BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7742
         (644 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|D86221|D86221 hypothetical protein [imported] - Arabidopsis ...   185   5e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AP000600_1820366 Arabidopsis thaliana genomic DNA, chromosome...    89   6e-17   
pir|B96582|B96582 hypothetical protein F15I1.21 [imported] - Ara...    88   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AF462830_1801941 Arabidopsis thaliana AT5g17860/MVA3_210 mRNA...    84   2e-15   
gb:AB011480_1511451 Arabidopsis thaliana genomic DNA, chromosome...    84   2e-15   
gb:AC125472_1740507 Oryza sativa (japonica cultivar-group) chrom...    78   1e-13   
gb:AC133859_1741535 Oryza sativa chromosome 3 BAC OSJNBa0075A22 ...    73   5e-12   
gb:AF466201_1802241 Sorghum bicolor clone SBTXS_0032H17 putative...    72   6e-12   
gb:AY542797_1188314 Zea mays chromosome 5 clone Z474J15 map 5S, ...    71   2e-11   
pir|S40705|S40705 Na+/Ca2+,K+-exchanging protein homolog - Caeno...    65   8e-10   Caenorhabditis elegans [roundworm]
sp|P34315|NCX6_CAEEL|NCX6_CAEEL Putative sodium/calcium exchanger 6 precurs...    65   8e-10   Caenorhabditis elegans [roundworm]
gb:AE016959_1022750 Oryza sativa (japonica cultivar-group) chrom...    65   1e-09   
pir|S40707|S40707 hypothetical protein C07A9.11 - Caenorhabditis...    64   2e-09   Caenorhabditis elegans [roundworm]
sp|P34322|NCX7_CAEEL|NCX7_CAEEL Putative sodium/calcium exchanger 7 precurs...    64   2e-09   Caenorhabditis elegans [roundworm]
pir|T38674|T38674 probable membrane transport protein - fission ...    64   2e-09   Schizosaccharomyces pombe
gb:CR382132_1665694 Yarrowia lipolytica chromosome F of strain C...    63   5e-09   
gb:BC043689_2098954 Mus musculus solute carrier family 24 (sodiu...    62   1e-08   
gb:AF261233_2060836 Mus musculus sodium/calcium exchanger protei...    62   1e-08   
pir|T03889|T03889 Na+/Ca2+,K+-exchanging protein homolog C13D9.8...    60   2e-08   Caenorhabditis elegans [roundworm]
gb:AC024881_1205080 Caenorhabditis elegans cosmid Y97E10B, compl...    60   3e-08   
gb:BC079350_2107470 Rattus norvegicus cDNA clone MGC:94807 IMAGE...    60   4e-08   
gb:AB049713_1520902 Pisum sativum ssa-2 mRNA for putative senesc...    60   4e-08   
pir|T03888|T03888 Na+/Ca2+,K+-exchanging protein homolog C13D9.7...    57   2e-07   Caenorhabditis elegans [roundworm]
gb:AE017341_1754606 Cryptococcus neoformans var. neoformans JEC2...    57   4e-07   
gb:AY601759_1957331 Homo sapiens Na+/Ca2+ K+ independent exchang...    54   3e-06   
gb:AX537505_1470015 Sequence 1 from Patent EP1241260.>gb:AX53750...    54   3e-06   
gb:CQ859746_1454443 Sequence 37 from Patent WO2004072277.              54   3e-06   
gb:CQ859744_1454442 Sequence 35 from Patent WO2004072277.              54   3e-06   
gb:AE013599_1131216 Drosophila melanogaster chromosome 2R, compl...    54   3e-06   
gb:AY075148_1296003 Tetrahymena thermophila cation-exchanger pro...    53   4e-06   
gb:CR382136_1668827 Debaryomyces hansenii chromosome D of strain...    51   2e-05   
gb:AY070497_1294642 Drosophila melanogaster GH07338 full length ...    47   2e-04   
gb:AE013599_1130688 Drosophila melanogaster chromosome 2R, compl...    47   2e-04   
gb:CEL5701_1365857 Caenorhabditis elegans mRNA for Na/Ca,K-excha...    46   6e-04   
gb:CEF35C12_1363397 Caenorhabditis elegans cosmid F35C12, comple...    46   6e-04   
pir|T21747|T21747 hypothetical protein F35C12.2 - Caenorhabditis...    46   6e-04   Caenorhabditis elegans [roundworm]
gb:BC016094_2092171 Mus musculus solute carrier family 24 (sodiu...    45   0.001   
gb:AE013599_1132280 Drosophila melanogaster chromosome 2R, compl...    45   0.001   
gb:AY601760_1957332 Homo sapiens Na+/Ca2+ K+ independent exchang...    44   0.002   
gb:AF177987_1888186 Homo sapiens cone sodium-calcium potassium e...    44   0.002   
sp|Q9UI40|NKX2_HUMAN|NKX2_HUMAN Sodium/potassium/calcium exchanger 2 precur...    44   0.002   Homo sapiens [man]
gb:AB014602_1864631 Homo sapiens mRNA for KIAA0702 protein, part...    44   0.003   
sp|O60721|NKX1_HUMAN|NKX1_HUMAN Sodium/potassium/calcium exchanger 1 precur...    44   0.003   Homo sapiens [man]
gb:AF026132_1877283 Homo sapiens retinal rod Na+/Ca+, K+ exchang...    43   0.004   
pir|T31433|T31433 Na+/Ca2+,K+-exchanging protein - bottle-nosed ...    43   0.004   Tursiops truncatus [Atlantic bottle-nosed dolphin]
sp|Q9IAL8|NKX1_CHICK|NKX1_CHICK Sodium/potassium/calcium exchanger 1 precur...    43   0.004   Gallus gallus [bantam]
gb:AC079889_1733015 Oryza sativa chromosome 3 BAC OSJNBa0092M19 ...    43   0.005   
pir|S20969|S20969 Na+/Ca2+,K+-exchanging protein - bovine>gb:BTN...    43   0.005   Bos taurus [bovine]
sp|Q28139|NKX1_BOVIN|NKX1_BOVIN Sodium/potassium/calcium exchanger 1 precur...    43   0.005   Bos taurus [bovine]
gb:AF177986_2478714 Gallus gallus clone dt3111 cone potassium-de...    42   0.007   
gb:AY191995_1309053 Gomphiocephalus hodgsoni mitochondrion, comp...    42   0.007   
sp|Q9IAL7|NKX2_CHICK|NKX2_CHICK Sodium/potassium/calcium exchanger 2 precur...    42   0.007   Gallus gallus [bantam]
gb:AF520706_1905816 Homo sapiens K-dependent Na/Ca exchanger NCK...    42   0.009   
gb:AF520705_1905815 Homo sapiens K-dependent Na/Ca exchanger NCK...    42   0.009   
gb:AK083127_1173824 Mus musculus adult male hippocampus cDNA, RI...    42   0.009   
gb:AK038800_1165179 Mus musculus adult male hypothalamus cDNA, R...    42   0.009   
gb:AK034424_1163750 Mus musculus adult male diencephalon cDNA, R...    42   0.009   
gb:AP008231_580966 Synechococcus elongatus PCC 6301 DNA, complet...    42   0.009   
sp|Q8NFF2|NKX4_HUMAN|NKX4_HUMAN Sodium/potassium/calcium exchanger 4 precur...    42   0.009   Homo sapiens [man]
sp|O54701|NKX2_RAT|NKX2_RAT Sodium/potassium/calcium exchanger 2 precurso...    42   0.009   Rattus norvegicus [brown rat]
gb:BC017615_2092512 Mus musculus solute carrier family 24 (sodiu...    42   0.012   
gb:AF314821_2062606 Mus musculus strain CD-1 K+-dependent Na/Ca ...    42   0.012   
gb:AL139429_1920781 Human DNA sequence from clone RP11-110K14 on...    42   0.012   
gb:AL136090_1918876 Human DNA sequence from clone RP11-97N19 on ...    42   0.012   
gb:AF169257_1887501 Homo sapiens potassium-dependent Na/Ca excha...    42   0.012   
gb:AK044368_1166933 Mus musculus adult retina cDNA, RIKEN full-l...    42   0.012   
gb:AK044239_1166881 Mus musculus adult retina cDNA, RIKEN full-l...    42   0.012   
sp|Q8CGQ8|NKX4_MOUSE|NKX4_MOUSE Sodium/potassium/calcium exchanger 4 precur...    42   0.012   Mus musculus [mouse]
sp|Q9EPQ0|NKX3_RAT|NKX3_RAT Sodium/potassium/calcium exchanger 3 precurso...    42   0.012   Rattus norvegicus [brown rat]
sp|Q99PD7|NKX3_MOUSE|NKX3_MOUSE Sodium/potassium/calcium exchanger 3 precur...    42   0.012   Mus musculus [mouse]
sp|Q9HC58|NKX3_HUMAN|NKX3_HUMAN Sodium/potassium/calcium exchanger 3 precur...    42   0.012   Homo sapiens [man]
sp|Q9QZM6|NKX1_RAT|NKX1_RAT Sodium/potassium/calcium exchanger 1 precurso...    42   0.012   Rattus norvegicus [brown rat]
gb:AY297781_606968 Alcaligenes faecalis strain NCIB 8687 arsenit...    41   0.015   
pir|A83708|A83708 hypothetical protein BH0465 [imported] - Bacil...    41   0.015   Bacillus halodurans
gb:AP004727_1843846 Oryza sativa (japonica cultivar-group) genom...    41   0.020   
gb:BX571662_779419 Wolinella succinogenes, complete genome; segm...    40   0.026   
gb:AY094674_1297848 Drosophila melanogaster GH04818 full insert ...    40   0.034   
gb:AF190455_1249483 Drosophila melanogaster potassium-dependent ...    40   0.034   
gb:AE014134_1128407 Drosophila melanogaster chromosome 2L, compl...    40   0.045   
sp|Q9U6A0|NCKX_DROME|NCKX_DROME Sodium/potassium/calcium exchanger (Na(+)/K...    40   0.045   Drosophila melanogaster
gb:AC144737_1744136 Oryza sativa (japonica cultivar-group) chrom...    39   0.076   
gb:AE014297_1137811 Drosophila melanogaster chromosome 3R, compl...    39   0.076   
pir|H82064|H82064 conserved hypothetical protein VC2522 [importe...    38   0.13    Vibrio cholerae
gb:AF036943_1878046 Homo sapiens myelin transcription factor 1-l...    38   0.17    
gb:CR380956_1652406 Candida glabrata strain CBS138 chromosome J ...    38   0.17    
gb:DRONCX_1382392 Drosophila melanogaster (clone DR1) Na/Ca exch...    38   0.17    
gb:AF009897_1231609 Drosophila melanogaster 3Na(+)-1Ca(2+) excha...    38   0.17    
gb:AE014297_1140561 Drosophila melanogaster chromosome 3R, compl...    38   0.17    
gb:BX294135_765868 Pirellula sp. strain 1 complete genome; segme...    38   0.17    
gb:AE010385_262583 Methanopyrus kandleri AV19 section 84 of 157 ...    38   0.17    
gb:CR382123_1656144 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.22    
gb:BA000037_721280 Vibrio vulnificus YJ016 DNA, chromosome I, co...    37   0.22    
gb:AE016799_335451 Vibrio vulnificus CMCP6 chromosome I section ...    37   0.22    
gb:AE006079_215316 Pasteurella multocida subsp. multocida str. P...    37   0.22    
gb:AP004667_1842967 Oryza sativa (japonica cultivar-group) genom...    37   0.29    
gb:CP000020_870569 Vibrio fischeri ES114 chromosome I, complete ...    37   0.29    
gb:AE016809_338245 Vibrio vulnificus CMCP6 chromosome II section...    37   0.38    
gb:CR378673_96532 Photobacterium profundum SS9; segment 11/12.         37   0.38    
gb:BX908809_1644563 Neurospora crassa DNA linkage group IV Cosmi...    36   0.64    
gb:BA000031_708125 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    36   0.64    
gb:AC137610_1743512 Oryza sativa (japonica cultivar-group) chrom...    35   0.84    
gb:AE016959_1022896 Oryza sativa (japonica cultivar-group) chrom...    35   0.84    
pir|S67765|S67765 probable membrane protein YDL206w - yeast (Sac...    35   1.1     Saccharomyces cerevisiae [brewer's yeast]
gb:AC104706_1737743 Oryza sativa (japonica cultivar-group) chrom...    35   1.4     
gb:BA000038_725143 Vibrio vulnificus YJ016 DNA, chromosome II, c...    35   1.4     
gb:CR628337_114126 Legionella pneumophila str. Lens complete gen...    35   1.4     
gb:AE017352_1759820 Cryptococcus neoformans var. neoformans JEC2...    34   1.9     
gb:AX647605_1472430 Sequence 1797 from Patent EP1270724.               34   1.9     
gb:BT003775_1357092 Drosophila melanogaster RE20724 full insert ...    34   1.9     
gb:AE014297_1140949 Drosophila melanogaster chromosome 3R, compl...    34   1.9     
gb:AE014297_1140948 Drosophila melanogaster chromosome 3R, compl...    34   1.9     
gb:AE013599_1130689 Drosophila melanogaster chromosome 2R, compl...    34   1.9     
gb:AE017283_432009 Propionibacterium acnes KPA171202, complete g...    34   1.9     
sp|Q8BZX4|SFRC_MOUSE|SFRC_MOUSE Splicing factor, arginine/serine-rich 12 (S...    34   1.9     Mus musculus [mouse]
gb:BC067984_2554968 Xenopus tropicalis hypothetical protein MGC6...    34   2.4     
gb:OSJN00286_1191036 Oryza sativa (japonica cultivar-group) chro...    34   2.4     
gb:CR628336_111073 Legionella pneumophila str. Paris complete ge...    34   2.4     
gb:CQ859750_1454445 Sequence 41 from Patent WO2004072277.>gb:AK0...    33   3.2     
gb:CQ859748_1454444 Sequence 39 from Patent WO2004072277.              33   3.2     
gb:PFMAL1P1_1394249 Plasmodium falciparum DNA from MAL1P1, compl...    33   3.2     
gb:CR926020_1185536 Pongo pygmaeus mRNA; cDNA DKFZp459M0120 (fro...    33   3.2     
gb:AY613856_1340676 Oikopleura dioica clone BACOIKO008 5xo15, co...    33   4.2     
gb:AE016938_362386 Bacteroides thetaiotaomicron VPI-5482, sectio...    33   4.2     
gb:BC075168_2558280 Xenopus laevis MGC82072 protein, mRNA (cDNA ...    33   5.4     
gb:AE017346_1757151 Cryptococcus neoformans var. neoformans JEC2...    33   5.4     
gb:AX646995_1472123 Sequence 1187 from Patent EP1270724.               33   5.4     
gb:AY149017_1303968 Plasmodium chabaudi chabaudi PC15B mRNA, com...    33   5.4     
gb:AJ586576_526378 Xanthomonas albilineans gene cluster XALB1 fo...    33   5.4     
gb:AE017175_397300 Porphyromonas gingivalis W83 section 4 of 8 o...    33   5.4     
sp|Q8WXA9|SFRC_HUMAN|SFRC_HUMAN Splicing factor, arginine/serine-rich 12 (S...    33   5.4     Homo sapiens [man]
gb:AE017346_1757474 Cryptococcus neoformans var. neoformans JEC2...    32   7.1     
gb:AC133398_1741433 Oryza sativa chromosome 3 BAC OSJNBa0083F15 ...    32   7.1     
gb:AY589780_1616592 Saccharomyces mikatae SED1 gene, partial cds.      32   7.1     
gb:BA000030_704881 Streptomyces avermitilis MA-4680 genomic DNA,...    32   7.1     
pir|E70306|E70306 conserved hypothetical protein aq_066 - Aquife...    32   7.1     Aquifex aeolicus
pir|T24415|T24415 hypothetical protein T04A11.6 - Caenorhabditis...    32   7.1     Caenorhabditis elegans [roundworm]
sp|O18017|BLM_CAEEL|BLM_CAEEL Bloom's syndrome protein homolog (EC 3.6.1.-...    32   7.1     Caenorhabditis elegans [roundworm]
gb:AK129145_2069376 Mus musculus mRNA for mKIAA0444 protein.           32   9.3     
gb:AB025582_2044389 Mus musculus mRNA for proliferation related ...    32   9.3     
gb:HS384F21_1998383 Human DNA sequence from clone RP3-384F21 on ...    32   9.3     
gb:HS233K16_1997698 Human DNA sequence from clone RP1-233K16 on ...    32   9.3     
gb:HS120G22_1997031 Human DNA sequence from clone RP1-120G22 on ...    32   9.3     
gb:BC041888_1983156 Homo sapiens RAB GTPase activating protein 1...    32   9.3     
gb:BC021210_1977421 Homo sapiens hypothetical protein BC018697, ...    32   9.3     
gb:BC018654_1976556 Homo sapiens hypothetical protein BC018697, ...    32   9.3     
gb:AL592046_1930296 Human DNA sequence from clone RP11-155O24 on...    32   9.3     
gb:AL592046_1930295 Human DNA sequence from clone RP11-155O24 on...    32   9.3     
gb:AL592046_1930294 Human DNA sequence from clone RP11-155O24 on...    32   9.3     
gb:AL136377_1919160 Human DNA sequence from clone RP5-830A10 on ...    32   9.3     
gb:AK126012_1916159 Homo sapiens cDNA FLJ44024 fis, clone TESTI4...    32   9.3     
gb:AK095838_1914447 Homo sapiens cDNA FLJ38519 fis, clone HCHON2...    32   9.3     
gb:AF425231_1901805 Homo sapiens chromodomain helicase DNA bindi...    32   9.3     
gb:AB071605_1871213 Homo sapiens mRNA for HECT domain protein LA...    32   9.3     
gb:AB029010_1865866 Homo sapiens mRNA for KIAA1087 protein, part...    32   9.3     
gb:AB007913_1864030 Homo sapiens mRNA for KIAA0444 protein, part...    32   9.3     
gb:AB002310_1863617 Homo sapiens mRNA for KIAA0312 gene, partial...    32   9.3     
gb:AP002745_1822735 Oryza sativa (japonica cultivar-group) genom...    32   9.3     
gb:CENACAEX_1366363 C.elegans mRNA for protein similar to verteb...    32   9.3     
gb:PFMAL8P1_1192305 Plasmodium falciparum 3D7 chromosome 8, *** ...    32   9.3     
gb:HSM802121_1186609 Homo sapiens mRNA; cDNA DKFZp434P202 (from ...    32   9.3     
gb:HSM801006_1186019 Homo sapiens mRNA; cDNA DKFZp434N231 (from ...    32   9.3     
gb:HSM800877_1185964 Homo sapiens mRNA; cDNA DKFZp434K213 (from ...    32   9.3     
gb:CR858152_1182339 Pongo pygmaeus mRNA; cDNA DKFZp468O1511 (fro...    32   9.3     
gb:AF161390_1150283 Homo sapiens HSPC272 mRNA, partial cds.            32   9.3     
pir|T17269|T17269 hypothetical protein DKFZp434N231.1 - human (f...    32   9.3     Homo sapiens [man]
pir|JC7357|JC7357 31K proliferation related acidic leucine-rich ...    32   9.3     Rattus norvegicus [brown rat]
sp|Q9UPR5|NAC2_HUMAN|NAC2_HUMAN Sodium/calcium exchanger 2 precursor (Na(+)...    32   9.3     Homo sapiens [man]


