BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7694
         (845 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB022220_1515144 Arabidopsis thaliana genomic DNA, chromosome...   286   3e-76   
gb:AE005173_893273 Arabidopsis thaliana chromosome 1, bottom arm...   282   6e-75   
pir|F96577|F96577 hypothetical protein F22G10.3 [imported] - Ara...   282   6e-75   Arabidopsis thaliana [mouse-ear cress]
gb:AC079633_1732639 Genomic Sequence for Oryza sativa, Nipponbar...   280   2e-74   
pir|T01268|T01268 leucine-rich repeat transmembrane protein kina...   277   2e-73   Zea mays [maize]
gb:AF023164_1762043 Zea mays leucine-rich repeat transmembrane p...   276   5e-73   
pir|T01267|T01267 leucine-rich repeat transmembrane protein kina...   276   5e-73   Zea mays [maize]
gb:AY224517_1590714 Oryza sativa (japonica cultivar-group) isola...   268   7e-71   
gb:AP004308_1839999 Oryza sativa (japonica cultivar-group) genom...   265   1e-69   
gb:AY518290_1610792 Arabidopsis thaliana strubbelig receptor fam...   258   1e-67   
gb:AP005849_1859071 Oryza sativa (japonica cultivar-group) genom...   253   4e-66   
gb:AC091787_1735101 Oryza sativa (japonica cultivar-group) chrom...   249   4e-65   
gb:AY664415_1620622 Zea mays cultivar B73 locus 9009, complete s...   245   9e-64   
gb:AF023166_1762045 Zea mays leucine-rich repeat transmembrane p...   244   1e-63   
pir|T01296|T01296 leucine-rich repeat transmembrane protein kina...   244   1e-63   Zea mays [maize]
gb:AY518289_1610791 Arabidopsis thaliana strubbelig receptor fam...   243   4e-63   
gb:AY518293_1610795 Arabidopsis thaliana strubbelig receptor fam...   230   2e-59   
gb:AE016959_1022362 Oryza sativa (japonica cultivar-group) chrom...   225   7e-58   
gb:AY518287_1610789 Arabidopsis thaliana strubbelig receptor fam...   204   1e-51   
gb:FSY298984_1679418 Fagus sylvatica partial mRNA for thymidine ...   204   2e-51   
gb:AP000366_1819746 Oryza sativa (japonica cultivar-group) genom...   195   1e-48   
gb:AP003992_1836055 Oryza sativa (japonica cultivar-group) genom...   186   4e-46   
gb:AC006234_1533809 Arabidopsis thaliana chromosome 2 clone F5H1...   182   7e-45   
gb:AY091019_1574250 Arabidopsis thaliana unknown protein (At1g11...   181   2e-44   
pir|D86245|D86245 hypothetical protein [imported] - Arabidopsis ...   178   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AY518288_1610790 Arabidopsis thaliana strubbelig receptor fam...   178   1e-43   
pir|B84594|B84594 probable LRR receptor protein kinase [imported...   175   1e-42   Arabidopsis thaliana [mouse-ear cress]
pir|A85043|A85043 probable LRR receptor-like protein kinase [imp...   145   9e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AP005474_1852533 Oryza sativa (japonica cultivar-group) genom...   118   2e-25   
gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genom...   117   4e-25   
gb:AK117863_1815873 Arabidopsis thaliana At1g79620 mRNA for unkn...   108   2e-22   
pir|T48210|T48210 hypothetical protein T20L15.160 - Arabidopsis ...   108   2e-22   Arabidopsis thaliana [mouse-ear cress]
pir|T10659|T10659 probable serine/threonine-specific protein kin...   108   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AE005173_895483 Arabidopsis thaliana chromosome 1, bottom arm...   107   4e-22   
pir|T04568|T04568 protein kinase homolog T12H17.120 - Arabidopsi...   106   5e-22   Arabidopsis thaliana [mouse-ear cress]
gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporoge...   105   1e-21   
sp|Q9LYN8|EXS_ARATH|EXS_ARATH Leucine-rich repeat receptor protein kinase ...   104   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860357 Oryza sativa (japonica cultivar-group) genom...   103   3e-21   
gb:AP003705_1832164 Oryza sativa (japonica cultivar-group) genom...   103   4e-21   
gb:AY102147_1577752 Arabidopsis thaliana At1g68400/T2E12_5 mRNA,...   101   2e-20   
gb:AB025613_1516374 Arabidopsis thaliana genomic DNA, chromosome...   101   2e-20   
pir|T01057|T01057 hypothetical protein YUP8H12R.40 - Arabidopsis...   101   2e-20   Arabidopsis thaliana [mouse-ear cress]
pir|H96707|H96707 probable receptor kinase T2E12.5 [imported] - ...   101   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome...   100   3e-20   
gb:AE005173_895101 Arabidopsis thaliana chromosome 1, bottom arm...   100   3e-20   
pir|D84889|D84889 probable receptor-like protein kinase [importe...   100   3e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC116926_1739356 Genomic sequence for Oryza sativa (japonica ...   100   5e-20   
gb:AY128385_1580684 Arabidopsis thaliana putative disease resist...   100   5e-20   
gb:AB028616_1518004 Arabidopsis thaliana genomic DNA, chromosome...   100   5e-20   
gb:AE016959_1022229 Oryza sativa (japonica cultivar-group) chrom...   100   5e-20   
pir|G84524|G84524 probable disease resistance protein [imported]...   100   5e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AF084034_1767051 Arabidopsis thaliana receptor-like protein k...   100   6e-20   
gb:AY244745_1592516 Arabidopsis thaliana ERECTA-like kinase 1 (E...   100   6e-20   
pir|G96524|G96524 protein T1N15.9 [imported] - Arabidopsis thali...   100   6e-20   Arabidopsis thaliana [mouse-ear cress]
pir|T04587|T04587 hypothetical protein F23E13.70 - Arabidopsis t...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP003302_1827702 Oryza sativa (japonica cultivar-group) genom...    98   2e-19   
gb:AC105364_1737972 Oryza sativa (japonica cultivar-group) chrom...    98   2e-19   
gb:AE016959_1021913 Oryza sativa (japonica cultivar-group) chrom...    98   2e-19   
gb:AP004769_1844738 Oryza sativa (japonica cultivar-group) genom...    98   2e-19   
gb:AC144737_1744140 Oryza sativa (japonica cultivar-group) chrom...    98   2e-19   
gb:AB019228_1514104 Arabidopsis thaliana genomic DNA, chromosome...    98   2e-19   
gb:AE016959_1021899 Oryza sativa (japonica cultivar-group) chrom...    98   2e-19   
gb:AP004747_1844315 Oryza sativa (japonica cultivar-group) genom...    97   3e-19   
gb:AY070033_1566676 Arabidopsis thaliana unknown protein (At3g56...    97   3e-19   
gb:AE016959_1020720 Oryza sativa (japonica cultivar-group) chrom...    97   3e-19   
pir|T49038|T49038 hypothetical protein T5P19.20 - Arabidopsis th...    97   3e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY086189_1571244 Arabidopsis thaliana clone 22221 mRNA, compl...    97   4e-19   
gb:AB019230_1514140 Arabidopsis thaliana genomic DNA, chromosome...    97   5e-19   
gb:AP005420_1851511 Oryza sativa (japonica cultivar-group) genom...    96   7e-19   
gb:BT006486_1639373 Arabidopsis thaliana At5g49760 gene, complet...    96   7e-19   
gb:AB025613_1516372 Arabidopsis thaliana genomic DNA, chromosome...    96   7e-19   
gb:AX196315_1463942 Sequence 22 from Patent WO0151627.                 96   7e-19   
gb:AX196312_1463939 Sequence 19 from Patent WO0151627.>gb:AX1963...    96   7e-19   
gb:AX196311_1463938 Sequence 18 from Patent WO0151627.>gb:AX1963...    96   7e-19   
gb:AP005966_1860372 Oryza sativa (japonica cultivar-group) genom...    96   9e-19   
pir|T47727|T47727 hypothetical protein F18O21.60 - Arabidopsis t...    96   9e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AC087553_1734109 Oryza sativa (japonica cultivar-group) chrom...    96   1e-18   
gb:AC084817_1733844 Oryza sativa (japonica cultivar-group) chrom...    96   1e-18   
gb:AC013288_1537852 Arabidopsis thaliana chromosome 1 BAC F4N21 ...    96   1e-18   
gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 ...    96   1e-18   
pir|H84421|H84421 probable receptor-like protein kinase [importe...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AY244746_1592517 Arabidopsis thaliana ERECTA-like kinase 2 (E...    95   2e-18   
pir|T48489|T48489 receptor-like protein kinase - Arabidopsis tha...    95   2e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860364 Oryza sativa (japonica cultivar-group) genom...    94   2e-18   
gb:AP003977_1835846 Oryza sativa (japonica cultivar-group) genom...    94   2e-18   
gb:AF506516_1806898 Glycine max receptor-like kinase RHG1 gene, ...    94   2e-18   
gb:AY182165_1587873 Elaeis guineensis clone Rlk-OPff receptor-li...    94   2e-18   
gb:AY059802_1564646 Arabidopsis thaliana leucine-rich repeat pro...    94   2e-18   
gb:AY057648_1564061 Arabidopsis thaliana At3g12148/T23B7.11 mRNA...    94   2e-18   
gb:AC073395_1541016 Arabidopsis thaliana chromosome 3 BAC F11B9 ...    94   2e-18   
gb:AX196310_1463937 Sequence 17 from Patent WO0151627.                 94   2e-18   
gb:AX196309_1463936 Sequence 16 from Patent WO0151627.                 94   2e-18   
gb:AX196306_1463933 Sequence 13 from Patent WO0151627.                 94   2e-18   
gb:AX196305_1463932 Sequence 12 from Patent WO0151627.                 94   2e-18   
gb:AX196304_1463931 Sequence 11 from Patent WO0151627.                 94   2e-18   
gb:AX196303_1463930 Sequence 10 from Patent WO0151627.                 94   2e-18   
gb:AX196296_1463926 Sequence 3 from Patent WO0151627.>gb:AX19630...    94   2e-18   
gb:AX196295_1463925 Sequence 2 from Patent WO0151627.>gb:AX19630...    94   2e-18   
gb:AP005321_1850585 Oryza sativa (japonica cultivar-group) genom...    94   3e-18   
pir|G84652|G84652 probable receptor-like protein kinase [importe...    94   3e-18   Arabidopsis thaliana [mouse-ear cress]
pir|B86465|B86465 probable Protein kinase [imported] - Arabidops...    94   3e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 ...    94   4e-18   
gb:AY268139_1593942 Hordeum vulgare BAC 184G9, complete sequece.       94   4e-18   
gb:AB010073_1510938 Arabidopsis thaliana genomic DNA, chromosome...    94   4e-18   
gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genom...    93   6e-18   
gb:AF136588_1771155 Arabidopsis thaliana leucine-rich repeat pro...    93   6e-18   
gb:U42445_1726335 Lycopersicon pimpinellifolium leucine rich rep...    93   6e-18   
gb:ATAC011620_1543299 Arabidopsis thaliana chromosome III BAC F1...    93   6e-18   
pir|T10504|T10504 disease resistance protein Cf-2.1 - currant to...    93   6e-18   Solanum pimpinellifolium [currant tomato]
sp|Q00874|D100_ARATH|D100_ARATH DNA-damage-repair/toleration protein DRT100...    93   6e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AC137619_1743655 Oryza sativa (japonica cultivar-group) chrom...    93   7e-18   
gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.                  92   9e-18   
gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome...    92   9e-18   
pir|T05322|T05322 hypothetical protein F18F4.240 - Arabidopsis t...    92   9e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP003630_1831761 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AP003489_1829914 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenes...    92   1e-17   
pir|E86312|E86312 F11A6.9 protein - Arabidopsis thaliana>gb:AE00...    92   1e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AB018110_1513754 Arabidopsis thaliana genomic DNA, chromosome...    92   2e-17   
pir|C84524|C84524 probable disease resistance protein [imported]...    92   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP003214_1825331 Oryza sativa (japonica cultivar-group) genom...    91   2e-17   
gb:AF053995_1764489 Lycopersicon esculentum Hcr2-0B (Hcr2-0B) ge...    91   2e-17   
gb:AY182166_1587874 Elaeis guineensis clone Rlk-OPmf receptor-li...    91   2e-17   
gb:AY099851_1576876 Arabidopsis thaliana receptor protein kinase...    91   2e-17   
pir|T08575|T08575 protein kinase homolog T22F8.170 - Arabidopsis...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860358 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AP004326_1840210 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AP004256_1839206 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AP003622_1831610 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AX093382_1461111 Sequence 1 from Patent WO0118061.                  91   3e-17   
gb:AE005173_894080 Arabidopsis thaliana chromosome 1, bottom arm...    91   3e-17   
gb:AP005386_1850809 Oryza sativa (japonica cultivar-group) genom...    91   4e-17   
gb:AP005064_1847429 Oryza sativa (japonica cultivar-group) genom...    91   4e-17   
gb:AY084350_1569441 Arabidopsis thaliana clone 105146 mRNA, comp...    91   4e-17   
sp|P93194|RPK1_PHANI|RPK1_PHANI Receptor-like protein kinase precursor (EC ...    91   4e-17   Ipomoea nil [qian niu]
gb:AC099732_1737183 Oryza sativa (japonica cultivar-group) chrom...    90   5e-17   
gb:AY368673_1602931 Triticum turgidum HMW-glutenin locus, comple...    90   5e-17   
pir|T00971|T00971 probable disease resistance protein [imported]...    90   5e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T02361|T02361 hypothetical protein T8F5.16 - Arabidopsis tha...    90   5e-17   Arabidopsis thaliana [mouse-ear cress]
pir|C84538|C84538 probable LRR receptor protein kinase [imported...    90   5e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T02565|T02565 disease resistance protein homolog At2g32660 [...    90   6e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T18536|T18536 receptor-like protein kinase - Ipomoea nil (Ja...    90   6e-17   Ipomoea nil [qian niu]
pir|B84659|B84659 probable receptor-like protein kinase, ERECTA ...    90   6e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP000607_1820463 Arabidopsis thaliana genomic DNA, chromosome...    89   8e-17   
gb:AC093952_1736170 Oryza sativa (japonica cultivar-group) chrom...    89   8e-17   
gb:AY065068_1566222 Arabidopsis thaliana AT4g37250/C7A10_110 mRN...    89   8e-17   
gb:AX093392_1461116 Sequence 11 from Patent WO0118061.                 89   8e-17   
pir|T46070|T46070 hypothetical protein T18N14.120 - Arabidopsis ...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T45718|T45718 receptor-kinase like protein - Arabidopsis tha...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
pir|B85440|B85440 receptor kinase-like protein [imported] - Arab...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860355 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:AB025639_1516701 Arabidopsis thaliana genomic DNA, chromosome...    89   1e-16   
pir|G86459|G86459 Hypothetical 55.6 kDa protein - Arabidopsis th...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T48216|T48216 hypothetical protein T20L15.220 - Arabidopsis ...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
pir|B84431|B84431 probable receptor protein kinase [imported] - ...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003768_1833268 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:AP003768_1833267 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:AJ786411_1814069 Phaseolus vulgaris bpgip4 gene for polygalac...    89   1e-16   
gb:AY632359_1618694 Gossypium hirsutum BAC 155C17, complete sequ...    89   1e-16   
gb:AY075617_1567762 Arabidopsis thaliana AT3g25560/MWL2_18 mRNA,...    89   1e-16   
gb:AY072083_1566979 Arabidopsis thaliana putative receptor prote...    89   1e-16   
pir|B84742|B84742 probable receptor-like protein kinase [importe...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
pir|E84846|E84846 probable receptor-like protein kinase [importe...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP005064_1847421 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP003210_1825238 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AY632360_1618708 Gossypium hirsutum BAC 106I22, complete sequ...    88   2e-16   
gb:AY064013_1565953 Arabidopsis thaliana putative receptor kinas...    88   2e-16   
pir|H86459|H86459 hypothetical protein T1E4.2 - Arabidopsis thal...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T45717|T45717 receptor-kinase like protein - Arabidopsis tha...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP005966_1860351 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP004063_1837106 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP003238_1825989 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP002908_1823802 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP002522_1822349 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AJ609275_1812000 Cicer arietinum mRNA for leucine rich repeat...    88   2e-16   
gb:AF053993_1764487 Lycopersicon esculentum disease resistance p...    88   2e-16   
gb:AY364476_1602838 Oryza sativa (indica cultivar-group) bacteri...    88   2e-16   
gb:AC069472_1540863 Arabidopsis thaliana chromosome 3 BAC F28J15...    88   2e-16   
gb:AB018111_1513765 Arabidopsis thaliana genomic DNA, chromosome...    88   2e-16   
gb:AB011476_1511391 Arabidopsis thaliana genomic DNA, chromosome...    88   2e-16   
gb:AE016959_1023018 Oryza sativa (japonica cultivar-group) chrom...    88   2e-16   
gb:AP004069_1837219 Oryza sativa (japonica cultivar-group) genom...    87   3e-16   
gb:AP003276_1827044 Oryza sativa (japonica cultivar-group) genom...    87   3e-16   
gb:AF529302_1809045 Glycine max polygalacturonase inhibitor prot...    87   3e-16   
gb:AF503433_1806732 Sorghum bicolor BAC 170F8, complete sequence.      87   3e-16   
gb:AF466199_1802194 Sorghum bicolor putative receptor protein ki...    87   3e-16   
gb:AF177673_1774649 Arabidopsis thaliana cultivar Lansberg erect...    87   3e-16   
gb:AP003858_1834406 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AF177674_1774650 Arabidopsis thaliana cultivar Wassilewskia r...    87   4e-16   
gb:AB025621_1516426 Arabidopsis thaliana genomic DNA, chromosome...    87   4e-16   
gb:AB022219_1515120 Arabidopsis thaliana genomic DNA, chromosome...    87   4e-16   
gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome...    87   4e-16   
pir|T30553|T30553 disease resistance protein Hcr2-5D - tomato>gb...    87   4e-16   Solanum lycopersicum
gb:AP003952_1835675 Oryza sativa (japonica cultivar-group) genom...    87   5e-16   
gb:OSJN00174_1696186 Oryza sativa genomic DNA, chromosome 4, BAC...    87   5e-16   
gb:AY534122S2_1612173 Aegilops tauschii transposons Caspar, XJ, ...    87   5e-16   
gb:AF053996_1764490 Lycopersicon pimpinellifolium Hcr2-2A (Hcr2-...    86   7e-16   
gb:ADPGIP_1745523 A.deliciosa pgip mRNA for polygalacturonase in...    86   7e-16   
gb:OSJN00189_1696455 Oryza sativa genomic DNA, chromosome 4, BAC...    86   7e-16   
gb:AY064972_1566148 Arabidopsis thaliana AT4g08850/T32A17_160 mR...    86   7e-16   
pir|T00502|T00502 probable receptor-like protein kinase At2g2330...    86   7e-16   Arabidopsis thaliana [mouse-ear cress]
pir|B85089|B85089 receptor protein kinase-like protein [imported...    86   7e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP004158_1838368 Oryza sativa (japonica cultivar-group) genom...    86   9e-16   
gb:AF053997_1764491 Lycopersicon esculentum Hcr2-5B (Hcr2-5B) ge...    86   9e-16   
gb:AC118284_1739500 Oryza sativa (japonica cultivar-group) chrom...    86   9e-16   
gb:AY075690_1567829 Arabidopsis thaliana AT5g20480/F7C8_70 mRNA,...    86   9e-16   
gb:ATAC018363_1543678 Arabidopsis thaliana chromosome III BAC F1...    86   9e-16   
gb:AP004747_1844318 Oryza sativa (japonica cultivar-group) genom...    86   1e-15   
gb:AP003898_1834956 Oryza sativa (japonica cultivar-group) genom...    86   1e-15   
gb:AP003237_1825947 Oryza sativa (japonica cultivar-group) genom...    86   1e-15   
gb:AF244890_1780447 Glycine max receptor-like protein kinase 3 (...    86   1e-15   
gb:AC082645_1733172 Oryza sativa chromosome 3 BAC OSJNBb0033N16 ...    86   1e-15   
gb:BT006440_1639327 Arabidopsis thaliana At1g60630 gene, complet...    86   1e-15   
gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSER...    86   1e-15   
gb:AE016959_1023555 Oryza sativa (japonica cultivar-group) chrom...    86   1e-15   
pir|E96631|E96631 probable receptor kinase F8A5.15 [imported] - ...    86   1e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP004747_1844313 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AP004562_1841637 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AC121365_1740180 Oryza sativa (japonica cultivar-group) chrom...    85   2e-15   
gb:AC111015_1738814 Oryza sativa (japonica cultivar-group) chrom...    85   2e-15   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...    85   2e-15   
gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC...    85   2e-15   
gb:OSJN00123_1695267 Oryza sativa genomic DNA, chromosome 4, BAC...    85   2e-15   
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...    85   2e-15   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...    85   2e-15   
gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinas...    85   2e-15   
gb:AY060554_1564862 Arabidopsis thaliana AT5g63710/MBK5_19 mRNA,...    85   2e-15   
gb:AC016163_1538126 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    85   2e-15   
gb:AX138089_1462210 Sequence 35 from Patent EP1094113.                 85   2e-15   
gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.              85   2e-15   
gb:CQ768549_1451792 Sequence 44 from Patent WO2004007712.>gb:AX1...    85   2e-15   
pir|T10725|T10725 protein kinase Xa21 (EC 2.7.1.-) A1, receptor ...    85   2e-15   Oryza longistaminata [long-staminate rice]
gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AP005826_1858575 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AJ864508_1814988 Phaseolus vulgaris ppgip3 gene for polygalac...    85   2e-15   
gb:AJ786410_1814068 Phaseolus vulgaris bpgip3 gene for polygalac...    85   2e-15   
gb:OSJN00083_1694586 Oryza sativa genomic DNA, chromosome 4, BAC...    85   2e-15   
gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09 (R2...    85   2e-15   
