and alkyl hydroperoxide
            reductase small subunit (ahpC) genes, complete cds; and
            valyl-tRNA synthetase (valS) gene, partial cds.
          Length = 299

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 59/199 (29%), Positives = 100/199 (50%), Gaps = 1/199 (0%)
 Frame = +3

Query: 411  LEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGI 590
            L D D  +S F++  L+ V  +L K +  ++S E+ AR++Y+ + I++    +L L +  
Sbjct: 63   LLDPDTEIS-FYDYLLIFVVCNLIKFIKDKISIEIPARISYNYNKIIIYSQKILFLCDQF 121

Query: 591  EIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRL 770
             I   R+L KIPAT  GI+A+  L+  GI+ +LT ++              +I  FVGR+
Sbjct: 122  GINKNRILIKIPATDSGIKAASKLKLSGIECNLTLIFDLNQVKKCFDNEIYIISPFVGRI 181

Query: 771  RDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILG 950
             D              +    D G   V   YNY   Y +K+K+MAA+ RN   + ++L 
Sbjct: 182  SD-------------IINCNFDSGVNFVKNIYNYKKNYNYKTKIMAASFRNLNQILNLLF 228

Query: 951  VDYI-VTPLKILQSLKESV 1004
             DYI ++P+   + L + +
Sbjct: 229  CDYITISPIYFEKLLNKKI 247



>gb:MMU63159_2122848 Mus musculus transaldolase mRNA, partial cds.
          Length = 140

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 4/133 (3%)
 Frame = +3

Query: 606 RLLFKIPATWQGIEASRLLEAE-GIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWA 782
           R+L K+ +TW+GI+A + LE + GI  ++T ++SF           ++I  FVGR+ DW 
Sbjct: 1   RILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDW- 59

Query: 783 RNHSGDSEVEGALRRGEDPGSALV---TKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGV 953
                   V    ++  DP    V   TK YNY  K+G+K+ +M A+ RN  ++ ++ G 
Sbjct: 60  -------HVANTDKKSYDPRKTWVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGC 112

Query: 954 DYIVTPLKILQSL 992
           D++    K+L  L
Sbjct: 113 DFLTISPKLLGEL 125



>gb:AF211135_488697 Carsonella ruddii natural-host Ctenarytaina
           spatulata 16S ribosomal RNA gene, partial sequence; 23S
           ribosomal RNA and 5S ribosomal RNA genes, complete
           sequence; transaldolase (tal) and alkyl hydroperoxide
           reductase small subunit (ahpC) genes, complete cds; and
           valyl-tRNA synthetase (valS) gene, partial cds.
          Length = 297

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 51/196 (26%), Positives = 99/196 (50%), Gaps = 1/196 (0%)
 Frame = +3

Query: 411 LEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGI 590
           L D D ++S  ++K L+ + G+L   +  ++S E+ AR++++ + I++    ++ L N  
Sbjct: 63  LLDSDIQIS-LYDKILIFIVGNLIPFINDKISIEIPARISFNYNLIIIYSKKIIFLCNKY 121

Query: 591 EIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRL 770
            I   ++L KIP T  GI+A++ L+  GI+T++T ++              +I  F+GR+
Sbjct: 122 GININKVLIKIPGTDSGIKAAKKLKEIGIETNITLIFDINQVKKCLDFGVYIISPFIGRI 181

Query: 771 RDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILG 950
            D             ++    D G   V   Y Y +   +K K+MAA+ RN   + ++  
Sbjct: 182 SD-------------SIYCKYDSGVNFVKNIYTYKNNNNYKIKIMAASFRNINQIINLTF 228

Query: 951 VDYI-VTPLKILQSLK 995
            D + ++P+  L+ LK
Sbjct: 229 CDCLTISPIYFLELLK 244



>gb:AF211141_488702 Carsonella ruddii natural-host Pachypsylla
           celtidis tryptophanyl-tRNA synthetase (trpS) gene,
           partial cds; 16S ribosomal RNA, 23S ribosomal RNA, and
           5S ribosomal RNA genes, complete sequence; transaldolase
           (tal) and alkyl hydroperoxide reductase small subunit
           (ahpC) genes, complete cds; and valyl-tRNA synthetase
           (valS) gene, partial cds.
          Length = 297

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 59/249 (23%), Positives = 118/249 (47%), Gaps = 1/249 (0%)
 Frame = +3

Query: 231 DAVTNYSEIVPDTVVFDDFEKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYG 410
           D + N ++I  D+   +  +     AAT + SL+L   S+    +   +   L       
Sbjct: 5   DFIKNKTKISIDSADINFIKNKLFNAATTNPSLILK--SILSKVYNKLLYAFLLKNFKKK 62

Query: 411 LEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGI 590
           + D D  +S  ++K LVN+  ++   +  ++S E+ AR++++ + I+   + ++ L   I
Sbjct: 63  IIDSDYNIS-LYDKLLVNIIANIIPYIEEKISIEIPARISFNYNKIIFYSYKIIYLCEKI 121

Query: 591 EIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRL 770
            I  +++L KIPAT  GI+A++ L+   I ++LT +++             +I  FVGR+
Sbjct: 122 GINLKKILIKIPATNSGIKAAKQLKNNNINSNLTLIFNLTQAKKCFDSGIYIISPFVGRV 181

Query: 771 RDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILG 950
            D             ++    D G   V    N  +   + +K+MAA+ RN   + ++  
Sbjct: 182 SD-------------SIYCKYDSGVNFVKNLVNLKNNNNYSTKIMAASFRNINQIINLTC 228

Query: 951 VDYI-VTPL 974
            D+I ++P+
Sbjct: 229 CDFITISPI 237



>gb:AF211133_488691 Carsonella ruddii natural-host Ctenarytaina
           eucalypti tryptophanyl-tRNA synthetase (trpS) gene,
           partial cds; 16S ribosomal RNA, 23S ribosomal RNA, and
           5S ribosomal RNA genes, complete sequence; transaldolase
           (tal) and alkyl hydroperoxide reductase small subunit
           (ahpC) genes, complete cds; and valyl-tRNA synthetase
           (valS) gene, partial cds.
          Length = 297

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 50/196 (25%), Positives = 100/196 (51%), Gaps = 1/196 (0%)
 Frame = +3

Query: 411 LEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGI 590
           L D D ++S  ++K L+ + G+L   +  ++S E+ AR++++ + I++    ++ L N  
Sbjct: 63  LLDSDIQIS-LYDKILILIVGNLIPFINDKISIEIPARISFNYNLIIIYSKKIIFLCNKY 121

Query: 591 EIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRL 770
            I  +++L KIP T  GI+A++ L+  GI+T++T ++              +I  FVGR+
Sbjct: 122 GINIKKILIKIPGTDSGIKAAKKLKEIGIETNITLIFDINQVKKCLDYGVYIISPFVGRI 181

Query: 771 RDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILG 950
            D             ++    D G   V   + Y +   +K+K+MAA+ RN   + ++  
Sbjct: 182 SD-------------SIFCKYDSGVNFVKNIFIYKNNNNYKTKIMAASFRNINQILNLTF 228

Query: 951 VDYI-VTPLKILQSLK 995
            D + ++P+   + LK
Sbjct: 229 CDCLTISPIYFSKLLK 244



>sp|Q9WYD1|TAL_THEMA Transaldolase (EC 2.2.1.2).>pir|G72394|G72394
           transaldolase-related protein - Thermotoga maritima
           (strain MSB8)>gb:AE001711_38211 Thermotoga maritima MSB8
           section 23 of 136 of the complete
           genome.>gb:AE000512_1112684 Thermotoga maritima MSB8,
           complete genome.
          Length = 218

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 51/175 (29%), Positives = 88/175 (50%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++  LV G VS EV   ++ D  G+V +  +L ++        E ++ KIP T  GI+A 
Sbjct: 45  EICDLVKGPVSAEV---VSLDYEGMVREARELAQI-------SEYVVIKIPMTPDGIKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
           + L AEGI+T++T V+S            + +  FVGR+ D +         +G    GE
Sbjct: 95  KTLSAEGIKTNVTLVFSPAQAILAAKAGATYVSPFVGRMDDLSN--------DGMRMLGE 146

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
                 + + YN    YG +++++AA+IR+   V   +++GVD +  P  +L+ L
Sbjct: 147 ------IVEIYN---NYGFETEIIAASIRHPMHVVEAALMGVDIVTMPFAVLEKL 192



>gb:AF544969_1151042 Ctenopharyngodon idella transaldolase mRNA,
            partial cds.
          Length = 185

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 51/183 (27%), Positives = 84/183 (45%), Gaps = 2/183 (1%)
 Frame = +3

Query: 657  LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGED 836
            L E  GI  ++T ++SF           ++I  FVGR+ DW + +S     E      ED
Sbjct: 4    LEEKHGIHCNMTLLFSFAQAVACAEARVTLISPFVGRILDWYKENSDRKNYEPH----ED 59

Query: 837  PGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPD 1016
            PG   VTK YNY  K+ + + +M A+ RN  +V ++ G D +     +L  L +      
Sbjct: 60   PGVQSVTKIYNYYKKFNYSTVVMGASFRNTGEVKALAGCDLLTISPGLLGELSQ------ 113

Query: 1017 EKYSFERRLSPQSAAAYNFTKEEVVTWDQYSFASAMGP--AAVELLTAGMEGYSNQAKRV 1190
            +  +    L+PQ A   +    E +  D+ SF         AVE L+ G+  ++  A ++
Sbjct: 114  DHSAVTCSLTPQGAKECDL---EQIHLDEKSFRWLHNEDRMAVEKLSDGIRKFAADAIKL 170

Query: 1191 EEL 1199
            E +
Sbjct: 171  EAM 173



>gb:AC006729_1203887 Caenorhabditis elegans cosmid Y24D9A, complete
            sequence.
          Length = 165

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 3/174 (1%)
 Frame = +3

Query: 687  LTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAY 866
            +T +++F           ++I  FVGR+ DW   ++       A  R +DPG   VT+ +
Sbjct: 1    MTLLFNFEQAVACAESGVTLISPFVGRIMDWFVKNTDQK----AYTRKDDPGVVSVTRIF 56

Query: 867  NYIHKYGHKSKLMAAAIRNKQDVYSILGVDYI-VTPLKILQSLKESVTPPDEKYSFERRL 1043
            NY  KY +K+++MAA+ RN +++  ++G D + ++P  + Q   E+   P         L
Sbjct: 57   NYYKKYDYKTQVMAASFRNTEEIKGLVGCDLLTISPALLKQLAAETELAPVV-------L 109

Query: 1044 SPQSAAAYNFTKEEVVTWDQYSFASAMG--PAAVELLTAGMEGYSNQAKRVEEL 1199
            S   A   +  K   V+ D+ +F  A+     A E L  G+  ++  A+ +E+L
Sbjct: 110  STSHAKTLDLPK---VSIDEKAFRWALNEDAMATEKLAEGIRNFAKDARTLEKL 160



>gb:BX957222_844561 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 215

 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 48/175 (27%), Positives = 84/175 (48%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++  +V G VS EV   +A D+ G+V +  +L+KL        E ++ KIP T +G++A 
Sbjct: 45  EICSIVDGPVSAEV---IALDSEGMVKEARELVKL-------AENVVVKIPMTKEGMKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
            +L  EGI+T++T ++S            S +  FVGRL D                 G+
Sbjct: 95  NILSKEGIKTNVTLIFSANQALLAAKAGASYVSPFVGRLDD----------------VGQ 138

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
           D G  L+++       YG +++++ A++R+   V   + +G D    P  +L  L
Sbjct: 139 D-GMFLISEVMQVFGAYGIETEVIVASVRHPIHVLESAKMGADIATIPFDVLDKL 192



>gb:BC046011_2549522 Danio rerio zgc:56232, mRNA (cDNA clone MGC:56232
            IMAGE:5601346), complete cds.
          Length = 260

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 61/234 (26%), Positives = 108/234 (46%), Gaps = 9/234 (3%)
 Frame = +3

Query: 525  LAYDTHG-IVLKVHDLLKLYNGIEIPPERLLFKIPA-----TWQGIEASRLLEAEGIQTH 686
            LA D H  IV++  + + L+  +   P   + ++ A       Q  EA+  +EAEG    
Sbjct: 28   LARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAP 87

Query: 687  LT-FVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKA 863
            LT  ++S            ++I  FVGR+ DW + ++     E      EDPG   VTK 
Sbjct: 88   LTELLHSRNEGVACAEARVTLISPFVGRILDWYKENTERKTYEPH----EDPGVLSVTKI 143

Query: 864  YNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSLKESVTPPDEKYSFERRL 1043
            YNY  K+ +++ +M A+ RN  +V ++ G D +     +L+ L +      +  +    L
Sbjct: 144  YNYYKKFDYRTVVMGASFRNIGEVKALAGCDLLTISPALLEELSQ------DHSAITCTL 197

Query: 1044 SPQSAAAYNFTKEEVVTWDQYSFASAMGP--AAVELLTAGMEGYSNQAKRVEEL 1199
            +PQ+A      + ++   D+ SF         AVE L+ G+  ++  A ++E +
Sbjct: 198  TPQTARECVLERLQL---DEKSFRWLHNEDRMAVEKLSDGIRKFAADAVKLETM 248