>pir|D86221|D86221 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889899 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:BT012294_1641500 Arabidopsis thaliana
           At1g08960 gene, complete cds.>gb:F7G19_1678555 Sequence
           of BAC F7G19 from Arabidopsis thaliana chromosome 1,
           complete sequence.
          Length = 546

 Score =  185 bits (470), Expect = 5e-46
 Identities = 98/174 (56%), Positives = 121/174 (69%), Gaps = 4/174 (2%)
 Frame = +3

Query: 135 PTYSSNHPSKHIL----LSPHRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQNPFL 302
           PT+  +HP + +L    ++ + S + +P+ SC    S ++ G+ NYFS+H C+F +N F 
Sbjct: 33  PTFP-DHPLRSLLDDSQITTNSSSIVNPKSSCVSSRSHDNGGVINYFSLHYCIFNENLFF 91

Query: 303 SVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASV 482
           S+P L L +LL+FYILI TAQ HFS V TKL   L LSPSM AVTLLALGNGAPDVFASV
Sbjct: 92  SIPILSLLILLHFYILIKTAQTHFSTVTTKLADRLNLSPSMAAVTLLALGNGAPDVFASV 151

Query: 483 AAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIYXXXXXXXXXXXXXXXMFYLTA 644
           AA++GGQ RTGFGAILSAGTFVSAFVVGFV+IY               +FYL A
Sbjct: 152 AALRGGQYRTGFGAILSAGTFVSAFVVGFVAIYAAPFPVDAASFVRDVLFYLIA 205



 Score = 35.4 bits (80), Expect = 0.84
 Identities = 24/74 (32%), Positives = 37/74 (50%)
 Frame = +3

Query: 324 FVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQ 503
           F++  F+I  +T        +  L   L+L P++  +T+LA GN   D+ A VA  K G+
Sbjct: 393 FIMSVFWI--STIAGELLNCLAALGTLLKLPPALLGLTVLAWGNSVGDLVADVAVAKAGR 450

Query: 504 PRTGFGAILSAGTF 545
           P     A+  AG F
Sbjct: 451 P-----AMAMAGCF 459



>gb:AP000600_1820366 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MAG2.
          Length = 643

 Score = 89.0 bits (219), Expect = 6e-17
 Identities = 51/125 (40%), Positives = 70/125 (56%), Gaps = 4/125 (3%)
 Frame = +3

Query: 216 CRFFSSD---ESDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVV 386
           C F  ++     DG F+Y S   C  R    L    LG++++  FY+L  TA  +F   +
Sbjct: 105 CEFLKANPICSPDGFFDYLSFFYCSCRDFSILGYMMLGVWLVALFYLLGNTAADYFCCSL 164

Query: 387 TKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKG-GQPRTGFGAILSAGTFVSAFVV 563
            KL   LRL P++  VTLL LGNGAPDVFAS+AA  G  +   G  ++L    FV++ VV
Sbjct: 165 EKLSKLLRLPPTVAGVTLLPLGNGAPDVFASIAAFVGTDKGEVGLNSVLGGAVFVTSVVV 224

Query: 564 GFVSI 578
           G VS+
Sbjct: 225 GIVSL 229



>pir|B96582|B96582 hypothetical protein F15I1.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_893309 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F15I1_1677534 Sequence of BAC F15I1 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 644

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 51/125 (40%), Positives = 68/125 (54%), Gaps = 4/125 (3%)
 Frame = +3

Query: 216 CRFFSSD---ESDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVV 386
           C F  S+     DG F+Y     C  R    L    LG++++  FY+L  TA  +F   +
Sbjct: 104 CEFLKSNPICSPDGFFDYLKFFYCSCRDFKILGYILLGVWLVALFYLLGNTAADYFCCSL 163

Query: 387 TKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG-QPRTGFGAILSAGTFVSAFVV 563
            KL   LRL P++  VTLL LGNGAPDVFAS+AA  G  +   G  ++L    FV+  VV
Sbjct: 164 EKLSKLLRLPPTVAGVTLLPLGNGAPDVFASIAAFVGSDKGEVGLNSVLGGAVFVTCVVV 223

Query: 564 GFVSI 578
           G VS+
Sbjct: 224 GIVSL 228



>gb:AF462830_1801941 Arabidopsis thaliana AT5g17860/MVA3_210 mRNA,
           complete cds.
          Length = 570

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 4/132 (3%)
 Frame = +3

Query: 195 LNSPQPSCRFFSSDES---DGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQ 365
           L+  +  C +  S       G  +Y  I  C+F Q+P L    L  ++ + FY+L  TA 
Sbjct: 62  LDDHRSKCSYIRSQSKCGPQGYIDYLKIFFCIFGQSPVLGHLVLSAWLFVLFYLLGDTAA 121

Query: 366 AHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAA-VKGGQPRTGFGAILSAGT 542
           ++F   +  L   L+LSP+M  VTLL+LGNGAPD+F+SV +  +      G  +IL    
Sbjct: 122 SYFCPSLDSLSKVLKLSPTMAGVTLLSLGNGAPDLFSSVVSFTRSNNGDFGLNSILGGAF 181

Query: 543 FVSAFVVGFVSI 578
           FVS+FVVG + +
Sbjct: 182 FVSSFVVGTICV 193



>gb:AB011480_1511451 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPI7.>gb:AY142021_1582858 Arabidopsis thaliana
           At5g17860/MVA3_210 mRNA, complete cds.
          Length = 570

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 4/132 (3%)
 Frame = +3

Query: 195 LNSPQPSCRFFSSDES---DGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQ 365
           L+  +  C +  S       G  +Y  I  C+F Q+P L    L  ++ + FY+L  TA 
Sbjct: 62  LDDHRSKCSYIRSQSKCGPQGYIDYLKIFFCIFGQSPVLGHLVLSAWLFVLFYLLGDTAA 121

Query: 366 AHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAA-VKGGQPRTGFGAILSAGT 542
           ++F   +  L   L+LSP+M  VTLL+LGNGAPD+F+SV +  +      G  +IL    
Sbjct: 122 SYFCPSLDSLSKVLKLSPTMAGVTLLSLGNGAPDLFSSVVSFTRSNNGDFGLNSILGGAF 181

Query: 543 FVSAFVVGFVSI 578
           FVS+FVVG + +
Sbjct: 182 FVSSFVVGTICV 193



>gb:AC125472_1740507 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0050H14, complete
           sequence.>gb:AC126223_1740528 Oryza sativa (japonica
           cultivar-group) chromosome 3 clone OSJNBb0076N15,
           complete sequence.
          Length = 639

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 46/114 (40%), Positives = 61/114 (53%), Gaps = 1/114 (0%)
 Frame = +3

Query: 240 SDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSP 419
           S G  +Y     C   +   L    LG+ +   FY+L  TA  +F   + K+ A LRL P
Sbjct: 109 SGGFVDYLGFFYCRCERFRVLGYAVLGVCLAALFYMLGNTAADYFCCSLEKMSALLRLPP 168

Query: 420 SMGAVTLLALGNGAPDVFASVAAVKG-GQPRTGFGAILSAGTFVSAFVVGFVSI 578
           ++  VTLL  GNGAPDVFAS+AA  G G    G  ++L    FV+  VVG VS+
Sbjct: 169 TVAGVTLLPFGNGAPDVFASIAAFMGTGAGDVGLNSVLGGAVFVTCVVVGAVSL 222



>gb:AC133859_1741535 Oryza sativa chromosome 3 BAC OSJNBa0075A22
           genomic sequence, complete sequence.
          Length = 575

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 43/112 (38%), Positives = 58/112 (51%), Gaps = 1/112 (0%)
 Frame = +3

Query: 246 GLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSM 425
           G  +Y  +  C F   P        L++ + FY+L  TA  +F   +  L A LRL P++
Sbjct: 97  GYVDYLRLFYCGFAHAPAAGYAAAVLWLAVLFYLLGDTASEYFCASLEGLSAELRLPPAI 156

Query: 426 GAVTLLALGNGAPDVFASVAAVKGGQ-PRTGFGAILSAGTFVSAFVVGFVSI 578
             VTLL+LGNGAPDVFASV +   G     G  + L    FVS  V G V++
Sbjct: 157 AGVTLLSLGNGAPDVFASVVSFAAGDGGGVGLNSALGGALFVSTVVAGVVAL 208



>gb:AF466201_1802241 Sorghum bicolor clone SBTXS_0032H17 putative
           cytochrome P450-like protein, putative DNA-binding
           protein homolog, TATA-binding protein, hypothetical
           protein M3E9.200, 3-glucanase, K-exchanger-like protein,
           small heat shock-like protein, methionine synthase
           protein, putative far-red impaired response protein, and
           putative vegetative storage protein genes, complete cds.
          Length = 573

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 44/113 (38%), Positives = 61/113 (53%), Gaps = 2/113 (1%)
 Frame = +3

Query: 246 GLFNYFSIHSCLFRQNPFLSV-PFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPS 422
           G  +Y  +  C F   P  +    L L++++ FY+L  TA  +F   +  L A LRL P+
Sbjct: 88  GYVDYLRLFYCAFAGAPAAAACAALALWLVVLFYLLGDTASEYFCASLEGLSAALRLPPA 147

Query: 423 MGAVTLLALGNGAPDVFASVAAVKGGQ-PRTGFGAILSAGTFVSAFVVGFVSI 578
           +  VTLL+LGNGAPDVFASV +   G     G  + L    FVS  V G V++
Sbjct: 148 VAGVTLLSLGNGAPDVFASVVSFASGDGGGVGLSSALGGALFVSTVVAGVVAL 200



>gb:AY542797_1188314 Zea mays chromosome 5 clone Z474J15 map 5S, ***
           SEQUENCING IN PROGRESS ***, 9 ordered pieces.
          Length = 516

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 1/110 (0%)
 Frame = +3

Query: 246 GLFNYFSIHSCLFRQNPFLSV-PFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPS 422
           G  +Y  +  C F   P  +    L L++ + FY+L  TA  +F   +  L A LRL P+
Sbjct: 91  GYVDYLRLFYCAFAGAPAAAACAALALWLAVLFYLLGDTASEYFCASLEGLSAALRLPPA 150

Query: 423 MGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           +  VTLL+LGNGAPDVFASV +   G    G   +  A +FVS + VG+V
Sbjct: 151 VAGVTLLSLGNGAPDVFASVVSFASGDDGGGGVTVWVAASFVSLY-VGYV 199



>pir|S40705|S40705 Na+/Ca2+,K+-exchanging protein homolog -
           Caenorhabditis elegans
          Length = 591

 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 3/111 (2%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           +++L+ F ++ + A   FS  ++ +VAHLR+S S+  VT +A GNGAPDVF ++A+V   
Sbjct: 105 IYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSS 164

Query: 501 ---QPRTGFGAILSAGTFVSAFVVGFVSIYXXXXXXXXXXXXXXXMFYLTA 644
              +     G +  AG FV+  V+  V+I+                FYL A
Sbjct: 165 PTPKADLALGELFGAGLFVTTMVLA-VTIFTRPFKAEVFSSIRDIAFYLVA 214



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 25/98 (25%), Positives = 44/98 (44%)
 Frame = +3

Query: 252 FNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGA 431
           ++ F+I    F  +    + + G  + + +  LI++   +   VVT L    R+S  +  
Sbjct: 420 YSLFNISISKFSWSLDSLISYAGFLMSIAWIYLISSEVVN---VVTMLGVVSRVSHEVLG 476

Query: 432 VTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTF 545
           +T+LA  N   D+ A V+  K G PR    A +    F
Sbjct: 477 LTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLF 514



>sp|P34315|NCX6_CAEEL Putative sodium/calcium exchanger 6 precursor
           (Na(+)/Ca(2+)-exchange protein 6).>gb:CEC07A9_1360159
           Caenorhabditis elegans cosmid C07A9, complete sequence.
          Length = 590

 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 3/111 (2%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           +++L+ F ++ + A   FS  ++ +VAHLR+S S+  VT +A GNGAPDVF ++A+V   
Sbjct: 105 IYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSS 164

Query: 501 ---QPRTGFGAILSAGTFVSAFVVGFVSIYXXXXXXXXXXXXXXXMFYLTA 644
              +     G +  AG FV+  V+  V+I+                FYL A
Sbjct: 165 PTPKADLALGELFGAGLFVTTMVLA-VTIFTRPFKAEVFSSIRDIAFYLVA 214



 Score = 35.4 bits (80), Expect = 0.84
 Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 2/99 (2%)
 Frame = +3

Query: 279 LFRQNPFLS--VPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALG 452
           L ++ PF    + + G  + + +  LI++   +   VVT L    R+S  +  +T+LA  
Sbjct: 420 LHKEPPFYKSLISYAGFLMSIAWIYLISSEVVN---VVTMLGVVSRVSHEVLGLTILAWS 476

Query: 453 NGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGF 569
           N   D+ A V+  K G PR    A +    F    ++GF
Sbjct: 477 NSIGDLIADVSVAKQGYPRMAMAAAIGGQLF--NLLIGF 513



>gb:AE016959_1022750 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017098_1752569
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 52 of 77 of the complete sequence.
          Length = 608

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 6/117 (5%)
 Frame = +3

Query: 246 GLFNYFSIHSCLF-RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPS 422
           G  +Y  +  C+F  +   L    +  ++ + FY+L  TA  +F   +  L   LRLSP+
Sbjct: 98  GYVDYLYLFDCVFGEERRVLGYAVMAAWLAVLFYLLGDTAAVYFCSSLEGLSRLLRLSPA 157

Query: 423 MGAVTLLALGNGAPDVFASVA--AVKGGQPRT---GFGAILSAGTFVSAFVVGFVSI 578
           +  VTLL+LGNGAPD  +++A  A  GG+  T   G   +L +   VS+ V+G + +
Sbjct: 158 IAGVTLLSLGNGAPDALSTIASFASGGGEGETTAVGLNGVLGSAMLVSSAVLGVIGV 214



>pir|S40707|S40707 hypothetical protein C07A9.11 - Caenorhabditis
           elegans
          Length = 590

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 3/111 (2%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           +++L+ F ++ + A   FS  ++ +VAHLR+S S+  VT +A GNGAPDVF S+A+V   
Sbjct: 14  IYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSS 73

Query: 501 ---QPRTGFGAILSAGTFVSAFVVGFVSIYXXXXXXXXXXXXXXXMFYLTA 644
              +     G +   G FV+  VV  + I                +FYL A
Sbjct: 74  PTPKADLALGELFGGGLFVTTMVVSTI-ILTSPFDVEVFSTIRDLLFYLVA 123



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 381 VVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTF 545
           VVT L    R+S  +  +T+LA  N   D+ A V+ VK G PR    A +    F
Sbjct: 453 VVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLF 507



>sp|P34322|NCX7_CAEEL Putative sodium/calcium exchanger 7 precursor
           (Na(+)/Ca(2+)-exchange protein 7).>gb:CEC07A9_1360160
           Caenorhabditis elegans cosmid C07A9, complete sequence.
          Length = 691

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 3/111 (2%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           +++L+ F ++ + A   FS  ++ +VAHLR+S S+  VT +A GNGAPDVF S+A+V   
Sbjct: 115 IYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSS 174

Query: 501 ---QPRTGFGAILSAGTFVSAFVVGFVSIYXXXXXXXXXXXXXXXMFYLTA 644
              +     G +   G FV+  VV  + I                +FYL A
Sbjct: 175 PTPKADLALGELFGGGLFVTTMVVSTI-ILTSPFDVEVFSTIRDLLFYLVA 224



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/55 (36%), Positives = 27/55 (49%)
 Frame = +3

Query: 381 VVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTF 545
           VVT L    R+S  +  +T+LA  N   D+ A V+ VK G PR    A +    F
Sbjct: 554 VVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLF 608



>pir|T38674|T38674 probable membrane transport protein - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPAC3A12_1717788
           S.pombe chromosome I cosmid c3A12.
          Length = 743

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 45/149 (30%), Positives = 70/149 (46%), Gaps = 6/149 (4%)
 Frame = +3

Query: 150 NHPSKHILLSPHRSLLNSPQPSCRF---FSSDESDGLFNYFSIHSCLFRQNPFLSVPFLG 320
           N  +  ILL+ +     +P   CRF   +   E+ G F+Y   + C       L  P L 
Sbjct: 57  NDSNDQILLTCNDIKNITPANQCRFAKAYCKGEASGFFDYVEFYFCTINS---LRFPVLS 113

Query: 321 LFVLLYFYILIT---TAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           + V    ++ IT   +A   FS  +  +   L+L  S+  VT LALGNG+PD+ ++ AAV
Sbjct: 114 IIVGWLIFLFITIGISASDFFSTNLVTISWLLQLPDSVVGVTFLALGNGSPDILSTFAAV 173

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSI 578
           +        G +L +  F+ A V G V +
Sbjct: 174 RVNSGGMAIGELLGSAFFIVAIVAGSVCL 202