gb:AP004039_1836723 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AP003491_1829947 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AC151804_1745143 Solanum demissum chromosome 5 BAC PGEC475B22...    84   3e-15   
gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein ...    84   3e-15   
gb:AB025613_1516373 Arabidopsis thaliana genomic DNA, chromosome...    84   3e-15   
gb:AE016959_1020712 Oryza sativa (japonica cultivar-group) chrom...    84   3e-15   
pir|T04313|T04313 protein kinase Xa21 (EC 2.7.1.-), receptor typ...    84   3e-15   Oryza sativa [red rice]
pir|T10636|T10636 hypothetical protein T13K14.100 - Arabidopsis ...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
pir|C96756|C96756 receptor-like protein kinase homolog [imported...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AP004564_1841662 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AP004234_1839081 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic embryog...    84   3e-15   
gb:AF053994_1764488 Lycopersicon esculentum Hcr2-0A (Hcr2-0A) ge...    84   3e-15   
gb:AY139779_1582396 Arabidopsis thaliana At1g73080/F3N23_28 mRNA...    84   3e-15   
pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis ...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
pir|B86479|B86479 hypothetical protein F14D7.1 - Arabidopsis tha...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP003962_1835750 Oryza sativa (japonica cultivar-group) genom...    84   4e-15   
gb:OSJN00042_1693769 Oryza sativa genomic DNA, chromosome 4, BAC...    84   4e-15   
gb:AB025629_1516537 Arabidopsis thaliana genomic DNA, chromosome...    84   4e-15   
gb:AB018109_1513744 Arabidopsis thaliana genomic DNA, chromosome...    84   4e-15   
pir|H84632|H84632 probable receptor-like protein kinase [importe...    84   4e-15   Arabidopsis thaliana [mouse-ear cress]
pir|F86410|F86410 protein F3M18.12 [imported] - Arabidopsis thal...    84   4e-15   Arabidopsis thaliana [mouse-ear cress]
pir|C96772|C96772 probable receptor protein kinase F1M20.4 [impo...    84   4e-15   Arabidopsis thaliana [mouse-ear cress]
sp|P58823|PGI3_PHAVU|PGI3_PHAVU Polygalacturonase inhibitor 3 precursor (Po...    84   4e-15   Phaseolus vulgaris [French bean]
gb:AP005966_1860381 Oryza sativa (japonica cultivar-group) genom...    83   6e-15   
gb:AP005245_1849450 Oryza sativa (japonica cultivar-group) genom...    83   6e-15   
gb:AP004014_1836382 Oryza sativa (japonica cultivar-group) genom...    83   6e-15   
gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genom...    83   6e-15   
gb:AC119796_1739716 Oryza sativa (japonica cultivar-group) chrom...    83   6e-15   
gb:OSB6015_1692796 Oryza sativa indica(GLA4) genomic DNA, chromo...    83   6e-15   
gb:AY463361_1607685 Oryza sativa (indica cultivar-group) benzoth...    83   6e-15   
gb:AY332474_1600056 Oryza sativa (japonica cultivar-group) trans...    83   6e-15   
gb:AY085401_1570470 Arabidopsis thaliana clone 15013 mRNA, compl...    83   6e-15   
gb:AB008270_1510484 Arabidopsis thaliana genomic DNA, chromosome...    83   6e-15   
gb:AP003434_1829316 Oryza sativa (japonica cultivar-group) genom...    83   7e-15   
gb:AP001800_1821417 Oryza sativa (japonica cultivar-group) genom...    83   7e-15   
gb:AF193835_1775568 Oryza sativa LRK1 protein (LRK1) mRNA, compl...    83   7e-15   
gb:AB016872_1512921 Arabidopsis thaliana genomic DNA, chromosome...    83   7e-15   
gb:AE016959_1021016 Oryza sativa (japonica cultivar-group) chrom...    83   7e-15   
pir|C96574|C96574 hypothetical protein T3F20.25 [imported] - Ara...    83   7e-15   
gb:AP005826_1858573 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP005064_1847423 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP004009_1836298 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003943_1835570 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AK117178_1815224 Arabidopsis thaliana At1g73080 mRNA for unkn...    82   1e-14   
gb:AJ864507_1814987 Phaseolus vulgaris ppgip2 gene for polygalac...    82   1e-14   
gb:AJ864506_1814986 Phaseolus vulgaris ppgip1 gene for polygalac...    82   1e-14   
gb:AJ786409_1814067 Phaseolus vulgaris bpgip2 gene for polygalac...    82   1e-14   
gb:AJ786408_1814066 Phaseolus vulgaris bpgip1 gene for polygalac...    82   1e-14   
gb:AF130974_1770831 Glycine max polygalacturonase inhibitor prot...    82   1e-14   
gb:OSJN00196_1696553 Oryza sativa genomic DNA, chromosome 4, BAC...    82   1e-14   
gb:OSJN00072_1694323 Oryza sativa genomic DNA, chromosome 4, BAC...    82   1e-14   
gb:BT010733_1640679 Arabidopsis thaliana At3g57830 gene, complet...    82   1e-14   
gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat...    82   1e-14   
gb:AY508110_1610230 Phaseolus vulgaris polygalacturonase-inhibit...    82   1e-14   
gb:AE016959_1023031 Oryza sativa (japonica cultivar-group) chrom...    82   1e-14   
pir|B86460|B86460 hypothetical protein F14M2.19 [imported] - Ara...    82   1e-14   
pir|T13435|T13435 hypothetical protein T17A13.60 - Arabidopsis t...    82   1e-14   
pir|T46005|T46005 receptor-like protein kinase - Arabidopsis tha...    82   1e-14   
pir|D96756|D96756 receptor-like protein kinase homolog [imported...    82   1e-14   
pir|C84527|C84527 probable receptor-like protein kinase [importe...    82   1e-14   
sp|P58822|PGI2_PHAVU|PGI2_PHAVU Polygalacturonase inhibitor 2 precursor (Po...    82   1e-14   
sp|P35334|PGI1_PHAVU|PGI1_PHAVU Polygalacturonase inhibitor 1 precursor (Po...    82   1e-14   
gb:OSJN00152_1695767 Oryza sativa genomic DNA, chromosome 4, BAC...    82   1e-14   
gb:AB012245_1511779 Arabidopsis thaliana genomic DNA, chromosome...    82   1e-14   
pir|D84858|D84858 hypothetical protein At2g42800 [imported] - Ar...    82   1e-14   
pir|T45569|T45569 receptor protein kinase-like protein - Arabido...    82   1e-14   
pir|T46033|T46033 receptor protein kinase-like protein - Arabido...    82   1e-14   
pir|C86203|C86203 hypothetical protein [imported] - Arabidopsis ...    82   1e-14   
gb:AK117429_1815463 Arabidopsis thaliana At3g11010 mRNA for puta...    82   2e-14   
gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threon...    82   2e-14   
gb:OSJN00095_1694822 Oryza sativa genomic DNA, chromosome 4, BAC...    82   2e-14   
gb:AY359965_1602032 Lycopersicon esculentum EIX receptor 1 (Eix1...    82   2e-14   
gb:AY050870_1562365 Arabidopsis thaliana putative receptor prote...    82   2e-14   
gb:AY040533_1560597 Gossypium hirsutum leucine-rich repeat resis...    82   2e-14   
gb:ATAC009991_1543120 Arabidopsis thaliana chromosome III BAC F9...    82   2e-14   
gb:AB017061_1513313 Arabidopsis thaliana genomic DNA, chromosome...    82   2e-14   
pir|B84664|B84664 probable receptor-like protein kinase [importe...    82   2e-14   
sp|P47735|RLK5_ARATH|RLK5_ARATH Receptor-like protein kinase 5 precursor (E...    82   2e-14   
gb:AP005633_1855149 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP004739_1844116 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:BT005989_1638911 Arabidopsis thaliana At5g24100 gene, complet...    81   2e-14   
gb:AY188755_1588361 Zea mays atypical receptor-like kinase MARK ...    81   2e-14   
gb:AY090373_1574121 Arabidopsis thaliana AT3g05370/T12H1_34 mRNA...    81   2e-14   
gb:ATAC009177_1542875 Arabidopsis thaliana chromosome III BAC T1...    81   2e-14   
gb:AB104529_1526474 Pisum sativum LKA mRNA for brassinosteroid r...    81   2e-14   
pir|A86460|A86460 99.9K hypothetical protein T1E4.10 - Arabidops...    81   2e-14   
gb:AP005593_1854663 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AP002522_1822355 Oryza sativa (japonica cultivar-group) genom...    81   3e-14   
gb:AF466357_1802292 Oryza sativa (japonica cultivar-group) flora...    81   3e-14   
gb:AC104427_1737594 Oryza sativa (japonica cultivar-group) chrom...    81   3e-14   
gb:AY597055_1617031 Glycine max cultivar PI 404198-A LRR-kinase ...    81   3e-14   
gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-...    81   3e-14   
gb:AP005896_1859825 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AP005841_1858891 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AP004126_1837999 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AP004006_1836240 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AP000366_1819745 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AC108875_1738611 Oryza sativa (japonica cultivar-group) chrom...    80   4e-14   
gb:OSJN00299_1698204 Oryza sativa genomic DNA, chromosome 4, BAC...    80   4e-14   
gb:AY756174_1627012 Oryza rufipogon putative leucine-rich repeat...    80   4e-14   
gb:AY714492_1624023 Oryza sativa (indica cultivar-group) clone O...    80   4e-14   
gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR receptor-...    80   4e-14   
pir|T00914|T00914 leucine-rich repeat protein F21B7.28 - Arabido...    80   4e-14   
pir|A86166|A86166 protein F21B7.6 [imported] - Arabidopsis thali...    80   4e-14   
gb:AP006064_1860783 Oryza sativa (japonica cultivar-group) genom...    80   5e-14   
gb:AP004342_1840507 Oryza sativa (japonica cultivar-group) genom...    80   5e-14   
gb:AF166121_1774011 Hordeum vulgare Cf2/Cf5 disease resistance p...    80   5e-14   
gb:F15P11_1677567 Arabidopsis thaliana BAC F15P11.                     80   5e-14   
gb:AY597126_1617100 Glycine max cultivar PI 79609 LRR-kinase pro...    80   5e-14   
gb:AY597124_1617098 Glycine max cultivar PI 548349 LRR-kinase pr...    80   5e-14   
gb:AY597123_1617097 Glycine max cultivar PI 567577 LRR-kinase pr...    80   5e-14   
gb:AB007644_1510128 Arabidopsis thaliana genomic DNA, chromosome...    80   5e-14   
gb:AE016959_1021557 Oryza sativa (japonica cultivar-group) chrom...    80   5e-14   
gb:AE005172_892242 Arabidopsis thaliana chromosome 1, top arm co...    80   5e-14   
pir|H96769|H96769 hypothetical protein F9E11.7 [imported] - Arab...    80   5e-14   
gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome...    80   6e-14   
gb:AF243040_1780205 Lycopersicon esculentum receptor-like protei...    80   6e-14   
gb:AC144737_1744149 Oryza sativa (japonica cultivar-group) chrom...    80   6e-14   
gb:AC137997_1743901 Oryza sativa chromosome 3 BAC OJ1499_D04 gen...    80   6e-14   
gb:AC120508_1739796 Oryza sativa chromosome 3 BAC OSJNBb0021O11 ...    80   6e-14   
gb:AY534122S2_1612167 Aegilops tauschii transposons Caspar, XJ, ...    80   6e-14   
gb:AB026655_1517330 Arabidopsis thaliana genomic DNA, chromosome...    80   6e-14   
gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.              80   6e-14   
pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis t...    80   6e-14   
gb:AP005846_1858989 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
gb:AP005473_1852497 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
gb:AP003019_1824215 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
gb:AP000386_1819927 Arabidopsis thaliana genomic DNA, chromosome...    79   8e-14   
gb:AC137928_1743818 Oryza sativa (japonica cultivar-group) chrom...    79   8e-14   
gb:AC105319_1737921 Oryza sativa (japonica cultivar-group) chrom...    79   8e-14   
gb:AY618860_1618279 Glycine max cultivar PI 437679 LRR-kinase pr...    79   8e-14   
gb:AY618859_1618278 Glycine max cultivar PI 339868-B LRR-kinase ...    79   8e-14   
gb:AY618858_1618277 Glycine max cultivar PI 509095 LRR-kinase pr...    79   8e-14   
gb:AY618846_1618265 Glycine max cultivar PI 437725 LRR-kinase pr...    79   8e-14   
gb:AY618845_1618264 Glycine max cultivar PI 567445-A LRR-kinase ...    79   8e-14   
gb:AY597056_1617032 Glycine max cultivar PI 408192-2 LRR-kinase ...    79   8e-14   
gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like ...    79   8e-14   
gb:AE016959_1023023 Oryza sativa (japonica cultivar-group) chrom...    79   8e-14   
pir|C96615|C96615 hypothetical protein T18I24.10 [imported] - Ar...    79   8e-14   
pir|T50850|T50850 receptor protein kinase homolog [imported] - s...    79   8e-14   
pir|G96748|G96748 hypothetical protein T10D10.7 [imported] - Ara...    79   8e-14   
gb:AF365929_1791620 Lycopersicon esculentum verticillium wilt di...    79   1e-13   
gb:AF172282_1774418 Oryza sativa adh1-adh2 region.                     79   1e-13   
gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    79   1e-13   
gb:BT003880_1637007 Arabidopsis thaliana clone RAFL15-22-I19 (R2...    79   1e-13   
gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete sequ...    79   1e-13   
gb:AB162660_1528632 Ipomoea batatas CLAVATA-1 gene for protein k...    79   1e-13   
gb:AB010698_1511224 Arabidopsis thaliana genomic DNA, chromosome...    79   1e-13   
gb:AE016959_1023024 Oryza sativa (japonica cultivar-group) chrom...    79   1e-13   
pir|T04492|T04492 protein kinase homolog F8F16.70 - Arabidopsis ...    79   1e-13   
pir|B84852|B84852 probable receptor-like protein kinase [importe...    79   1e-13   
gb:AP004762_1844627 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:AP003915_1835150 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:AP003255_1826441 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:AF529691_1809049 Brassica napus polygalacturonase inhibitor p...    79   1e-13   
gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete sequ...    79   1e-13   
gb:AC016163_1538127 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    79   1e-13   
pir|T01392|T01392 leucine-rich repeat protein T4I9.11 - Arabidop...    79   1e-13   
gb:AP004661_1842839 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:ATAC009177_1542874 Arabidopsis thaliana chromosome III BAC T1...    78   2e-13   
gb:AB020743_1514580 Arabidopsis thaliana genomic DNA, chromosome...    78   2e-13   
pir|T05887|T05887 hypothetical protein F6H11.60 - Arabidopsis th...    78   2e-13   
pir|S47965|S47965 polygalacturonase inhibitor protein - tomato>g...    78   2e-13   
pir|T45645|T45645 receptor kinase-like protein - Arabidopsis tha...    78   2e-13   
gb:AP004262_1839356 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AP002522_1822343 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AK118516_1816488 Arabidopsis thaliana At1g17230 mRNA for puta...    78   2e-13   
gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis r...    78   2e-13   
gb:AY086058_1571119 Arabidopsis thaliana clone 20900 mRNA, compl...    78   2e-13   
gb:AY085697_1570764 Arabidopsis thaliana clone 17160 mRNA, compl...    78   2e-13   
pir|E84527|E84527 hypothetical protein At2g15320 [imported] - Ar...    78   2e-13   
pir|T52400|T52400 receptor-like protein kinase [imported] - Arab...    78   2e-13   
pir|T05897|T05897 protein kinase homolog F6H11.160 - Arabidopsis...    78   2e-13   
pir|E86308|E86308 hypothetical protein F20D23.7 - Arabidopsis th...    78   2e-13   
gb:AP003512_1830157 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:AF528591_1808618 Arabidopsis thaliana ecotype Columbia recept...    77   3e-13   
gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,...    77   3e-13   
gb:AC151804_1745140 Solanum demissum chromosome 5 BAC PGEC475B22...    77   3e-13   
gb:BT005976_1638898 Arabidopsis thaliana At1g58190 gene, complet...    77   3e-13   
gb:AY903226_1632099 Prunus americana polygalacturonase-inhibitin...    77   3e-13   
gb:AX196339_1463946 Sequence 46 from Patent WO0151627.                 77   3e-13   
gb:AE016959_1021015 Oryza sativa (japonica cultivar-group) chrom...    77   3e-13   
pir|T49292|T49292 hypothetical protein T16L24.60 - Arabidopsis t...    77   3e-13   
pir|T05050|T05050 protein kinase homolog M3E9.30 - Arabidopsis t...    77   3e-13   
sp|Q8L899|BRI1_LYCPE|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1...    77   3e-13   
gb:AP005099_1847794 Oryza sativa (japonica cultivar-group) genom...    77   4e-13   
gb:AF528602_1808629 Arabidopsis thaliana ecotype Ita-0 receptor-...    77   4e-13   
gb:AC084817_1733839 Oryza sativa (japonica cultivar-group) chrom...    77   4e-13   
gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threoni...    77   4e-13   
gb:AY883417_1631947 Prunus americana polygalacturonase-inhibitin...    77   4e-13   
gb:AY618847_1618266 Glycine max cultivar PI 437770 LRR-kinase pr...    77   4e-13   
gb:AY282579_1594709 Solanum lycopersicoides disease resistance p...    77   4e-13   
gb:AY054256_1563076 Arabidopsis thaliana AT5g67280/K3G17_4 mRNA,...    77   4e-13   
gb:AB029327_1518169 Nicotiana tabacum mRNA for elicitor-inducibl...    77   4e-13   
gb:AB025614_1516378 Arabidopsis thaliana genomic DNA, chromosome...    77   4e-13   
gb:AX196297_1463927 Sequence 4 from Patent WO0151627.>gb:AX19633...    77   4e-13   
gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.              77   4e-13   
pir|C96519|C96519 probable disease resistance protein, 3954-7013...    77   4e-13   
pir|T50851|T50851 receptor protein kinase homolog [imported] - s...    77   4e-13   
gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genom...    77   5e-13   
gb:AF049920_1764119 Petunia x hybrida PGPS/D4 (PGPS/D4) mRNA, co...    77   5e-13   
gb:AC132489_1741183 Oryza sativa (japonica cultivar-group) chrom...    77   5e-13   
gb:AC084380_1733540 Oryza sativa chromosome 3 BAC OSJNBa0090P23 ...    77   5e-13   
gb:ATAC011620_1543300 Arabidopsis thaliana chromosome III BAC F1...    77   5e-13   
gb:AE016959_1023029 Oryza sativa (japonica cultivar-group) chrom...    77   5e-13   
pir|A57676|A57676 protein kinase Xa21 (EC 2.7.1.-), receptor typ...    77   5e-13   
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...    77   5e-13   
gb:AP005394_1851029 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AP004124_1837949 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AP003991_1836031 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AP003633_1831828 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AP002522_1822351 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AY903220_1632093 Prunus persica polygalacturonase-inhibiting ...    76   7e-13   
gb:AY756174_1627013 Oryza rufipogon putative leucine-rich repeat...    76   7e-13   
gb:AY714496_1624027 Oryza sativa (indica cultivar-group) clone O...    76   7e-13   
gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone O...    76   7e-13   
gb:AY714493_1624024 Oryza sativa (indica cultivar-group) clone O...    76   7e-13   
gb:AY618862_1618281 Glycine max cultivar PI 567562-A LRR-kinase ...    76   7e-13   
gb:AY618848_1618267 Glycine max cultivar PI 507471 LRR-kinase pr...    76   7e-13   
gb:AY597071_1617045 Glycine max cultivar PI 87631-1 LRR-kinase p...    76   7e-13   
gb:AY359966_1602033 Lycopersicon esculentum EIX receptor 2 (Eix2...    76   7e-13   
gb:AY092960_1574914 Arabidopsis thaliana receptor-kinase isolog ...    76   7e-13   
gb:AY088040_1573064 Arabidopsis thaliana clone 40594 mRNA, compl...    76   7e-13   
gb:AY056128_1563464 Arabidopsis thaliana putative receptor-kinas...    76   7e-13   
gb:AC026815_1539693 Oryza sativa chromosome 10 BAC OSJNBa0079L16...    76   7e-13   
gb:AE016959_1023026 Oryza sativa (japonica cultivar-group) chrom...    76   7e-13   
gb:AE016959_1020675 Oryza sativa (japonica cultivar-group) chrom...    76   7e-13   
pir|T10727|T10727 protein kinase Xa21 (EC 2.7.1.-) D, receptor t...    76   7e-13   
pir|T45899|T45899 receptor protein kinase-like protein - Arabido...    76   7e-13   
pir|T51383|T51383 receptor protein kinase-like protein - Arabido...    76   7e-13   
pir|C96654|C96654 hypothetical protein F16P17.10 [imported] - Ar...    76   7e-13   
gb:AP005966_1860365 Oryza sativa (japonica cultivar-group) genom...    76   9e-13   
gb:AP005457_1852180 Oryza sativa (japonica cultivar-group) genom...    76   9e-13   
gb:AP000412_1820059 Arabidopsis thaliana genomic DNA, chromosome...    76   9e-13   
gb:AF528603_1808630 Arabidopsis thaliana ecotype Jl-3 receptor-l...    76   9e-13   
gb:AF528597_1808624 Arabidopsis thaliana ecotype An-2 receptor-l...    76   9e-13   
gb:AF528594_1808621 Arabidopsis thaliana ecotype Cvi-0 receptor-...    76   9e-13   
gb:AF020785_1761704 Prunus armeniaca polygalacturonase inhibitin...    76   9e-13   
gb:AC090871_1734511 Oryza sativa chromosome 3 BAC OSJNBb0060J21 ...    76   9e-13   
gb:OSJN00195_1696533 Oryza sativa genomic DNA, chromosome 4, BAC...    76   9e-13   
gb:OSJN00064_1694194 Oryza sativa genomic DNA, chromosome 4, BAC...    76   9e-13   
gb:LES303345_1684557 Lycopersicon esculentum lateral suppressor ...    76   9e-13   
gb:AY311527_1598162 Solanum torvum verticillium wilt disease res...    76   9e-13   
gb:AY163905_1586045 Glycine max receptor-like kinase RHG4 (Rhg4)...    76   9e-13   
gb:AX196340_1463947 Sequence 47 from Patent WO0151627.                 76   9e-13   
pir|T46041|T46041 hypothetical protein T16K5.100 - Arabidopsis t...    76   9e-13   
pir|T45647|T45647 receptor protein kinase-like protein - Arabido...    76   9e-13   
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...    76   9e-13   
pir|C84668|C84668 probable receptor-like protein kinase [importe...    76   9e-13   
gb:AP005846_1858988 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AP003489_1829911 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AP003407_1828921 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AP003282_1827213 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AP002540_1822585 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AP000412_1820057 Arabidopsis thaliana genomic DNA, chromosome...    75   1e-12   
gb:OSJN00093_1694778 Oryza sativa genomic DNA, chromosome 4, BAC...    75   1e-12   
gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich...    75   1e-12   
gb:AY534122S2_1612170 Aegilops tauschii transposons Caspar, XJ, ...    75   1e-12   