>gb:AF211134_488694 Carsonella ruddii natural-host Ctenarytaina
           longicauda 16S ribosomal RNA gene, partial sequence; 23S
           ribosomal RNA and 5S ribosomal RNA genes, complete
           sequence; transaldolase (tal) and alkyl hydroperoxide
           reductase small subunit (ahpC) genes, complete cds; and
           valyl-tRNA synthetase (valS) gene, partial cds.
          Length = 297

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 44/187 (23%), Positives = 90/187 (48%), Gaps = 1/187 (0%)
 Frame = +3

Query: 417 DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEI 596
           D D  +S  ++K L+ + G+L   +  ++S E+ +R++++ + I++    ++ L     I
Sbjct: 65  DSDKEIS-LYDKILIFIVGNLIPYINDKISIEIPSRISFNYNLIIIYSKKIIYLCEKYGI 123

Query: 597 PPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRD 776
               +L KIP T  GI+A++ L+  GI+ ++T ++              +I  FVGR+ D
Sbjct: 124 NKSFILIKIPGTDSGIKAAKKLKEIGIEVNITLIFDINQVKKCFDYGIYLISPFVGRISD 183

Query: 777 WARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVD 956
                         +    D G   V   + Y +   +K+K+MAA+ RN   + ++   D
Sbjct: 184 -------------NIFCKYDSGVNFVKNIFIYKNNNNYKTKIMAASFRNINQIINLRFCD 230

Query: 957 YI-VTPL 974
            + ++P+
Sbjct: 231 CLTISPI 237



>sp|Q58370|TAL_METJA Probable transaldolase (EC
           2.2.1.2).>pir|H64419|H64419 transaldolase (EC 2.2.1.2) -
           Methanococcus jannaschii>gb:U67539_207069
           Methanocaldococcus jannaschii DSM 2661 section 81 of 150
           of the complete genome.>gb:L77117_1099827
           Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 217

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 50/175 (28%), Positives = 81/175 (46%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++ ++V G VS EV   ++ D  G+V +  +L KL + I I       KIP T  G++A 
Sbjct: 45  EICEIVEGPVSAEV---ISTDAEGMVKEARELAKLADNIVI-------KIPMTKDGMKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
           ++L AEGI+T++T V+S            + +  FVGRL D    H G   +E       
Sbjct: 95  KILSAEGIKTNVTLVFSPLQALVAAKAGATYVSPFVGRLDD--IGHVGMKLIED------ 146

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGVDYIVTPLKILQSL 992
                 V K Y     Y  K++++ A++R+   V     +G D    P  ++  L
Sbjct: 147 ------VVKIYK---NYDIKTEVIVASVRHPWHVLEAAKIGADIATMPPAVMDKL 192



>sp|Q88S98|TAL_LACPL Probable transaldolase (EC
           2.2.1.2).>gb:AL935262_552966 Lactobacillus plantarum
           strain WCFS1 complete genome; segment 11/11.
          Length = 217

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 46/175 (26%), Positives = 79/175 (45%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++ ++V G VS EV A  A +   ++ +  + +K  + I +       KIP T +G++A 
Sbjct: 45  EITQIVSGPVSAEVTATKAEE---MIAQARNEIKWASNIVV-------KIPMTEEGLKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
           ++L  EGI+T++T V+S            + I  F+GRL D   N               
Sbjct: 95  KVLSGEGIKTNVTLVFSVSQGLLAAKAGATYISPFLGRLDDIGGN--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
             G  LV      +  YG K++++AA++R  Q V   ++ G D    P  +   L
Sbjct: 140 --GIQLVKDLRQVLDTYGFKTEIIAASVRGPQHVQEAALAGADIATIPATVFGKL 192



>gb:AE017180_401266 Geobacter sulfurreducens PCA, complete genome.
          Length = 214

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 39/175 (22%), Positives = 82/175 (46%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++ ++V G +S EV   ++ +  G++ +  +L K++  I I       K+P T +G++A 
Sbjct: 45  EITEIVDGPISAEV---VSLEAAGMIREAGELAKIHKNIVI-------KLPMTPEGLKAC 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
             L  EGI+T++T +++            + +  FVGRL D +++               
Sbjct: 95  AALTREGIKTNVTLIFTPMQALLAAKAGATYVSPFVGRLDDISQD--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
             G  ++         YG++S+++ A++RN   V   +++G D    P  ++  L
Sbjct: 140 --GMGIIDDIKTIFDNYGYQSEIIVASVRNPVHVLNAALIGADIATIPYSVMLQL 192



>sp|O66520|TAL_AQUAE Probable transaldolase (EC
           2.2.1.2).>pir|E70311|E70311 transaldolase - Aquifex
           aeolicus>gb:AE000674_25871 Aquifex aeolicus VF5 section
           6 of 109 of the complete genome.>gb:AE000657_976402
           Aquifex aeolicus VF5 complete genome.
          Length = 217

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 46/175 (26%), Positives = 81/175 (46%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++ +LV G VS E    ++ D  G++ +   L +L        E ++ KIP T +G++A 
Sbjct: 45  EILELVDGPVSLET---VSLDAEGMIREGRMLAEL-------GENVVVKIPMTPEGLKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
             LE+EGI T++T V+S            S +  FVGRL D     SG+           
Sbjct: 95  IALESEGIPTNVTLVFSPTQALLAAKAGASYVSPFVGRLDD----ISGE----------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
             G  L+ +       Y   ++++ A++R+   V   +++G D    P K+++ L
Sbjct: 140 --GMKLIEEIKTIFSNYEFDTEIIVASVRHPMHVLESALIGADICTMPFKVMEQL 192



>sp|Q8R8S6|TAL_THETN Probable transaldolase (EC
            2.2.1.2).>gb:AE013142_289523 Thermoanaerobacter
            tengcongensis MB4, section 169 of 244 of the complete
            genome.>gb:AE008691_1111588 Thermoanaerobacter
            tengcongensis strain MB4, complete genome.
          Length = 216

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 45/181 (24%), Positives = 81/181 (44%), Gaps = 3/181 (1%)
 Frame = +3

Query: 474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
            ++A++V G +S EV   ++ D  G+V +  +L K++  I I       KIP T +G++A 
Sbjct: 45   EIAEIVDGPISAEV---ISDDHEGMVKEARELAKIHKNIVI-------KIPMTAEGLKAV 94

Query: 654  RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
             +L  EGI+T++T ++S            + +  FVGRL D                   
Sbjct: 95   NILSKEGIKTNVTLIFSANQALLAARAGATYVSPFVGRLDDI-----------------N 137

Query: 834  DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGVDYIVTPLKIL-QSLKESV 1004
              G  ++         Y  +++++ A++R+   V     LG      P K+L Q +K  +
Sbjct: 138  TDGMQIIEDIVTIFTNYDIQAEIITASVRHPIHVLEAAKLGAHIATVPYKVLMQMIKHPL 197

Query: 1005 T 1007
            T
Sbjct: 198  T 198



>sp|Q7MXG0|TAL_PORGI Probable transaldolase (EC
           2.2.1.2).>gb:AE017172_396600 Porphyromonas gingivalis
           W83 section 1 of 8 of the complete
           genome.>gb:AE015924_1032211 Porphyromonas gingivalis W83
           complete genome.
          Length = 220

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 44/174 (25%), Positives = 79/174 (45%), Gaps = 2/174 (1%)
 Frame = +3

Query: 477 LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR 656
           + ++V G VS EV   +A D  G++ +  +L  L+        +++ K+P T +GI+A +
Sbjct: 50  ICEIVDGDVSAEV---IATDYEGMIREGEELAALH-------PQIVVKVPCTAEGIKAIK 99

Query: 657 LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGED 836
               +GI+T+ T +++            S +  FVGRL D A +                
Sbjct: 100 YFSDKGIRTNCTLIFTVGQALLAAKAGASYVSPFVGRLDDIASD---------------- 143

Query: 837 PGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL--GVDYIVTPLKILQSL 992
            G  LV         Y ++++++AA+IR+ Q +   L  G D    PL  ++ L
Sbjct: 144 -GIKLVENIVAMFGFYRYETEVLAASIRHTQHIIQCLEAGADVATCPLNAIKGL 196



>sp|Q8XMJ6|TAL_CLOPE Probable transaldolase (EC
            2.2.1.2).>gb:BA000016_673732 Clostridium perfringens str.
            13 DNA, complete genome.
          Length = 215

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 3/190 (1%)
 Frame = +3

Query: 474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
            ++  +V G +S EV   +A +   +V +  +L K++  I I       KIP   +G++A 
Sbjct: 45   EICSIVDGPISAEV---MALECDEMVREGRELAKIHKNIVI-------KIPMCEEGLKAV 94

Query: 654  RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
            ++L +EGI+T++T ++S            S +  F+GRL D                   
Sbjct: 95   KVLASEGIRTNVTLIFSPLQALLAARAGASFVSPFLGRLDDIG----------------- 137

Query: 834  DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY-SILGVDYIVT-PLK-ILQSLKESV 1004
            +PG  +VT+       +G  +++++A++RN   V  S +   +I T P   ILQ +K  +
Sbjct: 138  NPGIEIVTQIAEMFALHGIDTEIISASVRNPMHVLDSAMAGSHIATIPYNVILQMVKHPL 197

Query: 1005 TPPDEKYSFE 1034
            T    K   E
Sbjct: 198  TDAGMKKFIE 207



>sp|Q97JD9|TAL_CLOAB Probable transaldolase (EC
           2.2.1.2).>pir|H97065|H97065 transaldolase, TAL
           [imported] - Clostridium
           acetobutylicum>gb:AE007646_228676 Clostridium
           acetobutylicum ATCC 824 section 134 of 356 of the
           complete genome.>gb:AE001437_1091631 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 215

 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 40/175 (22%), Positives = 83/175 (47%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++  +V G +S EV   +A D  G++ +  ++ K++       + ++ KIP T +G++A 
Sbjct: 45  EITSIVDGPISGEV---IALDAEGMIKEGREIAKIH-------KNMVVKIPMTEEGLKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
           ++L +EGI+T++T ++S            + +  F+GRL D   +  G            
Sbjct: 95  KVLSSEGIKTNVTLIFSAGQALLAARAGATFVSPFLGRLDDIGADSIG------------ 142

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
                L+    N    +  +++++AA+IR+ + V   +  G      P K+L+ L
Sbjct: 143 -----LIESIVNIFDIHDIRTEIIAASIRSPKHVIDSAEAGAHIGTVPYKVLKQL 192



>gb:BA000043_739962 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 213

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 42/175 (24%), Positives = 79/175 (45%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++  +V G VS EV   ++ D  G++ +  +L K+   I I       K+P T +G++A 
Sbjct: 45  EITSIVSGSVSAEV---ISTDAAGMIAEGEELAKIAPNITI-------KVPMTPEGLKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
           +    +GIQT++T V++            + +  F+GRL D   N               
Sbjct: 95  KAFSEKGIQTNVTLVFTANQALLAARAGATYVSPFLGRLDDIGHN--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSL 992
             G  L++      + +G +++++AA+IR+   V   ++ G      P K+L  L
Sbjct: 140 --GLELISTIAEIFNIHGIETEIIAASIRHPHHVTEAALRGAHIATVPYKVLMQL 192



>pir|G75407|G75407 transaldolase - Deinococcus radiodurans (strain
            R1)>gb:AE001980_41606 Deinococcus radiodurans R1 section
            117 of 229 of the complete chromosome
            1.>gb:AE000513_882501 Deinococcus radiodurans R1 complete
            chromosome 1.
          Length = 286

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 49/183 (26%), Positives = 87/183 (47%), Gaps = 4/183 (2%)
 Frame = +3

Query: 471  GDLAKLVPG-RVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE 647
            G++A+LVPG  +S EV A    D  G++ +  D+   +       ++++ K+P T  G++
Sbjct: 96   GEIAELVPGGAISAEVTA---LDAEGMIKEGKDVAAWH-------KQVVVKLPLTPAGLQ 145

Query: 648  ASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRR 827
            A + L +EGI+T++T  +S            + +  FVGR+ D                 
Sbjct: 146  ACKALTSEGIKTNVTLCFSVPQALLAARAGATYVSPFVGRVDD----------------T 189

Query: 828  GEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKIL-QSLKE 998
            G D GS L+ +          ++K++AA+IR+ Q V   ++ G D    P K+  Q +K 
Sbjct: 190  GWD-GSELIRQIKEAFVLGDIQTKVLAASIRHPQHVVQAALAGADVATIPYKVFTQMVKH 248

Query: 999  SVT 1007
             +T
Sbjct: 249  PLT 251



>sp|Q9RUP6|TAL_DEIRA Probable transaldolase (EC 2.2.1.2).
          Length = 234

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 49/183 (26%), Positives = 87/183 (47%), Gaps = 4/183 (2%)
 Frame = +3

Query: 471  GDLAKLVPG-RVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE 647
            G++A+LVPG  +S EV A    D  G++ +  D+   +       ++++ K+P T  G++
Sbjct: 44   GEIAELVPGGAISAEVTA---LDAEGMIKEGKDVAAWH-------KQVVVKLPLTPAGLQ 93