>gb:CR382132_1665694 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 812

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 36/117 (30%), Positives = 65/117 (55%), Gaps = 1/117 (0%)
 Frame = +3

Query: 231 SDESDGLFNYFSIHSCL-FRQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHL 407
           S++ +   +Y  ++ C  + Q PFL +  L L++L  F  L   A       +  + + L
Sbjct: 72  SEDENTFIDYMQVYYCSPYGQRPFLLIMLL-LWLLTLFMTLGIAASDFLCPNLGTISSLL 130

Query: 408 RLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSI 578
            +S S+  VT LA GNG+PD+F++ +++K G      G ++ A +F+SA VVG +++
Sbjct: 131 GMSESLAGVTFLAFGNGSPDLFSTYSSMKIGSGSLAIGELIGAASFISAVVVGAMAL 187



>gb:BC043689_2098954 Mus musculus solute carrier family 24
           (sodium/potassium/calcium exchanger), member 6, mRNA
           (cDNA clone MGC:49300 IMAGE:5137181), complete cds.
          Length = 552

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 42/127 (33%), Positives = 63/127 (49%), Gaps = 4/127 (3%)
 Frame = +3

Query: 210 PSCRFFSSDESDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILI-TTAQAHFSVVV 386
           P CR        G  +Y     C F  N       L +F LLY ++++  TA   F   +
Sbjct: 72  PDCR-----SEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNL 126

Query: 387 TKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRT---GFGAILSAGTFVSAF 557
           + +  +L+LS ++  VT LA GNGAPD+F+++ A     PRT     GA+  AG  V+  
Sbjct: 127 SAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTV 184

Query: 558 VVGFVSI 578
           V G ++I
Sbjct: 185 VAGGITI 191



>gb:AF261233_2060836 Mus musculus sodium/calcium exchanger protein
           mRNA, complete cds.
          Length = 585

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 42/127 (33%), Positives = 63/127 (49%), Gaps = 4/127 (3%)
 Frame = +3

Query: 210 PSCRFFSSDESDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILI-TTAQAHFSVVV 386
           P CR        G  +Y     C F  N       L +F LLY ++++  TA   F   +
Sbjct: 72  PDCR-----SEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNL 126

Query: 387 TKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRT---GFGAILSAGTFVSAF 557
           + +  +L+LS ++  VT LA GNGAPD+F+++ A     PRT     GA+  AG  V+  
Sbjct: 127 SAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTV 184

Query: 558 VVGFVSI 578
           V G ++I
Sbjct: 185 VAGGITI 191



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L   LRLS ++  +TLLA GN   D F+     
Sbjct: 420 LFAFLGFLTSALWINAAATEVVNILRSLGVILRLSNTVLGLTLLAWGNSIGDAFSDFTLA 479

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 480 RQGYPRMAFSA 490



>pir|T03889|T03889 Na+/Ca2+,K+-exchanging protein homolog C13D9.8 -
           Caenorhabditis elegans>gb:AF016420_1232211
           Caenorhabditis elegans cosmid C13D9, complete sequence.
          Length = 651

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 4/141 (2%)
 Frame = +3

Query: 231 SDESDGLFNYFSIHSCLFRQNPFLSVPFLG-LFVLLYFYILITTAQAHFSVVVTKLVAHL 407
           S E  G   +     C +     + +  LG L++++ F I+ + A   F   ++ +V+HL
Sbjct: 28  SCEGGGYLTWSHYVKCQYNIGVRVILIILGILYLIILFVIMSSIADDFFCPAISGIVSHL 87

Query: 408 RLSPSMGAVTLLALGNGAPDVFASVAAV-KGGQPRT--GFGAILSAGTFVSAFVVGFVSI 578
           R+S S+  VT LA GNGAPDVF+S+++V    +P+     G +     FV+  V+  + I
Sbjct: 88  RMSESIAGVTFLAFGNGAPDVFSSISSVLTTPKPKADLALGDLFGTSIFVTTVVLAII-I 146

Query: 579 YXXXXXXXXXXXXXXXMFYLT 641
           +               +FY+T
Sbjct: 147 FTKSFKVAIIPTLRDLIFYMT 167



>gb:AC024881_1205080 Caenorhabditis elegans cosmid Y97E10B, complete
           sequence.
          Length = 668

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 32/87 (36%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV-KG 497
           +++L  F ++   A   FS  +  +V HL++S S+  VT LA GNGAPDVF S+A+V   
Sbjct: 109 IYLLFLFVVMTVVADDFFSPSIAGIVRHLKISESIAGVTFLAFGNGAPDVFGSIASVITT 168

Query: 498 GQPRT--GFGAILSAGTFVSAFVVGFV 572
            +P+     G I+  G FV+  V+  +
Sbjct: 169 PKPKADLAIGDIIGGGIFVTTVVLSAI 195



>gb:BC079350_2107470 Rattus norvegicus cDNA clone MGC:94807
           IMAGE:7107820, complete cds.
          Length = 585

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 39/115 (33%), Positives = 59/115 (51%), Gaps = 4/115 (3%)
 Frame = +3

Query: 246 GLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILI-TTAQAHFSVVVTKLVAHLRLSPS 422
           G  +Y     C F  N       L +F LLY ++++  TA   F   ++ +   L+LS +
Sbjct: 79  GYLDYLKGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTSLKLSHN 138

Query: 423 MGAVTLLALGNGAPDVFASVAAVKGGQPRT---GFGAILSAGTFVSAFVVGFVSI 578
           +  VT LA GNGAPD+F+++ A     PRT     GA+  AG  V+  V G ++I
Sbjct: 139 VAGVTFLAFGNGAPDIFSALVAF--SDPRTAGLAIGALFGAGVLVTTVVAGGITI 191



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 420 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 479

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 480 RQGYPRMAFSA 490



>gb:AB049713_1520902 Pisum sativum ssa-2 mRNA for putative
           senescence-associated protein, complete cds.
          Length = 284

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 36/105 (34%), Positives = 52/105 (49%)
 Frame = +3

Query: 183 HRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTA 362
           H    +SP    +      S+G  +Y     C  +    L    LG+++   FY+L  TA
Sbjct: 101 HHDGYDSPCEFLKVNPQCTSEGYIDYLRFFFCKCQSFRVLGYLVLGVWLAALFYLLGNTA 160

Query: 363 QAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKG 497
             +F   +  L   L+L P++  V LL LGNGAPDVFAS+A+  G
Sbjct: 161 ADYFCPSLEHLSELLKLPPTVAGVVLLPLGNGAPDVFASIASFVG 205



>pir|T03888|T03888 Na+/Ca2+,K+-exchanging protein homolog C13D9.7 -
           Caenorhabditis elegans>gb:AF016420_1232210
           Caenorhabditis elegans cosmid C13D9, complete sequence.
          Length = 703

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 4/118 (3%)
 Frame = +3

Query: 231 SDESDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITT-AQAHFSVVVTKLVAHL 407
           S E  G   +     C +     + +  +G+  L++ +++++T A   F   ++ +V HL
Sbjct: 79  SCEGGGYLTWSHYVKCQYNIGARVVLIIVGIIYLIFLFVVMSTIADDFFCPSISGIVTHL 138

Query: 408 RLSPSMGAVTLLALGNGAPDVFASVAAV-KGGQPRT--GFGAILSAGTFVSAFVVGFV 572
           ++S S+  VT LA GNGAPDVF S+++V    +P+     G +     FV+  V+  +
Sbjct: 139 KMSESIAGVTFLAFGNGAPDVFGSISSVLSTPKPKAALALGDLFGTSIFVTTVVLAII 196



>gb:AE017341_1754606 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 974

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 37/117 (31%), Positives = 63/117 (53%), Gaps = 1/117 (0%)
 Frame = +3

Query: 228 SSDESDGLFNYFSIHSCLFRQNPFLSVPFLGLFVLLYFYILITTAQAHFSVV-VTKLVAH 404
           S D+S   F Y   ++ L      + + FL LF+L + +  I  + A F    ++ + A+
Sbjct: 53  SDDDSILDFPYLDWYNALPLTYRPIFILFL-LFILAFLFSFIGISAADFFCPNLSTVAAY 111

Query: 405 LRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVS 575
           L L+ S   VT LA GNG+PDVF++ +A+  G      G ++ A +F+ + VVG ++
Sbjct: 112 LGLNESTAGVTFLAFGNGSPDVFSTFSAMSSGTLGLAVGELIGAASFIVSIVVGSIA 168



>gb:AY601759_1957331 Homo sapiens Na+/Ca2+ K+ independent exchanger
           (NCLX) mRNA, complete cds, alternatively spliced.
          Length = 584

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query: 300 LSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFAS 479
           L+V     ++L  F IL  TA   F   ++ +   L+LS ++  VT LA GNGAPD+F++
Sbjct: 98  LAVTLYVSWLLYLFLILGVTAAKFFCPNLSAIPTTLKLSHNVAGVTFLAFGNGAPDIFSA 157

Query: 480 VAAVKGGQPRT---GFGAILSAGTFVSAFVVGFVSI 578
           + A     P T     GA+  AG  V+  V G ++I
Sbjct: 158 LVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITI 191



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 420 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 479

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 480 RQGYPRMAFSA 490



>gb:AX537505_1470015 Sequence 1 from Patent
           EP1241260.>gb:AX537507_1470016 Sequence 3 from Patent
           EP1241260.
          Length = 584

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query: 300 LSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFAS 479
           L+V     ++L  F IL  TA   F   ++ +   L+LS ++  VT LA GNGAPD+F++
Sbjct: 98  LAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSA 157

Query: 480 VAAVKGGQPRT---GFGAILSAGTFVSAFVVGFVSI 578
           + A     P T     GA+  AG  V+  V G ++I
Sbjct: 158 LVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITI 191



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 420 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 479

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 480 RQGYPRMAFSA 490



>gb:CQ859746_1454443 Sequence 37 from Patent WO2004072277.
          Length = 559

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query: 300 LSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFAS 479
           L+V     ++L  F IL  TA   F   ++ +   L+LS ++  VT LA GNGAPD+F++
Sbjct: 98  LAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSA 157

Query: 480 VAAVKGGQPRT---GFGAILSAGTFVSAFVVGFVSI 578
           + A     P T     GA+  AG  V+  V G ++I
Sbjct: 158 LVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITI 191



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 420 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 479

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 480 RQGYPRMAFSA 490



>gb:CQ859744_1454442 Sequence 35 from Patent WO2004072277.
          Length = 559

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +3

Query: 300 LSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFAS 479
           L+V     ++L  F IL  TA   F   ++ +   L+LS ++  VT LA GNGAPD+F++
Sbjct: 98  LAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSA 157

Query: 480 VAAVKGGQPRT---GFGAILSAGTFVSAFVVGFVSI 578
           + A     P T     GA+  AG  V+  V G ++I
Sbjct: 158 LVAF--SDPHTAGLALGALFGAGVLVTTVVAGGITI 191



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 420 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 479

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 480 RQGYPRMAFSA 490



>gb:AE013599_1131216 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003826_1226433 Drosophila melanogaster
           chromosome 2R, section 24 of 74 of the complete
           sequence.
          Length = 527

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 4/140 (2%)
 Frame = +3

Query: 165 HILLSPHRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQ----NPFLSVPFLGLFVL 332
           H LL   +       P C       +  LFNY   H C        N F SV  + L  +
Sbjct: 3   HDLLESQKCKFVQTTPDCLI-----NMNLFNYLGWHYCKVDVRNSFNSFWSVLGMFLITI 57

Query: 333 LYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRT 512
             F+++  T + +F   +  +   LR++ S   VT+LA+ NG+PD F ++A+ +    + 
Sbjct: 58  YVFWMMQITIKNYFCPTLMVIADLLRMNESTAGVTVLAIANGSPDFFTAIAS-RVQTSKH 116

Query: 513 GFGAILSAGTFVSAFVVGFV 572
            F + +S   F+  FV G V
Sbjct: 117 SFLSCMSQAMFLHIFVAGLV 136



>gb:AY075148_1296003 Tetrahymena thermophila cation-exchanger
           protein 1 mRNA, complete cds.
          Length = 594

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 39/107 (36%), Positives = 59/107 (55%), Gaps = 3/107 (2%)
 Frame = +3

Query: 252 FNYFSIHSCLFRQNPFLSVPFLGLFVLLY-FYILITTAQAHFSVVVTKLVAHLRLSPSMG 428
           F+YF  + C  +Q+  + +  L + + LY F +L   ++ + S  + K+    +LS S+ 
Sbjct: 36  FSYF--YFCQVKQS-IIVLDLLTILIPLYAFRMLSQISEYYLSPALAKVSKCFKLSQSVA 92

Query: 429 AVTLLALGNGAPDV-FASVAAVKGGQPRT-GFGAILSAGTFVSAFVV 563
            VTLLALGNG PDV  A VA   GG   T   G+I  AG FV+ + +
Sbjct: 93  GVTLLALGNGGPDVATAIVAGSSGGDSITIAVGSIFGAGLFVTTYTL 139



>gb:CR382136_1668827 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 710

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 1/118 (0%)
 Frame = +3

Query: 228 SSDESDGLFNYFSIHSCLFRQ-NPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAH 404
           +S+   G  NY +++ C F     F  +P L    LL F  L  TA  +    +  +   
Sbjct: 57  ASEIDIGRVNYLALYYCKFPALKSFSVIPLLSCLSLL-FIALGMTASDYLCPNLYTISKF 115

Query: 405 LRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSI 578
           L LS ++  +TLLA GNG+PDV ++  A+           ++ A  F+   +VG +++
Sbjct: 116 LELSDNLAGLTLLAFGNGSPDVLSTYKAMSLDSGSLAISELMGAALFIITVIVGSMAV 173



>gb:AY070497_1294642 Drosophila melanogaster GH07338 full length
           cDNA.
          Length = 617

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = +3

Query: 216 CRFFSS----DESDGLFNYFSIHSC-LFRQNPFLSVPFLGLFVLLYFYILIT---TAQAH 371
           C F +S    + S  +  Y  I +C L   N F  V FL LF+ L + IL+        +
Sbjct: 37  CAFVASAKDCNRSTNVLPYMRIMACDLNCVNEFEQVIFLALFMGLCYEILVLLIHVCNKY 96

Query: 372 FSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVS 551
           +S  +  +   L ++  +  VTLLA GN + D+F+++A+V    P   F   L+A  FVS
Sbjct: 97  YSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASVNANVP--VFANSLAAALFVS 154

Query: 552 AFVVGFV 572
               G +
Sbjct: 155 MVSGGLI 161



>gb:AE013599_1130688 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003836_1227020 Drosophila melanogaster
           chromosome 2R, section 14 of 74 of the complete
           sequence.
          Length = 582

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = +3

Query: 216 CRFFSS----DESDGLFNYFSIHSC-LFRQNPFLSVPFLGLFVLLYFYILIT---TAQAH 371
           C F +S    + S  +  Y  I +C L   N F  V FL LF+ L + IL+        +
Sbjct: 37  CAFVASAKDCNRSTNVLPYMRIMACDLNCVNEFEQVIFLALFMGLCYEILVLLIHVCNKY 96

Query: 372 FSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVS 551
           +S  +  +   L ++  +  VTLLA GN + D+F+++A+V    P   F   L+A  FVS
Sbjct: 97  YSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASVNANVP--VFANSLAAALFVS 154

Query: 552 AFVVGFV 572
               G +
Sbjct: 155 MVSGGLI 161



>gb:CEL5701_1365857 Caenorhabditis elegans mRNA for
           Na/Ca,K-exchanger.
          Length = 596

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 30/99 (30%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQN F+ +   GL  +  F  L       F   +  L   L LS  +   T +A G  AP
Sbjct: 97  RQNGFVVLHMCGLIYM--FVSLAIVCDEFFVPSLDVLTEKLSLSDDVAGATFMAAGGSAP 154

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           + F SV  V   Q   G G I+ + TF    V+ F +++
Sbjct: 155 EFFTSVIGVFIAQNNVGIGTIVGSATFNILCVLAFCTLF 193



>gb:CEF35C12_1363397 Caenorhabditis elegans cosmid F35C12, complete
           sequence.
          Length = 596

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 30/99 (30%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQN F+ +   GL  +  F  L       F   +  L   L LS  +   T +A G  AP
Sbjct: 97  RQNGFVVLHMCGLIYM--FVSLAIVCDEFFVPSLDVLTEKLSLSDDVAGATFMAAGGSAP 154

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           + F SV  V   Q   G G I+ + TF    V+ F +++
Sbjct: 155 EFFTSVIGVFIAQNNVGIGTIVGSATFNILCVLAFCTLF 193



>pir|T21747|T21747 hypothetical protein F35C12.2 - Caenorhabditis
           elegans
          Length = 611

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 30/99 (30%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQN F+ +   GL  +  F  L       F   +  L   L LS  +   T +A G  AP
Sbjct: 112 RQNGFVVLHMCGLIYM--FVSLAIVCDEFFVPSLDVLTEKLSLSDDVAGATFMAAGGSAP 169

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           + F SV  V   Q   G G I+ + TF    V+ F +++
Sbjct: 170 EFFTSVIGVFIAQNNVGIGTIVGSATFNILCVLAFCTLF 208



>gb:BC016094_2092171 Mus musculus solute carrier family 24
           (sodium/potassium/calcium exchanger), member 1, mRNA
           (cDNA clone MGC:27617 IMAGE:4504496), complete cds.
          Length = 1130

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYILITTAQAHFSVVVTKLVAH-LRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F ++Y ++ +      + V    ++ H L++S  +   T +A G  AP++F S+  V
Sbjct: 424 LHIFGMMYVFVALAIVCDEYFVPALGVITHKLQISEDVAGATFMAAGGSAPELFTSLIGV 483

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  +++
Sbjct: 484 FISHSNVGIGTIVGSAVFNILFVIGTCALF 513



>gb:AE013599_1132280 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003805_1225370 Drosophila melanogaster
           chromosome 2R, section 45 of 74 of the complete
           sequence.
          Length = 600