>gb:AB022220_1515144 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLN21.>gb:AY518292_1610794 Arabidopsis
           thaliana strubbelig receptor family 7 (SRF7) mRNA,
           complete cds.
          Length = 717

 Score =  286 bits (733), Expect = 3e-76
 Identities = 141/239 (58%), Positives = 185/239 (77%), Gaps = 1/239 (0%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct: 8   LALLILCIVGFEPSFIHGATDSSDTSALNIMFSSMNSPGQLSQWTASGGDPCGQNWKGIT 67

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN 486
           CSG+RVT+I++  L L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct: 68  CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTEFDMSNNNLGGDLPYQLPPNLERLNLANN 127

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
            FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N+  G++P T SS
Sbjct: 128 QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAFIGSLPNTCSS 186

Query: 667 LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           LT+ K++YLQNN F+GTID+LA LPL+NLN+ NN FTGWIP  L+GIN LQ  GN  NS
Sbjct: 187 LTSAKSIYLQNNQFSGTIDILATLPLENLNIANNRFTGWIPDSLKGIN-LQKDGNLLNS 244



>gb:AE005173_893273 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC024260_1539286 Arabidopsis
           thaliana chromosome 1 BAC F22G10 genomic sequence,
           complete sequence.
          Length = 516

 Score =  282 bits (721), Expect = 6e-75
 Identities = 137/246 (55%), Positives = 185/246 (75%), Gaps = 6/246 (2%)
 Frame = +1

Query: 124 WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE 288
           WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA  GDPCG+
Sbjct: 5   WAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTAAAGDPCGQ 61

Query: 289 SWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ 465
           +W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LPYQ PPN+Q
Sbjct: 62  NWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLPYQFPPNLQ 121

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
           +LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   +
Sbjct: 122 RLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDFSFNSFTNS 181

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG 825
           +P TFSSLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+GI +L   
Sbjct: 182 LPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGI-TLIKD 240

Query: 826 GNSWNS 843
           GNS+N+
Sbjct: 241 GNSFNT 246



>pir|F96577|F96577 hypothetical protein F22G10.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_893272 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539285 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.>gb:AY518291_1610793 Arabidopsis thaliana
           strubbelig receptor family 6 (SRF6) mRNA, complete
           cds.>gb:BT010600_1640546 Arabidopsis thaliana At1g53730
           gene, complete cds.
          Length = 719

 Score =  282 bits (721), Expect = 6e-75
 Identities = 137/246 (55%), Positives = 185/246 (75%), Gaps = 6/246 (2%)
 Frame = +1

Query: 124 WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE 288
           WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA  GDPCG+
Sbjct: 5   WAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTAAAGDPCGQ 61

Query: 289 SWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ 465
           +W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LPYQ PPN+Q
Sbjct: 62  NWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLPYQFPPNLQ 121

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
           +LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   +
Sbjct: 122 RLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDFSFNSFTNS 181

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG 825
           +P TFSSLT++K++YLQNN F+GT+DVLA LPL+ LN+ NN FTGWIP  L+GI +L   
Sbjct: 182 LPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETLNIANNDFTGWIPSSLKGI-TLIKD 240

Query: 826 GNSWNS 843
           GNS+N+
Sbjct: 241 GNSFNT 246



>gb:AC079633_1732639 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0032G08, from Chromosome 3, complete
           sequence.
          Length = 718

 Score =  280 bits (716), Expect = 2e-74
 Identities = 134/225 (59%), Positives = 178/225 (79%), Gaps = 3/225 (1%)
 Frame = +1

Query: 178 ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           ADTDP D +VL  LF+SLNSP QL  W A+GGDPCG+SW+G++CSG+ VT I++  L L+
Sbjct: 32  ADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLPSLGLS 91

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNS--LPYQLPPN-VQKLNLAGNGFTGGLPYSISQMA 528
           G++ + ++ + S+   D+S NNLG    + Y LP N +++LNLAGN FTG LPYSI  M+
Sbjct: 92  GNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTNKLERLNLAGNQFTGNLPYSIFSMS 151

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+YLN++HNQLQG +T +F SL +L+TLD SFNSLAG++PQ F+SL+++K +YLQNN F
Sbjct: 152 NLKYLNLNHNQLQGNITDVFSSLYSLTTLDLSFNSLAGDLPQGFTSLSSLKKLYLQNNQF 211

Query: 709 TGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           TG I+VLANLPLD+LNV NNHFTGWIP QL+ IN+LQT GNSW++
Sbjct: 212 TGYINVLANLPLDDLNVANNHFTGWIPSQLKKINNLQTDGNSWSN 256



>pir|T01268|T01268 leucine-rich repeat transmembrane protein kinase
           2 - maize>gb:AF023165_1762044 Zea mays leucine-rich
           repeat transmembrane protein kinase 2 (ltk2) mRNA,
           complete cds.
          Length = 725

 Score =  277 bits (708), Expect = 2e-73
 Identities = 134/225 (59%), Positives = 173/225 (76%), Gaps = 3/225 (1%)
 Frame = +1

Query: 178 ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           ADTDP D +VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L LT
Sbjct: 37  ADTDPNDLNVLNTLFTSLNSPGQLRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSLT 96

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNS--LPYQLPP-NVQKLNLAGNGFTGGLPYSISQMA 528
           G++ + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M 
Sbjct: 97  GNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMP 156

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+YLN++HNQLQG +T +F +L +LS LD SFNSL G++PQ+F+ L+++K MYLQNN F
Sbjct: 157 NLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQF 216

Query: 709 TGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           TG I+VLANLPL+ LNV NNHFTGWIP QL+ IN+LQT GNSW++
Sbjct: 217 TGYINVLANLPLETLNVGNNHFTGWIPSQLKEINNLQTDGNSWST 261



>gb:AF023164_1762043 Zea mays leucine-rich repeat transmembrane
           protein kinase 1 (ltk1) mRNA, partial cds.
          Length = 684

 Score =  276 bits (705), Expect = 5e-73
 Identities = 133/222 (59%), Positives = 172/222 (77%), Gaps = 3/222 (1%)
 Frame = +1

Query: 187 DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM 366
           DP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L LTG++
Sbjct: 1   DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNL 60

Query: 367 GFQLDQLKSVTTFDISTNNLGNS--LPYQLPP-NVQKLNLAGNGFTGGLPYSISQMAPLE 537
            + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M  L+
Sbjct: 61  AYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLK 120