Query: 648  ASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRR 827
            A + L +EGI+T++T  +S            + +  FVGR+ D                 
Sbjct: 94   ACKALTSEGIKTNVTLCFSVPQALLAARAGATYVSPFVGRVDD----------------T 137

Query: 828  GEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKIL-QSLKE 998
            G D GS L+ +          ++K++AA+IR+ Q V   ++ G D    P K+  Q +K 
Sbjct: 138  GWD-GSELIRQIKEAFVLGDIQTKVLAASIRHPQHVVQAALAGADVATIPYKVFTQMVKH 196

Query: 999  SVT 1007
             +T
Sbjct: 197  PLT 199



>gb:BX897700_829428 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 217

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 45/181 (24%), Positives = 81/181 (44%), Gaps = 2/181 (1%)
 Frame = +3

Query: 456 LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW 635
           +++V  ++  L+ G VS EV A        I++K   +L          + +  K+P T 
Sbjct: 39  ILDVIKEICTLIEGPVSAEVAAT----EFEIIMKEAAILAKI------ADNICIKLPLTL 88

Query: 636 QGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEG 815
           +G++A + L A+G++T+LT  +S            + +  F+GRL D   N         
Sbjct: 89  EGLKACKALAAQGLKTNLTLCFSANQALLAAKAGATFVSPFIGRLDDCGIN--------- 139

Query: 816 ALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQS 989
                   GS L+ +       YG +++++AA+IR    V   ++ G D    P  IL++
Sbjct: 140 --------GSELLHEIRTIYDNYGFETQILAASIRTVNHVKEAALSGADVASVPPTILKA 191

Query: 990 L 992
           L
Sbjct: 192 L 192



>gb:BX897699_828117 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 218

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 44/171 (25%), Positives = 76/171 (44%), Gaps = 2/171 (1%)
 Frame = +3

Query: 486 LVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE 665
           +V G VS EV A           +  D++K    +    + +  K+P T+ G++A + L 
Sbjct: 50  VVHGPVSAEVAAT----------EFEDIMKEAAVLANIADNICIKLPLTFDGLKACKALT 99

Query: 666 AEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGS 845
           A+G++T+LT  +S            + I  FVGRL D+  N                 GS
Sbjct: 100 AQGLKTNLTLCFSANQALLAAKAGATFISPFVGRLDDYGIN-----------------GS 142

Query: 846 ALVTKAYNYIHKYGHKSKLMAAAIR--NKQDVYSILGVDYIVTPLKILQSL 992
            L+ +     + Y  +++++AA+IR  N     ++ G D    P  IL++L
Sbjct: 143 DLLHEIRTIYNNYSFETQILAASIRTINHVKEAALSGADVATIPPTILKAL 193



>gb:CP000031_87129 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 217

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 48/218 (22%), Positives = 92/218 (42%), Gaps = 9/218 (4%)
 Frame = +3

Query: 366 KSAVDTA----LADQECYGLEDKDARMSCFFNKA---LVNVGGDLAKLVPGRVSTEVDAR 524
           K  VDTA    +A+    G+ D          K+   ++ V  ++  +V G VS EV A 
Sbjct: 2   KFFVDTAEIDAIAELNDLGMVDGVTTNPSLIKKSGRDIIEVTREICAMVDGPVSAEVTAT 61

Query: 525 LAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
              D   ++ +   L+++   I +       K+P TW G++A ++L  +G   ++T  +S
Sbjct: 62  ---DAETMIAEGRKLVEIAGNIAV-------KVPLTWDGLKACKVLSDDGHMVNVTLCFS 111

Query: 705 FCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY 884
                       + I  F+GRL D   +                 G  L+         Y
Sbjct: 112 ANQALLAAKAGATFISPFIGRLDDINLD-----------------GMELIEDIRTIYDNY 154

Query: 885 GHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
           G +++++AA+IR+   +   + +G D I  P  +++++
Sbjct: 155 GFETQILAASIRSVNHILDSARIGADVITAPPAVIKAM 192



>sp|Q9K6E4|TAL_BACHD Probable transaldolase (EC
           2.2.1.2).>pir|A84123|A84123 transaldolase (pentose
           phosphate) BH3785 [imported] - Bacillus halodurans
           (strain C-125)>gb:BA000004_657731 Bacillus halodurans
           C-125 DNA, complete genome.
          Length = 212

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 42/177 (23%), Positives = 76/177 (42%), Gaps = 2/177 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++  LV G VS EV   +A D  G++ +  +L  +   I +       K+P T +G++A 
Sbjct: 45  EITSLVKGSVSAEV---VALDAEGMIKEGKELAAIAPNITV-------KVPMTTEGLKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
                EGI T++T V+S            + +  F+GRL D   +               
Sbjct: 95  HAFHQEGITTNVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHD--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSLKE 998
             G  L+++     H +    +++AA+IR+ Q V   ++ G      P K++  L +
Sbjct: 140 --GLDLISQIAEIFHVHDLDIQIIAASIRHPQHVTEAALRGAHIATIPFKVISQLSK 194



>sp|Q9A2F1|TAL_CAUCR Probable transaldolase (EC
           2.2.1.2).>pir|D87697|D87697 transaldolase family protein
           [imported] - Caulobacter crescentus>gb:AE006020_214739
           Caulobacter crescentus CB15 section 346 of 359 of the
           complete genome.>gb:AE005673_924638 Caulobacter
           crescentus CB15 complete genome.
          Length = 217

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 51/216 (23%), Positives = 88/216 (40%), Gaps = 6/216 (2%)
 Frame = +3

Query: 363 FKSAVDT-ALADQECYGLEDKDARMSCFFNKA---LVNVGGDLAKLVPGRVSTEVDARLA 530
           F  + DT  +AD    GL D          K+   ++ V  ++  +VPG +S EV A  A
Sbjct: 4   FLDSTDTKVIADLASTGLIDGVTTNPTLIAKSGRPMLEVIAEICDIVPGPISAEVAATTA 63

Query: 531 YDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFC 710
                ++ +   L K+   + +       KIP T  G+ A      E I+T++T  +S  
Sbjct: 64  ---DAMIAEGQKLAKIAPNVVV-------KIPLTRDGLIACAAFADEEIKTNVTLCFSPT 113

Query: 711 XXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGH 890
                     + I  F+GRL D+  +                 G  L+         YG+
Sbjct: 114 QALLAAKAGATYISPFIGRLDDYGFD-----------------GMDLIRDIRAIYDNYGY 156

Query: 891 KSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSL 992
           +++++AA++RN   V   +I+G D +  P  +   L
Sbjct: 157 ETEILAASVRNAAHVKEAAIVGADVVTIPPAVFSDL 192



>gb:BX842646_823100 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 1/11.
          Length = 215

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 42/175 (24%), Positives = 80/175 (45%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++ K + G VS EV   ++     +V +  +L KL + + +       KIP    G+ A 
Sbjct: 45  EICKEITGPVSAEV---ISLQHEEMVREGKELAKLASNVVV-------KIPMCEDGMIAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
           + L++EGI+T++T V+S            +++  FVGRL         D  VE       
Sbjct: 95  KKLKSEGIKTNVTLVFSPMQALLAAKAGATMVSPFVGRL--------DDIGVE------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
             G  +V +       Y  +++++ A++R+   +   + +G D    P K++QS+
Sbjct: 140 --GMQMVDQVIQMYRNYDFETEVLVASVRSPMHIQLAAEMGADIATIPFKVMQSM 192



>gb:AP006627_566197 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 216

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++AKLVPG VS EV   ++ D  G++ +   L  +        E +  K+P T  G++A 
Sbjct: 45  EIAKLVPGSVSAEV---ISLDAEGMIEEGKTLAAI-------SENITVKVPMTVDGLKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
           +     GI+T++T ++S            + +  F+GRL D   +               
Sbjct: 95  KAFAELGIKTNVTLIFSVPQALLAARAGATYVSPFLGRLDDIGHD--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL--GVDYIVTPLKILQSL 992
             G  L++   +    +G  ++++AA++R+   V      G      PL +++ L
Sbjct: 140 --GLQLISDIADIFSTHGLPTQIIAASVRHPVHVSEAAKRGAHIATIPLNVIKQL 192



>gb:AP006618_559971 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 380

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 37/111 (33%), Positives = 50/111 (45%)
 Frame = +3

Query: 372 AVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIV 551
           A   A AD     +   D R +C     +    G L     GRVS EVD R A+D    V
Sbjct: 69  AAQGADADAAIRTITTDDVREACDVLAPVYEATGGL----DGRVSIEVDPRFAFDADKTV 124

Query: 552 LKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
            +  DL K      +    L  KIPAT +G+ A   + AEGI  ++T ++S
Sbjct: 125 AQAVDLWKT-----VDRPNLFIKIPATEEGLPAITAVIAEGISVNVTLIFS 170



>gb:AE017331_445146 Listeria monocytogenes str. 4b F2365, section 10
            of 10 of the complete genome.>gb:AE017262_1077502
            Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 214

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 41/181 (22%), Positives = 79/181 (43%), Gaps = 3/181 (1%)
 Frame = +3

Query: 474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
            ++  +V G +S EV   ++ +   ++ +   + K++         ++ KIP T +G+ A 
Sbjct: 45   EITSIVDGPISGEV---VSLEADEMIAEGRVIAKIH-------PNMVVKIPMTGEGLAAV 94

Query: 654  RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
            ++L  EGI+T++T V+S            + +  F+GRL D                   
Sbjct: 95   KVLTEEGIKTNVTLVFSATQALLAARAGATYVSPFLGRLDDIG----------------- 137

Query: 834  DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGVDYIVTPLKIL-QSLKESV 1004
            D G  L+    +    YG  +++++A++R+   V      G D    P K+  Q LK  +
Sbjct: 138  DDGLVLIRDIADIFEIYGIPTEIISASVRHPIHVIECAKAGADIATVPFKVFEQMLKHPL 197

Query: 1005 T 1007
            T
Sbjct: 198  T 198



>sp|Q8FYQ9|TAL_BRUSU Probable transaldolase (EC
           2.2.1.2).>gb:AE014291_309214 Brucella suis 1330
           chromosome I, complete sequence.
          Length = 217

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 39/181 (21%), Positives = 75/181 (41%), Gaps = 2/181 (1%)
 Frame = +3

Query: 456 LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW 635
           ++ V  ++  +V G VS EV A           +   ++K    I    + +  K+P T 
Sbjct: 39  IIEVTKEICNIVKGPVSAEVAAT----------EYEQMMKEAAVIARIADNICIKLPVTL 88

Query: 636 QGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEG 815
            G++A + L +EG + ++T  +S            + I  F+GRL D   N         
Sbjct: 89  DGLKACKALTSEGHKVNMTLCFSANQALLAAKAGATFISPFIGRLDDTGIN--------- 139

Query: 816 ALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQS 989
                   G  L+ +       Y  +++++AA++R    V   +++G D +  P   L++
Sbjct: 140 --------GMELIAEIRTIYDNYDFRTEILAASVRTVNHVKEAALIGADVVTAPPATLKA 191

Query: 990 L 992
           L
Sbjct: 192 L 192



>sp|Q8YJ42|TAL_BRUME Probable transaldolase (EC
           2.2.1.2).>pir|AG3282|AG3282 transaldolase (EC 2.2.1.2)
           [imported] - Brucella melitensis  (strain
           16M)>gb:AE009467_252163 Brucella melitensis 16M
           chromosome I, section 24 of 195 of the complete
           sequence.>gb:AE008917_978075 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 217

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 39/181 (21%), Positives = 75/181 (41%), Gaps = 2/181 (1%)
 Frame = +3

Query: 456 LVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATW 635
           ++ V  ++  +V G VS EV A           +   ++K    I    + +  K+P T 
Sbjct: 39  IIEVTKEICNIVKGPVSAEVAAT----------EYEQMMKEAAVIARIADNICIKLPVTL 88

Query: 636 QGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEG 815
            G++A + L +EG + ++T  +S            + I  F+GRL D   N         
Sbjct: 89  DGLKACKALTSEGHKVNMTLCFSANQALLAAKAGATFISPFIGRLDDTGIN--------- 139

Query: 816 ALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQS 989
                   G  L+ +       Y  +++++AA++R    V   +++G D +  P   L++
Sbjct: 140 --------GMELIAEIRTIYDNYDFRTEILAASVRTVNHVKEAALIGADVVTAPPATLKA 191

Query: 990 L 992
           L
Sbjct: 192 L 192



>sp|Q927A3|TAL1_LISIN Probable transaldolase 1 (EC
            2.2.1.2).>pir|AH1792|AH1792 transaldolase homolog lin2886
            [imported] - Listeria innocua  (strain
            Clip11262)>gb:AL596173_540226 Listeria innocua Clip11262
            complete genome, segment 11/12.
          Length = 214

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 6/184 (3%)
 Frame = +3

Query: 474  DLAKLVPGRVSTEV---DARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGI 644
            ++  +V G +S EV   +A    +   ++ K+H               ++ KIP T +G+
Sbjct: 45   EITSIVDGPISGEVVSLNAEEMIEEGRVIAKIHP-------------NMVVKIPMTGEGL 91