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 8/127 (6%)
 Frame = +3

Query: 216 CRFFSSDE----SDGLFNYFSIHSCLFRQ-NPFLSVPFLGLFVLLYFYILIT---TAQAH 371
           C F    E    S  +  Y  + +C  +  N F  + F+ LFV   F IL+    T   +
Sbjct: 45  CEFVQKAEDCNSSTNVIPYMRLLACDLKCINQFQEMIFIALFVAFCFQILVLLIYTINVY 104

Query: 372 FSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVS 551
           +S  +  +   L ++  +  VTL+A GN + D FA++A+V+   P   F   LS+  FV 
Sbjct: 105 YSPALKAVSRFLHMNEHLAGVTLMAFGNTSADFFANLASVERHVP--VFANNLSSALFVI 162

Query: 552 AFVVGFV 572
               G +
Sbjct: 163 TISGGLI 169



>gb:AY601760_1957332 Homo sapiens Na+/Ca2+ K+ independent exchanger
           short splice isoform (NCLX) mRNA, complete cds,
           alternatively spliced.
          Length = 528

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 29/93 (31%), Positives = 49/93 (52%)
 Frame = +3

Query: 300 LSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFAS 479
           L+V     ++L  F IL  TA   F   ++ +   L+LS ++  VT LA GNGAPD+F++
Sbjct: 98  LAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSA 157

Query: 480 VAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSI 578
           + A     P T   A+ +   ++  +V   V++
Sbjct: 158 LVAF--SDPHTAGLALGALFGYLGLYVFYVVTV 188



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 364 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 423

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 424 RQGYPRMAFSA 434



>gb:AF177987_1888186 Homo sapiens cone sodium-calcium potassium
           exchanger splice variant (NCKX) mRNA, complete
           cds.>gb:AL133281_1918319 Human DNA sequence from clone
           RP11-252O2 on chromosome 9p22.1-22.3 Contains part of
           the SLC24A2 gene for solute carrier family 24
           (sodium/potassium/calcium exchanger), member 2 (NCKX2)
           and a pseudogene similar to part of a novel gene,
           complete sequence.>gb:AL158077_1921296 Human DNA
           sequence from clone RP11-471J7 on chromosome 9 Contains
           the 5' end of the SLC24A2 gene for solute carrier family
           24 (sodium/potassium/calcium exchanger), member 2
           (NCKX2) and a CpG island, complete
           sequence.>gb:AL158206_1921431 Human DNA sequence from
           clone RP11-363E7 on chromosome 9 Contains the 3' end of
           a novel gene, possible ortholog of mouse cancer related
           gene-liver 1 (CRG-L1), a tmicortubule-associated protein
           pseudogene, the 3' end of the SLC24A2 gene for solute
           carrier family 24 (sodium/potassium/calcium exchanger)
           member 2 (NCKX2) and 2 CpG islands, complete sequence.
          Length = 644

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 40/199 (20%), Positives = 78/199 (39%), Gaps = 7/199 (3%)
 Frame = +3

Query: 6   KTPRVNCLSFFWYGMAFNSAALTTTAISXXXXXXXXXXXXXXPPTYSSNHPSKHILLSPH 185
           K   +  L  F   +A ++ + + +A S               P  +  +  + +L    
Sbjct: 33  KLKLIRVLGLFMGLVAISTVSFSISAFSETDTQSTGEASVVSGPRVAQGYHQRTLLDLND 92

Query: 186 RSLLNSPQPSCRFF-----SSDESDGLF--NYFSIHSCLFRQNPFLSVPFLGLFVLLYFY 344
           + L  +PQP          S+D + G +  + FS+     R+   + +  +G+  +  F 
Sbjct: 93  KILDYTPQPPLSKEGESENSTDHAQGDYPKDIFSLEE---RRKGAIILHVIGMIYM--FI 147

Query: 345 ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGA 524
            L       F   +T +   L +S  +   T +A G  AP++F S+  V       G G 
Sbjct: 148 ALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHSNVGIGT 207

Query: 525 ILSAGTFVSAFVVGFVSIY 581
           I+ +  F   FV+G  +++
Sbjct: 208 IVGSAVFNILFVIGMCALF 226



>sp|Q9UI40|NKX2_HUMAN Sodium/potassium/calcium exchanger 2 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 2) (Retinal cone
           Na-Ca+K exchanger).>gb:AF097366_1882820 Homo sapiens
           cone sodium-calcium potassium exchanger (NCKX2) mRNA,
           complete cds.>gb:AL133281_1918318 Human DNA sequence
           from clone RP11-252O2 on chromosome 9p22.1-22.3 Contains
           part of the SLC24A2 gene for solute carrier family 24
           (sodium/potassium/calcium exchanger), member 2 (NCKX2)
           and a pseudogene similar to part of a novel gene,
           complete sequence.>gb:AL158077_1921295 Human DNA
           sequence from clone RP11-471J7 on chromosome 9 Contains
           the 5' end of the SLC24A2 gene for solute carrier family
           24 (sodium/potassium/calcium exchanger), member 2
           (NCKX2) and a CpG island, complete
           sequence.>gb:AL158206_1921430 Human DNA sequence from
           clone RP11-363E7 on chromosome 9 Contains the 3' end of
           a novel gene, possible ortholog of mouse cancer related
           gene-liver 1 (CRG-L1), a tmicortubule-associated protein
           pseudogene, the 3' end of the SLC24A2 gene for solute
           carrier family 24 (sodium/potassium/calcium exchanger)
           member 2 (NCKX2) and 2 CpG islands, complete
           sequence.>gb:BC069622_1988221 Homo sapiens solute
           carrier family 24 (sodium/potassium/calcium exchanger),
           member 2, mRNA (cDNA clone MGC:97156 IMAGE:7262398),
           complete cds.
          Length = 661

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 40/199 (20%), Positives = 78/199 (39%), Gaps = 7/199 (3%)
 Frame = +3

Query: 6   KTPRVNCLSFFWYGMAFNSAALTTTAISXXXXXXXXXXXXXXPPTYSSNHPSKHILLSPH 185
           K   +  L  F   +A ++ + + +A S               P  +  +  + +L    
Sbjct: 33  KLKLIRVLGLFMGLVAISTVSFSISAFSETDTQSTGEASVVSGPRVAQGYHQRTLLDLND 92

Query: 186 RSLLNSPQPSCRFF-----SSDESDGLF--NYFSIHSCLFRQNPFLSVPFLGLFVLLYFY 344
           + L  +PQP          S+D + G +  + FS+     R+   + +  +G+  +  F 
Sbjct: 93  KILDYTPQPPLSKEGESENSTDHAQGDYPKDIFSLEE---RRKGAIILHVIGMIYM--FI 147

Query: 345 ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGA 524
            L       F   +T +   L +S  +   T +A G  AP++F S+  V       G G 
Sbjct: 148 ALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHSNVGIGT 207

Query: 525 ILSAGTFVSAFVVGFVSIY 581
           I+ +  F   FV+G  +++
Sbjct: 208 IVGSAVFNILFVIGMCALF 226



>gb:AB014602_1864631 Homo sapiens mRNA for KIAA0702 protein, partial
           cds.
          Length = 988

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F ++Y ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  V
Sbjct: 460 LHVFGMMYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGV 519

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  S++
Sbjct: 520 FISHSNVGIGTIVGSAVFNILFVIGTCSLF 549



>sp|O60721|NKX1_HUMAN Sodium/potassium/calcium exchanger 1 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 1) (Retinal rod
           Na-Ca+K exchanger).>gb:AF062921_1880204 Homo sapiens
           retinal rod Na-Ca+K exchanger splice variant (NCKX1)
           mRNA, complete cds.>gb:AF062922_1880205 Homo sapiens
           retinal rod Na-Ca+K exchanger (NCKX1) mRNA, complete
           cds.
          Length = 1099

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F ++Y ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  V
Sbjct: 457 LHVFGMMYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGV 516

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  S++
Sbjct: 517 FISHSNVGIGTIVGSAVFNILFVIGTCSLF 546



>gb:AF026132_1877283 Homo sapiens retinal rod Na+/Ca+, K+ exchanger
           (NCKX) mRNA, complete cds.
          Length = 1081

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F ++Y ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  +
Sbjct: 457 LHVFGMMYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGI 516

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  S++
Sbjct: 517 FISHSNVGIGTIVGSAVFNILFVIGTCSLF 546



>pir|T31433|T31433 Na+/Ca2+,K+-exchanging protein - bottle-nosed
           dolphin>gb:AF059031_1413318 Tursiops truncatus retinal
           rod Na/Ca+K exchanger (NCKXr) mRNA, complete cds.
          Length = 1014

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F +LY ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  +
Sbjct: 453 LHIFGMLYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGI 512

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  +++
Sbjct: 513 FISHSNVGIGTIVGSAVFNILFVIGTCALF 542



>sp|Q9IAL8|NKX1_CHICK Sodium/potassium/calcium exchanger 1 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 1) (Retinal rod
           Na-Ca+K exchanger).>gb:AF177984_2478712 Gallus gallus
           clone rp31 potassium-dependent sodium-calcium exchanger
           NCKX1 (NCKX) mRNA, complete cds.
          Length = 663

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F ++Y ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  V
Sbjct: 133 LHIFGMMYVFVALAIVCDEYFVPALGVITEKLQISEDVAGATFMAAGGSAPELFTSLIGV 192

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  +++
Sbjct: 193 FISHSNVGIGTIVGSAVFNILFVIGTCALF 222



>gb:AC079889_1733015 Oryza sativa chromosome 3 BAC OSJNBa0092M19
           genomic sequence, complete sequence.
          Length = 306

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = -1

Query: 455 IPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEK 321
           + +R+ER   HGR EAE   E GD  GEVG     ED EV+E  +
Sbjct: 227 VAEREERDGGHGRGEAEAGREAGDRGGEVGPCDGGEDAEVEEERR 271



>pir|S20969|S20969 Na+/Ca2+,K+-exchanging protein -
           bovine>gb:BTNACAKEX_1437253 B.taurus mRNA for
           Na/Ca,K-exchanger.
          Length = 1199

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F ++Y ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  V
Sbjct: 451 LHIFGMMYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGV 510

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  +++
Sbjct: 511 FISHSNVGIGTIVGSAVFNILFVIGTCALF 540



>sp|Q28139|NKX1_BOVIN Sodium/potassium/calcium exchanger 1 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 1) (Retinal rod
           Na-Ca+K exchanger).
          Length = 1216

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 22/90 (24%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F ++Y ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  V
Sbjct: 451 LHIFGMMYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGV 510

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  +++
Sbjct: 511 FISHSNVGIGTIVGSAVFNILFVIGTCALF 540



>gb:AF177986_2478714 Gallus gallus clone dt3111 cone
           potassium-dependent sodium-calcium exchanger (NCKX)
           mRNA, complete cds.
          Length = 634

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVV-VTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           ++Y +I +      F V  +T +   L +S  +   T +A G  AP++F S+  V     
Sbjct: 144 MIYMFIALAIVCDEFFVPSLTVITEKLSISDDVAGATFMAAGGSAPELFTSLIGVFISHS 203

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 204 NVGIGTIVGSAVFNILFVIGMCALF 228



>gb:AY191995_1309053 Gomphiocephalus hodgsoni mitochondrion,
           complete genome.
          Length = 313

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 28/96 (29%), Positives = 44/96 (45%)
 Frame = +3

Query: 294 PFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVF 473
           PF   P    F++L  +ILI T     ++ +  L+  L    S G  TL+  G  +   +
Sbjct: 74  PFYFAPLASFFIILLMWILIPTYSNTVNMALGGLM--LFCCTSFGVYTLMGSGWSSNSSY 131

Query: 474 ASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           A + A++G      +   L+     S F+VGF SIY
Sbjct: 132 ALLGAIRGVAQTISYEVALALFFLSSIFLVGFYSIY 167



>sp|Q9IAL7|NKX2_CHICK Sodium/potassium/calcium exchanger 2 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 2) (Retinal cone
           Na-Ca+K exchanger).>gb:AF177985_2478713 Gallus gallus
           clone dt53 cone potassium-dependent sodium-calcium
           exchanger (NCKX) mRNA, complete cds.
          Length = 651

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVV-VTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           ++Y +I +      F V  +T +   L +S  +   T +A G  AP++F S+  V     
Sbjct: 144 MIYMFIALAIVCDEFFVPSLTVITEKLSISDDVAGATFMAAGGSAPELFTSLIGVFISHS 203

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 204 NVGIGTIVGSAVFNILFVIGMCALF 228



>gb:AF520706_1905816 Homo sapiens K-dependent Na/Ca exchanger NCKX4
           (SLC24A4) mRNA, complete cds; alternatively spliced.
          Length = 558

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 27/99 (27%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQ+  + +  LG   L  FY L       F   + K+   L LS  +   T +A G+  P
Sbjct: 31  RQHGAVLLHILG--ALYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSTP 88

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           ++FASV  V       G G I+ +  F    ++G   ++
Sbjct: 89  ELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLF 127



>gb:AF520705_1905815 Homo sapiens K-dependent Na/Ca exchanger NCKX4
           (SLC24A4) mRNA, complete cds; alternatively spliced.
          Length = 586

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 27/99 (27%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQ+  + +  LG   L  FY L       F   + K+   L LS  +   T +A G+  P
Sbjct: 78  RQHGAVLLHILG--ALYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSTP 135

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           ++FASV  V       G G I+ +  F    ++G   ++
Sbjct: 136 ELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLF 174



>gb:AK083127_1173824 Mus musculus adult male hippocampus cDNA, RIKEN
           full-length enriched library, clone:C630015N03
           product:solute carrier family 24
           (sodium/potassium/calcium exchanger), member 2, full
           insert sequence.
          Length = 666

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVV-VTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           ++Y +I +      F V  +T +   L +S  +   T +A G  AP++F S+  V     
Sbjct: 143 MIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHS 202

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 203 NVGIGTIVGSAVFNILFVIGMCALF 227



>gb:AK038800_1165179 Mus musculus adult male hypothalamus cDNA,
           RIKEN full-length enriched library, clone:A230064F17
           product:solute carrier family 24
           (sodium/potassium/calcium exchanger), member 2, full
           insert sequence.
          Length = 394

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVV-VTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           ++Y +I +      F V  +T +   L +S  +   T +A G  AP++F S+  V     
Sbjct: 143 MIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHS 202

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 203 NVGIGTIVGSAVFNILFVIGMCALF 227



>gb:AK034424_1163750 Mus musculus adult male diencephalon cDNA,
           RIKEN full-length enriched library, clone:9330189J04
           product:solute carrier family 24
           (sodium/potassium/calcium exchanger), member 2, full
           insert sequence.
          Length = 449

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVV-VTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           ++Y +I +      F V  +T +   L +S  +   T +A G  AP++F S+  V     
Sbjct: 143 MIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHS 202

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 203 NVGIGTIVGSAVFNILFVIGMCALF 227



>gb:AP008231_580966 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 370

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVV-VTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKG 497
           LF+LL   IL+  A A F V   +KL A + LSP +  +T++A G  AP++  S+ AV  
Sbjct: 13  LFLLLGLVILV--AGAEFLVRGASKLAALVGLSPLIIGLTVVAYGTSAPELAVSIQAVLE 70

Query: 498 GQPRTGFGAILSAGTFVSAFVVGFVSI 578
           G      G ++ +  F   F++G  ++
Sbjct: 71  GSNDISLGNVVGSNIFNVLFILGISAL 97



>sp|Q8NFF2|NKX4_HUMAN Sodium/potassium/calcium exchanger 4 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein
           4).>gb:AF520704_1905814 Homo sapiens K-dependent Na/Ca
           exchanger NCKX4 (SLC24A4) mRNA, complete cds;
           alternatively spliced.>gb:BC069653_1988251 Homo sapiens
           solute carrier family 24 (sodium/potassium/calcium
           exchanger), member 4, transcript variant 1, mRNA (cDNA
           clone MGC:97168 IMAGE:7262411), complete cds.
          Length = 605

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 27/99 (27%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQ+  + +  LG   L  FY L       F   + K+   L LS  +   T +A G+  P
Sbjct: 78  RQHGAVLLHILG--ALYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSTP 135

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           ++FASV  V       G G I+ +  F    ++G   ++
Sbjct: 136 ELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLF 174



>sp|O54701|NKX2_RAT Sodium/potassium/calcium exchanger 2 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 2) (Retinal cone
           Na-Ca+K exchanger).>gb:AF021923_2051133 Rattus
           norvegicus potassium-dependent sodium-calcium exchanger
           (NCKX2) mRNA, complete cds.
          Length = 670

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVV-VTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           ++Y +I +      F V  +T +   L +S  +   T +A G  AP++F S+  V     
Sbjct: 143 MIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFMAAGGSAPELFTSLIGVFIAHS 202

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 203 NVGIGTIVGSAVFNILFVIGMCALF 227



>gb:BC017615_2092512 Mus musculus solute carrier family 24
           (sodium/potassium/calcium exchanger), member 3, mRNA
           (cDNA clone MGC:27686 IMAGE:4914291), complete cds.
          Length = 595

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 64  LCAMYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 123

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 124 KGDVGVGTIVGSAVFNILCIIGVCGLF 150



>gb:AF314821_2062606 Mus musculus strain CD-1 K+-dependent Na/Ca
           exchanger (Slc24A3) mRNA, partial cds.
          Length = 627

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 96  LCAMYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 155

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 156 KGDVGVGTIVGSAVFNILCIIGVCGLF 182



>gb:AL139429_1920781 Human DNA sequence from clone RP11-110K14 on
           chromosome 20 Contains part of the SLC24A3 gene for
           solute carrier family 24 (sodium/potassium/calcium
           exchanger) member 3, complete
           sequence.>gb:HS542H21_1999007 Human DNA sequence from
           clone RP4-542H21 on chromosome 20p11.21-12.1 Contains
           part of the SLC24A3 gene for solute carrier family 24
           (sodium/potassium/calcium exchanger) member 3, complete
           sequence.>gb:HSJ1027G4_2015644 Human DNA sequence from
           clone RP5-1027G4 on chromosome 20 Contains part of the
           SLC24A3 gene for solute carrier family 24
           (sodium/potassium/calcium exchanger) member 3 and a
           novel gene, complete sequence.>gb:HSJ122P22_2015747
           Human DNA sequence from clone RP1-122P22 on chromosome
           20 Contains the 3' end the SLC24A3 gene for solute
           carrier family 24 (sodium/potassium/calcium exchanger)
           member 3, a novel gene and a CpG island, complete
           sequence.>gb:HSJ718D20_2016427 Human DNA sequence from
           clone RP4-718D20 on chromosome 20 Contains part of the
           SLC24A3 gene for solute carrier family 24
           (sodium/potassium/calcium exchanger) member 3, a novel
           gene and a CpG island, complete sequence.
          Length = 593