Query: 538 YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
           YLN++HNQLQG ++ +F +L +LS LD SFNSL G++PQ+F+ L+++K +YLQNN FTG 
Sbjct: 121 YLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGN 180

Query: 718 IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           I+VLANLPL+ LNV NNHFTGWIP QL+ INSLQT GNSW++
Sbjct: 181 INVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWST 222



>pir|T01267|T01267 leucine-rich repeat transmembrane protein kinase
           1 - maize  (fragment)
          Length = 684

 Score =  276 bits (705), Expect = 5e-73
 Identities = 133/222 (59%), Positives = 172/222 (77%), Gaps = 3/222 (1%)
 Frame = +1

Query: 187 DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM 366
           DP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L LTG++
Sbjct: 1   DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNL 60

Query: 367 GFQLDQLKSVTTFDISTNNLGNS--LPYQLPP-NVQKLNLAGNGFTGGLPYSISQMAPLE 537
            + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M  L+
Sbjct: 61  AYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLK 120

Query: 538 YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
           YLN++HNQLQG ++ +F +L +LS LD SFNSL G++PQ+F+ L+++K +YLQNN FTG 
Sbjct: 121 YLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGN 180

Query: 718 IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           I+VLANLPL+ LNV NNHFTGWIP QL+ INSLQT GNSW++
Sbjct: 181 INVLANLPLETLNVANNHFTGWIPSQLKKINSLQTDGNSWST 222



>gb:AY224517_1590714 Oryza sativa (japonica cultivar-group) isolate
           20144 putative leucine-rich repeat transmembrane protein
           kinase mRNA, complete cds.
          Length = 719

 Score =  268 bits (686), Expect = 7e-71
 Identities = 128/225 (56%), Positives = 173/225 (76%), Gaps = 3/225 (1%)
 Frame = +1

Query: 178 ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           A TD  D +VL  LF+SLNSP QL  W  NGGDPCG SW+G++CSG+ VT I++  L L+
Sbjct: 27  ATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGASWQGITCSGSSVTAIKLPSLGLS 86

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMA 528
           G++ + ++ ++S+   D+S NNLG   ++ Y LP   +++LNLAGN F G +PYSIS M 
Sbjct: 87  GNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKKLERLNLAGNQFAGNVPYSISTMP 146

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+YLN++HNQLQG +T +F +L +LSTLD S NSL G++PQ+F+SL+++K +YLQNN F
Sbjct: 147 KLKYLNLNHNQLQGNMTDVFSNLPSLSTLDLSLNSLTGDLPQSFTSLSSLKTLYLQNNQF 206

Query: 709 TGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           TG+I+VLANLPLDNLNV NN FTGWIP +L+ INSLQT GNSW++
Sbjct: 207 TGSINVLANLPLDNLNVGNNRFTGWIPNELKKINSLQTDGNSWST 251



>gb:AP004308_1839999 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0552F09.>gb:AP004309_1840005 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0560B08.>gb:AP004988_1846760 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:B1056G08.
          Length = 720

 Score =  265 bits (676), Expect = 1e-69
 Identities = 129/240 (53%), Positives = 172/240 (71%), Gaps = 1/240 (0%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           A   ++ FL        A+TD  D + L  L++S+NSP QLT W +  GDPCG+SW G++
Sbjct: 4   ATGAVMLFLAATLSGVSANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGIT 63

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG 483
           CSG+RVT I++SG+ + G++G+ ++ L S+   D S NNLG S +PY LPPN+++LNLA 
Sbjct: 64  CSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAE 123

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N FTG +PYSISQM  L  LN+ HN L      MF  LTNL+TLD S+N+L+GNIPQ+F+
Sbjct: 124 NNFTGSIPYSISQMIALRILNLGHNHL-ATTNDMFNQLTNLTTLDLSYNTLSGNIPQSFN 182

Query: 664 SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           SLTN++ + LQNN F GTIDVLA+LPL +LNV NN FTGWIP +L+ I +LQT GNS+ S
Sbjct: 183 SLTNLRKLNLQNNGFNGTIDVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGS 242



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 52/178 (29%), Positives = 79/178 (44%), Gaps = 3/178 (1%)
 Frame = +1

Query: 142 IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS-CSGN 318
           +G+ +N   S V + D T  + L G     N PP L +      +  G     +S     
Sbjct: 83  LGYNMNLLTSLV-ELD-TSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIAL 140

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGF 492
           R+  +  + L  T  M    +QL ++TT D+S N L  ++P  +    N++KLNL  NGF
Sbjct: 141 RILNLGHNHLATTNDM---FNQLTNLTTLDLSYNTLSGNIPQSFNSLTNLRKLNLQNNGF 197

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
            G +   +    PL  LNV++NQ  G +      + NL T   SF S     P  + S
Sbjct: 198 NGTI--DVLADLPLTDLNVANNQFTGWIPDKLKKIKNLQTNGNSFGSGPSPPPPPYQS 253



>gb:AY518290_1610792 Arabidopsis thaliana strubbelig receptor family
           5 (SRF5) mRNA, complete cds.
          Length = 699

 Score =  258 bits (658), Expect = 1e-67
 Identities = 119/222 (53%), Positives = 164/222 (73%)
 Frame = +1

Query: 178 ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           A TD  + S L  +F+SLNSP +L  W ANGGDPC +SW+GV C G+ VTE+Q+SG +L 
Sbjct: 22  AKTDNQEVSALNVMFTSLNSPSKLKGWKANGGDPCEDSWEGVKCKGSSVTELQLSGFELG 81

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE 537
           GS G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct: 82  GSRGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENELDGNVPYSLSQMKNLQ 141

Query: 538 YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
            +N+  N+L GE+  MF  L+ L TLDFS N L+G +PQ+F++LT++K ++LQ+N FTG 
Sbjct: 142 SINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSGKLPQSFANLTSLKKLHLQDNRFTGD 201

Query: 718 IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           I+VL NL +D+LNVE+N F GWIP +L+ I+SL TGGN W++
Sbjct: 202 INVLRNLAIDDLNVEDNQFEGWIPNELKDIDSLLTGGNDWST 243



>gb:AP005849_1859071 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0031B09.
          Length = 718

 Score =  253 bits (645), Expect = 4e-66
 Identities = 125/239 (52%), Positives = 166/239 (69%), Gaps = 2/239 (0%)
 Frame = +1

Query: 133 ALLIGFLLNAPPS-AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG-DPCGESWKGVS 306
           A L+GFLL    + A A TD +DA+ L  L+SS NSP QL  W+A GG DPCG  W+G+S
Sbjct: 6   AALVGFLLAVSSAPAGATTDASDAAALGNLYSSWNSPSQLAGWSAGGGGDPCGAGWQGIS 65

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN 486
           CSG  VTEI+++G+ L GS+G++L  L S+ T D+S NNL  S+PYQLPPN+  LNLA N
Sbjct: 66  CSGAGVTEIRLAGVGLDGSLGYELSSLFSLKTLDLSNNNLHGSIPYQLPPNLTYLNLATN 125

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +G LPYSIS M  LEYLNVSHN L  ++  +F SL +LS LD SFN L G++P +  S
Sbjct: 126 NLSGNLPYSISNMVSLEYLNVSHNSLSQQIGDLFGSLNSLSELDVSFNKLTGDLPNSLGS 185

Query: 667 LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           L+N+ ++Y+QNN  TG+++VL+ L L  LN+ NN+F GWIP +   I  L  GGNS+ +
Sbjct: 186 LSNLSSLYMQNNQLTGSVNVLSGLSLTTLNIANNNFNGWIPQEFSSIPDLTLGGNSFTN 244



>gb:AC091787_1735101 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0087G11 map MAP_LOC, complete
           sequence.
          Length = 753

 Score =  249 bits (637), Expect = 4e-65
 Identities = 122/245 (49%), Positives = 174/245 (71%), Gaps = 1/245 (0%)
 Frame = +1

Query: 112 MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES 291
           +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct: 20  VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS 77

Query: 292 WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQK 468
           W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNLG   +PY LPPN+++
Sbjct: 78  WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER 137

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+TLD S N+ +G +
Sbjct: 138 LNLENNSFTGTLPYSISQMASLKYLNLGHNQLSS-INVMFNQLTNLATLDLSDNTFSGTL 196

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGG 828
           P +FS+LT++  ++LQ+N FTGTIDVL++LPL +LNV+NN  +G IP +L+GI++LQ  G
Sbjct: 197 PDSFSNLTSLTMLHLQDNRFTGTIDVLSDLPLTDLNVQNNQLSGAIPDKLKGISNLQISG 256

Query: 829 NSWNS 843
           NS+++
Sbjct: 257 NSFSN 261



>gb:AY664415_1620622 Zea mays cultivar B73 locus 9009, complete
           sequence.>gb:AY664419_1620660 Zea mays cultivar Mo17
           locus 9009, complete sequence.
          Length = 693

 Score =  245 bits (625), Expect = 9e-64
 Identities = 121/240 (50%), Positives = 164/240 (68%), Gaps = 1/240 (0%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           AV ++  FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+
Sbjct: 6   AVGVVALFLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVT 65

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG 483
           CSG+RVT I++SG++L G++G+ ++QL ++   D+S NNLG S +PY LPPN+Q LNLA 
Sbjct: 66  CSGSRVTAIKLSGMRLNGTLGYNMNQLTALVQLDMSNNNLGGSDIPYNLPPNLQSLNLAV 125

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N FTG +PYSISQM  L                          LD S+N+ +G+IP +F+
Sbjct: 126 NNFTGTVPYSISQMVALR------------------------DLDLSYNTFSGDIPHSFN 161

Query: 664 SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           SLT++K +YLQNN F GTIDVL +LPL +LNVENN  TGWIP +L+GIN+LQT GNS+N+
Sbjct: 162 SLTSLKTLYLQNNKFNGTIDVLTDLPLTDLNVENNQLTGWIPDKLKGINNLQTSGNSFNN 221



>gb:AF023166_1762045 Zea mays leucine-rich repeat transmembrane
           protein kinase 3 (ltk3) mRNA, partial cds.
          Length = 358

 Score =  244 bits (623), Expect = 1e-63
 Identities = 117/199 (58%), Positives = 152/199 (76%), Gaps = 3/199 (1%)
 Frame = +1

Query: 256 WTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS 435
           W ANGGDPCG+SWKG++CSG+ VT+IQ+  L L G++ + ++ L S+   D+S NNLG  
Sbjct: 3   WQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLAGNLAYNMNNLGSLVELDMSQNNLGGG 62

Query: 436 --LPYQLPP-NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL 606
             + Y LP   ++KLNLAGN F G LPYSIS M  L+YLN++HNQLQG +T +F +L +L
Sbjct: 63  GQIQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSL 122

Query: 607 STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWI 786
           S LD SFNSL G++PQ F+ L+++K MYLQNN FT  I+VLANLPL+ LNV NNHFTGWI
Sbjct: 123 SELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTSYINVLANLPLETLNVGNNHFTGWI 182

Query: 787 PPQLQGINSLQTGGNSWNS 843
           P QL+ IN+LQT GNSW++
Sbjct: 183 PSQLKKINNLQTDGNSWST 201



>pir|T01296|T01296 leucine-rich repeat transmembrane protein kinase
           3 - maize  (fragment)
          Length = 358

 Score =  244 bits (623), Expect = 1e-63
 Identities = 117/199 (58%), Positives = 152/199 (76%), Gaps = 3/199 (1%)
 Frame = +1

Query: 256 WTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS 435
           W ANGGDPCG+SWKG++CSG+ VT+IQ+  L L G++ + ++ L S+   D+S NNLG  
Sbjct: 3   WQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLAGNLAYNMNNLGSLVELDMSQNNLGGG 62

Query: 436 --LPYQLPP-NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL 606
             + Y LP   ++KLNLAGN F G LPYSIS M  L+YLN++HNQLQG +T +F +L +L
Sbjct: 63  GQIQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNHNQLQGNITDVFSNLYSL 122

Query: 607 STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWI 786
           S LD SFNSL G++PQ F+ L+++K MYLQNN FT  I+VLANLPL+ LNV NNHFTGWI
Sbjct: 123 SELDLSFNSLTGDLPQGFTGLSSLKRMYLQNNQFTSYINVLANLPLETLNVGNNHFTGWI 182

Query: 787 PPQLQGINSLQTGGNSWNS 843
           P QL+ IN+LQT GNSW++
Sbjct: 183 PSQLKKINNLQTDGNSWST 201



>gb:AY518289_1610791 Arabidopsis thaliana strubbelig receptor family
           4 (SRF4) mRNA, complete cds.
          Length = 687

 Score =  243 bits (619), Expect = 4e-63
 Identities = 112/224 (50%), Positives = 158/224 (70%), Gaps = 1/224 (0%)
 Frame = +1

Query: 175 VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL 354
           +A TD  D S L   + S+NSP +L  W+++GGDPCG+SW G++C G+ VTEI++SG  L
Sbjct: 24  LAKTDSQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITCKGSSVTEIKVSGRGL 83

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL 534
           +GS+G+QL  LKS+T  D+S NNL  +LPYQLP  +  L+ + N F G +PYS+S M  L
Sbjct: 84  SGSLGYQLGNLKSLTYLDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDL 143

Query: 535 EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
            YLN+  N L GE++ MF  L  L T+D S N L G +PQ+F++LT +K ++LQ N F G
Sbjct: 144 SYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKG 203

Query: 715 TIDVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           +I+ L +LP +D++NV NN FTGWIP +L+ I +L+TGGN W+S
Sbjct: 204 SINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLETGGNKWSS 247



>gb:AY518293_1610795 Arabidopsis thaliana strubbelig receptor family
           8 (SRF8) mRNA, complete cds.
          Length = 703

 Score =  230 bits (587), Expect = 2e-59
 Identities = 109/220 (49%), Positives = 152/220 (69%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS 363
           TDP+D   L+ L++SLNSP QLT W   GGDPCGESWKG++C G+ V  I IS L ++G+
Sbjct: 29  TDPSDVQALQVLYTSLNSPSQLTNWKNGGGDPCGESWKGITCEGSAVVTIDISDLGVSGT 88

Query: 364 MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL 543
           +G+ L  LKS+   D+S N++ ++LPYQLPPN+  LNLA N  +G LPYSIS M  L Y+
Sbjct: 89  LGYLLSDLKSLRKLDVSGNSIHDTLPYQLPPNLTSLNLARNNLSGNLPYSISAMGSLSYM 148

Query: 544 NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID 723
           NVS N L   +  +F    +L+TLD S N+ +G++P + S+++ +  +Y+QNN  TG+ID
Sbjct: 149 NVSGNSLTMSIGDIFADHKSLATLDLSHNNFSGDLPSSLSTVSTLSVLYVQNNQLTGSID 208

Query: 724 VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           VL+ LPL  LNV NNHF G IP +L  I +L   GNS+++
Sbjct: 209 VLSGLPLKTLNVANNHFNGSIPKELSSIQTLIYDGNSFDN 248



>gb:AE016959_1022362 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079936_1733087
           Genomic Sequence For Oryza sativa, Nipponbare Strain,
           Chromosome X, Clone OSJNBb0061I18, complete
           sequence.>gb:AE017089_1752181 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 43 of 77 of the
           complete sequence.
          Length = 736

 Score =  225 bits (574), Expect = 7e-58
 Identities = 113/225 (50%), Positives = 151/225 (67%), Gaps = 3/225 (1%)
 Frame = +1

Query: 178 ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           A TD  D +VL  LF+SLNSP QL  W  NGGDPCG SW+G++CSG+ VT I++  L L+
Sbjct: 27  ATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGASWQGITCSGSSVTAIKLPSLGLS 86

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMA 528
           G++ + ++ ++S+   D+S NNLG   ++ Y LP   +++LNLAGN F G +PYSIS M 
Sbjct: 87  GNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKKLERLNLAGNQFAGNVPYSISTMP 146

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+YLN++HNQLQG                        N+   FS+L ++  +YLQNN F
Sbjct: 147 KLKYLNLNHNQLQG------------------------NMTDVFSNLPSLSTLYLQNNQF 182

Query: 709 TGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           TG+I+VLANLPLDNLNV NN FTGWIP +L+ INSLQT GNSW++
Sbjct: 183 TGSINVLANLPLDNLNVGNNRFTGWIPNELKKINSLQTDGNSWST 227



>gb:AY518287_1610789 Arabidopsis thaliana strubbelig receptor family
           2 (SRF2) mRNA, complete cds.>gb:AP002032_1821494
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MPH15.
          Length = 735

 Score =  204 bits (520), Expect = 1e-51
 Identities = 97/223 (43%), Positives = 143/223 (64%)
 Frame = +1

Query: 172 AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ 351
           A  DTDP +   L+ L+ SL +P QL  W   GGDPCGE+W G+SCSG+ + ++Q+  L+
Sbjct: 23  AKTDTDPLEVLALQDLYKSLRNPEQLRGWRLEGGDPCGEAWLGISCSGSSIVDLQLRELK 82

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP 531
           L GS+G QL  L ++   D+S NNL   +P+ LPPN   +N+A N  T  +P+S+  M  
Sbjct: 83  LLGSLGNQLQHLHNLKILDVSFNNLEGEIPFGLPPNATHINMAYNNLTQSIPFSLPLMTS 142