Query: 645  EASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALR 824
             A ++L  EGI+T++T V+S            + +  F+GRL D                
Sbjct: 92   AAVKVLTEEGIKTNVTLVFSATQALLAARAGATYVSPFLGRLDDIG-------------- 137

Query: 825  RGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGVDYIVTPLKIL-QSLK 995
               D G  L+         +G  +++++A++R+   V      G D    P K+  Q LK
Sbjct: 138  ---DDGLVLIRDIAEIFETHGIPTEIISASVRHPIHVIECAKAGADIATVPYKVFEQMLK 194

Query: 996  ESVT 1007
              +T
Sbjct: 195  HPLT 198



>gb:AE017231_411882 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 5 of 16 of the complete
           genome.>gb:AE016958_1055286 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 373

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 29/72 (40%), Positives = 40/72 (55%)
 Frame = +3

Query: 489 VPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEA 668
           V GRVS EVD RLA DT   + +  +L K+     +    L  KIPAT  G+ A   + A
Sbjct: 105 VDGRVSIEVDPRLAGDTDKTIAQAVELWKI-----VDRPNLFIKIPATQAGLPAITAVLA 159

Query: 669 EGIQTHLTFVYS 704
           EGI  ++T ++S
Sbjct: 160 EGISVNVTLIFS 171



>sp|O06812|TAL_MYCTU Transaldolase (EC 2.2.1.2).>pir|C70917|C70917
           probable tal protein - Mycobacterium tuberculosis
           (strain H37RV)>gb:BX842576_819512 Mycobacterium
           tuberculosis H37Rv complete genome; segment 5/13.
          Length = 373

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +3

Query: 489 VPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEA 668
           V GRVS EVD RLA++T   + +  +L K+     +    L  KIPAT  G+ A   + A
Sbjct: 105 VDGRVSIEVDPRLAHETEKTIQQAIELWKI-----VDRPNLFIKIPATKAGLPAISAVLA 159

Query: 669 EGIQTHLTFVYS 704
           EGI  ++T ++S
Sbjct: 160 EGISVNVTLIFS 171



>sp|P59955|TAL_MYCBO Transaldolase (EC 2.2.1.2).>gb:AE000516_21531
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248339_758839 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment 6/14.
          Length = 373

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = +3

Query: 489 VPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEA 668
           V GRVS EVD RLA++T   + +  +L K+     +    L  KIPAT  G+ A   + A
Sbjct: 105 VDGRVSIEVDPRLAHETEKTIQQAIELWKI-----VDRPNLFIKIPATKAGLPAISAVLA 159

Query: 669 EGIQTHLTFVYS 704
           EGI  ++T ++S
Sbjct: 160 EGISVNVTLIFS 171



>gb:BX251411_764626 Tropheryma whipplei TW08/27, complete genome;
           segment 2/3.
          Length = 364

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 29/75 (38%), Positives = 40/75 (53%)
 Frame = +3

Query: 480 AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
           +K + GRVS EVD  LAYDT G    V  + +  N        L  KIPAT +G+EA   
Sbjct: 99  SKGIDGRVSIEVDPTLAYDTEGTFRSVKSIWESIN-----KPNLYVKIPATREGLEAISQ 153

Query: 660 LEAEGIQTHLTFVYS 704
             A G+  ++T ++S
Sbjct: 154 SIASGVCVNVTLIFS 168



>gb:AE016851_348865 Tropheryma whipplei str. Twist, section 2 of 3
           of the complete genome.>gb:AE014184_1029061 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 370

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 29/75 (38%), Positives = 40/75 (53%)
 Frame = +3

Query: 480 AKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRL 659
           +K + GRVS EVD  LAYDT G    V  + +  N        L  KIPAT +G+EA   
Sbjct: 105 SKGIDGRVSIEVDPTLAYDTEGTFRSVKSIWESIN-----KPNLYVKIPATREGLEAISQ 159

Query: 660 LEAEGIQTHLTFVYS 704
             A G+  ++T ++S
Sbjct: 160 SIASGVCVNVTLIFS 174



>gb:AE017355_464462 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 222

 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 2/166 (1%)
 Frame = +3

Query: 501 VSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQ 680
           VS EV    A     ++ +  +L+K+  G     E++  K+P T  G+EA R L  +G++
Sbjct: 56  VSAEVTPD-AVTAEEMIAQAEELIKINGG----DEKVTIKLPMTLAGLEACRYLTEKGVK 110

Query: 681 THLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTK 860
           T++T +++            + +  F+GRL D +                 + G  LV K
Sbjct: 111 TNVTLIFTVNQALLAARAGATYVSPFLGRLDDIS-----------------EDGVLLVAK 153

Query: 861 AYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSL 992
                  +   ++++AA++R+   V   ++ G      P K+++ L
Sbjct: 154 IAELFDVHQLDTQIIAASVRHPDHVTRVAMAGAHIATIPYKVIEQL 199



>sp|P55193|TAL_MYCLE Transaldolase (EC 2.2.1.2).>pir|T11020|T11020
           transaldolase - Mycobacterium leprae>gb:MLCL536_145507
           Mycobacterium leprae cosmid L536.>gb:MLEPRTN3_146382
           Mycobacterium leprae strain TN complete genome; segment
           3/10.
          Length = 375

 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 27/70 (38%), Positives = 40/70 (57%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           GRVS EVD RLA+DT   + +  +L ++     +    L  KIPAT  G+ A   + AEG
Sbjct: 109 GRVSIEVDPRLAHDTDKTIAQAVELWRI-----VDHPNLFIKIPATKAGLPAITAVLAEG 163

Query: 675 IQTHLTFVYS 704
           I  ++T ++S
Sbjct: 164 ISVNVTLIFS 173



>sp|Q81MY9|TAL2_BACAN Probable transaldolase 2 (EC
           2.2.1.2).>gb:AE017034_383442 Bacillus anthracis str.
           Ames section 11 of 18 of the complete
           genome.>gb:AE017225_408563 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017275_424616 Bacillus
           cereus ATCC 10987, section 12 of 18 of the complete
           genome.>gb:AE017334_453289 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:CP000001_853687 Bacillus
           cereus ZK, complete genome.>gb:AE016879_1013147 Bacillus
           anthracis str. Ames complete genome.>gb:AE017194_1063035
           Bacillus cereus ATCC 10987, complete genome.
          Length = 222

 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 2/166 (1%)
 Frame = +3

Query: 501 VSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQ 680
           VS EV    A     ++ +  +L+K+  G     E++  K+P T  G+EA R L  +G++
Sbjct: 56  VSAEVTPD-AVTAEEMIAQAEELIKINGG----DEKVTIKLPMTLAGLEACRYLTEKGVK 110

Query: 681 THLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTK 860
           T++T +++            + +  F+GRL D +                 + G  LV K
Sbjct: 111 TNVTLIFTVNQALLAARAGATYVSPFLGRLDDIS-----------------EDGVLLVAK 153

Query: 861 AYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSL 992
                  +   ++++AA++R+   V   ++ G      P K+++ L
Sbjct: 154 IAELFDVHQLDTQIIAASVRHPDHVTRVAMAGAHIATIPYKVIEQL 199



>sp|Q8KGF8|TAL_CHLTE Probable transaldolase (EC
           2.2.1.2).>gb:AE012780_285500 Chlorobium tepidum TLS
           section 1 of 194 of the complete
           genome.>gb:AE006470_932668 Chlorobium tepidum TLS
           complete genome.
          Length = 222

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 38/174 (21%), Positives = 72/174 (41%), Gaps = 2/174 (1%)
 Frame = +3

Query: 477 LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR 656
           + ++V G VS EV            LK  +++     +    + ++ K P T  G++A +
Sbjct: 54  ICEIVDGPVSAEVTT----------LKAGEMIAQGEELAAIHKNIVVKCPLTVDGLKAIK 103

Query: 657 LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGED 836
              + GI+T+ T V+S              +  FVGRL D + +                
Sbjct: 104 HFSSNGIKTNATLVFSPTQALLAAKAGADFVSPFVGRLDDISTS---------------- 147

Query: 837 PGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDYIVTPLKILQSL 992
            G  LV +       YG+ ++++ A++RN   V   +++G D    P  +++ L
Sbjct: 148 -GMELVRQIVTIYDNYGYLTEVIVASVRNPLHVVESAMVGADIATIPYSVIKQL 200



>sp|Q8Y3T8|TAL1_LISMO Probable transaldolase 1 (EC
            2.2.1.2).>pir|AF1417|AF1417 transaldolase homolog lmo2743
            [imported] - Listeria monocytogenes (strain
            EGD-e)>gb:AL591984_537233 Listeria monocytogenes strain
            EGD, complete genome, segment 12/12.
          Length = 214

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 40/181 (22%), Positives = 79/181 (43%), Gaps = 3/181 (1%)
 Frame = +3

Query: 474  DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
            ++  +V G +S EV   ++ +   ++ +   + K++         ++ KIP T +G+ A 
Sbjct: 45   EITSIVDGPISGEV---VSLEADEMIAEGRVIAKIH-------PNMVVKIPMTGEGLAAV 94

Query: 654  RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
            ++L  EGI+T++T V+S            + +  F+GRL D                   
Sbjct: 95   KVLTEEGIKTNVTLVFSATQALLAARAGATYVSPFLGRLDDIG----------------- 137

Query: 834  DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGVDYIVTPLKIL-QSLKESV 1004
            D G  L+    +    +G  +++++A++R+   V      G D    P K+  Q LK  +
Sbjct: 138  DDGLVLIRDIADIFEIHGIPTEIISASVRHPIHVIECAKAGADIATVPFKVFEQMLKHPL 197

Query: 1005 T 1007
            T
Sbjct: 198  T 198



>gb:AF417540_509429 Bifidobacterium infantis strain ATCC 15702
           transaldolase gene, complete cds.
          Length = 367

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 28/72 (38%), Positives = 40/72 (55%)
 Frame = +3

Query: 489 VPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEA 668
           V GRVS EVD RLA+DT   V +  +L +  N         + KIPAT +G+ A  +  A
Sbjct: 100 VDGRVSIEVDPRLAHDTENTVKQAVELWEKVN-----RPNAMIKIPATLEGLPAITVTLA 154

Query: 669 EGIQTHLTFVYS 704
           +GI +  T ++S
Sbjct: 155 KGISSTFTLIFS 166



>sp|Q8E3B1|TAL_STRA3 Probable transaldolase (EC
           2.2.1.2).>sp|Q8DXP1|TAL_STRA5 Probable transaldolase (EC
           2.2.1.2).>gb:SAG766853_171378 Streptococcus agalactiae
           NEM316 complete genome, segment 11.>gb:AE014274_307105
           Streptococcus agalactiae 2603V/R section 84 of 100 of
           the complete genome.>gb:AE009948_937218 Streptococcus
           agalactiae 2603V/R complete genome.
          Length = 215

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 43/175 (24%), Positives = 72/175 (41%), Gaps = 2/175 (1%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++ ++V G VS EV      +   +V +  ++ K    + +       KIP T +G+ A 
Sbjct: 45  EICQIVDGPVSAEVTGLTCDE---MVTEAREIAKWSPNVVV-------KIPMTEEGLAAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
             L  EGI+T++T +++            + I  FVGRL D   +               
Sbjct: 95  SQLSKEGIKTNVTLIFTVAQGLSAMKAGATFISPFVGRLEDIGTD--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGVDYIVTPLKILQSL 992
               AL+    + I  YG +S+++AA+IR    V  +   G      P K   SL
Sbjct: 140 --AYALIRDLRHIIDFYGFQSEIIAASIRGLAHVEGVAKCGAHIATIPDKTFASL 192



>gb:AF087301_478162 Chlamydia trachomatis 344 transaldolase (tal)
           gene, partial cds.
          Length = 76

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = +3

Query: 621 IPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDW 779
           IP TW+GI A+ +LE++GI  ++T +++            +++  FVGR+ DW
Sbjct: 1   IPGTWEGICAAEVLESQGIACNVTLIFNSVQAIAAAKAKVTLVSPFVGRIYDW 53



>sp|Q99YJ2|TAL_STRPY Probable transaldolase (EC
           2.2.1.2).>gb:AE006598_220560 Streptococcus pyogenes M1
           GAS, section 127 of 167 of the complete
           genome.>gb:AE010080_259112 Streptococcus pyogenes strain
           MGAS8232, section 128 of 173 of the complete
           genome.>gb:AE014164_304940 Streptococcus pyogenes
           MGAS315, section 29 of 37 of the complete
           genome.>gb:BA000034_713327 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:CP000003_861349 Streptococcus
           pyogenes MGAS10394, complete genome.>gb:AE009949_905494
           Streptococcus pyogenes strain MGAS8232, complete
           genome.>gb:AE014074_928119 Streptococcus pyogenes
           MGAS315, complete genome.>gb:AE004092_1106406
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 214

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 34/157 (21%), Positives = 69/157 (43%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++  +V G +S EV    A     +V +   + K ++ + +       KIP T +G++A+
Sbjct: 45  EICDIVDGPISAEVTGLTA---DAMVEEARSIAKWHDNVVV-------KIPMTTEGLKAT 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
            +L  EGI+T++T +++            + I  F+GRL D   +               
Sbjct: 95  NILSKEGIKTNVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTD--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI 944
                L++     I  Y  +++++AA+IR    V ++
Sbjct: 140 --AYQLISDLREIIDLYDFQAEIIAASIRTTAHVEAV 174