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 64  LCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 123

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 124 KGDVGVGTIVGSAVFNILCIIGVCGLF 150



>gb:AL136090_1918876 Human DNA sequence from clone RP11-97N19 on
           chromosome 20 Contains the 5' end of the SLC24A3 gene
           for solute carrier family 24 (sodium/potassium/calcium
           exchanger) member 3, a novel gene and a CpG island,
           complete sequence.>gb:AL139429_1920782 Human DNA
           sequence from clone RP11-110K14 on chromosome 20
           Contains part of the SLC24A3 gene for solute carrier
           family 24 (sodium/potassium/calcium exchanger) member 3,
           complete sequence.>gb:HS542H21_1999008 Human DNA
           sequence from clone RP4-542H21 on chromosome
           20p11.21-12.1 Contains part of the SLC24A3 gene for
           solute carrier family 24 (sodium/potassium/calcium
           exchanger) member 3, complete
           sequence.>gb:HSJ1027G4_2015643 Human DNA sequence from
           clone RP5-1027G4 on chromosome 20 Contains part of the
           SLC24A3 gene for solute carrier family 24
           (sodium/potassium/calcium exchanger) member 3 and a
           novel gene, complete sequence.>gb:HSJ122P22_2015748
           Human DNA sequence from clone RP1-122P22 on chromosome
           20 Contains the 3' end the SLC24A3 gene for solute
           carrier family 24 (sodium/potassium/calcium exchanger)
           member 3, a novel gene and a CpG island, complete
           sequence.>gb:HSJ718D20_2016428 Human DNA sequence from
           clone RP4-718D20 on chromosome 20 Contains part of the
           SLC24A3 gene for solute carrier family 24
           (sodium/potassium/calcium exchanger) member 3, a novel
           gene and a CpG island, complete sequence.
          Length = 644

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 115 LCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 174

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 175 KGDVGVGTIVGSAVFNILCIIGVCGLF 201



>gb:AF169257_1887501 Homo sapiens potassium-dependent Na/Ca
           exchanger NCKX3 (SLC24A3) mRNA, partial cds.
          Length = 625

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 96  LCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 155

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 156 KGDVGVGTIVGSAVFNILCIIGVCGLF 182



>gb:AK044368_1166933 Mus musculus adult retina cDNA, RIKEN
           full-length enriched library, clone:A930009K01
           product:weakly similar to SODIUM/POTASSIUM/CALCIUM
           EXCHANGER 3 PRECURSOR (NA(+)/K(+)/CA(2+)-EXCHANGE
           PROTEIN 3) [Mus musculus], full insert sequence.
          Length = 257

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 27/99 (27%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQ+  + +  LG   L  FY L       F   + K+   L LS  +   T +A G+  P
Sbjct: 95  RQHGAVLLHILG--ALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTP 152

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           ++FASV  V       G G I+ +  F    ++G   ++
Sbjct: 153 ELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLF 191



>gb:AK044239_1166881 Mus musculus adult retina cDNA, RIKEN
           full-length enriched library, clone:A930002M03
           product:weakly similar to SODIUM/POTASSIUM/CALCIUM
           EXCHANGER 3 PRECURSOR (NA(+)/K(+)/CA(2+)-EXCHANGE
           PROTEIN 3) [Mus musculus], full insert sequence.
          Length = 500

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 27/99 (27%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQ+  + +  LG   L  FY L       F   + K+   L LS  +   T +A G+  P
Sbjct: 31  RQHGAVLLHILG--ALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTP 88

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           ++FASV  V       G G I+ +  F    ++G   ++
Sbjct: 89  ELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLF 127



>sp|Q8CGQ8|NKX4_MOUSE Sodium/potassium/calcium exchanger 4 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein
           4).>gb:AY156046_2076919 Mus musculus K-dependent Na/Ca
           exchanger NCKX4 (Slc24a4) mRNA, complete cds.
          Length = 605

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 27/99 (27%), Positives = 43/99 (43%)
 Frame = +3

Query: 285 RQNPFLSVPFLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAP 464
           RQ+  + +  LG   L  FY L       F   + K+   L LS  +   T +A G+  P
Sbjct: 78  RQHGAVLLHILG--ALYMFYALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTP 135

Query: 465 DVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
           ++FASV  V       G G I+ +  F    ++G   ++
Sbjct: 136 ELFASVIGVFITHGDVGVGTIVGSAVFNILCIIGVCGLF 174



>sp|Q9EPQ0|NKX3_RAT Sodium/potassium/calcium exchanger 3 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 3)
           (Fragment).>gb:AY009158_2073461 Rattus norvegicus
           potassium-dependent sodium-calcium exchanger NCKX3
           (SLC24A3) mRNA, partial cds.
          Length = 624

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 96  LCAMYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 155

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 156 KGDVGVGTIVGSAVFNILCIIGVCGLF 182



>sp|Q99PD7|NKX3_MOUSE Sodium/potassium/calcium exchanger 3 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 3).
          Length = 645

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 114 LCAMYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 173

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 174 KGDVGVGTIVGSAVFNILCIIGVCGLF 200



>sp|Q9HC58|NKX3_HUMAN Sodium/potassium/calcium exchanger 3 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 3).
          Length = 644

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 23/87 (26%), Positives = 38/87 (43%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  FY L       F   + K+   L LS  +   T +A G+ AP++F SV  V   
Sbjct: 115 LCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFIT 174

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSIY 581
           +   G G I+ +  F    ++G   ++
Sbjct: 175 KGDVGVGTIVGSAVFNILCIIGVCGLF 201



>sp|Q9QZM6|NKX1_RAT Sodium/potassium/calcium exchanger 1 precursor
           (Na(+)/K(+)/Ca(2+)- exchange protein 1) (Retinal rod
           Na-Ca+K exchanger).>gb:AF176688_2057858 Rattus
           norvegicus sodium/calcium/potassium exchanger NCKX1
           (SLC24A1) mRNA, complete cds.
          Length = 1181

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +3

Query: 315 LGLFVLLYFYI-LITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           L +F + Y ++ L      +F   +  +   L++S  +   T +A G  AP++F S+  V
Sbjct: 424 LHIFGMTYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTSLIGV 483

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
                  G G I+ +  F   FV+G  +++
Sbjct: 484 FISHSNVGIGTIVGSAVFNILFVIGTCALF 513



>gb:AY297781_606968 Alcaligenes faecalis strain NCIB 8687 arsenite
           oxidation genes, partial sequence.
          Length = 359

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 25/87 (28%), Positives = 43/87 (49%)
 Frame = +3

Query: 318 GLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKG 497
           GLF+L+    L+    +       KL     +SP +  +T++ALG  AP+V  SV AV  
Sbjct: 9   GLFLLVMGASLLVRGSS-------KLALSFGISPLVVGLTIVALGTSAPEVAVSVGAVLD 61

Query: 498 GQPRTGFGAILSAGTFVSAFVVGFVSI 578
           G+     G ++ +  F   F++G  ++
Sbjct: 62  GKTDIAIGNVVGSNIFNVLFILGISAL 88



>pir|A83708|A83708 hypothetical protein BH0465 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_654411 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 318

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +3

Query: 324 FVLLYFYILITTAQAHFSVVVTKLVAHL-RLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           +VLL     +    A F V  +  +A L  +SP +  +T++A G  +P+  AS+ A   G
Sbjct: 3   YVLLLLGFALLIKGADFFVDGSSSIARLLNVSPLLIGLTIVAFGTSSPEATASIIAALNG 62

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSI 578
            P    G ++ +  F    VVG  ++
Sbjct: 63  NPDVALGNVIGSNMFNITLVVGLTAL 88



>gb:AP004727_1843846 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0516A04.
          Length = 300

 Score = 40.8 bits (94), Expect = 0.020
 Identities = 21/58 (36%), Positives = 31/58 (53%)
 Frame = -1

Query: 476 SKHIRGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDG 303
           ++ I   + +  E    HGR EAE + E+GD  G  G     ED EV+E E+ + R+G
Sbjct: 194 TRDIGRAVAECAEHDGGHGRGEAEAAREVGDRRGRSGTRGGSEDAEVEEEEEREHREG 251



>gb:BX571662_779419 Wolinella succinogenes, complete genome; segment
           6/7.
          Length = 360

 Score = 40.4 bits (93), Expect = 0.026
 Identities = 18/64 (28%), Positives = 36/64 (56%)
 Frame = +3

Query: 387 TKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVG 566
           +KL   L +SP +  +T++A G  AP++  ++ +  GGQP    G ++ +  F   F++G
Sbjct: 27  SKLAFKLGISPLVVGLTVVAFGTSAPELAINIQSSLGGQPDLALGNVVGSNIFNVLFILG 86

Query: 567 FVSI 578
             ++
Sbjct: 87  LSAL 90



>gb:AY094674_1297848 Drosophila melanogaster GH04818 full insert
           cDNA.
          Length = 536

 Score = 40.0 bits (92), Expect = 0.034
 Identities = 21/85 (24%), Positives = 37/85 (43%)
 Frame = +3

Query: 327 VLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           V+  F  L       F   +  ++  L ++  +   T +A G  AP++F SV  V     
Sbjct: 340 VIYMFVALAIVCDEFFVPSLDVIIERLGITDDVAGATFMAAGGSAPELFTSVIGVFVSFD 399

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 400 DVGIGTIVGSAVFNILFVIGMCALF 424



>gb:AF190455_1249483 Drosophila melanogaster potassium-dependent
           sodium/calcium exchanger NCKX30C mRNA, complete cds.
          Length = 856

 Score = 40.0 bits (92), Expect = 0.034
 Identities = 21/85 (24%), Positives = 37/85 (43%)
 Frame = +3

Query: 327 VLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           V+  F  L       F   +  ++  L ++  +   T +A G  AP++F SV  V     
Sbjct: 340 VIYMFVALAIVCDEFFVPSLDVIIERLGITDDVAGATFMAAGGSAPELFTSVIGVFVSFD 399

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 400 DVGIGTIVGSAVFNILFVIGMCALF 424



>gb:AE014134_1128407 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003626_1218514 Drosophila melanogaster
           chromosome 2L, section 35 of 83 of the complete
           sequence.
          Length = 888

 Score = 39.7 bits (91), Expect = 0.045
 Identities = 21/85 (24%), Positives = 37/85 (43%)
 Frame = +3

Query: 327 VLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           V+  F  L       F   +  ++  L ++  +   T +A G  AP++F SV  V     
Sbjct: 340 VIYMFVALAIVCDEFFVPSLDVIIEKLGITDDVAGATFMAAGGSAPELFTSVIGVFVSFD 399

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 400 DVGIGTIVGSAVFNILFVIGMCALF 424



>sp|Q9U6A0|NCKX_DROME Sodium/potassium/calcium exchanger
           (Na(+)/K(+)/Ca(2+)-exchange
           protein).>gb:AE014134_1128405 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1128406
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003626_1218512 Drosophila melanogaster
           chromosome 2L, section 35 of 83 of the complete
           sequence.>gb:AE003626_1218513 Drosophila melanogaster
           chromosome 2L, section 35 of 83 of the complete
           sequence.
          Length = 856

 Score = 39.7 bits (91), Expect = 0.045
 Identities = 21/85 (24%), Positives = 37/85 (43%)
 Frame = +3

Query: 327 VLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQP 506
           V+  F  L       F   +  ++  L ++  +   T +A G  AP++F SV  V     
Sbjct: 340 VIYMFVALAIVCDEFFVPSLDVIIEKLGITDDVAGATFMAAGGSAPELFTSVIGVFVSFD 399

Query: 507 RTGFGAILSAGTFVSAFVVGFVSIY 581
             G G I+ +  F   FV+G  +++
Sbjct: 400 DVGIGTIVGSAVFNILFVIGMCALF 424



>gb:AC144737_1744136 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0018K15, complete sequence.
          Length = 256

 Score = 38.9 bits (89), Expect = 0.076
 Identities = 23/39 (58%), Positives = 26/39 (66%), Gaps = 3/39 (7%)
 Frame = -2

Query: 511 VLGWPPLTAATEA---NTSGAPFPSAKSVTAPMDGERRR 404
           V+G   L AA  A    TSG P PSA+SVTA +DGERRR
Sbjct: 131 VVGAVALIAAAFAIPPATSGTPLPSARSVTAAIDGERRR 169



>gb:AE014297_1137811 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003606_1217595 Drosophila melanogaster
           chromosome 3R, section 2 of 118 of the complete
           sequence.
          Length = 642

 Score = 38.9 bits (89), Expect = 0.076
 Identities = 20/86 (23%), Positives = 38/86 (44%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           L  +  F+ L      +F   + +L   L+LSP +   T +A G+ AP++   V  V   
Sbjct: 130 LVAVFTFFGLAIVCDEYFVASLDRLCEELKLSPDVAGATFMAAGSSAPELATVVIGVFFA 189

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSI 578
           +   G   ++ +  F   FV+   ++
Sbjct: 190 KDDIGISGVIGSAVFNIMFVISVCAL 215



>pir|H82064|H82064 conserved hypothetical protein VC2522 [imported]
           - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004322_52894 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 230 of 251 of the
           complete chromosome.>gb:AE003852_1053668 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 332

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 23/89 (25%), Positives = 44/89 (49%)
 Frame = +3

Query: 312 FLGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           F+GL +L++    +    A        L  ++ +SP +  +T+LA+G+ AP++  S  A 
Sbjct: 22  FIGLAILVWGADKLVFGSA-------ALARNIGISPLVIGMTILAMGSSAPEMMVSATAA 74

Query: 492 KGGQPRTGFGAILSAGTFVSAFVVGFVSI 578
             G+  T  G +L +     A ++G  +I
Sbjct: 75  LEGKTDTAVGNVLGSNIANIALILGITAI 103



>gb:AF036943_1878046 Homo sapiens myelin transcription factor 1-like
           (MYT1-l) mRNA, complete cds.
          Length = 1192

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 8/94 (8%)
 Frame = -1

Query: 557 KSRDKSPGREYRPK--------SSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRREAEM 402
           K++DK P +E  PK         SS +   D S G++ +        E+    G   +E 
Sbjct: 62  KTQDKQP-QEPAPKRKPFAVKADSSSVDECDDSDGTEDM-------DEKEEDEGEEYSED 113

Query: 401 SDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGE 300
           +DE GD D E   G  +E+ E++E ++    DGE
Sbjct: 114 NDEPGDEDEEDEEGDREEEEEIEEEDEDDDEDGE 147



>gb:CR380956_1652406 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 748

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 17/58 (29%), Positives = 31/58 (53%)
 Frame = +3

Query: 405 LRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSI 578
           L++S  +  +TLLALGN  PD+  +  ++K  +     G ++    F+   ++G V I
Sbjct: 69  LKISDRVSGMTLLALGNAIPDITTTYQSMKRNETSLALGELIGGVFFLLTVILGVVGI 126



>gb:DRONCX_1382392 Drosophila melanogaster (clone DR1) Na/Ca exchange
            protein (NCX) gene, complete cds.
          Length = 950

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 14/111 (12%)
 Frame = +3

Query: 204  PQPSCRFFSSDESDGL---FNYFSIHSCLFRQNPFLSVP-----------FLGLFVLLYF 341
            P     F + DE + +   F+Y S   CLF +  F  VP            + +FV+   
Sbjct: 732  PADESEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVI 791

Query: 342  YILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVK 494
              +I  A ++F          L +  S+ A+  +ALG   PD FAS+ A K
Sbjct: 792  TAIIGDAASYFGCA-------LNIKDSVTAILFVALGTSIPDTFASMIAAK 835



>gb:AF009897_1231609 Drosophila melanogaster 3Na(+)-1Ca(2+) exchanger
            (Calx) mRNA, complete cds.
          Length = 950

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 14/111 (12%)
 Frame = +3

Query: 204  PQPSCRFFSSDESDGL---FNYFSIHSCLFRQNPFLSVP-----------FLGLFVLLYF 341
            P     F + DE + +   F+Y S   CLF +  F  VP            + +FV+   
Sbjct: 732  PADESEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVI 791

Query: 342  YILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVK 494
              +I  A ++F          L +  S+ A+  +ALG   PD FAS+ A K
Sbjct: 792  TAIIGDAASYFGCA-------LNIKDSVTAILFVALGTSIPDTFASMIAAK 835



>gb:AE014297_1140561 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1140562 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE014297_1140563
            Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003733_1222554 Drosophila melanogaster
            chromosome 3R, section 71 of 118 of the complete
            sequence.>gb:AE003733_1222555 Drosophila melanogaster
            chromosome 3R, section 71 of 118 of the complete
            sequence.>gb:AE003733_1222556 Drosophila melanogaster
            chromosome 3R, section 71 of 118 of the complete
            sequence.>gb:AY118680_1300402 Drosophila melanogaster
            AT10348 full insert cDNA.>gb:BT011420_1357902 Drosophila
            melanogaster AT07459 full insert cDNA.
          Length = 950

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 14/111 (12%)
 Frame = +3

Query: 204  PQPSCRFFSSDESDGL---FNYFSIHSCLFRQNPFLSVP-----------FLGLFVLLYF 341
            P     F + DE + +   F+Y S   CLF +  F  VP            + +FV+   
Sbjct: 732  PADESEFDNDDEEEEVPSCFSYVSHFVCLFWKVLFAFVPPTDICGGYVTFVVSIFVIGVI 791

Query: 342  YILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVK 494
              +I  A ++F          L +  S+ A+  +ALG   PD FAS+ A K
Sbjct: 792  TAIIGDAASYFGCA-------LNIKDSVTAILFVALGTSIPDTFASMIAAK 835