Query: 532 LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT 711
           L+ LN+SHN L G +  +F  L  +  +D SFN+L G++P +F +L N+ ++YLQNN  T
Sbjct: 143 LQSLNLSHNSLSGPLGNVFSGL-QIKEMDLSFNNLTGDLPSSFGTLMNLTSLYLQNNRLT 201

Query: 712 GTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           G++  LA+LPL +LN+E+N F+G IP   Q I  L   GN ++
Sbjct: 202 GSVIYLADLPLADLNIEDNQFSGIIPSHFQSIPHLWIWGNKFH 244



>gb:FSY298984_1679418 Fagus sylvatica partial mRNA for thymidine
           kinase (pkf6 gene), clone FsPKf6.
          Length = 170

 Score =  204 bits (518), Expect = 2e-51
 Identities = 98/160 (61%), Positives = 127/160 (79%)
 Frame = +1

Query: 361 SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY 540
           ++ FQLD+LKS+T  D+S NN G  +PYQLPPN+Q+LNLA + F G  PYSIS M  L+Y
Sbjct: 5   TLEFQLDRLKSLTILDMSNNNFGGGIPYQLPPNLQQLNLANDNFNGAAPYSISLMTSLKY 64

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           LN+SHNQLQ +++ MF  L++LSTLD SFNSL+G++P +FSSL++M +MYLQNN FTG+I
Sbjct: 65  LNISHNQLQNQLSDMFGQLSSLSTLDSSFNSLSGDLPTSFSSLSSMTSMYLQNNQFTGSI 124

Query: 721 DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           +VL+NLPL+NLNVENN F GW   QL+ IN L   GNSW+
Sbjct: 125 NVLSNLPLENLNVENNQFNGWDSEQLKSIN-LHKDGNSWH 163



>gb:AP000366_1819746 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0437H03.
          Length = 772

 Score =  195 bits (495), Expect = 1e-48
 Identities = 100/238 (42%), Positives = 151/238 (63%), Gaps = 20/238 (8%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES-----WKGVSCSGNRVTEIQISGL 348
           TDP+DA  L  L+ +L+SP QL+ WT+ GGDPCG       W GV C  + +  + ISGL
Sbjct: 27  TDPSDALGLWELYRTLDSPWQLSGWTSQGGDPCGRGGEQRPWHGVLCRDSSIVALNISGL 86

Query: 349 QLTGSMGFQLDQ---LKSVTTF------------DISTNNLGNSLPYQLPPNVQKLNLAG 483
            + G +G +L +   LK +  F            D+S NN+   +P  LPP+V+ LN A 
Sbjct: 87  GVGGWLGLELLKFYSLKILPVFNFFASLNHDDRRDVSFNNIAGEIPRNLPPSVEYLNFAA 146

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N F G +P S+  +  L+YLN+SHN+L G +  +FV++ +L T+D SFNS +G++P +FS
Sbjct: 147 NQFEGSIPPSLPWLHTLKYLNLSHNKLSGIIGDVFVNMESLGTMDLSFNSFSGDLPTSFS 206

Query: 664 SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW 837
           SL N+ ++YLQ+N FTG++ +LA+LPL +LN+ENN F+G++P   + I  L+  GN +
Sbjct: 207 SLKNLHHLYLQHNEFTGSVILLADLPLSSLNIENNSFSGYVPGTFESIPELRIDGNQF 264



>gb:AP003992_1836055 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1077_E05.
          Length = 795

 Score =  186 bits (473), Expect = 4e-46
 Identities = 96/247 (38%), Positives = 151/247 (61%), Gaps = 4/247 (1%)
 Frame = +1

Query: 115 GLPWAVALLIGFLLNA----PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPC 282
           G P AV +L   LL A    P  A+A T   D + + GL+ +L SP  L KWTANGGDPC
Sbjct: 14  GAPAAVLVLPLLLLIAAAALPRRALAATVAADVAAINGLYVALGSPA-LPKWTANGGDPC 72

Query: 283 GESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
           G+ W+GV C G+ +  I  +   L G +G  L    S+TT ++S NN+G ++P  LP  +
Sbjct: 73  GDGWQGVVCIGSNIDSIIFNAANLEGQLG-SLGNFTSITTINLSNNNIGGTIPEDLPVTL 131

Query: 463 QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAG 642
           Q   ++ N  TG +P S+S +  L  ++++ N L G++   F SLT L   D S N+ +G
Sbjct: 132 QHFFMSDNQLTGSIPTSLSMLQSLTDMSLNDNHLDGKLPDAFGSLTGLVNFDISSNNFSG 191

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           ++P +  SL+++  +++Q+N  +GT+DVL +LPL +LN+ENN F+G +PP+L  + + + 
Sbjct: 192 SLPPSLGSLSSLTTLHMQDNQLSGTLDVLQDLPLKDLNIENNLFSGPVPPKLLNVPNFKK 251

Query: 823 GGNSWNS 843
            GN +N+
Sbjct: 252 DGNPFNT 258



>gb:AC006234_1533809 Arabidopsis thaliana chromosome 2 clone F5H14
           map mi148, complete sequence.>gb:AY056176_1563501
           Arabidopsis thaliana putative LRR receptor protein
           kinase (At2g20850) mRNA, complete
           cds.>gb:AY518286_1610788 Arabidopsis thaliana strubbelig
           receptor family 1 (SRF1) mRNA, complete
           cds.>gb:BT001939_1635542 Arabidopsis thaliana clone
           C105466 putative LRR receptor protein kinase (At2g20850)
           mRNA, complete cds.
          Length = 772

 Score =  182 bits (462), Expect = 7e-45
 Identities = 92/230 (40%), Positives = 144/230 (62%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE 330
           L++ P  ++A T+P D + +  LF +L SP  L  W A+GGDPCGESW+GV C+ ++V  
Sbjct: 19  LISLPSLSLALTNPDDVAAINSLFLALESP-LLPGWVASGGDPCGESWQGVLCNASQVET 77

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY 510
           I +    L G +G  L+   S+   D S N++G S+P  LP ++Q L L+GN FTG +P 
Sbjct: 78  IILISANLGGELGVGLNMFTSLKAMDFSNNHIGGSIPSTLPVSLQNLFLSGNNFTGTIPE 137

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
           S+S +  L  +++++N L G++  +F  L  +  +D S N+L+G +P +  +L+ + ++ 
Sbjct: 138 SLSSLKSLSVMSLNNNLLSGKIPDVFQDLGLMINIDLSSNNLSGPLPPSMQNLSTLTSLL 197

Query: 691 LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           LQNN  +G +DVL +LPL +LNVENN F G IP +L  I +   GGN +N
Sbjct: 198 LQNNHLSGELDVLQDLPLKDLNVENNLFNGPIPEKLLSIPNFIKGGNLFN 247



>gb:AY091019_1574250 Arabidopsis thaliana unknown protein
           (At1g11135) mRNA, complete cds.>gb:AY117318_1579359
           Arabidopsis thaliana unknown protein (At1g11130) mRNA,
           complete cds.>gb:AF399923_1796019 Arabidopsis thaliana
           LRR receptor kinase (SUB) mRNA, complete cds.
          Length = 768

 Score =  181 bits (459), Expect = 2e-44
 Identities = 90/240 (37%), Positives = 143/240 (59%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV 303
           W V   +  L    P +   T+  D S +  L+ +L +P  L  W A GGDPCGE W+GV
Sbjct: 6   WEVFFGLSVLALTMPFSAGVTNLRDVSAINNLYITLGAP-SLHHWLAFGGDPCGEKWQGV 64

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG 483
            C  + +TEI+I G+++ G +   L    S+   D S+N++  ++P  LP +++ L+L+ 
Sbjct: 65  VCDSSNITEIRIPGMKVGGGLSDTLADFSSIQVMDFSSNHISGTIPQALPSSIRNLSLSS 124

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N FTG +P+++S ++ L  L++  N L GE+   F  L+ L+ LD S N L G++P +  
Sbjct: 125 NRFTGNIPFTLSFLSDLSELSLGSNLLSGEIPDYFQQLSKLTKLDLSSNILEGHLPSSMG 184

Query: 664 SLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            L ++K +YLQ+N  TGT+DV+ +L L +LNVENN F+G IPP L  I + +  G  +N+
Sbjct: 185 DLASLKILYLQDNKLTGTLDVIEDLFLTDLNVENNLFSGPIPPNLLKIPNFKKDGTPFNT 244



>pir|D86245|D86245 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890123 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007259_1535697 Arabidopsis thaliana
           chromosome I BAC T28P6 genomic sequence, complete
           sequence.
          Length = 750

 Score =  178 bits (452), Expect = 1e-43
 Identities = 87/226 (38%), Positives = 139/226 (61%)
 Frame = +1

Query: 166 PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISG 345
           P +   T+  D S +  L+ +L +P  L  W A GGDPCGE W+GV C  + +TEI+I G
Sbjct: 2   PFSAGVTNLRDVSAINNLYITLGAP-SLHHWLAFGGDPCGEKWQGVVCDSSNITEIRIPG 60

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM 525
           +++ G +   L    S+   D S+N++  ++P  LP +++ L+L+ N FTG +P+++S +
Sbjct: 61  MKVGGGLSDTLADFSSIQVMDFSSNHISGTIPQALPSSIRNLSLSSNRFTGNIPFTLSFL 120

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L  L++  N L GE+   F  L+ L+ LD S N L G++P +   L ++K +YLQ+N 
Sbjct: 121 SDLSELSLGSNLLSGEIPDYFQQLSKLTKLDLSSNILEGHLPSSMGDLASLKILYLQDNK 180

Query: 706 FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            TGT+DV+ +L L +LNVENN F+G IPP L  I + +  G  +N+
Sbjct: 181 LTGTLDVIEDLFLTDLNVENNLFSGPIPPNLLKIPNFKKDGTPFNT 226



>gb:AY518288_1610790 Arabidopsis thaliana strubbelig receptor family
           3 (SRF3) mRNA, complete cds.
          Length = 776

 Score =  178 bits (451), Expect = 1e-43
 Identities = 88/236 (37%), Positives = 142/236 (60%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           LL+  L+  P  ++A T+P D + + GLF++L +P  L  W A+GGDPCGE+W+G+ C+ 
Sbjct: 15  LLLSLLIWIPSISLAATNPDDVAAINGLFAALGAPV-LPGWIASGGDPCGEAWQGIICNV 73

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT 495
           + +  I ++   L G +G  L +  S+   D S N +G S+P  LP  +Q   L+ N FT
Sbjct: 74  SDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNRIGGSIPSTLPVTLQHFFLSANQFT 133

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  ++ L  ++++ N L GE+  +F +L  L  LD S N+++G +P +  +L  
Sbjct: 134 GSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLT 193

Query: 676 MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           +  + +QNN  +GT+DVL  LPL +LN+ENN F+G IP +L  I      GN +N+
Sbjct: 194 LTTLRVQNNQLSGTLDVLQGLPLQDLNIENNLFSGPIPDKLLSIPKFLHEGNPFNA 249



>pir|B84594|B84594 probable LRR receptor protein kinase [imported] -
           Arabidopsis thaliana
          Length = 767

 Score =  175 bits (443), Expect = 1e-42
 Identities = 97/254 (38%), Positives = 148/254 (58%), Gaps = 24/254 (9%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE 330
           L++ P  ++A T+P D + +  LF +L SP  L  W A+GGDPCGESW+GV C+ ++V  
Sbjct: 22  LISLPSLSLALTNPDDVAAINSLFLALESP-LLPGWVASGGDPCGESWQGVLCNASQVET 80

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY 510
           I +    L G +G  L+   S+   D S N++G S+P  LP ++Q L L+GN FTG +P 
Sbjct: 81  IILISANLGGELGVGLNMFTSLKAMDFSNNHIGGSIPSTLPVSLQNLFLSGNNFTGTIPE 140

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMF---------------------VSLTNLST---LD 618
           S+S +  L  +++++N L G++  +F                      S+ NLST   LD
Sbjct: 141 SLSSLKSLSVMSLNNNLLSGKIPDVFQDLGLMINIDLSSNNLSGPLPPSMQNLSTLTSLD 200

Query: 619 FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL 798
            S N+L+G +P +  +L+ + ++ LQNN  +G +DVL +LPL +LNVENN F G IP +L
Sbjct: 201 LSSNNLSGPLPPSMQNLSTLTSLLLQNNHLSGELDVLQDLPLKDLNVENNLFNGPIPEKL 260

Query: 799 QGINSLQTGGNSWN 840
             I +   GGN +N
Sbjct: 261 LSIPNFIKGGNLFN 274



>pir|A85043|A85043 probable LRR receptor-like protein kinase
           [imported] - Arabidopsis thaliana>gb:AC005275_1532370
           Arabidopsis thaliana BAC F4C21 from chromosome IV, top
           arm, near 17 cM, complete sequence.>gb:ATCHRIV8_1547320
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 8.
          Length = 754

 Score =  145 bits (366), Expect = 9e-34
 Identities = 71/203 (34%), Positives = 122/203 (60%), Gaps = 1/203 (0%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           LL+  L+  P  ++A T+P D + + GLF++L +P  L  W A+GGDPCGE+W+G+ C+ 
Sbjct: 15  LLLSLLIWIPSISLAATNPDDVAAINGLFAALGAPV-LPGWIASGGDPCGEAWQGIICNV 73

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT 495
           + +  I ++   L G +G  L +  S+   D S N +G S+P  LP  +Q   L+ N FT
Sbjct: 74  SDIISITVNAANLQGELGDNLAKFTSIRGIDFSNNRIGGSIPSTLPVTLQHFFLSANQFT 133

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  ++ L  ++++ N L GE+  +F +L  L  LD S N+++G +P +  +L  
Sbjct: 134 GSIPESLGTLSFLNDMSLNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLT 193

Query: 676 MKNMYLQNNVFTGTI-DVLANLP 741
           +  + ++NN+F+G I D L ++P
Sbjct: 194 LTTLNIENNLFSGPIPDKLLSIP 216



>gb:AP005474_1852533 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBa0081C13.>gb:AP005647_1855397 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0026E05.
          Length = 673

 Score =  118 bits (295), Expect = 2e-25
 Identities = 68/199 (34%), Positives = 109/199 (54%), Gaps = 1/199 (0%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS 363
           T P D   +  L++SL SP  L  W ++GGDPC E+W+GV C G  +T I++ G  L G 
Sbjct: 33  TSPQDVDAINELYASLGSP-DLHGWASSGGDPCMEAWQGVQCLGPNITAIELRGAGLGGK 91

Query: 364 MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL 543
           +   L +  ++T  D+S+N +G  +P  LPP V++LNL+ N  +G LP S++++  L  L
Sbjct: 92  LSETLGKFTAMTALDLSSNRIGGVIPESLPPAVKQLNLSSNSLSGKLPDSMAKLNSLSTL 151

Query: 544 NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI- 720
           +V +NQL G + V+                  G++P        +K++ ++NN+F+G I 
Sbjct: 152 HVQNNQLTGTLDVL------------------GDLP--------LKDLDIENNLFSGPIP 185

Query: 721 DVLANLPLDNLNVENNHFT 777
           + L N+P    N   NH T
Sbjct: 186 EKLINIPKFLRN--GNHLT 202



>gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1148D12.
          Length = 1083

 Score =  117 bits (292), Expect = 4e-25
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 12/239 (5%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           LL+  LL +   + + T+P D S L+ L  +  + PQ   W  +  DPC  SW G+SCS 
Sbjct: 8   LLLFMLLVSLRLSFSQTNPQDVSALQALMKNWQNEPQ--SWMGST-DPC-TSWDGISCSN 63

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTN-NLGNSLPYQLPPNVQKLN---LAG 483
            RVTE+++SG+ L G++   +DQL S+T  D+S N NLG  LP  +  N+++L    L G
Sbjct: 64  GRVTEMRLSGINLQGTLSNAIDQLSSLTYLDLSNNLNLGGPLPPSI-VNLKQLTTLILLG 122

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
             FTG +P  I  +  L +L ++ N+  G +      L+ L  LD S N L+G IP +  
Sbjct: 123 CSFTGDIPEQIGALRQLTFLALNSNKFTGGIPPTLGLLSKLFWLDLSDNQLSGKIPVSSG 182

Query: 664 S------LTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           S      L N +++   NN FTG I   +     +  + +++N F+G +P  +  ++ L
Sbjct: 183 SNPGLDQLVNAEHLIFDNNNFTGPIPGSLGRVSSIQIIRLDHNQFSGPVPGSIANLSRL 241



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 48/183 (26%), Positives = 82/183 (44%), Gaps = 19/183 (10%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--------VQKLN 474
           ++T + ++  + TG +   L  L  +   D+S N L   +P     N         + L 
Sbjct: 138 QLTFLALNSNKFTGGIPPTLGLLSKLFWLDLSDNQLSGKIPVSSGSNPGLDQLVNAEHLI 197

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
              N FTG +P S+ +++ ++ + + HNQ  G V     +L+ L  L  + N L G +P 
Sbjct: 198 FDNNNFTGPIPGSLGRVSSIQIIRLDHNQFSGPVPGSIANLSRLMELSLASNQLNGTVPD 257