>gb:AE014295_311109 Bifidobacterium longum NCC2705, complete genome.
          Length = 367

 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/72 (37%), Positives = 39/72 (54%)
 Frame = +3

Query: 489 VPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEA 668
           V GRVS EVD RLA+DT     +  +L +  N         + KIPAT +G+ A     A
Sbjct: 100 VDGRVSIEVDPRLAHDTENTAKQAVELWEKVN-----RPNAMIKIPATLEGLPAITATLA 154

Query: 669 EGIQTHLTFVYS 704
           +GI  ++T ++S
Sbjct: 155 KGISVNVTLIFS 166



>sp|Q92EU7|TAL2_LISMO Probable transaldolase 2 (EC
           2.2.1.2).>pir|AH1117|AH1117 transaldolase homolog
           lmo0343 [imported] - Listeria monocytogenes (strain
           EGD-e)>pir|AB1478|AB1478 transaldolase homolog lin0361
           [imported] - Listeria innocua  (strain
           Clip11262)>gb:AE017323_442800 Listeria monocytogenes
           str. 4b F2365, section 2 of 10 of the complete
           genome.>gb:AL591975_534835 Listeria monocytogenes strain
           EGD, complete genome, segment 3/12.>gb:AL596164_537708
           Listeria innocua Clip11262 complete genome, segment
           2/12.>gb:AE017262_1075156 Listeria monocytogenes str. 4b
           F2365, complete genome.
          Length = 218

 Score = 45.4 bits (106), Expect = 0.003
 Identities = 36/150 (24%), Positives = 66/150 (44%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           ++  +V G VS EV   +  +   +V +   L K    + +       KIP T +G++A 
Sbjct: 45  EICSIVDGPVSAEV---IGLEADKMVEEARILAKWAPNVVV-------KIPMTEEGLKAV 94

Query: 654 RLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGE 833
             L AEGI+T++T +++            + I  F+GRL D   +               
Sbjct: 95  HTLTAEGIKTNVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTD--------------- 139

Query: 834 DPGSALVTKAYNYIHKYGHKSKLMAAAIRN 923
             G  L+      +  YG K+++++A+IR+
Sbjct: 140 --GMILIKNLKKVLDNYGLKAEIISASIRH 167



>sp|Q81B21|TAL2_BACCR Probable transaldolase 2 (EC
           2.2.1.2).>gb:AE017009_378267 Bacillus cereus ATCC 14579
           section 12 of 18 of the complete
           genome.>gb:AE016877_1018517 Bacillus cereus ATCC 14579
           complete genome.
          Length = 222

 Score = 45.1 bits (105), Expect = 0.004
 Identities = 36/166 (21%), Positives = 72/166 (43%), Gaps = 2/166 (1%)
 Frame = +3

Query: 501 VSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQ 680
           VS EV    A     ++ +  +L+K+  G     + +  K+P T  G+EA R L  +G++
Sbjct: 56  VSAEVTPD-AVTAEEMIAQAEELIKINGG----DKNVTIKLPMTLAGLEACRYLTEKGVK 110

Query: 681 THLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTK 860
           T++T +++            + +  F+GRL D +                 + G  LV K
Sbjct: 111 TNVTLIFTVNQALLAARAGATYVSPFLGRLDDIS-----------------EDGVLLVAK 153

Query: 861 AYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSL 992
                  +   ++++AA++R+   V   ++ G      P K+++ L
Sbjct: 154 IAELFDVHQLDTQIIAASVRHPDHVTRVAMAGAHIATIPYKVIEQL 199



>gb:HUMTALH_2036816 Homo sapiens transaldolase (TALH) gene, exons 2
           and 3 and partial cds.
          Length = 78

 Score = 44.7 bits (104), Expect = 0.005
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = +3

Query: 288 EKFPPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNV 467
           +++ P  AT + SL+L    +P   ++  V+ A+A     G   +D ++    +K  V  
Sbjct: 3   DEYKPQDATTNPSLILAAAQMP--AYQELVEEAIAYGRKLGGSQED-QIKNAIDKLFVLF 59

Query: 468 GGDLAKLVPGRVSTEVDAR 524
           G ++ K +PGRVSTEVDAR
Sbjct: 60  GAEILKKIPGRVSTEVDAR 78



>gb:AP008226_578523 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 223

 Score = 44.7 bits (104), Expect = 0.005
 Identities = 41/174 (23%), Positives = 75/174 (43%), Gaps = 2/174 (1%)
 Frame = +3

Query: 477 LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR 656
           + + V G VS EV A    +   +V +   L  ++  I +       K+P T +G++A +
Sbjct: 55  ICETVGGPVSAEVTA---LEAEAMVAEGRRLAAIHPNIVV-------KLPTTEEGLKACK 104

Query: 657 LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGED 836
            L AEGI+ ++T ++S            S +  F+GR+ D + +                
Sbjct: 105 RLSAEGIKVNMTLIFSANQALLAARAGASYVSPFLGRVDDISWD---------------- 148

Query: 837 PGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSL 992
            G  L+ +    I       K++AA+IR+ + V   ++LG D    P  + + L
Sbjct: 149 -GGELLREIVEMIQVQDLPVKVIAASIRHPRHVTEAALLGADIATMPHAVFKQL 201



>gb:AE017303_436341 Thermus thermophilus HB27 section 3 of 7 of the
           complete genome.>gb:AE017221_1078319 Thermus
           thermophilus HB27 complete genome.
          Length = 223

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 2/174 (1%)
 Frame = +3

Query: 477 LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR 656
           + + V G VS EV A    +   +V +   L  ++        +++ K+P T +G++A +
Sbjct: 55  ICETVGGPVSAEVTA---LEAEAMVAEGRRLAAIH-------PQIVVKLPTTEEGLKACK 104

Query: 657 LLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGED 836
            L AEGI+ ++T ++S            S +  F+GR+ D + +                
Sbjct: 105 RLSAEGIRVNMTLIFSANQALLAARAGASYVSPFLGRVDDISWD---------------- 148

Query: 837 PGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDV--YSILGVDYIVTPLKILQSL 992
            G  L+ +    I       K++AA+IR+ + V   ++LG D    P  + + L
Sbjct: 149 -GGELLREIVEMIQVQDLPVKVIAASIRHPRHVTEAALLGADIATMPHAVFKQL 201



>gb:CP000009_863688 Gluconobacter oxydans 621H, complete genome.
          Length = 957

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 40/155 (25%), Positives = 66/155 (42%), Gaps = 12/155 (7%)
 Frame = +3

Query: 423 DARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPP 602
           D R +C    A+++   +  K + G VS EV   LA+D HG + +   L K      +  
Sbjct: 97  DIRSAC----AVLDPVFEKTKGLDGYVSLEVSPYLAFDAHGTITEARRLWKA-----VGR 147

Query: 603 ERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWA 782
             L+ KIP T +G  A R   A+GI  ++T ++S            S ++  V R  + +
Sbjct: 148 PNLMIKIPGTVEGTGAIREAIADGINVNVTLLFSLDAYKAVLEAYISGLEARVARGEEIS 207

Query: 783 RNHSG------------DSEVEGALRRGEDPGSAL 851
           R  S             D+E++  +  G+    AL
Sbjct: 208 RISSVASFFVSRIDAKIDAEIDRRVAAGDPEAEAL 242



>gb:BA000040_735018 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 949

 Score = 43.1 bits (100), Expect = 0.014
 Identities = 29/79 (36%), Positives = 41/79 (51%)
 Frame = +3

Query: 468 GGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIE 647
           GGD      G VS EV   LA DT G V +   L K     ++  + L+ K+PAT +G+ 
Sbjct: 101 GGD------GYVSLEVSPYLAMDTTGTVAEARRLWK-----DVNRKNLMVKVPATPEGLP 149

Query: 648 ASRLLEAEGIQTHLTFVYS 704
           A   L  EGI  ++T ++S
Sbjct: 150 AIETLIGEGISINITLLFS 168



>gb:AE017342_1755171 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 379

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 33/136 (24%), Positives = 61/136 (44%)
 Frame = +3

Query: 297 PPTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGD 476
           P  A  ++S+ LL    L + + K  V+  + + +     D    ++  F K ++     
Sbjct: 34  PIKAHDMTSNQLLTDEQLKNPENKELVEKTIRELKGANWFDVQTVLTARFAKRVI----- 88

Query: 477 LAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASR 656
               + GRV  +     A+D   I+       K +    I  +R   K+PAT  G++A++
Sbjct: 89  --PYIQGRVLAQTTPTKAFDKDAIISHARAYDKAFQAEGISRDRYCVKVPATTAGVQAAK 146

Query: 657 LLEAEGIQTHLTFVYS 704
           +L  EGI+T  T ++S
Sbjct: 147 ILNEEGIRTLGTSLFS 162



>gb:BX248357_762580 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 4/8.
          Length = 360

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 1/116 (0%)
 Frame = +3

Query: 360 KFKSAVDTALADQECYGLEDKDARMSC-FFNKALVNVGGDLAKLVPGRVSTEVDARLAYD 536
           K K+A   A AD   Y +   D R +C  F++      G       GRVS EVD R++ D
Sbjct: 64  KLKAA--QADADSAVYAMSIDDVRAACDVFSEIYAESEGK-----DGRVSIEVDPRISED 116

Query: 537 THGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
               + +  +L   +N +  P   ++ KIPAT   + A     AEGI  ++T ++S
Sbjct: 117 RDATISQAREL---WNKVNRP--NVMIKIPATRGSLPAITDALAEGISVNVTLIFS 167



>gb:BA000045_743452 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 373

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 10/133 (7%)
 Frame = +3

Query: 336 GICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKL--------- 488
           G+ S P    K+ V +A  D++  G  ++   +   +   +V    D A L         
Sbjct: 42  GLTSNPAIFEKAIVGSAAYDEQIRG--ERGQSVDAVYENLVVKDIQDAADLFRPLYESSE 99

Query: 489 -VPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLE 665
              G VS EV   LA DT G + + H L +      +    L+ K+P T +GI A   L 
Sbjct: 100 GADGYVSLEVSPYLARDTEGTIREAHHLWE-----RVGRPNLMIKVPGTAEGIPAIEALI 154

Query: 666 AEGIQTHLTFVYS 704
           A GI  ++T +++
Sbjct: 155 AAGINVNVTLLFA 167



>gb:CP000027_80378 Dehalococcoides ethenogenes 195, complete genome.
          Length = 216

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 35/147 (23%), Positives = 61/147 (41%), Gaps = 2/147 (1%)
 Frame = +3

Query: 564 DLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXS 743
           ++LK    I      ++ KIPAT +G+E    L  EG++ ++T  +S            +
Sbjct: 67  EMLKQAREIAKWAPNVVVKIPATAEGLEIISKLSKEGVRFNMTLCFSVNQALLGALAGAA 126

Query: 744 VIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRN 923
            +  FVGRL D                 G D G  L+    +   +YG +++++AA+IR+
Sbjct: 127 FVSPFVGRLDD----------------AGHD-GMMLINDIVSIYKEYGFETQVIAASIRH 169

Query: 924 KQDVYSI--LGVDYIVTPLKILQSLKE 998
                     G      P K+L  + +
Sbjct: 170 PLHCTQAAQTGAGIATVPYKVLMQMMQ 196



>gb:AB106333_13200 Gluconobacter oxydans tkt, tal-pgi, gnd genes for
           transketolase, transaldolase and glucose-6-phosphate
           isomerase bifunctional protein, 6-phosphogluconate
           dehydrogenase, complete cds.
          Length = 957

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 34/121 (28%), Positives = 55/121 (45%)
 Frame = +3

Query: 423 DARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPP 602
           D R +C    A+++   +  K + G VS EV   LA+D HG + +   L K      +  
Sbjct: 97  DIRSAC----AVLDPVFEKTKGLDGYVSLEVSPYLAFDAHGTITEERRLWKA-----VGR 147

Query: 603 ERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWA 782
             L+ KIP T +G  A R   A+GI  ++T ++S            S ++  V R  + +
Sbjct: 148 PNLMIKIPGTVEGTGAIREAIADGINANVTLLFSLDAYKAVLEAYISGLEARVARGEEIS 207

Query: 783 R 785
           R
Sbjct: 208 R 208



>gb:AE016822_340236 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 381

 Score = 42.4 bits (98), Expect = 0.024
 Identities = 31/96 (32%), Positives = 45/96 (46%)
 Frame = +3

Query: 417 DKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEI 596
           D  A  S  F+      GG     V GRVS EV+  LA+D    + +   L       ++
Sbjct: 90  DDVADASDIFHDVYTATGG-----VDGRVSIEVEPGLAHDAAATIAEAKRL-----AAKV 139

Query: 597 PPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
               +L KIPAT +G+EA     A GI  ++T ++S
Sbjct: 140 DRPNVLIKIPATVEGLEAITETIAAGISVNVTLIFS 175



>sp|O88018|TAL1_STRCO Transaldolase 1 (EC
           2.2.1.2).>pir|T35161|T35161 transaldolase - Streptomyces
           coelicolor>gb:SCO939128_180329 Streptomyces coelicolor
           A3(2) complete genome; segment 25/29.
          Length = 381