>gb:BX294135_765868 Pirellula sp. strain 1 complete genome; segment
           3/24.
          Length = 339

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 18/65 (27%), Positives = 34/65 (52%)
 Frame = +3

Query: 387 TKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVG 566
           ++L    +LSP    +T+++LG  AP++  S A    GQ     G ++ +  F    +VG
Sbjct: 34  SRLAIAAKLSPLFVGLTVVSLGTSAPEMAVSFATALRGQADITIGNVVGSNLFNMLMIVG 93

Query: 567 FVSIY 581
           F +++
Sbjct: 94  FSALF 98



>gb:AE010385_262583 Methanopyrus kandleri AV19 section 84 of 157 of
           the complete genome.>gb:AE009439_903364 Methanopyrus
           kandleri AV19, complete genome.
          Length = 329

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 20/78 (25%), Positives = 34/78 (43%)
 Frame = +3

Query: 411 LSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFVSIYXXX 590
           LS S+   TL A+G  AP+  +S++++    P  G G IL +  +    + G  ++    
Sbjct: 56  LSESVAGATLAAIGTSAPEFGSSLSSILLEHPNVGVGTILGSAVYNVTVIPGLAALAAGG 115

Query: 591 XXXXXXXXXXXXMFYLTA 644
                       +FYL A
Sbjct: 116 LTLERAVYRRDVLFYLLA 133



>gb:CR382123_1656144 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 684

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +3

Query: 405 LRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVG 566
           L +S  +  +TLLALGN  PD+ ++  A+K G      G  L A  F+   V+G
Sbjct: 67  LFISDRISGMTLLALGNAIPDITSTYKAMKRGTTTLAIGESLGAIFFLLTVVIG 120



>gb:BA000037_721280 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 347

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 17/62 (27%), Positives = 34/62 (54%)
 Frame = +3

Query: 393 LVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           L  ++ +SP +  +T+LA+G+ AP++  S  A   G+  T  G +L +     A ++G  
Sbjct: 55  LARNIGISPLVIGMTILAMGSSAPEMMVSATAALDGKTDTAVGNVLGSNIANIALILGIT 114

Query: 573 SI 578
           ++
Sbjct: 115 AL 116



>gb:AE016799_335451 Vibrio vulnificus CMCP6 chromosome I section 3
           of 11 of the complete sequence.>gb:AE016795_1045175
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 321

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 17/62 (27%), Positives = 34/62 (54%)
 Frame = +3

Query: 393 LVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           L  ++ +SP +  +T+LA+G+ AP++  S  A   G+  T  G +L +     A ++G  
Sbjct: 29  LARNIGISPLVIGMTILAMGSSAPEMMVSATAALDGKTDTAVGNVLGSNIANIALILGIT 88

Query: 573 SI 578
           ++
Sbjct: 89  AL 90



>gb:AE006079_215316 Pasteurella multocida subsp. multocida str. Pm70
           section 46 of 204 of the complete
           genome.>gb:AE004439_1118046 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 322

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 22/86 (25%), Positives = 42/86 (48%)
 Frame = +3

Query: 321 LFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGG 500
           LF L+    L+  +         K+  +L +S  +  +T++A+G   P+V AS+AA + G
Sbjct: 174 LFWLIVGLALLMVSSQLLIWGAVKIAHYLGVSDLVIGLTVVAIGTSLPEVAASIAAARKG 233

Query: 501 QPRTGFGAILSAGTFVSAFVVGFVSI 578
           +     G I+ +  + +  VVG   +
Sbjct: 234 EVDLAVGNIIGSNLYNTLAVVGLAGV 259



>gb:AP004667_1842967 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0433E10.
          Length = 126

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = -1

Query: 455 IPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEK 321
           + +R ER   HGR EA+ + E GD  G  G     ED +V+E E+
Sbjct: 54  VAERAERDGGHGRGEAKAAREAGDRRGRSGTRGGREDAKVEEEER 98



>gb:CP000020_870569 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 323

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 17/62 (27%), Positives = 34/62 (54%)
 Frame = +3

Query: 393 LVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           L  +  +SP +  +T+LA+G+ AP++  S AA   G+  T  G ++ +     A ++G  
Sbjct: 32  LARNYGISPLVIGMTILAMGSSAPEMMVSAAAALDGKTDTAVGNVIGSNIANIALILGIT 91

Query: 573 SI 578
           ++
Sbjct: 92  AL 93



 Score = 32.7 bits (73), Expect = 5.4
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +3

Query: 375 SVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSA 554
           +VV+ K   +  +S  +  +T++ALG   P++ ASVA V  G+     G I+ +  F   
Sbjct: 199 AVVIAK---YFGMSELVIGLTIIALGTSLPELAASVAGVLKGEDDMAAGNIIGSNVFNIL 255

Query: 555 FVVGFVSI 578
            V+G  ++
Sbjct: 256 AVMGIPAL 263



>gb:AE016809_338245 Vibrio vulnificus CMCP6 chromosome II section 2
           of 6 of the complete sequence.>gb:AE016796_1047969
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 322

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 20/87 (22%), Positives = 41/87 (47%)
 Frame = +3

Query: 315 LGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVK 494
           + +F L+   +L+  +          +   L +S  +  +T++ALG   P++ AS+ A +
Sbjct: 172 MAIFWLIAGLVLLIVSSRMLVWGAVNIAQQLGISDLLIGLTIVALGTSLPELAASIVAAR 231

Query: 495 GGQPRTGFGAILSAGTFVSAFVVGFVS 575
            G+     G ++ +  F S  VVG  +
Sbjct: 232 KGEHDIAVGNVVGSNMFNSLAVVGIAA 258



>gb:CR378673_96532 Photobacterium profundum SS9; segment 11/12.
          Length = 321

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +3

Query: 393 LVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           L  +  ++P +  +T+LA+G+ AP++  S  A   G+  T  G +L +     A ++G  
Sbjct: 29  LAKNFGIAPLVIGMTILAMGSSAPEMMVSATAALAGKTDTAVGNVLGSNIANIALIIGIT 88

Query: 573 SI 578
           ++
Sbjct: 89  AL 90



>gb:BX908809_1644563 Neurospora crassa DNA linkage group IV Cosmid
           contig 29E8.
          Length = 466

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 6/61 (9%)
 Frame = -1

Query: 458 PIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEH-EKPKKR-----DGEK 297
           P  QR++R R+H RR ++   + GD  G+   GR      + +H  KP KR     DG  
Sbjct: 102 PGEQREQRRRSHRRRSSQHRGDRGDDRGDRDRGRRRHSRNLSQHINKPLKRHEWTSDGTV 161

Query: 296 W 294
           W
Sbjct: 162 W 162



>gb:BA000031_708125 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 321

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 16/62 (25%), Positives = 34/62 (54%)
 Frame = +3

Query: 393 LVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           +  ++ +SP +  +T+LA+G+ AP++  S  A   G+  T  G +L +     A ++G  
Sbjct: 29  IARNVGISPLVIGMTILAMGSSAPEMMVSATAAWDGKTDTAVGNVLGSNIANIALILGIT 88

Query: 573 SI 578
           ++
Sbjct: 89  AL 90



>gb:AC137610_1743512 Oryza sativa (japonica cultivar-group)
           chromosome 5 BAC clone OSJNBa0018H09, complete sequence.
          Length = 1362

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = -1

Query: 488 GSYGSKHIRGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPK-K 312
           G YG  H     P+  E     G+++ E +     H  EV   R +ED EVK   KPK K
Sbjct: 321 GEYG--HFIADCPKSNEAKAKGGKKKPERAHVAEAHMAEVWYSRDEEDPEVKPKPKPKDK 378

Query: 311 RDGE 300
            +GE
Sbjct: 379 VEGE 382



>gb:AE016959_1022896 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017101_1752715
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 55 of 77 of the complete sequence.
          Length = 207

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 21/41 (51%), Positives = 23/41 (56%)
 Frame = -2

Query: 469 TSGAPFPSAKSVTAPMDGERRR*ATSLVTTTEKWAWAVVMR 347
           TSGAP PSA+S+TA MD  RRR         EKW  A   R
Sbjct: 170 TSGAPLPSARSMTAAMDEGRRR------QPGEKWDPAAAAR 204



>pir|S67765|S67765 probable membrane protein YDL206w - yeast
           (Saccharomyces cerevisiae)>gb:CS39KBCIV_1673784
           S.cerevisiae 39kb DNA segment of chromosome
           IV.>gb:SCYDL206W_1711784 S.cerevisiae chromosome IV
           reading frame ORF YDL206w.
          Length = 762

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 16/54 (29%), Positives = 28/54 (51%)
 Frame = +3

Query: 411 LSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           +S  +  +TLLALGN  PD+ ++  ++K G      G +     F+   V+G +
Sbjct: 70  ISDRVSGMTLLALGNALPDITSTYQSMKSGVTSLAIGELFGGIFFLLTVVIGLM 123



>gb:AC104706_1737743 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1116_F05, complete
           sequence.>gb:AC134342_1741735 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0053E01,
           complete sequence.
          Length = 424

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 27/75 (36%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = -1

Query: 518 KSSSGLASLDGSYGSKHIRGPI-PQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDV 342
           +   G+  L G  GS+ +   + P   E  R H RRE     ELG+  G VG GR    V
Sbjct: 56  RRGGGVGRLLGEAGSRQVEEAVNPAYAESGRLHARREEAGHKELGEASG-VGGGRQKVLV 114

Query: 341 EVKEHEKPKKRDGEK 297
           EV   E  +K DG +
Sbjct: 115 EVAGGE-AEKEDGRR 128



>gb:BA000038_725143 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 322

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 17/61 (27%), Positives = 32/61 (52%)
 Frame = +3

Query: 393 LVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           +   L +S  +  +T++ALG   P++ AS+ A + G+     G ++ +  F S  VVG  
Sbjct: 198 IAQQLGISDLLIGLTIVALGTSLPELAASIVAARKGEHDIAVGNVVGSNMFNSLAVVGIA 257

Query: 573 S 575
           +
Sbjct: 258 A 258



>gb:CR628337_114126 Legionella pneumophila str. Lens complete
           genome.
          Length = 319

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASV 482
           L+  +I +  A  H     + L    +LSP M  +T++ALG  AP++F S+
Sbjct: 7   LIISFIALLWAANHLVAGASGLAIRFQLSPLMIGLTIVALGTSAPELFISI 57



>gb:AE017352_1759820 Cryptococcus neoformans var. neoformans JEC21
           chromosome 12, complete sequence.
          Length = 817

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = -1

Query: 413 EAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +AE+  E G+ DGE G G  DED E  E E+  + DG++
Sbjct: 110 DAEVEGE-GEEDGEEGSGSEDEDEEEDEEEEEDESDGDE 147



>gb:AX647605_1472430 Sequence 1797 from Patent EP1270724.
          Length = 548

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 21/60 (35%), Positives = 24/60 (40%), Gaps = 8/60 (13%)
 Frame = +2

Query: 428 CGDALGAGEWGPGCVCFRSCRQGRPAQNWIWGDTLCRDFCLGF--------CCGLRVHLC 583
           CGDA      G    C  +C         +WGD  C   CLG          CG+RVHLC
Sbjct: 306 CGDACAPVCLGTRVTCAHAC---------VWGDA-CAPVCLGTRVTCAHACVCGMRVHLC 355



>gb:BT003775_1357092 Drosophila melanogaster RE20724 full insert
           cDNA.
          Length = 643

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 4/90 (4%)
 Frame = -1

Query: 557 KSRDKSPGREYRPKSSSGLASLDGS-YGSKHIRGPIPQRQERHRTH--GRREAEMSDELG 387
           KS D+ P +E +  +SS    L+ S + SKH +    +R    R+H   R +++   +  
Sbjct: 103 KSSDEDPDQENKGGNSSSGEDLNTSKHKSKHAKSTKHERSSSSRSHSKSRSDSDKKHKSS 162

Query: 386 DHDGEVGLGRSDE-DVEVKEHEKPKKRDGE 300
            HD      +  E   E KEH K KK +GE
Sbjct: 163 RHDKSKDRDKDREGQKEAKEH-KEKKSNGE 191



>gb:AE014297_1140949 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003742_1222942 Drosophila melanogaster
           chromosome 3R, section 80 of 118 of the complete
           sequence.>gb:AY061363_1293166 Drosophila melanogaster
           LD28673 full length cDNA.
          Length = 566

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 4/90 (4%)
 Frame = -1

Query: 557 KSRDKSPGREYRPKSSSGLASLDGS-YGSKHIRGPIPQRQERHRTH--GRREAEMSDELG 387
           KS D+ P +E +  +SS    L+ S + SKH +    +R    R+H   R +++   +  
Sbjct: 26  KSSDEDPDQENKGGNSSSGEDLNTSKHKSKHAKSTKHERSSSSRSHSKSRSDSDKKHKSS 85

Query: 386 DHDGEVGLGRSDE-DVEVKEHEKPKKRDGE 300
            HD      +  E   E KEH K KK +GE
Sbjct: 86  RHDKSKDRDKDREGQKEAKEH-KEKKSNGE 114



>gb:AE014297_1140948 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003742_1222941 Drosophila melanogaster
           chromosome 3R, section 80 of 118 of the complete
           sequence.
          Length = 643

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 4/90 (4%)
 Frame = -1

Query: 557 KSRDKSPGREYRPKSSSGLASLDGS-YGSKHIRGPIPQRQERHRTH--GRREAEMSDELG 387
           KS D+ P +E +  +SS    L+ S + SKH +    +R    R+H   R +++   +  
Sbjct: 103 KSSDEDPDQENKGGNSSSGEDLNTSKHKSKHAKSTKHERSSSSRSHSKSRSDSDKKHKSS 162

Query: 386 DHDGEVGLGRSDE-DVEVKEHEKPKKRDGE 300
            HD      +  E   E KEH K KK +GE
Sbjct: 163 RHDKSKDRDKDREGQKEAKEH-KEKKSNGE 191



>gb:AE013599_1130689 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003836_1227021 Drosophila melanogaster
           chromosome 2R, section 14 of 74 of the complete
           sequence.
          Length = 513

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 7/69 (10%)
 Frame = +3

Query: 321 LFVLLYFYILIT-------TAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFAS 479
           LF+LL+ +I +            +FS V+  +   L ++  +  VT LA GN +P++ A+
Sbjct: 16  LFMLLFAFICVAFLWLMSFNIGTYFSPVLKIISLKLHMNEYLAGVTFLAFGNCSPEIIAN 75

Query: 480 VAAVKGGQP 506
           +  V+   P
Sbjct: 76  LMPVRADAP 84



>gb:AE017283_432009 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 498

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = -2

Query: 571 TKPTTKAETKVPAESIAPNPVLGWPPLTAATEANTSGAPFPSAKSVTAPMDGERRR 404
           TKP+T A+ + PA+  AP        +   ++ N   AP P+AK++TA   G   R
Sbjct: 287 TKPSTPAKPRTPAKDDAP--------IHTTSDVNVRTAPSPTAKAITALAQGTGAR 334



>sp|Q8BZX4|SFRC_MOUSE Splicing factor, arginine/serine-rich 12
           (Serine-arginine-rich splicing regulatory protein 86)
           (SRrp86).>gb:AK033354_1163288 Mus musculus 16 days
           embryo lung cDNA, RIKEN full-length enriched library,
           clone:8430401B01 product:SERINE-ARGININE-RICH SPLICING
           REGULATORY PROTEIN SRRP86 homolog [Rattus norvegicus],
           full insert sequence.>gb:BC070460_2106291 Mus musculus
           splicing factor, arginine/serine-rich 12, mRNA (cDNA
           clone MGC:92998 IMAGE:30548562), complete cds.
          Length = 494

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 14/98 (14%)
 Frame = -1

Query: 572 HEAHNKSRDKS-PGREYRPKSSSGLASLDGSYGSKHIRGPIPQ-------RQERHRTH-- 423
           + A  +SR  S   R  R +SSS       +   K  R P P+       ++E+ R H  
Sbjct: 353 YNASRRSRSTSRERRRRRSRSSSRSPRTSKTVKRKSSRSPSPRGRNKKEKKREKERDHIS 412

Query: 422 GRREAEMSDEL----GDHDGEVGLGRSDEDVEVKEHEK 321
            RRE E S       GD DG+  + +S   V+ KEH K
Sbjct: 413 DRRERERSTSTKKSSGDRDGKEKVEKSTTPVKEKEHSK 450



>gb:BC067984_2554968 Xenopus tropicalis hypothetical protein
           MGC69430, mRNA (cDNA clone MGC:69430 IMAGE:5335693),
           complete cds.
          Length = 568

 Score = 33.9 bits (76), Expect = 2.4
 Identities = 28/86 (32%), Positives = 35/86 (40%), Gaps = 1/86 (1%)
 Frame = -1

Query: 551 RDKSPGREYRPKSSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRREAEMSDELGDHDG- 375
           R   P  E  P     + +L G +  +H RG   Q  ER R   RRE   S+   D D  
Sbjct: 357 RPPEPKPEEPPHPHPHIPALRGEH-REHDRGAREQWAEREREMERRERTRSEREWDRDKI 415

Query: 374 EVGLGRSDEDVEVKEHEKPKKRDGEK 297
             G      D   KEH K K++  EK
Sbjct: 416 REGPRSRSRDRRRKEHAKSKEKKNEK 441



>gb:OSJN00286_1191036 Oryza sativa (japonica cultivar-group)
           chromosome 4 clone OSJNBa0042I15, *** SEQUENCING IN
           PROGRESS ***, 11 ordered pieces.
          Length = 1510

 Score = 33.9 bits (76), Expect = 2.4
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = -1

Query: 488 GSYGSKHIRGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPK-K 312
           G YG  H     P+  E     G+++ E +     H  EV     +ED EVK   KPK K
Sbjct: 220 GEYG--HFIADFPKSNEAKAKGGKKKPERAHVAEAHMPEVWYSGDEEDPEVKPKPKPKDK 277