Query: 655 TFSSLTNMKNMYLQNNVFTGT-----IDVLANLPLDNLNVENNHFTGWIP------PQLQ 801
             +S   +  + L NN F  +        L +  L  L ++++H TG IP      PQLQ
Sbjct: 258 -LTSANALTYVDLSNNNFMSSPAPRWFSTLTS--LTTLFMDSDHLTGTIPSALFSFPQLQ 314

Query: 802 GIN 810
            I+
Sbjct: 315 QIS 317



 Score = 38.1 bits (87), Expect = 0.21
 Identities = 31/114 (27%), Positives = 58/114 (50%), Gaps = 4/114 (3%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQ-LDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLA 480
           S N +T + +S      S   +    L S+TT  + +++L  ++P  L   P +Q+++LA
Sbjct: 260 SANALTYVDLSNNNFMSSPAPRWFSTLTSLTTLFMDSDHLTGTIPSALFSFPQLQQISLA 319

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQL-QGEVTVMFVSLTNLSTLDFSFNSLA 639
            N F+G L  S +  + L  +N+++NQ+   EV   +     LS     FN+++
Sbjct: 320 KNSFSGELNMSSNISSLLRVVNLTNNQIFNAEVDPSYTGSLILSGNLICFNNIS 373



>gb:AK117863_1815873 Arabidopsis thaliana At1g79620 mRNA for unknown
           protein, complete cds, clone: RAFL19-03-A10.
          Length = 971

 Score =  108 bits (269), Expect = 2e-22
 Identities = 76/226 (33%), Positives = 116/226 (51%), Gaps = 14/226 (6%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSL-NSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG 360
           TDP DA+ LR L     N+PP    W     DPCG  W+GVSC+ +R+T + +S + L G
Sbjct: 32  TDPRDAAALRSLMDQWDNTPPS---W-GGSDDPCGTPWEGVSCNNSRITALGLSTMGLKG 87

Query: 361 SMGFQLDQLKSVTTFDISTN-NLGNSLPYQLPPNVQKLN---LAGNGFTGGLPYSISQMA 528
            +   + +L  + + D+S N  L  SL  +L  ++QKLN   LAG GFTG +P  +  + 
Sbjct: 88  RLSGDIGELAELRSLDLSFNRGLTGSLTSRL-GDLQKLNILILAGCGFTGTIPNELGYLK 146

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS------LTNMKNMY 690
            L +L ++ N   G++     +LT +  LD + N L G IP +  S      L   K+ +
Sbjct: 147 DLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIPISSGSSPGLDLLLKAKHFH 206

Query: 691 LQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
              N  +GTI      + + L ++  + N FTG IP  L  I +L+
Sbjct: 207 FNKNQLSGTIPPKLFSSEMILIHVLFDGNRFTGSIPSTLGLIQTLE 252



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 66/220 (30%), Positives = 100/220 (45%), Gaps = 8/220 (3%)
 Frame = +1

Query: 184 TDPTDASVLRGL-FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT-EIQISGLQLT 357
           T P +   L+ L F +LNS     K  A+ G+     W  +  + N++T  I IS     
Sbjct: 137 TIPNELGYLKDLSFLALNSNNFTGKIPASLGNLTKVYW--LDLADNQLTGPIPISSGSSP 194

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---LAGNGFTGGLPYSISQMA 528
           G     LD L     F  + N L  ++P +L  +   L      GN FTG +P ++  + 
Sbjct: 195 G-----LDLLLKAKHFHFNKNQLSGTIPPKLFSSEMILIHVLFDGNRFTGSIPSTLGLIQ 249

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            LE L +  N L G+V     +LTN+  L+ + N L G++P   S + +M  + L NN F
Sbjct: 250 TLEVLRLDRNTLTGKVPENLSNLTNIIELNLAHNKLVGSLPD-LSDMKSMNYVDLSNNSF 308

Query: 709 TGTIDVL--ANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
             +   L  + LP L  L +E     G +P +L G   LQ
Sbjct: 309 DPSESPLWFSTLPSLTTLVMEYGSLQGPLPNKLFGFPQLQ 348



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 3/135 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           +   G + TGS+   L  ++++    +  N L   +P  L    N+ +LNLA N   G L
Sbjct: 230 VLFDGNRFTGSIPSTLGLIQTLEVLRLDRNTLTGKVPENLSNLTNIIELNLAHNKLVGSL 289

Query: 505 PYSISQMAPLEYLNVSHNQLQ-GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P  +S M  + Y+++S+N     E  + F +L +L+TL   + SL G +P        ++
Sbjct: 290 P-DLSDMKSMNYVDLSNNSFDPSESPLWFSTLPSLTTLVMEYGSLQGPLPNKLFGFPQLQ 348

Query: 682 NMYLQNNVFTGTIDV 726
            + L+ N F GT+ +
Sbjct: 349 QVRLKKNAFNGTLSL 363



>pir|T48210|T48210 hypothetical protein T20L15.160 - Arabidopsis
           thaliana>gb:ATT20L15_1555042 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T20L15 (ESSA
           project).>gb:BT004520_1637554 Arabidopsis thaliana
           At5g01890/T20L15_160 gene, complete
           cds.>gb:AF424563_1798902 Arabidopsis thaliana
           AT5g01890/T20L15_160 mRNA, complete cds.
          Length = 967

 Score =  108 bits (269), Expect = 2e-22
 Identities = 86/274 (31%), Positives = 143/274 (52%), Gaps = 38/274 (13%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLF---SSLNSP-PQLTKWTANGGDPCGESW 294
           AV+LL  FL  A  SA AD  PT    + GL    + L+ P  +L+ W +   DPC  +W
Sbjct: 5   AVSLL--FLFLAVVSARAD--PTFNDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPC--NW 58

Query: 295 KGVSC--SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-------------- 426
            G +C  + NRV+E+++    L+G +G  L +L+ + T  +S NNL              
Sbjct: 59  VGCTCDPATNRVSELRLDAFSLSGHIGRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGSL 118

Query: 427 ------GNSLPYQLPP-------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ 567
                 GN+L  ++P        +++ ++LA N  TG +P S+S  + L +LN+S NQL 
Sbjct: 119 QVVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSYCSTLTHLNLSSNQLS 178

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLP 741
           G +      L +L +LDFS N L G+IP     L +++++ L  N F+G +  D+     
Sbjct: 179 GRLPRDIWFLKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSRNWFSGDVPSDIGRCSS 238

Query: 742 LDNLNVENNHFTGWIPPQLQGI---NSLQTGGNS 834
           L +L++  N+F+G +P  ++ +   +S++  GNS
Sbjct: 239 LKSLDLSENYFSGNLPDSMKSLGSCSSIRLRGNS 272



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 55/178 (30%), Positives = 91/178 (51%), Gaps = 4/178 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           +T + +S  QL+G +   +  LKS+ + D S N L   +P  L    +++ +NL+ N F+
Sbjct: 167 LTHLNLSSNQLSGRLPRDIWFLKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSRNWFS 226

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  I + + L+ L++S N   G +     SL + S++    NSL G IP     +  
Sbjct: 227 GDVPSDIGRCSSLKSLDLSENYFSGNLPDSMKSLGSCSSIRLRGNSLIGEIPDWIGDIAT 286

Query: 676 MKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           ++ + L  N FTGT+   L NL  L +LN+  N   G +P  L   ++L +   S NS
Sbjct: 287 LEILDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELPQTLSNCSNLISIDVSKNS 344



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 39/133 (29%), Positives = 74/133 (55%), Gaps = 2/133 (1%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGG 501
           ++ +S   L GS+   +  LK     D+S+N L  +LP ++    ++++L+L  N  +G 
Sbjct: 413 QLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTLPSEIGGAVSLKQLHLHRNRLSGQ 472

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P  IS  + L  +N+S N+L G +     SL+NL  +D S N+L+G++P+    L+++ 
Sbjct: 473 IPAKISNCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNLSGSLPKEIEKLSHLL 532

Query: 682 NMYLQNNVFTGTI 720
              + +N  TG +
Sbjct: 533 TFNISHNNITGEL 545



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 2/132 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           I +S    +G +   + +  S+ + D+S N    +LP  +    +   + L GN   G +
Sbjct: 218 INLSRNWFSGDVPSDIGRCSSLKSLDLSENYFSGNLPDSMKSLGSCSSIRLRGNSLIGEI 277

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  I  +A LE L++S N   G V     +L  L  L+ S N LAG +PQT S+ +N+ +
Sbjct: 278 PDWIGDIATLEILDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELPQTLSNCSNLIS 337

Query: 685 MYLQNNVFTGTI 720
           + +  N FTG +
Sbjct: 338 IDVSKNSFTGDV 349



 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 38/119 (31%), Positives = 61/119 (51%), Gaps = 2/119 (1%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           L+L+ NGFTG LP +I  +  L  LN+S N L G +      L     LD S N L G +
Sbjct: 390 LDLSSNGFTGELPSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTL 449

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           P       ++K ++L  N  +G I   ++N   L+ +N+  N  +G IP  +  +++L+
Sbjct: 450 PSEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIPGSIGSLSNLE 508



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 49/196 (25%), Positives = 87/196 (44%), Gaps = 32/196 (16%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S    TG++ F L  L+ +   ++S N L   LP  L    N+  ++++ N FTG +
Sbjct: 290 LDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELPQTLSNCSNLISIDVSKNSFTGDV 349

Query: 505 ----------PYSISQMA------------------PLEYLNVSHNQLQGEVTVMFVSLT 600
                       S+S+ +                   L  L++S N   GE+      LT
Sbjct: 350 LKWMFTGNSESSSLSRFSLHKRSGNDTIMPIVGFLQGLRVLDLSSNGFTGELPSNIWILT 409

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHF 774
           +L  L+ S NSL G+IP     L   + + L +N+  GT+  ++   + L  L++  N  
Sbjct: 410 SLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTLPSEIGGAVSLKQLHLHRNRL 469

Query: 775 TGWIPPQLQGINSLQT 822
           +G IP ++   ++L T
Sbjct: 470 SGQIPAKISNCSALNT 485



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 32/116 (27%), Positives = 60/116 (51%), Gaps = 3/116 (2%)
 Frame = +1

Query: 313 GNRVTEI-QISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAG 483
           G +V EI  +S   L G++  ++    S+    +  N L   +P ++     +  +NL+ 
Sbjct: 431 GLKVAEILDLSSNLLNGTLPSEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSE 490

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           N  +G +P SI  ++ LEY+++S N L G +      L++L T + S N++ G +P
Sbjct: 491 NELSGAIPGSIGSLSNLEYIDLSRNNLSGSLPKEIEKLSHLLTFNISHNNITGELP 546



>pir|T10659|T10659 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T5F17.100 - Arabidopsis
           thaliana>gb:ATCHRIV69_1546745 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 69.
          Length = 1013

 Score =  108 bits (269), Expect = 2e-22
 Identities = 74/228 (32%), Positives = 121/228 (53%), Gaps = 6/228 (2%)
 Frame = +1

Query: 154 LNAPPSAVADTDPT-DASVLRGLFSSLNSPPQLTK-WT-ANGGDPCGESWKGVSCSGN-R 321
           + +  S +A  D   + SVL  + S+L  P    K W  ++  D C  +W GV C+ N  
Sbjct: 15  IGSTSSVLASIDNVNELSVLLSVKSTLVDPLNFLKDWKLSDTSDHC--NWTGVRCNSNGN 72

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG 501
           V ++ ++G+ LTG +   + QL S+ +F+IS N   + LP  +PP ++ ++++ N F+G 
Sbjct: 73  VEKLDLAGMNLTGKISDSISQLSSLVSFNISCNGFESLLPKSIPP-LKSIDISQNSFSGS 131

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           L    ++   L +LN S N L G +T    +L +L  LD   N   G++P +F +L  ++
Sbjct: 132 LFLFSNESLGLVHLNASGNNLSGNLTEDLGNLVSLEVLDLRGNFFQGSLPSSFKNLQKLR 191

Query: 682 NMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
            + L  N  TG +  VL  LP L+   +  N F G IPP+   INSL+
Sbjct: 192 FLGLSGNNLTGELPSVLGQLPSLETAILGYNEFKGPIPPEFGNINSLK 239



 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 53/183 (28%), Positives = 93/183 (50%), Gaps = 4/183 (2%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLA 480
           C+   +T++ +     TG +   L   +S+    +  N L  S+P  +     +Q+L LA
Sbjct: 377 CNKGNLTKLILFNNTFTGQIPATLSTCQSLVRVRMQNNLLNGSIPIGFGKLEKLQRLELA 436

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
           GN  +GG+P  IS    L +++ S NQ++  +    +S+ NL     + N ++G +P  F
Sbjct: 437 GNRLSGGIPGDISDSVSLSFIDFSRNQIRSSLPSTILSIHNLQAFLVADNFISGEVPDQF 496

Query: 661 SSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS 834
               ++ N+ L +N  TGTI   + +   L +LN+ NN+ TG IP Q+  +++L     S
Sbjct: 497 QDCPSLSNLDLSSNTLTGTIPSSIASCEKLVSLNLRNNNLTGEIPRQITTMSALAVLDLS 556

Query: 835 WNS 843
            NS
Sbjct: 557 NNS 559



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 49/154 (31%), Positives = 79/154 (51%), Gaps = 4/154 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           +  G +  +   + S+   D++   L   +P +L    +++ L L  N FTG +P  I  
Sbjct: 223 EFKGPIPPEFGNINSLKYLDLAIGKLSGEIPSELGKLKSLETLLLYENNFTGTIPREIGS 282

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L+ L+ S N L GE+ +    L NL  L+   N L+G+IP   SSL  ++ + L NN
Sbjct: 283 ITTLKVLDFSDNALTGEIPMEITKLKNLQLLNLMRNKLSGSIPPAISSLAQLQVLELWNN 342

Query: 703 VFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
             +G +  D+  N PL  L+V +N F+G IP  L
Sbjct: 343 TLSGELPSDLGKNSPLQWLDVSSNSFSGEIPSTL 376



 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 52/166 (31%), Positives = 84/166 (50%), Gaps = 7/166 (4%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMA 528
           TG++  ++  + ++   D S N L   +P ++    N+Q LNL  N  +G +P +IS +A
Sbjct: 273 TGTIPREIGSITTLKVLDFSDNALTGEIPMEITKLKNLQLLNLMRNKLSGSIPPAISSLA 332

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+ L + +N L GE+       + L  LD S NS +G IP T  +  N+  + L NN F
Sbjct: 333 QLQVLELWNNTLSGELPSDLGKNSPLQWLDVSSNSFSGEIPSTLCNKGNLTKLILFNNTF 392

Query: 709 TGTIDVLANL--PLDNLNVENNHFTGWIP---PQLQGINSLQTGGN 831
           TG I    +    L  + ++NN   G IP    +L+ +  L+  GN
Sbjct: 393 TGQIPATLSTCQSLVRVRMQNNLLNGSIPIGFGKLEKLQRLELAGN 438



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 63/219 (28%), Positives = 98/219 (44%), Gaps = 8/219 (3%)
 Frame = +1

Query: 187 DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT--EIQISGLQLTG 360
           D +  S    LF   N    L    A+G +  G   + +   GN V+   + + G    G
Sbjct: 122 DISQNSFSGSLFLFSNESLGLVHLNASGNNLSGNLTEDL---GNLVSLEVLDLRGNFFQG 178

Query: 361 SMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPL 534
           S+      L+ +    +S NNL   LP  L   P+++   L  N F G +P     +  L
Sbjct: 179 SLPSSFKNLQKLRFLGLSGNNLTGELPSVLGQLPSLETAILGYNEFKGPIPPEFGNINSL 238

Query: 535 EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
           +YL+++  +L GE+      L +L TL    N+  G IP+   S+T +K +   +N  TG
Sbjct: 239 KYLDLAIGKLSGEIPSELGKLKSLETLLLYENNFTGTIPREIGSITTLKVLDFSDNALTG 298

Query: 715 TIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            I +    L NL L  LN+  N  +G IPP +  +  LQ
Sbjct: 299 EIPMEITKLKNLQL--LNLMRNKLSGSIPPAISSLAQLQ 335



 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 45/187 (24%), Positives = 87/187 (46%), Gaps = 29/187 (15%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP------------------- 441
           ++  ++++G +L+G +   +    S++  D S N + +SLP                   
Sbjct: 429 KLQRLELAGNRLSGGIPGDISDSVSLSFIDFSRNQIRSSLPSTILSIHNLQAFLVADNFI 488

Query: 442 -------YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
                  +Q  P++  L+L+ N  TG +P SI+    L  LN+ +N L GE+     +++
Sbjct: 489 SGEVPDQFQDCPSLSNLDLSSNTLTGTIPSSIASCEKLVSLNLRNNNLTGEIPRQITTMS 548

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV---LANLPLDNLNVENNH 771
            L+ LD S NSL G +P++  +   ++ + +  N  TG + +   L  +  D+L   +  
Sbjct: 549 ALAVLDLSNNSLTGVLPESIGTSPALELLNVSYNKLTGPVPINGFLKTINPDDLRGNSGL 608

Query: 772 FTGWIPP 792
             G +PP
Sbjct: 609 CGGVLPP 615



 Score = 37.0 bits (84), Expect = 0.47
 Identities = 25/91 (27%), Positives = 39/91 (42%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
           S  ++  + +    LTG +  Q+  + ++   D+S N+L                     
Sbjct: 522 SCEKLVSLNLRNNNLTGEIPRQITTMSALAVLDLSNNSL--------------------- 560