 Score = 42.4 bits (98), Expect = 0.024
 Identities = 26/70 (37%), Positives = 37/70 (52%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           GRVS EVD RLA+DT   V +   L  L     +    ++ KIPAT  G+ A   +   G
Sbjct: 113 GRVSIEVDPRLAHDTAATVAEARQLSWL-----VDRPNVMIKIPATKAGLPAITEVIGAG 167

Query: 675 IQTHLTFVYS 704
           I  ++T ++S
Sbjct: 168 ISVNVTLIFS 177



>gb:BA000030_699654 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 378

 Score = 42.0 bits (97), Expect = 0.031
 Identities = 25/70 (35%), Positives = 37/70 (52%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           GRVS EVD RLA+DT   + +   L  L     +    ++ KIPAT  G+ A   +   G
Sbjct: 110 GRVSIEVDPRLAHDTEATIAEAKQLAWL-----VDRPNVMIKIPATKAGLPAITEVIGLG 164

Query: 675 IQTHLTFVYS 704
           I  ++T ++S
Sbjct: 165 ISVNVTLIFS 174



>gb:AX973017_1488326 Sequence 3820 from Patent EP1104808.
          Length = 86

 Score = 41.6 bits (96), Expect = 0.041
 Identities = 23/65 (35%), Positives = 38/65 (58%)
 Frame = +3

Query: 363 FKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTH 542
           ++  V+ A+A     G   +D ++    +K  V  G ++ K +PGRVSTEVDARL++D  
Sbjct: 4   YQELVEEAIAYGRKLGGSQED-QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKD 62

Query: 543 GIVLK 557
            +V +
Sbjct: 63  AMVAR 67



>gb:AX973016_1488325 Sequence 3819 from Patent EP1104808.
          Length = 86

 Score = 41.6 bits (96), Expect = 0.041
 Identities = 23/65 (35%), Positives = 38/65 (58%)
 Frame = +3

Query: 363 FKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTH 542
           ++  V+ A+A     G   +D ++    +K  V  G ++ K +PGRVSTEVDARL++D  
Sbjct: 4   YQELVEEAIAYGRKLGGSQED-QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKD 62

Query: 543 GIVLK 557
            +V +
Sbjct: 63  AMVAR 67



>gb:AE017283_430238 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 358

 Score = 41.2 bits (95), Expect = 0.053
 Identities = 40/176 (22%), Positives = 65/176 (36%), Gaps = 17/176 (9%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           GR+S + D RL  D   +  +  +   L   I       + KIP T  GIEA       G
Sbjct: 107 GRLSIQTDPRLHRDAKALADQAEEFSNLAPNI-------IVKIPCTSVGIEAIEEATYRG 159

Query: 675 IQTHLTFVYSFCXXXXXXXX-----------------XXSVIQIFVGRLRDWARNHSGDS 803
           +  ++T  ++                              V+ I  GRL DW +  +   
Sbjct: 160 VSVNVTVSFTVPQAVKSAEAIERGLQRRAAEGKPIDEMGPVVTIMAGRLDDWLKIVAERD 219

Query: 804 EVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTP 971
            +       E  G A + +A     + G  S+++ AA RN      ++G D +V+P
Sbjct: 220 RLFIDPGHLEWAGIAAIKRANQIFVERGFHSRVLCAAFRNVLQWSELIGGDLVVSP 275



>sp|Q9XAC0|TAL2_STRCO Transaldolase 2 (EC
           2.2.1.2).>pir|T36008|T36008 probable transaldolase -
           Streptomyces coelicolor>gb:SCO939110_175611 Streptomyces
           coelicolor A3(2) complete genome; segment 7/29.
          Length = 372

 Score = 41.2 bits (95), Expect = 0.053
 Identities = 26/70 (37%), Positives = 35/70 (50%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           GRVS EVD RLA++TH  V +   L  L     +       KIPAT  G+ A       G
Sbjct: 104 GRVSIEVDPRLAHNTHATVAEAKQLAWL-----VDRPNTFIKIPATEAGLPAIAETIGLG 158

Query: 675 IQTHLTFVYS 704
           I  ++T ++S
Sbjct: 159 ISVNVTLIFS 168



>gb:BA000030_704200 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 372

 Score = 40.8 bits (94), Expect = 0.069
 Identities = 27/70 (38%), Positives = 36/70 (51%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           GRVS EVD RLA++T   V +   L  L     +     L KIPAT  GI A   +   G
Sbjct: 104 GRVSIEVDPRLAHNTKATVAEAKQLAWL-----VDRPNTLIKIPATKAGIPAITEVIGLG 158

Query: 675 IQTHLTFVYS 704
           I  ++T ++S
Sbjct: 159 ISVNVTLIFS 168



>gb:AE005674_70357 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016980_370732 Shigella flexneri 2a str.
           2457T section 3 of 16 of the complete
           genome.>gb:AE014073_995482 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 244

 Score = 40.8 bits (94), Expect = 0.069
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 2/147 (1%)
 Frame = +3

Query: 558 VHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXX 737
           V+D LKL + I      ++ K+P T +G+ A ++L+AEGI T  T VY            
Sbjct: 93  VNDALKLRSIIA----DIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAG 148

Query: 738 XSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAI 917
              +  +V R+           + +G        G   VT  +  +  +  ++K++AA+ 
Sbjct: 149 AEYVAPYVNRI-----------DAQGG------SGIQTVTDLHQLLKMHAPQAKVLAASF 191

Query: 918 RNKQDVYSIL--GVDYIVTPLKILQSL 992
           +  +     L  G + I  PL + Q +
Sbjct: 192 KTPRQALDCLLAGCESITLPLDVAQQM 218



>pir|A64820|A64820 transaldolase-like protein (EC 2.2.1.-) -
           Escherichia coli  (strain K-12)>gb:D90720_121567
           Escherichia coli K12 genomic DNA. (18.4 - 18.8
           min).>gb:D90721_121574 Escherichia coli K12 genomic DNA.
           (18.6 - 19.0 min).>gb:U00096_199901 Escherichia coli
           K-12 MG1655 complete genome.
          Length = 244

 Score = 40.8 bits (94), Expect = 0.069
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 2/147 (1%)
 Frame = +3

Query: 558 VHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXX 737
           V+D LKL + I      ++ K+P T +G+ A ++L+AEGI T  T VY            
Sbjct: 93  VNDALKLRSIIA----DIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAG 148

Query: 738 XSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAI 917
              +  +V R+           + +G        G   VT  +  +  +  ++K++AA+ 
Sbjct: 149 AEYVAPYVNRI-----------DAQGG------SGIQTVTDLHQLLKMHAPQAKVLAASF 191

Query: 918 RNKQDVYSIL--GVDYIVTPLKILQSL 992
           +  +     L  G + I  PL + Q +
Sbjct: 192 KTPRQALDCLLAGCESITLPLDVAQQM 218



>sp|P78055|FSAA_ECOLI Fructose-6-phosphate aldolase 1 (EC
           4.1.2.-).>gb:D88188_121038 Escherichia coli DNA for
           MipB, complete cds.
          Length = 220

 Score = 40.8 bits (94), Expect = 0.069
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 2/147 (1%)
 Frame = +3

Query: 558 VHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXX 737
           V+D LKL + I      ++ K+P T +G+ A ++L+AEGI T  T VY            
Sbjct: 69  VNDALKLRSIIA----DIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAG 124

Query: 738 XSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAI 917
              +  +V R+           + +G        G   VT  +  +  +  ++K++AA+ 
Sbjct: 125 AEYVAPYVNRI-----------DAQGG------SGIQTVTDLHQLLKMHAPQAKVLAASF 167

Query: 918 RNKQDVYSIL--GVDYIVTPLKILQSL 992
           +  +     L  G + I  PL + Q +
Sbjct: 168 KTPRQALDCLLAGCESITLPLDVAQQM 194



>gb:BA000035_716478 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 360

 Score = 40.4 bits (93), Expect = 0.091
 Identities = 31/108 (28%), Positives = 49/108 (45%), Gaps = 1/108 (0%)
 Frame = +3

Query: 384 ALADQECYGLEDKDARMSC-FFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV 560
           A  D+  Y +   D R +C  F     + GG       GRVS EVD R++ D    + + 
Sbjct: 70  ASVDEAVYAMSIDDVRDACDLFTDIYESTGG-----YDGRVSIEVDPRISADAAATLEQA 124

Query: 561 HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
            +L       ++    ++ KIPAT   + A     AEGI  ++T ++S
Sbjct: 125 KELWA-----KVDRPNVMIKIPATPGSLPAISDALAEGISVNVTLIFS 167



>gb:AE017258_418312 Wolbachia endosymbiont of Drosophila
           melanogaster, section 3 of 5 of the complete
           genome.>gb:AE017196_1058949 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 213

 Score = 40.4 bits (93), Expect = 0.091
 Identities = 43/177 (24%), Positives = 73/177 (41%), Gaps = 4/177 (2%)
 Frame = +3

Query: 474 DLAKLVPGRVSTEVDARLAYDTHG-IVLKVHDLLKLYNGIEIPPERLLFKIPATWQG-IE 647
           ++  ++ G VS EV A    D+H  ++ +  +L K+ + + I       K+P T +G I 
Sbjct: 45  EICSIIKGPVSVEVVA----DSHEEMITEGLNLAKIADNVVI-------KLPLTHEGLIS 93

Query: 648 ASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRR 827
             +L     I  ++T  +S              I  FVGRL D + +             
Sbjct: 94  CKKLWTEHKIPVNITLCFSPGQALLAAKVGACFISPFVGRLDDISYD------------- 140

Query: 828 GEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGVDYIVTPLKILQSL 992
               G +L+         YG  +K++ A++R+   V     LG D I  P K+L+ L
Sbjct: 141 ----GLSLIEDICTIYSNYGFDTKVLVASVRSPAHVIEAARLGADSITVPAKVLRQL 193



>pir|B85592|B85592 probable transaldolase mipB [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>pir|G90741|G90741 probable transaldolase
           [imported] - Escherichia coli (strain O157:H7, substrain
           RIMD 0509952)>gb:AE005174_65131 Escherichia coli O157:H7
           EDL933, complete genome.>gb:BA000007_658915 Escherichia
           coli O157:H7 DNA, complete genome.
          Length = 244

 Score = 40.0 bits (92), Expect = 0.12
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 2/130 (1%)
 Frame = +3

Query: 609 LLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARN 788
           ++ K+P T +G+ A ++L+AEGI T  T VY               +  +V R+      
Sbjct: 106 IVVKVPVTTEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRI------ 159

Query: 789 HSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL--GVDYI 962
                + +G        G   VT  +  +  +  ++K++AA+ +  +     L  G + I
Sbjct: 160 -----DAQGG------SGIQTVTDLHQLLKMHAPRAKVLAASFKTPRQALDCLLAGCESI 208

Query: 963 VTPLKILQSL 992
             PL + Q +
Sbjct: 209 TLPLDVAQQM 218



>sp|P58423|FSAA_ECO57 Fructose-6-phosphate aldolase 1 (EC 4.1.2.-).
          Length = 220

 Score = 40.0 bits (92), Expect = 0.12
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 2/130 (1%)
 Frame = +3

Query: 609 LLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARN 788
           ++ K+P T +G+ A ++L+AEGI T  T VY               +  +V R+      
Sbjct: 82  IVVKVPVTTEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRI------ 135

Query: 789 HSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL--GVDYI 962
                + +G        G   VT  +  +  +  ++K++AA+ +  +     L  G + I
Sbjct: 136 -----DAQGG------SGIQTVTDLHQLLKMHAPRAKVLAASFKTPRQALDCLLAGCESI 184

Query: 963 VTPLKILQSL 992
             PL + Q +
Sbjct: 185 TLPLDVAQQM 194



>gb:BA000036_719302 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927152_833152 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 5/10.>gb:AX065119_1459473 Sequence 245
           from Patent WO0100844.>gb:AX076272_1460647 Sequence 1
           from Patent WO0104325.>gb:AX076274_1460648 Sequence 3
           from Patent WO0104325.
          Length = 360

 Score = 39.7 bits (91), Expect = 0.15
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 1/108 (0%)
 Frame = +3

Query: 384 ALADQECYGLEDKDARMSC-FFNKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGIVLKV 560
           A  DQ  Y +   D R +C  F     +  G       GRVS EVD R++ D    + + 
Sbjct: 70  ASVDQAVYAMSIDDVRNACDLFTGIFESSNG-----YDGRVSIEVDPRISADRDATLAQA 124

Query: 561 HDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
            +L       ++    ++ KIPAT   + A     AEGI  ++T ++S
Sbjct: 125 KELWA-----KVDRPNVMIKIPATPGSLPAITDALAEGISVNVTLIFS 167



>gb:APU33282_582377 Anabaena PCC7120 zwf region, fructose
           1,6-bisphosphatase (fbpP), transaldolase (tal), and
           glucose 6-phosphate dehydrogenase (zwf) genes, complete
           cds.
          Length = 381