Query: 311 RDGE 300
            DGE
Sbjct: 278 VDGE 281



>gb:CR628336_111073 Legionella pneumophila str. Paris complete
           genome.>gb:AE017354_459270 Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1, complete
           genome.>gb:AF480914_514445 Legionella pneumophila clone
           pB47G putative Na/Ca antiporter (nceA) gene, complete
           cds; and unknown gene.
          Length = 319

 Score = 33.9 bits (76), Expect = 2.4
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASV 482
           L+  +I +  A  H     + L    +LSP M  +T++ALG  AP++F S+
Sbjct: 7   LIISFIALLWAANHLVAGSSGLAIRFQLSPLMIGLTIVALGTSAPELFISI 57



>gb:CQ859750_1454445 Sequence 41 from Patent
           WO2004072277.>gb:AK025886_1910427 Homo sapiens cDNA:
           FLJ22233 fis, clone HRC02016.
          Length = 389

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 225 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 284

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 285 RQGYPRMAFSA 295



>gb:CQ859748_1454444 Sequence 39 from Patent WO2004072277.
          Length = 339

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
 Frame = +3

Query: 321 LFVLLYFY---ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           LF  L F    + I  A      ++  L    RLS ++  +TLLA GN   D F+     
Sbjct: 225 LFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLA 284

Query: 492 KGGQPRTGFGA 524
           + G PR  F A
Sbjct: 285 RQGYPRMAFSA 295



>gb:PFMAL1P1_1394249 Plasmodium falciparum DNA from MAL1P1, complete
           sequence.
          Length = 1451

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/91 (25%), Positives = 36/91 (39%)
 Frame = -1

Query: 569 EAHNKSRDKSPGREYRPKSSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRREAEMSDEL 390
           E   +  +K    +   K   G        G K   G     +++      RE E S++ 
Sbjct: 342 EDKEEEGEKEVSEDIEDKEEEGEKEESEDKGDKEEEGKKEVSEDKENAEEVREEEASEDK 401

Query: 389 GDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
            D + E+G G   ED+E KE E  K+   +K
Sbjct: 402 EDAE-ELGKGEVSEDMEDKEEEGKKEESEDK 431



>gb:CR926020_1185536 Pongo pygmaeus mRNA; cDNA DKFZp459M0120 (from
           clone DKFZp459M0120).
          Length = 402

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = -1

Query: 539 PGREYRPKSSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLG 360
           P +E  P+SS  +++L      + I+  IPQ  E+ R HG+   E   +  + D E+   
Sbjct: 289 PSKEKSPRSSKEMSALQEGNLEEKIKQHIPQMHEQRRFHGQAPLEEMRKAAE-DLEIATE 347

Query: 359 RSDEDVEVK 333
             DE +++K
Sbjct: 348 LQDEVLKLK 356



>gb:AY613856_1340676 Oikopleura dioica clone BACOIKO008 5xo15,
           complete sequence.
          Length = 557

 Score = 33.1 bits (74), Expect = 4.2
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 8/100 (8%)
 Frame = +3

Query: 216 CRFFSSDES----DGLFNYFSIHSC---LFRQNPFLSVPFL-GLFVLLYFYILITTAQAH 371
           C F+ + ES    +    Y  +  C     + + F+ +  L  L+ L  F  L   A A 
Sbjct: 37  CEFYENVESCELEESFIEYVEVVLCSDNADKDSYFIGMNILYSLWCLWLFIALGLVADAF 96

Query: 372 FSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAV 491
           F   +TK+ + L+LS ++  VTL+A G      F    A+
Sbjct: 97  FVPNLTKISSQLKLSENVAGVTLVAFGTALQTYFLQSPAL 136



>gb:AE016938_362386 Bacteroides thetaiotaomicron VPI-5482, section
           13 of 21 of the complete genome.>gb:AE015928_988874
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 328

 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/89 (20%), Positives = 40/89 (44%)
 Frame = +3

Query: 315 LGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVK 494
           + + +L+   ILI       +     +    R+   +  +T++A G  AP++  SVA+  
Sbjct: 1   MNILLLIGGLILILLGANGLTDGAASVAKRFRIPSIVIGLTIVAFGTSAPELTVSVASAL 60

Query: 495 GGQPRTGFGAILSAGTFVSAFVVGFVSIY 581
            G      G ++ +  F +  +VG  +++
Sbjct: 61  KGSADIAIGNVVGSNIFNTLMIVGCTALF 89



>gb:BC075168_2558280 Xenopus laevis MGC82072 protein, mRNA (cDNA
           clone MGC:82072 IMAGE:7011536), complete cds.
          Length = 353

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = -1

Query: 455 IPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDE-DVEVKEHEKPKKR 309
           +PQ +++ +T   RE E S+ +G  D E   G S + D   +E EKPKKR
Sbjct: 269 VPQSKKKSKTKKYREPE-SERVGRKDEEEEDGASHQNDCRTEEEEKPKKR 317



>gb:AE017346_1757151 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 568

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 6/94 (6%)
 Frame = -1

Query: 569 EAHNKSRDKSPGREYRPK--SSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRREAEMS- 399
           E  ++ +DK   ++ R    + +G  ++DG      + G   + + R R   ++ A+ + 
Sbjct: 475 EEKDEKKDKKDKKKKRKSEVAEAGDVTMDGDADLSMVAGETKE-ERRARKEAKKAAKAAK 533

Query: 398 ---DELGDHDGEVGLGRSDEDVEVKEHEKPKKRD 306
              +E GD D +    R+DED + ++ +K KK+D
Sbjct: 534 KAAEESGDGDKKSKKRRADEDEDSEKKKKKKKKD 567



>gb:AX646995_1472123 Sequence 1187 from Patent EP1270724.
          Length = 280

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 8/93 (8%)
 Frame = -1

Query: 557 KSRDKSPGREYRPK--SSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRRE----AEMSD 396
           +SR K  GRE R +  + +G  + +G  G+K   G   Q +   +TH RR+     E  +
Sbjct: 46  ESRGKKGGREGRGEEXAGAGTGTTEGKRGTKKGAGRQEQEEGSEQTHTRRKERERGEGRE 105

Query: 395 ELGDHDGEVGLGR--SDEDVEVKEHEKPKKRDG 303
             G+ + E G GR   +E  E +E    ++ +G
Sbjct: 106 RKGEEEEESG-GREGGEEQREARERRDRQQSEG 137



>gb:AY149017_1303968 Plasmodium chabaudi chabaudi PC15B mRNA,
           complete cds.
          Length = 123

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 17/38 (44%), Positives = 19/38 (50%)
 Frame = -2

Query: 601 STGKGAA*MDTKPTTKAETKVPAESIAPNPVLGWPPLT 488
           S+GK A   D KP  KAET     S  P P   +PP T
Sbjct: 85  SSGKPAPVADNKPAPKAETPAKPTSNTPPPTKSYPPPT 122



>gb:AJ586576_526378 Xanthomonas albilineans gene cluster XALB1 for
           albicidin pathotoxin production.
          Length = 317

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = +3

Query: 330 LLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPR 509
           L Y Y  +     H   V+  L  H +  P++ A  +  +G+      A   A+ GG+P 
Sbjct: 100 LEYSYQNLEDRPRHIRAVIDTLTGHAQFGPAIQAHNVAVIGHSVGGYTA--LAIAGGEPH 157

Query: 510 TGF 518
           TGF
Sbjct: 158 TGF 160



>gb:AE017175_397300 Porphyromonas gingivalis W83 section 4 of 8 of
           the complete genome.>gb:AE015924_1032911 Porphyromonas
           gingivalis W83 complete genome.
          Length = 317

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 19/88 (21%), Positives = 37/88 (42%)
 Frame = +3

Query: 315 LGLFVLLYFYILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVK 494
           L + +L+    L+       +     +    RLS  +  +T+LA G  AP++  S+ A  
Sbjct: 3   LNILLLIIGLALVVGGANFLTDGAASIAKRFRLSDLVIGLTVLAFGTSAPELTVSLMAAL 62

Query: 495 GGQPRTGFGAILSAGTFVSAFVVGFVSI 578
            G      G ++ +  F    +VG  ++
Sbjct: 63  KGSADIAIGNVIGSNIFNILAIVGITAL 90



>sp|Q8WXA9|SFRC_HUMAN Splicing factor, arginine/serine-rich 12
           (Serine-arginine-rich splicing regulatory protein 86)
           (SRrp86) (Splicing regulatory protein 508)
           (SRrp508).>gb:AF459094_1902677 Homo sapiens splicing
           factor, arginine/serine-rich 12 (SFRS12) mRNA, complete
           cds.
          Length = 508

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 14/98 (14%)
 Frame = -1

Query: 572 HEAHNKSRDKS-PGREYRPKSSSGLASLDGSYGSKHIRGPIPQ-------RQERHRTH-- 423
           + A  +SR  S   R  R +SSS       +   K  R P P+       ++E+ R H  
Sbjct: 368 YNASRRSRSSSRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRSRNKKDKKREKERDHIS 427

Query: 422 GRREAEMSDEL----GDHDGEVGLGRSDEDVEVKEHEK 321
            RRE E S  +     D DG+  L ++   ++ KEH K
Sbjct: 428 ERRERERSTSMRKSSNDRDGKEKLEKNSTSLKEKEHNK 465



>gb:AE017346_1757474 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 708

 Score = 32.3 bits (72), Expect = 7.1
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 8/89 (8%)
 Frame = -1

Query: 557 KSRDKSPGREYRPKSSSGLASLDGSYGSKHIRGPIPQRQERHR-------THGRREAEMS 399
           +SR +S GR    K S    S   S  S + R P P+R  + +        HGR    ++
Sbjct: 308 RSRSRSRGRSPPRKKSHRARSYSYSSSSSYSRSPSPERTCKQKWLDSIPEEHGRFIKTVA 367

Query: 398 DELGDHDGEVGLGRSDEDVEV-KEHEKPK 315
           + + +H      G+  EDV + KE E PK
Sbjct: 368 NRVKEH------GKGFEDVLMEKERENPK 390



>gb:AC133398_1741433 Oryza sativa chromosome 3 BAC OSJNBa0083F15
           genomic sequence, complete sequence.
          Length = 1177

 Score = 32.3 bits (72), Expect = 7.1
 Identities = 19/58 (32%), Positives = 26/58 (44%)
 Frame = -1

Query: 488 GSYGSKHIRGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPK 315
           G YG  H     P+  E     G+++ E +  +  H  EV     +ED EVK   KPK
Sbjct: 129 GEYG--HFIADCPKSNESKANGGKKKPEHAHVVEAHMAEVWYSGDEEDPEVKPKPKPK 184



>gb:AY589780_1616592 Saccharomyces mikatae SED1 gene, partial cds.
          Length = 267

 Score = 32.3 bits (72), Expect = 7.1
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = -2

Query: 562 TTKAETKVPAESIAPNPVLGWPPLTAATEANTSGAPF-PSAKSVT 431
           +++A T++P   I+PN    +PP T+   +NT+  P+ PS +  T
Sbjct: 75  SSEAPTELPTSFISPNSTTAFPPTTSLPPSNTTIPPYNPSTEYTT 119



>gb:BA000030_704881 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 217

 Score = 32.3 bits (72), Expect = 7.1
 Identities = 18/41 (43%), Positives = 20/41 (48%)
 Frame = +2

Query: 344 HPHHYGPGPLLRRGHQARRSSPPLAVHGCGDALGAGEWGPG 466
           H HH GPGP  R G + RR +      G G   G G  GPG
Sbjct: 17  HGHHGGPGPRGRGGFEGRRGA--FGPFGPGGPGGPGFGGPG 55



>pir|E70306|E70306 conserved hypothetical protein aq_066 - Aquifex
           aeolicus>gb:AE000672_25831 Aquifex aeolicus VF5 section
           4 of 109 of the complete genome.>gb:AE000657_976362
           Aquifex aeolicus VF5 complete genome.
          Length = 322

 Score = 32.3 bits (72), Expect = 7.1
 Identities = 16/62 (25%), Positives = 31/62 (50%)
 Frame = +3

Query: 393 LVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFVVGFV 572
           L   L +S ++  + ++A+G   P++FAS  +   G P    G +  +  F +  V+G  
Sbjct: 199 LAKALGVSEAVIGLFVVAIGTSLPELFASAVSAYKGNPDIALGNVAGSNIFNATLVLGTS 258

Query: 573 SI 578
           S+
Sbjct: 259 SV 260



>pir|T24415|T24415 hypothetical protein T04A11.6 - Caenorhabditis
           elegans
          Length = 1231

 Score = 32.3 bits (72), Expect = 7.1
 Identities = 23/70 (32%), Positives = 33/70 (47%)
 Frame = -1

Query: 524 RPKSSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDED 345
           +P S + LASL  S         I   Q+RH  HGR    + D+  +   EVGL  +D +
Sbjct: 422 QPPSKNTLASLQKSDSE------IALNQQRHDMHGRFRGFLQDDSEEFSDEVGLLGADMN 475

Query: 344 VEVKEHEKPK 315
            E+ +  K K
Sbjct: 476 KELYDTLKSK 485



>sp|O18017|BLM_CAEEL Bloom's syndrome protein homolog (EC 3.6.1.-)
           (RecQ helicase homolog).>gb:AY095296_1298362
           Caenorhabditis elegans RecQ helicase (him-6) mRNA,
           complete cds.>gb:CET04A11_1367110 Caenorhabditis elegans
           cosmid T04A11, complete sequence.
          Length = 988

 Score = 32.3 bits (72), Expect = 7.1
 Identities = 23/70 (32%), Positives = 33/70 (47%)
 Frame = -1

Query: 524 RPKSSSGLASLDGSYGSKHIRGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDED 345
           +P S + LASL  S         I   Q+RH  HGR    + D+  +   EVGL  +D +
Sbjct: 179 QPPSKNTLASLQKSDSE------IALNQQRHDMHGRFRGFLQDDSEEFSDEVGLLGADMN 232

Query: 344 VEVKEHEKPK 315
            E+ +  K K
Sbjct: 233 KELYDTLKSK 242



>gb:AK129145_2069376 Mus musculus mRNA for mKIAA0444 protein.
          Length = 702

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 99  KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 152



>gb:AB025582_2044389 Mus musculus mRNA for proliferation related
           acidic leucine rich protein PAL31, complete
           cds.>gb:BC003489_2089256 Mus musculus acidic nuclear
           phosphoprotein 32 family, member B, mRNA (cDNA clone
           MGC:6313 IMAGE:2811622), complete
           cds.>gb:BC005628_2090031 Mus musculus acidic nuclear
           phosphoprotein 32 family, member B, mRNA (cDNA clone
           MGC:11590 IMAGE:3963541), complete cds.
          Length = 272

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = -1

Query: 446 RQERHRTHGRREAEMSDELGDHDGEV-GLGRSDEDVEVKEHEKPKKRDGEK 297
           R+++       E +  +E  D DGEV G+ + +ED E ++ E+ +  DGE+
Sbjct: 150 REDQEAPDSDVEVDSVEEAPDSDGEVDGVDKEEEDEEGEDEEEEEDEDGEE 200



>gb:HS384F21_1998383 Human DNA sequence from clone RP3-384F21 on
           chromosome 1q24 Contains part of the gene for expressed
           in hematopoietic cells (heart, liver) (HLL) and the
           GPR52 gene for G protein-coupled receptor 52, complete
           sequence.>gb:HS681J21_1999266 Human DNA sequence from
           clone RP4-681J21 on chromosome 1q23.2-24.3 Contains the
           5' end of a novel gene, the 5' end of the gene for
           expressed in hematopoietic cells (heart, liver) (HLL)
           and a CpG island, complete
           sequence.>gb:HS681J211_1999269 Novel human mRNA from
           chromosome 1, clones AL031286, AL022400, AL022171, has
           similarities to mouse Hh1 mRNA (af118565) and human rab6
           GTPase activating protein.>gb:HS809F4_1999536 Human DNA
           sequence from clone RP4-809F4 on chromosome 1q23.1-24.3
           Contains part of the gene for expressed in hematopoietic
           cells (heart, liver) (HLL), a novel pseudogene and a CpG
           island, complete sequence.
          Length = 582

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 135 PTYSSNHPSKHILLSPHRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQNP 296
           P   +N PS  ++L P  + +++P+PS      +E   LFN  +   C+   +P
Sbjct: 92  PASQTNKPSLQLILDPSNTEISTPRPSSPGGLPEEDSVLFNKLTYLGCMKVSSP 145



>gb:HS233K16_1997698 Human DNA sequence from clone RP1-233K16 on
           chromosome 1p36.21-36.33 Contains the 5' end of the
           NPHP4 gene for nephronophthisis 4, the KCNAB2 gene for
           potassium voltage-gated channel, shaker-related
           subfamily, beta member 2, the 3' end of the CHD5 gene
           for chromodomain helicase DNA binding protein 5 and a
           CpG island, complete sequence.
          Length = 808

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 198 KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 251



>gb:HS120G22_1997031 Human DNA sequence from clone RP1-120G22 on
            chromosome 1p36.21-36.33 Contains the 5' end of the CHD5
            gene for chromodomain helicase DNA binding protein 5, the
            RPL22 gene for ribosomal protein L22, eight novel genes,
            the ICMT gene for isoprenylcysteine carboxyl
            methyltransferase, possible ortholog of rodent
            transcription factor HES-3, the 3' end of the gene for
            brain acyl-CoA hydrolase (BACH) and seven CpG islands,
            complete sequence.>gb:HS233K16_1997695 Human DNA sequence
            from clone RP1-233K16 on chromosome 1p36.21-36.33
            Contains the 5' end of the NPHP4 gene for
            nephronophthisis 4, the KCNAB2 gene for potassium
            voltage-gated channel, shaker-related subfamily, beta
            member 2, the 3' end of the CHD5 gene for chromodomain
            helicase DNA binding protein 5 and a CpG island, complete
            sequence.
          Length = 1195

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464  RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
            +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 857  KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 910