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
            TG LP SI     LE LNVS+N+L G V +
Sbjct: 561 -TGVLPESIGTSPALELLNVSYNKLTGPVPI 590



>gb:AE005173_895483 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC010793_1537061 Genomic sequence
           for Arabidopsis thaliana BAC F20B17 from chromosome I,
           complete sequence.
          Length = 980

 Score =  107 bits (266), Expect = 4e-22
 Identities = 72/225 (32%), Positives = 115/225 (51%), Gaps = 14/225 (6%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSL-NSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG 360
           TDP DA+ LR L     N+PP    W     DPCG  W+GVSC+ +R+T + +S + L G
Sbjct: 32  TDPRDAAALRSLMDQWDNTPPS---W-GGSDDPCGTPWEGVSCNNSRITALGLSTMGLKG 87

Query: 361 SMGFQLDQLKSVTTFDISTN-NLGNSLPYQLPPNVQKLN---LAGNGFTGGLPYSISQMA 528
            +   + +L  + + D+S N  L  SL  +L  ++QKLN   LAG GFTG +P  +  + 
Sbjct: 88  RLSGDIGELAELRSLDLSFNRGLTGSLTSRL-GDLQKLNILILAGCGFTGTIPNELGYLK 146

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS------LTNMKNMY 690
            L +L ++ N   G++     +LT +  LD + N L G IP +  S      L   K+ +
Sbjct: 147 DLSFLALNSNNFTGKIPASLGNLTKVYWLDLADNQLTGPIPISSGSSPGLDLLLKAKHFH 206

Query: 691 LQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
              N  +GTI      + + L ++ ++ N  TG +P  L  + ++
Sbjct: 207 FNKNQLSGTIPPKLFSSEMILIHVRLDRNTLTGKVPENLSNLTNI 251



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 3/109 (2%)
 Frame = +1

Query: 409 ISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ-GEVT 579
           +  N L   +P  L    N+ +LNLA N   G LP  +S M  + Y+++S+N     E  
Sbjct: 232 LDRNTLTGKVPENLSNLTNIIELNLAHNKLVGSLP-DLSDMKSMNYVDLSNNSFDPSESP 290

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV 726
           + F +L +L+TL   + SL G +P        ++ + L+ N F GT+ +
Sbjct: 291 LWFSTLPSLTTLVMEYGSLQGPLPNKLFGFPQLQQVRLKKNAFNGTLSL 339



>pir|T04568|T04568 protein kinase homolog T12H17.120 - Arabidopsis
           thaliana>gb:ATCHRIV57_1546110 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           57.>gb:ATT12H17_1554358 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12H17 (ESSAII
           project).>gb:BT010747_1640693 Arabidopsis thaliana
           At4g22730 gene, complete cds.>gb:AK176866_1818854
           Arabidopsis thaliana mRNA for leucine rich repeat
           receptor kinase-like protein, complete cds, clone:
           RAFL25-42-K06.
          Length = 688

 Score =  106 bits (265), Expect = 5e-22
 Identities = 73/234 (31%), Positives = 122/234 (52%), Gaps = 6/234 (2%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTK-WTANGGDPCGESWKGV 303
           A  L++  +  A PS V      +   L  L SSL+   +L + WT NG DPC  S++G+
Sbjct: 6   ATLLILLSIFLATPSNVRGN--AELKALMELKSSLDPENKLLRSWTFNG-DPCDGSFEGI 62

Query: 304 SCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLN 474
           +C+ + +V  I + G +L G +   + +LK ++   +  N+L   +P ++     +  L 
Sbjct: 63  ACNQHLKVANISLQGKRLVGKLSPAVAELKCLSGLYLHYNSLSGEIPQEITNLTELSDLY 122

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           L  N F+G +P  I  MA L+ +++  N L G++     SL  L+ L    N L G +P 
Sbjct: 123 LNVNNFSGEIPADIGSMAGLQVMDLCCNSLTGKIPKNIGSLKKLNVLSLQHNKLTGEVPW 182

Query: 655 TFSSLTNMKNMYLQNNVFTGTID-VLANLP-LDNLNVENNHFTGWIPPQLQGIN 810
           T  +L+ +  + L  N   G I   LAN+P LD L++ NN  +G++PP L+ +N
Sbjct: 183 TLGNLSMLSRLDLSFNNLLGLIPKTLANIPQLDTLDLRNNTLSGFVPPGLKKLN 236



>gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra
           sporogenous cells (ESP gene).
          Length = 1192

 Score =  105 bits (262), Expect = 1e-21
 Identities = 71/247 (28%), Positives = 122/247 (49%), Gaps = 6/247 (2%)
 Frame = +1

Query: 118 LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT-ANGGDPCGESW 294
           + +  AL +    +   SA+ D      S++     SL +P  L+ W  ++    C   W
Sbjct: 1   MAFLTALFLFLFFSFSSSAIVDLSSETTSLI-SFKRSLENPSLLSSWNVSSSASHC--DW 57

Query: 295 KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQK 468
            GV+C   RV  + +  L L G +  ++  LK++    ++ N     +P ++    ++Q 
Sbjct: 58  VGVTCLLGRVNSLSLPSLSLRGQIPKEISSLKNLRELCLAGNQFSGKIPPEIWNLKHLQT 117

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV-MFVSLTNLSTLDFSFNSLAGN 645
           L+L+GN  TG LP  +S++  L YL++S N   G + +  F+SL  LS+LD S NSL+G 
Sbjct: 118 LDLSGNSLTGLLPSRLSELPELLYLDLSDNHFSGSLPLSFFISLPALSSLDVSNNSLSGE 177

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           IP     L+N+ N+Y+  N F+G I  ++     L N    +  F G +P ++  +  L 
Sbjct: 178 IPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNTSLLKNFAAPSCFFNGPLPKEISKLKHLA 237

Query: 820 TGGNSWN 840
               S+N
Sbjct: 238 KLDLSYN 244



 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 57/170 (33%), Positives = 95/170 (55%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGFT 495
            + EI +S   L+G +   L +L ++T  D+S N L  S+P ++  ++  Q LNLA N   
Sbjct: 606  LVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALTGSIPKEMGNSLKLQGLNLANNQLN 665

Query: 496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
            G +P S   +  L  LN++ N+L G V     +L  L+ +D SFN+L+G +    S++  
Sbjct: 666  GHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEK 725

Query: 676  MKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +  +Y++ N FTG I   L NL  L+ L+V  N  +G IP ++ G+ +L+
Sbjct: 726  LVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLPNLE 775



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 52/184 (28%), Positives = 89/184 (48%), Gaps = 5/184 (2%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLNL 477
           C    +  I +SG  L+G++    D   S+    ++ N +  S+P   ++LP  +  L+L
Sbjct: 374 CGSGSLEAIDLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLP--LMALDL 431

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N FTG +P S+ +   L     S+N+L+G +     +  +L  L  S N L G IP+ 
Sbjct: 432 DSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPRE 491

Query: 658 FSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
              LT++  + L  N+F G I V       L  L++ +N+  G IP ++  +  LQ    
Sbjct: 492 IGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVL 551

Query: 832 SWNS 843
           S+N+
Sbjct: 552 SYNN 555



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 51/190 (26%), Positives = 88/190 (46%), Gaps = 16/190 (8%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-------YQLP-PNVQKL-- 471
            +T + +    L G +  ++  L  +    +S NNL  S+P       +Q+  P++  L  
Sbjct: 522  LTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQIDMPDLSFLQH 581

Query: 472  ----NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
                +L+ N  +G +P  + +   L  +++S+N L GE+      LTNL+ LD S N+L 
Sbjct: 582  HGIFDLSYNRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALT 641

Query: 640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINS 813
            G+IP+   +   ++ + L NN   G I     L   L  LN+  N   G +P  L  +  
Sbjct: 642  GSIPKEMGNSLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKE 701

Query: 814  LQTGGNSWNS 843
            L     S+N+
Sbjct: 702  LTHMDLSFNN 711



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
            + ++ ++  +L G +   L  LK +T  D+S NNL   L  +L     +  L +  N FT
Sbjct: 678  LVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVGLYIEQNKFT 737

Query: 496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
            G +P  +  +  LEYL+VS N L GE+      L NL  L+ + N+L G +P
Sbjct: 738  GEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRGEVP 789



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 38/132 (28%), Positives = 68/132 (51%), Gaps = 2/132 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + +     TG +   L +  ++  F  S N L   LP ++    ++++L L+ N  TG +
Sbjct: 429 LDLDSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEI 488

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  I ++  L  LN++ N  QG++ V     T+L+TLD   N+L G IP   ++L  ++ 
Sbjct: 489 PREIGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQC 548

Query: 685 MYLQNNVFTGTI 720
           + L  N  +G+I
Sbjct: 549 LVLSYNNLSGSI 560



 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 40/159 (25%), Positives = 79/159 (49%), Gaps = 3/159 (1%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG--FT 495
           ++ + +S   L+G +  ++ +L +++   +  N+    +P ++       N A     F 
Sbjct: 164 LSSLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNTSLLKNFAAPSCFFN 223

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G LP  IS++  L  L++S+N L+  +   F  L NLS L+     L G+IP    +  +
Sbjct: 224 GPLPKEISKLKHLAKLDLSYNPLKCSIPKSFGELQNLSILNLVSAELIGSIPPELGNCKS 283

Query: 676 MKNMYLQNNVFTGTIDV-LANLPLDNLNVENNHFTGWIP 789
           +K++ L  N  +G + + L+ +PL   + E N  +G +P
Sbjct: 284 LKSLMLSFNSLSGPLPLELSEIPLLTFSAERNQLSGSLP 322



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 50/194 (25%), Positives = 87/194 (44%), Gaps = 19/194 (9%)
 Frame = +1

Query: 292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQ 465
            WK  +     + E   S  +L G +  ++    S+    +S N L   +P ++    ++ 
Sbjct: 445  WKSTN-----LMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKLTSLS 499

Query: 466  KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
             LNL  N F G +P  +     L  L++  N LQG++     +L  L  L  S+N+L+G+
Sbjct: 500  VLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGS 559

Query: 646  IPQTFSSLTNMKNM----YLQNNVFTGTIDVLAN-------------LPLDNLNVENNHF 774
            IP   S+  +  +M    +LQ++   G  D+  N             L L  +++ NNH 
Sbjct: 560  IPSKPSAYFHQIDMPDLSFLQHH---GIFDLSYNRLSGPIPEELGECLVLVEISLSNNHL 616

Query: 775  TGWIPPQLQGINSL 816
            +G IP  L  + +L
Sbjct: 617  SGEIPASLSRLTNL 630



 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 50/196 (25%), Positives = 89/196 (45%), Gaps = 26/196 (13%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-NVQKLNLAGNGFTGGLP 507
           + +   +L GS+  +L   KS+ +  +S N+L   LP +L    +   +   N  +G LP
Sbjct: 263 LNLVSAELIGSIPPELGNCKSLKSLMLSFNSLSGPLPLELSEIPLLTFSAERNQLSGSLP 322

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
             I +   L+ L +++N+  GE+         L  L  + N L+G+IP+      +++ +
Sbjct: 323 SWIGKWKVLDSLLLANNRFSGEIPREIEDCPMLKHLSLASNLLSGSIPRELCGSGSLEAI 382

Query: 688 YLQNNVFTGTID------------VLAN-------------LPLDNLNVENNHFTGWIPP 792
            L  N+ +GTI+            +L N             LPL  L++++N+FTG IP 
Sbjct: 383 DLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLPLMALDLDSNNFTGEIPK 442

Query: 793 QLQGINSLQTGGNSWN 840
            L    +L     S+N
Sbjct: 443 SLWKSTNLMEFTASYN 458



 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 41/161 (25%), Positives = 78/161 (48%), Gaps = 4/161 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           QL+GS+   + + K + +  ++ N     +P ++   P ++ L+LA N  +G +P  +  
Sbjct: 316 QLSGSLPSWIGKWKVLDSLLLANNRFSGEIPREIEDCPMLKHLSLASNLLSGSIPRELCG 375

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              LE +++S N L G +  +F   ++L  L  + N + G+IP+    L  M  + L +N
Sbjct: 376 SGSLEAIDLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLPLMA-LDLDSN 434

Query: 703 VFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            FTG I   +  +  L       N   G++P ++    SL+
Sbjct: 435 NFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLK 475



 Score = 36.2 bits (82), Expect = 0.80
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 2/120 (1%)
 Frame = +1

Query: 223  SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTT 402
            +SL +  +LT    +  +  GE    +S    ++  + I   + TG +  +L  L  +  
Sbjct: 694  ASLGNLKELTHMDLSFNNLSGELSSELSTM-EKLVGLYIEQNKFTGEIPSELGNLTQLEY 752

Query: 403  FDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
             D+S N L   +P ++   PN++ LNLA N   G +P       P + L   + +L G V
Sbjct: 753  LDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRGEVPSDGVCQDPSKALLSGNKELCGRV 812



 Score = 33.5 bits (75), Expect = 5.2
 Identities = 29/111 (26%), Positives = 45/111 (40%)
 Frame = +1

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
           S+   + L   NVS +    +   +   L  +++L     SL G IP+  SSL N++ + 
Sbjct: 36  SLENPSLLSSWNVSSSASHCDWVGVTCLLGRVNSLSLPSLSLRGQIPKEISSLKNLRELC 95

Query: 691 LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           L  N F+G                       IPP++  +  LQT   S NS
Sbjct: 96  LAGNQFSGK----------------------IPPEIWNLKHLQTLDLSGNS 124



>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
           precursor (EC 2.7.1.37) (Extra sporogenous cells
           protein) (EXCESS MICROSPOROCYTES1
           protein).>pir|T48499|T48499 receptor-like protein
           kinase-like protein - Arabidopsis
           thaliana>gb:ATH488154_1552685 Arabidopsis thaliana mRNA
           for receptor-like protein kinase-like protein (ems1
           gene).>gb:ATT28J14_1555609 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 1192

 Score =  104 bits (260), Expect = 2e-21
 Identities = 72/247 (29%), Positives = 122/247 (49%), Gaps = 6/247 (2%)
 Frame = +1

Query: 118 LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT-ANGGDPCGESW 294
           + +  AL +    +   SA+ D      S++     SL +P  L+ W  ++    C   W
Sbjct: 1   MAFLTALFLFLFFSFSSSAIVDLSSETTSLI-SFKRSLENPSLLSSWNVSSSASHC--DW 57

Query: 295 KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQK 468
            GV+C   RV  + +  L L G +  ++  LK++    ++ N     +P ++    ++Q 
Sbjct: 58  VGVTCLLGRVNSLSLPSLSLRGQIPKEISSLKNLRELCLAGNQFSGKIPPEIWNLKHLQT 117

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV-MFVSLTNLSTLDFSFNSLAGN 645
           L+L+GN  TG LP  +S++  L YL++S N   G +    F+SL  LS+LD S NSL+G 
Sbjct: 118 LDLSGNSLTGLLPRLLSELPQLLYLDLSDNHFSGSLPPSFFISLPALSSLDVSNNSLSGE 177

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           IP     L+N+ N+Y+  N F+G I   + N+  L N    +  F G +P ++  +  L 
Sbjct: 178 IPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNISLLKNFAAPSCFFNGPLPKEISKLKHLA 237

Query: 820 TGGNSWN 840
               S+N
Sbjct: 238 KLDLSYN 244



 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 57/170 (33%), Positives = 95/170 (55%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGFT 495
            + EI +S   L+G +   L +L ++T  D+S N L  S+P ++  ++  Q LNLA N   
Sbjct: 606  LVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALTGSIPKEMGNSLKLQGLNLANNQLN 665

Query: 496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
            G +P S   +  L  LN++ N+L G V     +L  L+ +D SFN+L+G +    S++  
Sbjct: 666  GHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEK 725

Query: 676  MKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +  +Y++ N FTG I   L NL  L+ L+V  N  +G IP ++ G+ +L+
Sbjct: 726  LVGLYIEQNKFTGEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLPNLE 775



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 52/184 (28%), Positives = 89/184 (48%), Gaps = 5/184 (2%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLNL 477
           C    +  I +SG  L+G++    D   S+    ++ N +  S+P   ++LP  +  L+L
Sbjct: 374 CGSGSLEAIDLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLP--LMALDL 431

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N FTG +P S+ +   L     S+N+L+G +     +  +L  L  S N L G IP+ 
Sbjct: 432 DSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPRE 491

Query: 658 FSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
              LT++  + L  N+F G I V       L  L++ +N+  G IP ++  +  LQ    
Sbjct: 492 IGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVL 551

Query: 832 SWNS 843
           S+N+
Sbjct: 552 SYNN 555



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 51/190 (26%), Positives = 88/190 (46%), Gaps = 16/190 (8%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-------YQLP-PNVQKL-- 471
            +T + +    L G +  ++  L  +    +S NNL  S+P       +Q+  P++  L  
Sbjct: 522  LTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGSIPSKPSAYFHQIEMPDLSFLQH 581