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 1/118 (0%)
 Frame = +3

Query: 354 DTKFKSAVDTALADQECY-GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLA 530
           D   ++ V   L   + Y  L   D R +C   + +      L     G VS EV   +A
Sbjct: 61  DADIEAGVRAGLPTYKIYESLIFADIRNACDILRPVYEASNKL----DGYVSIEVPPTIA 116

Query: 531 YDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
           +DT   +   ++  + Y   EI  E ++ KIP T  G+ A   + AEGI  ++T ++S
Sbjct: 117 HDTQATI---NEARRYYQ--EIGRENVMIKIPGTEAGLPAVEQVIAEGINVNVTLLFS 169



>gb:AE016918_357208 Chromobacterium violaceum ATCC 12472 section 9 of
            16 of the complete genome.>gb:AE016825_1042362
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 224

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 30/134 (22%), Positives = 54/134 (40%), Gaps = 2/134 (1%)
 Frame = +3

Query: 606  RLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR 785
            R++ KIPA   G  A  +LE EG+ T  T ++             S    +V R+   A 
Sbjct: 79   RMVVKIPAVGDGFRAMSMLEREGVATLATAIFETRQLALAALAGASYAAPYVNRIELSAG 138

Query: 786  NHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVY--SILGVDY 959
            N                    ++ ++   +  YG+K+ ++AAA++  +     +  GV  
Sbjct: 139  N-----------------AFEVLEQSQRLLDAYGYKTAILAAAVKTVEQFLRCAQTGVAA 181

Query: 960  IVTPLKILQSLKES 1001
            +  P+ + Q L  S
Sbjct: 182  VTLPVAVFQQLYAS 195



>gb:AE016757_324952 Escherichia coli CFT073 section 3 of 18 of the
           complete genome.>gb:AE014075_955536 Escherichia coli
           CFT073 complete genome.
          Length = 244

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 2/130 (1%)
 Frame = +3

Query: 609 LLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARN 788
           ++ K+P T +G+ A ++L+AEGI T  T VY               +  +V R+      
Sbjct: 106 IVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRI------ 159

Query: 789 HSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL--GVDYI 962
                + +G        G   VT  +  +  +  ++K++AA+ +  +     L  G + I
Sbjct: 160 -----DAQGG------SGIQTVTDLHQLLKMHAPQAKVLAASFKTPRQALDCLLAGCESI 208

Query: 963 VTPLKILQSL 992
             PL + Q +
Sbjct: 209 TLPLDVAQQM 218



>sp|P48993|TAL2_ANASP Transaldolase 2 (EC
           2.2.1.2).>pir|AE2308|AE2308 transaldolase [imported] -
           Nostoc sp. (strain PCC 7120)>gb:BA000019_685009 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 381

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 1/118 (0%)
 Frame = +3

Query: 354 DTKFKSAVDTALADQECY-GLEDKDARMSCFFNKALVNVGGDLAKLVPGRVSTEVDARLA 530
           D   ++ V   L   + Y  L   D R +C   + +      L     G VS EV   +A
Sbjct: 61  DADIEAGVRAGLPTYKIYESLIFADIRNACDILRPVYEASNKL----DGYVSIEVPPTIA 116

Query: 531 YDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
           +DT   +   ++  + Y   EI  E ++ KIP T  G+ A   + AEGI  ++T ++S
Sbjct: 117 HDTQATI---NEARRYYQ--EIGRENVMIKIPGTEAGLPAVEQVIAEGINVNVTLLFS 169



>sp|P48983|TAL2_NOSPU Transaldolase 2 (EC
           2.2.1.2).>gb:NOSFTZOOP_156008 Nostoc sp. oxidative
           pentose phosphate cycle operon, complete sequence.
          Length = 381

 Score = 38.9 bits (89), Expect = 0.26
 Identities = 23/70 (32%), Positives = 36/70 (51%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G VS EV   +A+DT   + +     +     EI  E L+ KIP T  G+ A   + AEG
Sbjct: 105 GYVSIEVPPTIAHDTEATISEARRYFQ-----EIGRENLMIKIPGTEPGLPAVEQVIAEG 159

Query: 675 IQTHLTFVYS 704
           +  ++T ++S
Sbjct: 160 MNVNITLLFS 169



>gb:AF087310_478170 Chlamydia trachomatis 463 transaldolase B (talB)
           gene, partial cds.
          Length = 56

 Score = 38.5 bits (88), Expect = 0.34
 Identities = 17/34 (50%), Positives = 26/34 (76%)
 Frame = +3

Query: 447 NKALVNVGGDLAKLVPGRVSTEVDARLAYDTHGI 548
           +K  VN+G ++ K VPGRVS E+DARL+++T  +
Sbjct: 23  DKIQVNLGLEILKHVPGRVSLEIDARLSFNTEAM 56



>gb:AE004969_61267 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 351

 Score = 38.1 bits (87), Expect = 0.45
 Identities = 25/70 (35%), Positives = 35/70 (50%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G VS EV   LA D  G V +   L        I  +  + K+PAT  GI+A   L ++G
Sbjct: 102 GFVSLEVSPELAKDAQGTVEEARRL-----HAAIARKNAMIKVPATDAGIDALETLVSDG 156

Query: 675 IQTHLTFVYS 704
           I  +LT ++S
Sbjct: 157 ISVNLTLLFS 166



>sp|Q9K139|TAL_NEIMB Transaldolase (EC 2.2.1.2).>pir|E81210|E81210
           transaldolase NMB0351 [imported] - Neisseria
           meningitidis  (strain MC58 serogroup
           B)>gb:AE002391_45820 Neisseria meningitidis serogroup B
           strain MC58 section 33 of 206 of the complete
           genome.>gb:AE002098_895933 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 351

 Score = 38.1 bits (87), Expect = 0.45
 Identities = 25/70 (35%), Positives = 37/70 (52%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G VS EV   L+ D  G V    +  +LY  I    +  + K+PAT  GI+A   L ++G
Sbjct: 102 GFVSLEVSPELSKDAQGTV---EEARRLYAAIGC--KNAMIKVPATDAGIDALETLVSDG 156

Query: 675 IQTHLTFVYS 704
           I  +LT ++S
Sbjct: 157 ISVNLTLLFS 166



>sp|Q9JSU1|TAL_NEIMA Transaldolase (EC 2.2.1.2).>pir|E81785|E81785
           transaldolase (EC 2.2.1.2) NMA2136 [imported] -
           Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA7Z2491_155004 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 7/7.
          Length = 351

 Score = 38.1 bits (87), Expect = 0.45
 Identities = 25/70 (35%), Positives = 37/70 (52%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G VS EV   L+ D  G V    +  +LY  I    +  + K+PAT  GI+A   L ++G
Sbjct: 102 GFVSLEVSPELSKDAQGTV---EEARRLYAAIGC--KNAMIKVPATDAGIDALETLVSDG 156

Query: 675 IQTHLTFVYS 704
           I  +LT ++S
Sbjct: 157 ISVNLTLLFS 166



>gb:BA000032_710109 Vibrio parahaemolyticus RIMD 2210633 DNA,
            chromosome 2, complete sequence.
          Length = 224

 Score = 37.7 bits (86), Expect = 0.59
 Identities = 37/162 (22%), Positives = 66/162 (40%), Gaps = 10/162 (6%)
 Frame = +3

Query: 600  PERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDW 779
            P  ++ K+PAT  G+ A +L++ EGIQ   T +YS              +  +V R+   
Sbjct: 80   PYDMVIKVPATETGLSAIKLMKKEGIQVLATAIYSAQQGFLAALCGADYLAPYVNRIDAM 139

Query: 780  ARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSI--LGV 953
              N                 G  +V      + +    +K++AA+ +N Q    +  LG+
Sbjct: 140  NGN-----------------GVEVVADLQLLLDQNQLPAKILAASFKNTQQAMEVMKLGI 182

Query: 954  DYIVTPLKILQSL--KESVTP------PDEKYSFERRLSPQS 1055
            + I  P+ +   +    +V P       D K +F  +LS +S
Sbjct: 183  EAITLPVDVAAQMFSHPAVQPAVDQFDKDWKSTFGNKLSFES 224



>gb:AE016911_355525 Chromobacterium violaceum ATCC 12472 section 2
           of 16 of the complete genome.>gb:AE016825_1040679
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 353

 Score = 37.4 bits (85), Expect = 0.77
 Identities = 24/70 (34%), Positives = 34/70 (48%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G VS EV   L+ D  G +     L       EI     + KIPAT +GI A + L  EG
Sbjct: 104 GYVSLEVSPELSRDEAGTLAAARRLWA-----EIGRANAMIKIPATAEGIRAFQALTREG 158

Query: 675 IQTHLTFVYS 704
           +  ++T ++S
Sbjct: 159 VNVNITLLFS 168



>gb:U00013_198795 Mycobacterium leprae cosmid B1496.
          Length = 159

 Score = 37.4 bits (85), Expect = 0.77
 Identities = 22/53 (41%), Positives = 30/53 (56%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEAS 653
           GRVS EVD RLA+DT   + +  +L ++     +    L  KIPAT  G+ AS
Sbjct: 109 GRVSIEVDPRLAHDTDKTIAQAVELWRI-----VDHPNLFIKIPATKAGLPAS 156



>gb:CR555306_108051 Azoarcus sp. EbN1 complete genome.
          Length = 359

 Score = 37.4 bits (85), Expect = 0.77
 Identities = 28/95 (29%), Positives = 45/95 (47%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G VS EV   LA+DT   V      L+L + +    + +L K+PAT  G+EA   L   G
Sbjct: 103 GYVSLEVSPALAHDTARTVAAG---LRLKHAVG--RDNVLIKVPATSAGLEAIEQLTGHG 157

Query: 675 IQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDW 779
           +  ++T ++S            +V + ++G L  W
Sbjct: 158 VSVNVTLMFSL-------AHVDAVAEAYLGGLAAW 185



>sp|P56108|TAL_HELPY Transaldolase (EC 2.2.1.2).>pir|G64706|G64706
           transaldolase - Helicobacter pylori (strain
           26695)>gb:AE000648_25655 Helicobacter pylori 26695
           section 126 of 134 of the complete
           genome.>gb:AE000511_881094 Helicobacter pylori 26695
           complete genome.
          Length = 316

 Score = 37.4 bits (85), Expect = 0.77
 Identities = 49/240 (20%), Positives = 87/240 (36%), Gaps = 14/240 (5%)
 Frame = +3

Query: 315 VSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDLAKLVP 494
           ++   + G  S P    ++   +A    E   L+ K A+   +   AL ++    + L+P
Sbjct: 24  INKGAICGATSNPSLFCEAITKSAFYKDEIAKLKGKKAK-EIYETLALKDILQASSALMP 82

Query: 495 --------GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEA 650
                   G +S E+D  L  D    + +   L K  N   +     + K+PA+  GIE 
Sbjct: 83  LYEKDPNNGYISLEIDPFLEDDAAKSIDEAKRLFKTLNRPNV-----MIKVPASESGIEV 137

Query: 651 SRLLEAEGIQTHLTFVYS------FCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVE 812
              L    I  ++T V+S                  +VI +FV R          D E++
Sbjct: 138 VSALTQASIPVNVTLVFSPKIAGEIAQILAKEAQKRAVISVFVSRF---------DKEID 188

Query: 813 GALRRGEDPGSALVTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDYIVTPLKILQSL 992
             + +     S ++     Y     H +KL +    +     + L  DY +  L    S+
Sbjct: 189 PLVPKNLQAQSGIINATECYYQINQHANKLTSTLFASTGVKSNSLAKDYYIKALCFKNSI 248



>gb:AE010778_266475 Methanosarcina acetivorans str. C2A, section 123
           of 534 of the complete genome.>gb:AE010299_907034
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 406

 Score = 37.0 bits (84), Expect = 1.0
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 3/88 (3%)
 Frame = +3

Query: 309 ATVSSSLLLGICSLPDTKFKSAVDTA--LADQECYGLEDKDARMSCFFNKALVN-VGGDL 479
           A  + SLL+G   + +T F S ++    +   +  G ++KD  M   FN A+V  VGG L
Sbjct: 283 AIAAVSLLVGAVGIANTMFTSVLEKTKEIGTMKAIGAKNKDILMIFLFNSAMVGFVGGVL 342

Query: 480 AKLVPGRVSTEVDARLAYDTHGIVLKVH 563
              +   VS+ + A +   T G  + +H
Sbjct: 343 GVTLGAFVSSGLQAMMGQMTSGSGVSLH 370



>gb:CP000002_859425 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 221

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 25/74 (33%), Positives = 34/74 (45%)
 Frame = +3

Query: 576 LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
           LYN ++     +  KIP T QG+ A R L AE IQT  T VY+            S +  
Sbjct: 75  LYNWLD---GNVSVKIPVTTQGLYAIRKLAAENIQTTGTTVYTAAQAVLAAKAGASYVAP 131

Query: 756 FVGRLRDWARNHSG 797
           +V R+     N +G
Sbjct: 132 YVNRIDQEYGNGAG 145



>gb:AE017333_449639 Bacillus licheniformis DSM 13, complete genome.
          Length = 222

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 25/74 (33%), Positives = 34/74 (45%)
 Frame = +3