>gb:BC041888_1983156 Homo sapiens RAB GTPase activating protein
           1-like, mRNA (cDNA clone MGC:44489 IMAGE:5298493),
           complete cds.>gb:HS384F21_1998384 Human DNA sequence
           from clone RP3-384F21 on chromosome 1q24 Contains part
           of the gene for expressed in hematopoietic cells (heart,
           liver) (HLL) and the GPR52 gene for G protein-coupled
           receptor 52, complete sequence.>gb:HS681J21_1999268
           Human DNA sequence from clone RP4-681J21 on chromosome
           1q23.2-24.3 Contains the 5' end of a novel gene, the 5'
           end of the gene for expressed in hematopoietic cells
           (heart, liver) (HLL) and a CpG island, complete
           sequence.>gb:HS809F4_1999537 Human DNA sequence from
           clone RP4-809F4 on chromosome 1q23.1-24.3 Contains part
           of the gene for expressed in hematopoietic cells (heart,
           liver) (HLL), a novel pseudogene and a CpG island,
           complete sequence.>gb:HS970D1_1999850 Human DNA sequence
           from clone RP5-970D1 on chromosome 1q24 Contains the 3'
           end of a variant of the gene for expressed in
           hematopoietic cells (heart, liver) (HLL), complete
           sequence.
          Length = 605

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 135 PTYSSNHPSKHILLSPHRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQNP 296
           P   +N PS  ++L P  + +++P+PS      +E   LFN  +   C+   +P
Sbjct: 55  PASQTNKPSLQLILDPSNTEISTPRPSSPGGLPEEDSVLFNKLTYLGCMKVSSP 108



>gb:BC021210_1977421 Homo sapiens hypothetical protein BC018697,
           mRNA (cDNA clone MGC:12924 IMAGE:4137205), complete cds.
          Length = 350

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 24/65 (36%), Positives = 26/65 (40%), Gaps = 9/65 (13%)
 Frame = +2

Query: 458 GPGCVCFRSCRQGRPAQNWIWGDTLCRDF--CLGFCCGLRVHLCRALS-------GRSGP 610
           GPGC    SCR     ++W W     R    CL   C      CR  S       GRSG 
Sbjct: 183 GPGC---ESCRPSH--RDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGG 237

Query: 611 VCEGC 625
           VCE C
Sbjct: 238 VCERC 242



>gb:BC018654_1976556 Homo sapiens hypothetical protein BC018697,
           mRNA (cDNA clone MGC:2419 IMAGE:2961115), complete
           cds.>gb:BC018697_1976576 Homo sapiens hypothetical
           protein BC018697, mRNA (cDNA clone MGC:4067
           IMAGE:2961115), complete cds.>gb:BC033207_1980861 Homo
           sapiens hypothetical protein BC018697, mRNA (cDNA clone
           MGC:45863 IMAGE:4903484), complete cds.
          Length = 489

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 24/65 (36%), Positives = 26/65 (40%), Gaps = 9/65 (13%)
 Frame = +2

Query: 458 GPGCVCFRSCRQGRPAQNWIWGDTLCRDF--CLGFCCGLRVHLCRALS-------GRSGP 610
           GPGC    SCR     ++W W     R    CL   C      CR  S       GRSG 
Sbjct: 183 GPGC---ESCRPSH--RDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGG 237

Query: 611 VCEGC 625
           VCE C
Sbjct: 238 VCERC 242



>gb:AL592046_1930296 Human DNA sequence from clone RP11-155O24 on
           chromosome X Contains part of the gene for upstream
           regulatory element binding protein 1 (UREB1) and a CpG
           island, complete sequence.>gb:HS339A18_1998158 Human DNA
           sequence from clone RP3-339A18 on chromosome Xp11.1-11.4
           Contains the 5' end of the SMC1L1 gene for SMC1
           structural maintenance of chromosomes 1-like 1 (yeast),
           a novel RIB43A domain containing protein (FLJ32783), the
           HADH2 gene for hydroxyacyl-Coenzyme A dehydrogenase type
           II, a novel pseudogene (FLJ20516), the 3' end of the
           gene for upstream regulatory element binding protein 1
           (UREB1), a novel gene and three CpG islands, complete
           sequence.
          Length = 1196

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -2

Query: 613 NGAGSTGKGAA*MDTKPTTKAETKVPAESIAPNPVLGWPPLTAATEANT 467
           +GA ST    +   T  TT A T  P    AP PV   P L AAT  +T
Sbjct: 315 SGASSTTTATSTTSTTTTTAAST-TPTPPTAPTPVTSAPALVAATAIST 362



>gb:AL592046_1930295 Human DNA sequence from clone RP11-155O24 on
            chromosome X Contains part of the gene for upstream
            regulatory element binding protein 1 (UREB1) and a CpG
            island, complete sequence.>gb:HS339A18_1998159 Human DNA
            sequence from clone RP3-339A18 on chromosome Xp11.1-11.4
            Contains the 5' end of the SMC1L1 gene for SMC1
            structural maintenance of chromosomes 1-like 1 (yeast), a
            novel RIB43A domain containing protein (FLJ32783), the
            HADH2 gene for hydroxyacyl-Coenzyme A dehydrogenase type
            II, a novel pseudogene (FLJ20516), the 3' end of the gene
            for upstream regulatory element binding protein 1
            (UREB1), a novel gene and three CpG islands, complete
            sequence.
          Length = 3407

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -2

Query: 613  NGAGSTGKGAA*MDTKPTTKAETKVPAESIAPNPVLGWPPLTAATEANT 467
            +GA ST    +   T  TT A T  P    AP PV   P L AAT  +T
Sbjct: 2511 SGASSTTTATSTTSTTTTTAAST-TPTPPTAPTPVTSAPALVAATAIST 2558



>gb:AL592046_1930294 Human DNA sequence from clone RP11-155O24 on
            chromosome X Contains part of the gene for upstream
            regulatory element binding protein 1 (UREB1) and a CpG
            island, complete sequence.>gb:HS154P24_1997217 Human DNA
            sequence from clone RP1-154P24 on chromosome Xp11.1-11.23
            Contains the 5' end of the gene for upstream regulatory
            element binding protein 1 (UREB1) and three CpG islands,
            complete sequence.>gb:HS339A18_1998157 Human DNA sequence
            from clone RP3-339A18 on chromosome Xp11.1-11.4 Contains
            the 5' end of the SMC1L1 gene for SMC1 structural
            maintenance of chromosomes 1-like 1 (yeast), a novel
            RIB43A domain containing protein (FLJ32783), the HADH2
            gene for hydroxyacyl-Coenzyme A dehydrogenase type II, a
            novel pseudogene (FLJ20516), the 3' end of the gene for
            upstream regulatory element binding protein 1 (UREB1), a
            novel gene and three CpG islands, complete sequence.
          Length = 4374

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -2

Query: 613  NGAGSTGKGAA*MDTKPTTKAETKVPAESIAPNPVLGWPPLTAATEANT 467
            +GA ST    +   T  TT A T  P    AP PV   P L AAT  +T
Sbjct: 3478 SGASSTTTATSTTSTTTTTAAST-TPTPPTAPTPVTSAPALVAATAIST 3525



>gb:AL136377_1919160 Human DNA sequence from clone RP5-830A10 on
           chromosome 1 Contains part of the gene for expressed in
           hematopoietic cells (heart, liver) (HLL), complete
           sequence.>gb:AL161671_1922123 Human DNA sequence from
           clone RP11-64I24 on chromosome 1 Contains a barrier to
           autointegration factor 1 (BANF1) pseudogene, part of the
           gene for expressed in hematopoietic cells (heart, liver)
           (HLL) and a chromosome 6 open reading frame 66 (C6orf66)
           pseudogene, complete sequence.>gb:AL591108_1929990 Human
           DNA sequence from clone RP11-11B12 on chromosome 1
           Contains part of the gene for expressed in hematopoietic
           cells (heart, liver) (HLL), complete
           sequence.>gb:HS102G20_1996546 Human DNA sequence from
           clone RP1-102G20 on chromosome 1q24-25 Contains a novel
           pseudogene, two novel genes, a ribosomal protein S26
           (RPS26) pseudogenem, the 3' end of the gene for
           expressed in hematopoietic cells (heart, liver) (HLL),
           the gene for Siah-interacting protein (SIP), the 3' end
           of the MRPS14 gene for mitochondrial ribosomal protein
           S14 and a CpG island, complete
           sequence.>gb:HS384F21_1998385 Human DNA sequence from
           clone RP3-384F21 on chromosome 1q24 Contains part of the
           gene for expressed in hematopoietic cells (heart, liver)
           (HLL) and the GPR52 gene for G protein-coupled receptor
           52, complete sequence.>gb:HS681J21_1999267 Human DNA
           sequence from clone RP4-681J21 on chromosome 1q23.2-24.3
           Contains the 5' end of a novel gene, the 5' end of the
           gene for expressed in hematopoietic cells (heart, liver)
           (HLL) and a CpG island, complete
           sequence.>gb:HS809F4_1999538 Human DNA sequence from
           clone RP4-809F4 on chromosome 1q23.1-24.3 Contains part
           of the gene for expressed in hematopoietic cells (heart,
           liver) (HLL), a novel pseudogene and a CpG island,
           complete sequence.
          Length = 815

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 135 PTYSSNHPSKHILLSPHRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQNP 296
           P   +N PS  ++L P  + +++P+PS      +E   LFN  +   C+   +P
Sbjct: 92  PASQTNKPSLQLILDPSNTEISTPRPSSPGGLPEEDSVLFNKLTYLGCMKVSSP 145



>gb:AK126012_1916159 Homo sapiens cDNA FLJ44024 fis, clone
           TESTI4026524, moderately similar to Chromodomain
           helicase-DNA-binding protein 4.
          Length = 671

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 61  KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 114



>gb:AK095838_1914447 Homo sapiens cDNA FLJ38519 fis, clone
           HCHON2000751, moderately similar to Rab6 GTPase
           activating protein.
          Length = 815

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 135 PTYSSNHPSKHILLSPHRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQNP 296
           P   +N PS  ++L P  + +++P+PS      +E   LFN  +   C+   +P
Sbjct: 92  PASQTNKPSLQLILDPSNTEISTPRPSSPGGLPEEDSVLFNKLTYLGCMKVSSP 145



>gb:AF425231_1901805 Homo sapiens chromodomain helicase DNA binding
            protein 5 (CHD5) mRNA, complete cds.>gb:HS120G22_1997030
            Human DNA sequence from clone RP1-120G22 on chromosome
            1p36.21-36.33 Contains the 5' end of the CHD5 gene for
            chromodomain helicase DNA binding protein 5, the RPL22
            gene for ribosomal protein L22, eight novel genes, the
            ICMT gene for isoprenylcysteine carboxyl
            methyltransferase, possible ortholog of rodent
            transcription factor HES-3, the 3' end of the gene for
            brain acyl-CoA hydrolase (BACH) and seven CpG islands,
            complete sequence.>gb:HS233K16_1997696 Human DNA sequence
            from clone RP1-233K16 on chromosome 1p36.21-36.33
            Contains the 5' end of the NPHP4 gene for
            nephronophthisis 4, the KCNAB2 gene for potassium
            voltage-gated channel, shaker-related subfamily, beta
            member 2, the 3' end of the CHD5 gene for chromodomain
            helicase DNA binding protein 5 and a CpG island, complete
            sequence.
          Length = 1954

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464  RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
            +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 1341 KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 1394



>gb:AB071605_1871213 Homo sapiens mRNA for HECT domain protein LASU1,
            complete cds.
          Length = 3360

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -2

Query: 613  NGAGSTGKGAA*MDTKPTTKAETKVPAESIAPNPVLGWPPLTAATEANT 467
            +GA ST    +   T  TT A T  P    AP PV   P L AAT  +T
Sbjct: 2464 SGASSTTTATSTTSTTTTTAAST-TPTPPTAPTPVTSAPALVAATAIST 2511



>gb:AB029010_1865866 Homo sapiens mRNA for KIAA1087 protein, partial
           cds.
          Length = 952

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +3

Query: 345 ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGF-- 518
           I IT A    SV   ++      + ++  +TL+ALG+ AP++  SV  V G   + G   
Sbjct: 138 ITITKANGETSVGTVRI-----WNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELG 192

Query: 519 -GAILSAGTFVSAFVVGFVSIY 581
            G I+ +  F + FVV  V IY
Sbjct: 193 PGTIVGSAAF-NMFVVIAVCIY 213



>gb:AB007913_1864030 Homo sapiens mRNA for KIAA0444 protein, partial
           cds.
          Length = 978

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 365 KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 418



>gb:AB002310_1863617 Homo sapiens mRNA for KIAA0312 gene, partial cds.
          Length = 3192

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -2

Query: 613  NGAGSTGKGAA*MDTKPTTKAETKVPAESIAPNPVLGWPPLTAATEANT 467
            +GA ST    +   T  TT A T  P    AP PV   P L AAT  +T
Sbjct: 2296 SGASSTTTATSTTSTTTTTAAST-TPTPPTAPTPVTSAPALVAATAIST 2343



>gb:AP002745_1822735 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0489G09.>gb:AP002861_1823245 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0665D10.
          Length = 771

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 6/54 (11%)
 Frame = +2

Query: 323 FRAPLLLH-----PHHYGPGPLLRRGHQARRSSPPLAVHGCGDALG-AGEWGPG 466
           F +PL LH     PH      + RRG + R ++PP A    G+A G  G  GPG
Sbjct: 49  FGSPLPLHARFHWPHAVASSSMRRRGRRRRATAPPAAA-AAGEATGDGGGSGPG 101



>gb:CENACAEX_1366363 C.elegans mRNA for protein similar to
           vertebrate Na/Ca exchanger
           (CE-NCX1).>gb:CEY113G7A_1369325 Caenorhabditis elegans
           YAC Y113G7A, complete sequence.
          Length = 880

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +3

Query: 411 LSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGFGAILSAGTFVSAFV 560
           L  S+ A+TL+A+G   PD FAS  A  G Q   G    ++    V+ F+
Sbjct: 737 LKDSVTALTLVAMGTSLPDTFASRTAAVGDQWADGSIGNVTGSNAVNVFL 786



>gb:PFMAL8P1_1192305 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1121

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 6/54 (11%)
 Frame = -1

Query: 437 RHRTHGRREAEMSDELGDHDGEVGLGRSDEDVE------VKEHEKPKKRDGEKW 294
           R    G  +  M D  GD D      +SDEDV         ++EK K R  EKW
Sbjct: 260 RDDNKGDEDVSMDDNKGDEDVSRDDNKSDEDVSRDDENISSDNEKKKNRKEEKW 313



>gb:HSM802121_1186609 Homo sapiens mRNA; cDNA DKFZp434P202 (from
           clone DKFZp434P202).
          Length = 1061

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 715 KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 768



>gb:HSM801006_1186019 Homo sapiens mRNA; cDNA DKFZp434N231 (from
           clone DKFZp434N231).
          Length = 1388

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 775 KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 828



>gb:HSM800877_1185964 Homo sapiens mRNA; cDNA DKFZp434K213 (from
           clone DKFZp434K213).
          Length = 1059

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 723 KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 776



>gb:CR858152_1182339 Pongo pygmaeus mRNA; cDNA DKFZp468O1511 (from
           clone DKFZp468O1511).
          Length = 815

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = +3

Query: 135 PTYSSNHPSKHILLSPHRSLLNSPQPSCRFFSSDESDGLFNYFSIHSCLFRQNP 296
           P   +N PS  ++L P  + +++P+PS      +E   LFN  +   C+   +P
Sbjct: 92  PASQTNKPSLQLILDPSNTEISTPRPSSPGGLPEEDSVLFNKLTYLGCMKVSSP 145



>gb:AF161390_1150283 Homo sapiens HSPC272 mRNA, partial cds.
          Length = 2011

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -2

Query: 613  NGAGSTGKGAA*MDTKPTTKAETKVPAESIAPNPVLGWPPLTAATEANT 467
            +GA ST    +   T  TT A T  P    AP PV   P L AAT  +T
Sbjct: 1028 SGASSTTTATSTTSTTTTTAAST-TPTPPTAPTPVTSAPALVAATAIST 1075



>pir|T17269|T17269 hypothetical protein DKFZp434N231.1 - human
           (fragment)
          Length = 1388

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 15/56 (26%), Positives = 29/56 (51%)
 Frame = -1

Query: 464 RGPIPQRQERHRTHGRREAEMSDELGDHDGEVGLGRSDEDVEVKEHEKPKKRDGEK 297
           +G   ++Q  +    + + E  DEL D+  E  +G  DED + +  E+P+ + G +
Sbjct: 775 KGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFE--ERPEGQSGRR 828



>pir|JC7357|JC7357 31K proliferation related acidic leucine-rich
           protein - rat>gb:AB025581_2044388 Rattus norvegicus mRNA
           for proliferation related acidic leucine rich protein
           PAL31, complete cds.>gb:BC086508_2109644 Rattus
           norvegicus acidic nuclear phosphoprotein 32 family,
           member B, mRNA (cDNA clone MGC:91514 IMAGE:7103152),
           complete cds.
          Length = 272

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = -1

Query: 446 RQERHRTHGRREAEMSDELGDHDGEV-GLGRSDEDVEVKEHEKPKKRDGEK 297
           R+++       E +  +E  D DGEV G+ + +ED E ++ E+ +  DGE+
Sbjct: 150 REDQEAPDSDVEVDSVEEAPDSDGEVDGVDKEEEDEEGEDEEEEEDEDGEE 200



>sp|Q9UPR5|NAC2_HUMAN Sodium/calcium exchanger 2 precursor
           (Na(+)/Ca(2+)-exchange protein 2).
          Length = 921

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = +3

Query: 345 ILITTAQAHFSVVVTKLVAHLRLSPSMGAVTLLALGNGAPDVFASVAAVKGGQPRTGF-- 518
           I IT A    SV   ++      + ++  +TL+ALG+ AP++  SV  V G   + G   
Sbjct: 107 ITITKANGETSVGTVRI-----WNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELG 161

Query: 519 -GAILSAGTFVSAFVVGFVSIY 581
            G I+ +  F + FVV  V IY
Sbjct: 162 PGTIVGSAAF-NMFVVIAVCIY 182


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 633,496,648
Number of Sequences: 1806583
Number of extensions: 13020619
Number of successful extensions: 52095
Number of sequences better than 10.0: 167
Number of HSP's better than 10.0 without gapping: 48250
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51921
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 34858786810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)