Query: 576 LYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQI 755
           LYN ++     +  KIP T QG+ A R L AE IQT  T VY+            S +  
Sbjct: 76  LYNWLD---GNVSVKIPVTTQGLYAIRKLAAENIQTTGTTVYTAAQAVLAAKAGASYVAP 132

Query: 756 FVGRLRDWARNHSG 797
           +V R+     N +G
Sbjct: 133 YVNRIDQEYGNGAG 146



>gb:AE016770_328871 Escherichia coli CFT073 section 16 of 18 of the
           complete genome.>gb:AE014075_959455 Escherichia coli
           CFT073 complete genome.
          Length = 220

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 35/158 (22%), Positives = 62/158 (39%), Gaps = 2/158 (1%)
 Frame = +3

Query: 525 LAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
           ++ D  G+V +   L     GI +       KIP T +G+ A ++L+ EGI T  T VYS
Sbjct: 61  MSRDAQGMVKEAKHLRDAIPGIVV-------KIPVTSEGLAAIKMLKKEGITTLGTAVYS 113

Query: 705 FCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY 884
                         +  +V R+           + +G        G   V +    +  +
Sbjct: 114 AAQGLLAALAGAKYVAPYVNRV-----------DAQGG------DGIRTVQELQALLEMH 156

Query: 885 GHKSKLMAAAIRNKQDVYSIL--GVDYIVTPLKILQSL 992
             +S ++AA+ +  +     L  G + I  PL + Q +
Sbjct: 157 APESMVLAASFKTPRQALDCLLAGCESITLPLDVAQQM 194



>sp|P32669|FSAB_ECOLI Fructose-6-phosphate aldolase 2 (EC
           4.1.2.-).>pir|E65201|E65201 transaldolase-like protein
           (EC 2.2.1.-) - Escherichia coli  (strain
           K-12)>gb:ECOUW89_131489 E. coli chromosomal region from
           89.2 to 92.8 minutes.>gb:U00096_202922 Escherichia coli
           K-12 MG1655 complete genome.
          Length = 220

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 35/158 (22%), Positives = 62/158 (39%), Gaps = 2/158 (1%)
 Frame = +3

Query: 525 LAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
           ++ D  G+V +   L     GI +       KIP T +G+ A ++L+ EGI T  T VYS
Sbjct: 61  MSRDAQGMVEEAKRLRDAIPGIVV-------KIPVTSEGLAAIKILKKEGITTLGTAVYS 113

Query: 705 FCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY 884
                         +  +V R+           + +G        G   V +    +  +
Sbjct: 114 AAQGLLAALAGAKYVAPYVNRV-----------DAQGG------DGIRTVQELQTLLEMH 156

Query: 885 GHKSKLMAAAIRNKQDVYSIL--GVDYIVTPLKILQSL 992
             +S ++AA+ +  +     L  G + I  PL + Q +
Sbjct: 157 APESMVLAASFKTPRQALDCLLAGCESITLPLDVAQQM 194



>gb:AY070515_1294660 Drosophila melanogaster GH20378 full length
           cDNA.
          Length = 367

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = -1

Query: 885 HICG-CSYKLLSPEQIQDLLLFEVHLLLQSHQNGSVPNPSAD 763
           H CG CSYK + PE +      E H+LLQ H   SV NP+ D
Sbjct: 127 HACGKCSYKFMWPENL------EQHILLQ-HSKSSVSNPTGD 161



>gb:AE014297_1139052 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003692_1221045 Drosophila melanogaster
           chromosome 3R, section 30 of 118 of the complete
           sequence.>gb:BT016102_1358547 Drosophila melanogaster
           LD23980 full insert cDNA.
          Length = 936

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = -1

Query: 885 HICG-CSYKLLSPEQIQDLLLFEVHLLLQSHQNGSVPNPSAD 763
           H CG CSYK + PE +      E H+LLQ H   SV NP+ D
Sbjct: 696 HACGKCSYKFMWPENL------EQHILLQ-HSKSSVSNPTGD 730



>sp|Q8ZKM8|FSA_SALTY Probable fructose-6-phosphate aldolase (EC
           4.1.2.-).>gb:CP000026_78601 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008892_245722 Salmonella typhimurium LT2,
           section 196 of 220 of the complete
           genome.>gb:AE006468_1002804 Salmonella typhimurium LT2,
           complete genome.
          Length = 220

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 38/168 (22%), Positives = 63/168 (37%), Gaps = 2/168 (1%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G   T     ++ D  G+V +   L     GI +       KIP T +G+ A +LL+ EG
Sbjct: 51  GEEGTLFAQTMSRDAKGMVEEAKRLNNAIPGIVV-------KIPVTAEGLAAIKLLKKEG 103

Query: 675 IQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALV 854
           I T  T VYS              +  +V R+           + +G        G  +V
Sbjct: 104 IVTLGTAVYSASQGLLAALAGAKYVAPYVNRV-----------DAQGG------DGIRMV 146

Query: 855 TKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL--GVDYIVTPLKILQSL 992
            +    +  +   S ++AA+ +  +     L  G   I  PL + Q +
Sbjct: 147 QELQTLLEHHAPDSMVLAASFKTPRQALDCLLAGCQAITLPLDVAQQM 194



>sp|Q8Z305|FSA_SALTI Probable fructose-6-phosphate aldolase (EC
           4.1.2.-).>pir|AG0936|AG0936 probable transaldolase
           STY3758 [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)>gb:AE016845_347472
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           section 12 of 16 of the complete
           genome.>gb:AL627279_543807 Salmonella enterica serovar
           Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 15/20.>gb:AE014613_984804 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 220

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 38/168 (22%), Positives = 63/168 (37%), Gaps = 2/168 (1%)
 Frame = +3

Query: 495 GRVSTEVDARLAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEG 674
           G   T     ++ D  G+V +   L     GI +       KIP T +G+ A +LL+ EG
Sbjct: 51  GEEGTLFAQTMSRDAKGMVEEAKRLNNAIPGIVV-------KIPVTAEGLAAIKLLKKEG 103

Query: 675 IQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALV 854
           I T  T VYS              +  +V R+           + +G        G  +V
Sbjct: 104 IVTLGTAVYSASQGLLAALAGAKYVAPYVNRV-----------DAQGG------DGIRMV 146

Query: 855 TKAYNYIHKYGHKSKLMAAAIRNKQDVYSIL--GVDYIVTPLKILQSL 992
            +    +  +   S ++AA+ +  +     L  G   I  PL + Q +
Sbjct: 147 LELQTLLEHHAPDSMVLAASFKTPRQALDCLLAGCQAITLPLDVAQQM 194



>sp|P58424|FSAB_ECO57 Fructose-6-phosphate aldolase 2 (EC
           4.1.2.-).>pir|G86085|G86085 probable transaldolase talC
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>pir|C91238|C91238 probable
           transaldolase [imported] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>gb:AE005174_69146
           Escherichia coli O157:H7 EDL933, complete
           genome.>gb:BA000007_662887 Escherichia coli O157:H7 DNA,
           complete genome.
          Length = 220

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 35/158 (22%), Positives = 62/158 (39%), Gaps = 2/158 (1%)
 Frame = +3

Query: 525 LAYDTHGIVLKVHDLLKLYNGIEIPPERLLFKIPATWQGIEASRLLEAEGIQTHLTFVYS 704
           ++ D  G+V +   L     GI +       KIP T +G+ A ++L+ EGI T  T VYS
Sbjct: 61  MSRDAQGMVEEAKRLRDAIPGIVV-------KIPVTSEGLAAIKILKKEGITTLGTAVYS 113

Query: 705 FCXXXXXXXXXXSVIQIFVGRLRDWARNHSGDSEVEGALRRGEDPGSALVTKAYNYIHKY 884
                         +  +V R+           + +G        G   V +    +  +
Sbjct: 114 AAQGLLAALAGAKYVAPYVNRV-----------DAQGG------DGIRTVQELQALLEMH 156

Query: 885 GHKSKLMAAAIRNKQDVYSIL--GVDYIVTPLKILQSL 992
             +S ++AA+ +  +     L  G + I  PL + Q +
Sbjct: 157 APESMVLAASFKTPRQALDCLLAGCESITLPLDVAQQM 194



>pir|C64594|C64594 hypothetical protein HP0595 - Helicobacter pylori
           (strain 26695)>gb:AE000573_24769 Helicobacter pylori
           26695 section 51 of 134 of the complete
           genome.>gb:AE000511_880208 Helicobacter pylori 26695
           complete genome.
          Length = 490

 Score = 34.7 bits (78), Expect = 5.0
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = -2

Query: 965 NNVINPQNAIDILLVPNSRCHQLRFMPIFVDVVISFCHQSRSRIFSSSKCTFYFRVTR 792
           N VI   N   + + PN   + L+  P F++ V SF    RSR+ +S    +Y  V R
Sbjct: 308 NIVIMGNNKTSVEITPNKNANMLKNFPYFLEGVNSFDEVERSRLKTSRAKNYYVSVAR 365



>gb:AJ628768_1494503 Bacteriophage S-RSM2 ORF1, omp1 gene, psbA
           gene, psbD gene and tal gene.
          Length = 226

 Score = 33.9 bits (76), Expect = 8.5
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +3

Query: 618 KIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRD 776
           K+P T  G+   + L  EGI+ ++T ++             + +  FVGRL D
Sbjct: 95  KVPCTRDGLSVCKQLSDEGIKVNVTLIFCAAQAVLAAKAGATYVSPFVGRLDD 147



>gb:BX908798_831539 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 219

 Score = 33.9 bits (76), Expect = 8.5
 Identities = 30/142 (21%), Positives = 58/142 (40%), Gaps = 4/142 (2%)
 Frame = +3

Query: 606  RLLFKIPATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWAR 785
            R++ K+P T  G+EA  LL  +GI T  T ++             + +  ++ R+     
Sbjct: 79   RIIVKVPLTKNGLEALHLLARQGIPTMATVIFHPRQALMAALAGANYVAPYISRIE---- 134

Query: 786  NHSGDSEVEGALRRGEDPGSAL--VTKAYNYIHKYGHKSKLMAAAIRNKQDVYSILGVDY 959
                        + GE+P   L  +TK +    +Y  ++K+M A++ +   V     +  
Sbjct: 135  ------------KLGENPWPMLESLTKTF---QQYQLQTKIMGASLNSVDQVIKCAEIGI 179

Query: 960  IVTPLK--ILQSLKESVTPPDE 1019
                LK  + + + E  +P  E
Sbjct: 180  YGVTLKDDLFEKMIEDYSPTVE 201



>sp|P27206|SRF1_BACSU Surfactin synthetase subunit
            1.>pir|I40485|I40485 surfactin synthetase component I -
            Bacillus subtilis>gb:D50453_120086 Bacillus subtilis DNA
            for 25-36 degree region containing the amyE-srfA region,
            complete cds.>gb:BSSRFAP_751271 B.subtilis srfA-sfp gene
            region for surfactin synthetase.>gb:BSUB0002_752313
            Bacillus subtilis complete genome (section 2 of 21): from
            213031 to 415798.
          Length = 3588

 Score = 33.9 bits (76), Expect = 8.5
 Identities = 63/262 (24%), Positives = 103/262 (39%), Gaps = 26/262 (9%)
 Frame = +3

Query: 300  PTAATVSSSLLLGICSLPDTKFKSAVDTALADQECYGLEDKDARMSCFFNKALVNVGGDL 479
            PT   + +S +L   S P  K    VD  +   E  G  D +A M+ F          DL
Sbjct: 1108 PTPRVIETSFVLEN-STPRQKIHVCVDFNIEMIERGGRSD-EAIMASFVRTF------DL 1159

Query: 480  AKLVPGRVST----EVDARLAYDTHGIV-------LKVHDLLKLYNGIEIPPERLLFKIP 626
            AK    R+      E    L +D H ++       + + +L ++Y G ++P  RL +K  
Sbjct: 1160 AKAPLFRIGLLGLEENRHMLLFDMHHLISDGVSIGIMLEELARIYKGEQLPDLRLQYKDY 1219

Query: 627  ATWQGIEASRLLEAEGIQTHLTFVYSFCXXXXXXXXXXSVIQIFVGRLRDWARNHSG--- 797
            A WQ  +A     AEG +    +                V+Q+     R   ++  G   
Sbjct: 1220 AVWQSRQA-----AEGYKKDQAY------WKEVFAGELPVLQLLSDYPRPPVQSFEGDRV 1268

Query: 798  ----DSEVEGALRR-GEDPGSAL----VTKAYNYIHKYGHKSKLMA---AAIRNKQDVYS 941
                D+ V+  L R  E  G+ L    ++  Y  + KY  +  ++    +A RN  D   
Sbjct: 1269 SIKLDAGVKDRLNRLAEQNGATLYMVMLSAYYTLLSKYTGQDDIIVGTPSAGRNHSDTEG 1328

Query: 942  ILGVDYIVTPLKILQSLKESVT 1007
            I+G+   V  L I   +K++ T
Sbjct: 1329 IIGM--FVNTLAIRSEVKQNET 1348


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,434,425,221
Number of Sequences: 1806583
Number of extensions: 29344768
Number of successful extensions: 75865
Number of sequences better than 10.0: 234
Number of HSP's better than 10.0 without gapping: 70998
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 75573
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 120982996095
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)