Query: 472  ----NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
                +L+ N  +G +P  + +   L  +++S+N L GE+      LTNL+ LD S N+L 
Sbjct: 582  HGIFDLSYNRLSGPIPEELGECLVLVEISLSNNHLSGEIPASLSRLTNLTILDLSGNALT 641

Query: 640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINS 813
            G+IP+   +   ++ + L NN   G I     L   L  LN+  N   G +P  L  +  
Sbjct: 642  GSIPKEMGNSLKLQGLNLANNQLNGHIPESFGLLGSLVKLNLTKNKLDGPVPASLGNLKE 701

Query: 814  LQTGGNSWNS 843
            L     S+N+
Sbjct: 702  LTHMDLSFNN 711



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
            + ++ ++  +L G +   L  LK +T  D+S NNL   L  +L     +  L +  N FT
Sbjct: 678  LVKLNLTKNKLDGPVPASLGNLKELTHMDLSFNNLSGELSSELSTMEKLVGLYIEQNKFT 737

Query: 496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
            G +P  +  +  LEYL+VS N L GE+      L NL  L+ + N+L G +P
Sbjct: 738  GEIPSELGNLTQLEYLDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRGEVP 789



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 38/132 (28%), Positives = 68/132 (51%), Gaps = 2/132 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + +     TG +   L +  ++  F  S N L   LP ++    ++++L L+ N  TG +
Sbjct: 429 LDLDSNNFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEI 488

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  I ++  L  LN++ N  QG++ V     T+L+TLD   N+L G IP   ++L  ++ 
Sbjct: 489 PREIGKLTSLSVLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQC 548

Query: 685 MYLQNNVFTGTI 720
           + L  N  +G+I
Sbjct: 549 LVLSYNNLSGSI 560



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 50/194 (25%), Positives = 86/194 (44%), Gaps = 19/194 (9%)
 Frame = +1

Query: 292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQ 465
            WK  +     + E   S  +L G +  ++    S+    +S N L   +P ++    ++ 
Sbjct: 445  WKSTN-----LMEFTASYNRLEGYLPAEIGNAASLKRLVLSDNQLTGEIPREIGKLTSLS 499

Query: 466  KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
             LNL  N F G +P  +     L  L++  N LQG++     +L  L  L  S+N+L+G+
Sbjct: 500  VLNLNANMFQGKIPVELGDCTSLTTLDLGSNNLQGQIPDKITALAQLQCLVLSYNNLSGS 559

Query: 646  IPQTFSSLTNMKNM----YLQNNVFTGTIDVLAN-------------LPLDNLNVENNHF 774
            IP   S+  +   M    +LQ++   G  D+  N             L L  +++ NNH 
Sbjct: 560  IPSKPSAYFHQIEMPDLSFLQHH---GIFDLSYNRLSGPIPEELGECLVLVEISLSNNHL 616

Query: 775  TGWIPPQLQGINSL 816
            +G IP  L  + +L
Sbjct: 617  SGEIPASLSRLTNL 630



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 40/159 (25%), Positives = 78/159 (49%), Gaps = 3/159 (1%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG--FT 495
           ++ + +S   L+G +  ++ +L +++   +  N+    +P ++       N A     F 
Sbjct: 164 LSSLDVSNNSLSGEIPPEIGKLSNLSNLYMGLNSFSGQIPSEIGNISLLKNFAAPSCFFN 223

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G LP  IS++  L  L++S+N L+  +   F  L NLS L+     L G IP    +  +
Sbjct: 224 GPLPKEISKLKHLAKLDLSYNPLKCSIPKSFGELHNLSILNLVSAELIGLIPPELGNCKS 283

Query: 676 MKNMYLQNNVFTGTIDV-LANLPLDNLNVENNHFTGWIP 789
           +K++ L  N  +G + + L+ +PL   + E N  +G +P
Sbjct: 284 LKSLMLSFNSLSGPLPLELSEIPLLTFSAERNQLSGSLP 322



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 41/161 (25%), Positives = 79/161 (49%), Gaps = 4/161 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           QL+GS+   + + K + +  ++ N     +P+++   P ++ L+LA N  +G +P  +  
Sbjct: 316 QLSGSLPSWMGKWKVLDSLLLANNRFSGEIPHEIEDCPMLKHLSLASNLLSGSIPRELCG 375

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              LE +++S N L G +  +F   ++L  L  + N + G+IP+    L  M  + L +N
Sbjct: 376 SGSLEAIDLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLPLMA-LDLDSN 434

Query: 703 VFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            FTG I   +  +  L       N   G++P ++    SL+
Sbjct: 435 NFTGEIPKSLWKSTNLMEFTASYNRLEGYLPAEIGNAASLK 475



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 48/196 (24%), Positives = 88/196 (44%), Gaps = 26/196 (13%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-NVQKLNLAGNGFTGGLP 507
           + +   +L G +  +L   KS+ +  +S N+L   LP +L    +   +   N  +G LP
Sbjct: 263 LNLVSAELIGLIPPELGNCKSLKSLMLSFNSLSGPLPLELSEIPLLTFSAERNQLSGSLP 322

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
             + +   L+ L +++N+  GE+         L  L  + N L+G+IP+      +++ +
Sbjct: 323 SWMGKWKVLDSLLLANNRFSGEIPHEIEDCPMLKHLSLASNLLSGSIPRELCGSGSLEAI 382

Query: 688 YLQNNVFTGTID------------VLAN-------------LPLDNLNVENNHFTGWIPP 792
            L  N+ +GTI+            +L N             LPL  L++++N+FTG IP 
Sbjct: 383 DLSGNLLSGTIEEVFDGCSSLGELLLTNNQINGSIPEDLWKLPLMALDLDSNNFTGEIPK 442

Query: 793 QLQGINSLQTGGNSWN 840
            L    +L     S+N
Sbjct: 443 SLWKSTNLMEFTASYN 458



 Score = 36.2 bits (82), Expect = 0.80
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 2/120 (1%)
 Frame = +1

Query: 223  SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTT 402
            +SL +  +LT    +  +  GE    +S    ++  + I   + TG +  +L  L  +  
Sbjct: 694  ASLGNLKELTHMDLSFNNLSGELSSELSTM-EKLVGLYIEQNKFTGEIPSELGNLTQLEY 752

Query: 403  FDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
             D+S N L   +P ++   PN++ LNLA N   G +P       P + L   + +L G V
Sbjct: 753  LDVSENLLSGEIPTKICGLPNLEFLNLAKNNLRGEVPSDGVCQDPSKALLSGNKELCGRV 812



 Score = 33.5 bits (75), Expect = 5.2
 Identities = 29/111 (26%), Positives = 45/111 (40%)
 Frame = +1

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
           S+   + L   NVS +    +   +   L  +++L     SL G IP+  SSL N++ + 
Sbjct: 36  SLENPSLLSSWNVSSSASHCDWVGVTCLLGRVNSLSLPSLSLRGQIPKEISSLKNLRELC 95

Query: 691 LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           L  N F+G                       IPP++  +  LQT   S NS
Sbjct: 96  LAGNQFSGK----------------------IPPEIWNLKHLQTLDLSGNS 124



>gb:AP005966_1860357 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863465 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 1128

 Score =  103 bits (258), Expect = 3e-21
 Identities = 70/224 (31%), Positives = 113/224 (50%), Gaps = 8/224 (3%)
 Frame = +1

Query: 172 AVADTDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCS---GNRVTEIQI 339
           A+ +    D   L    S L+ P + L+ W+    + C  SW GV+CS    +RV  I +
Sbjct: 27  AICNETEYDRQALLCFKSQLSGPSRALSSWSNTSLNFC--SWDGVTCSVRRPHRVIAIDL 84

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYS 513
           +   +TG++   +  L S+TT  +S N+   S+P +L     +  LNL+ N   G +P  
Sbjct: 85  ASEGITGTISRCIANLTSLTTLQLSNNSFHGSIPSRLGLLSELNNLNLSMNSLEGNIPSE 144

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           +S  + LE L + +N +QGE+        +L  ++ S N L G+IP TF +L  +K + L
Sbjct: 145 LSSCSQLEILGLWNNSIQGEIPASLSKCIHLQEINLSRNKLQGSIPSTFGNLPKLKTLVL 204

Query: 694 QNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
             N  TG I     +++ L  +++ NN  TG IP  L   +SLQ
Sbjct: 205 ARNRLTGDIPPFLGSSVSLRYVDLGNNALTGSIPESLANSSSLQ 248



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 49/168 (29%), Positives = 84/168 (50%), Gaps = 5/168 (2%)
 Frame = +1

Query: 355  TGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQMA 528
            TG++   +  + S+     + N L   +P  +     +  L L GN F+G +P SISQ  
Sbjct: 526  TGNIPPTIGNMNSLVVLSFAQNKLSGHIPDIFGNLSQLTDLKLDGNNFSGKIPASISQCT 585

Query: 529  PLEYLNVSHNQLQGEVTVMFVSLTNLST-LDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+ LN++HN L G +      +++LS  +D S N L+G IP    +L ++  + + NN+
Sbjct: 586  QLQILNIAHNSLDGNIPSKIFEISSLSEEMDLSHNYLSGEIPNEVGNLIHLNRLVISNNM 645

Query: 706  FTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
             +G I       + L+ L ++NN F G IP     + S++    S N+
Sbjct: 646  LSGKIPSSLGQCVVLEYLEIQNNFFVGSIPQSFVNLVSIKRMDISQNN 693



 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 59/208 (28%), Positives = 102/208 (49%), Gaps = 7/208 (3%)
 Frame = +1

Query: 214 GLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGL---QLTGSMGFQLDQ 384
           GL S LN+   L+  +  G  P   S    SCS     +++I GL    + G +   L +
Sbjct: 122 GLLSELNNL-NLSMNSLEGNIPSELS----SCS-----QLEILGLWNNSIQGEIPASLSK 171

Query: 385 LKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
              +   ++S N L  S+P      P ++ L LA N  TG +P  +     L Y+++ +N
Sbjct: 172 CIHLQEINLSRNKLQGSIPSTFGNLPKLKTLVLARNRLTGDIPPFLGSSVSLRYVDLGNN 231

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLA-- 732
            L G +     + ++L  L    NSL+G +P++  + +++  + LQ N F G+I  +   
Sbjct: 232 ALTGSIPESLANSSSLQVLRLMSNSLSGQLPKSLLNTSSLIAICLQQNSFVGSIPAVTAK 291

Query: 733 NLPLDNLNVENNHFTGWIPPQLQGINSL 816
           + P+  LN+ NN+ +G IP  L  ++SL
Sbjct: 292 SSPIKYLNLRNNYISGAIPSSLANLSSL 319



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 52/194 (26%), Positives = 103/194 (53%), Gaps = 12/194 (6%)
 Frame = +1

Query: 244  QLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGL---QLTGSMGFQLDQLKSVTT-FDI 411
            QLT    +G +  G+    +  S ++ T++QI  +    L G++  ++ ++ S++   D+
Sbjct: 562  QLTDLKLDGNNFSGK----IPASISQCTQLQILNIAHNSLDGNIPSKIFEISSLSEEMDL 617

Query: 412  STNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM 585
            S N L   +P ++    ++ +L ++ N  +G +P S+ Q   LEYL + +N   G +   
Sbjct: 618  SHNYLSGEIPNEVGNLIHLNRLVISNNMLSGKIPSSLGQCVVLEYLEIQNNFFVGSIPQS 677

Query: 586  FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI------DVLANLPLD 747
            FV+L ++  +D S N+L+GNIP+  +SL+++ ++ L  N F G +      D+ A + L+
Sbjct: 678  FVNLVSIKRMDISQNNLSGNIPEFLTSLSSLHSLNLSYNNFDGVVPRGGVFDINAAVSLE 737

Query: 748  NLNVENNHFTGWIP 789
                 N+H    +P
Sbjct: 738  G----NDHLCTRVP 747



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 48/160 (30%), Positives = 76/160 (47%), Gaps = 7/160 (4%)
 Frame = +1

Query: 358 GSMGFQ--LDQLKSVTTFDISTNNLGNSLPYQ---LPPNVQKLNLAGNGFTGGLPYSISQ 522
           G  GF   L     +T   +  NNL  +LP     L  N++ L L  N F G +P  I  
Sbjct: 452 GDWGFMTSLSNCSRLTKLMLDGNNLQGNLPSSIGNLSSNLEALWLKNNKFFGPIPSEIGN 511

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L  L + +N   G +     ++ +L  L F+ N L+G+IP  F +L+ + ++ L  N
Sbjct: 512 LKSLNRLFMDYNVFTGNIPPTIGNMNSLVVLSFAQNKLSGHIPDIFGNLSQLTDLKLDGN 571

Query: 703 VFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            F+G I   +     L  LN+ +N   G IP ++  I+SL
Sbjct: 572 NFSGKIPASISQCTQLQILNIAHNSLDGNIPSKIFEISSL 611



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 44/170 (25%), Positives = 84/170 (49%), Gaps = 11/170 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + +    LTGS+   L    S+    + +N+L   LP  L    ++  + L  N F G +
Sbjct: 226 VDLGNNALTGSIPESLANSSSLQVLRLMSNSLSGQLPKSLLNTSSLIAICLQQNSFVGSI 285

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P   ++ +P++YLN+ +N + G +     +L++L +L  + N+L GNIP++   +  ++ 
Sbjct: 286 PAVTAKSSPIKYLNLRNNYISGAIPSSLANLSSLLSLRLNENNLVGNIPESLGHIQTLEM 345

Query: 685 MYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIP-------PQLQGI 807
           + L  N  +G +   +     L  L + NN  TG +P       P++QG+
Sbjct: 346 LALNVNNLSGLVPPSIFNMSSLIFLAMANNSLTGRLPSDIGYTLPKIQGL 395



 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 43/160 (26%), Positives = 81/160 (50%), Gaps = 4/160 (2%)
 Frame = +1

Query: 301 VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLN 474
           V+   + +  + +    ++G++   L  L S+ +  ++ NNL  ++P  L     ++ L 
Sbjct: 288 VTAKSSPIKYLNLRNNYISGAIPSSLANLSSLLSLRLNENNLVGNIPESLGHIQTLEMLA 347

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIP 651
           L  N  +G +P SI  M+ L +L +++N L G + + +  +L  +  L  S N   G IP
Sbjct: 348 LNVNNLSGLVPPSIFNMSSLIFLAMANNSLTGRLPSDIGYTLPKIQGLILSTNKFVGPIP 407

Query: 652 QTFSSLTNMKNMYLQNNVFTGTIDVLANLP-LDNLNVENN 768
            +  +  +++ +YL  N FTG I    +LP L+ L+V  N
Sbjct: 408 ASLLNAYHLEMLYLGKNSFTGLIPFFGSLPNLNELDVSYN 447



>gb:AP003705_1832164 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1112_E08.>gb:AP003932_1835435 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1773_H01.
          Length = 750

 Score =  103 bits (257), Expect = 4e-21
 Identities = 66/240 (27%), Positives = 114/240 (47%), Gaps = 4/240 (1%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           + A+ +  L  A P + + T   D   + GL+++L SP  +  W  NGGDPC E W+GV 
Sbjct: 12  SAAVFLLLLSAALPLSQSYTYEQDVFAINGLYTALGSP-SVPGWITNGGDPCNEGWQGVE 70

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN 486
           C  + +T I ++   L G +G  L    S+ TF +S                      GN
Sbjct: 71  CVVSNITSITLNAANLGGQLGNTLGNFTSLITFFLS----------------------GN 108

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +G +P ++S +  L  L++++N L GE+   F +LT L+ LDFS N+L G +P +  +
Sbjct: 109 QLSGSIPSTLSTLTLLTGLSLNNNHLSGEIPDAFSTLTGLANLDFSSNNLTGPLPPSMGN 168

Query: 667 LTNMKNMY----LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS 834
           LT + ++        ++    +   A  PL +++    H    +P +    +S+   GN+
Sbjct: 169 LTALTSLKDGNPFNTSIAPSALPPAAPTPLPSVSPPAGH----VPTKEPSNSSIAPAGNA 224



>gb:AY102147_1577752 Arabidopsis thaliana At1g68400/T2E12_5 mRNA,
           complete cds.>gb:AF378890_1793475 Arabidopsis thaliana
           At1g68400/T2E12_5 mRNA, complete cds.
          Length = 671

 Score =  101 bits (252), Expect = 2e-20
 Identities = 66/221 (29%), Positives = 102/221 (46%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           LL+  L+      ++ +  TD+  L     + +S  +L  W     +PC   W GVSC+ 
Sbjct: 11  LLLSLLILLQSCLLSSSSSTDSETLLNFKLTADSTGKLNSWNTTT-NPC--QWTGVSCNR 67

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT 495
           NRVT + +  + LTGS+   L  L S+    +  NNL   +P                  
Sbjct: 68  NRVTRLVLEDINLTGSIS-SLTSLTSLRVLSLKHNNLSGPIP------------------ 108

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
                ++S +  L+ L +S+NQ  G       SLT L  LD SFN+ +G IP   + LT+
Sbjct: 109 -----NLSNLTALKLLFLSNNQFSGNFPTSITSLTRLYRLDLSFNNFSGQIPPDLTDLTH 163

Query: 676 MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL 798
           +  + L++N F+G I  +    L + NV  N+F G IP  L
Sbjct: 164 LLTLRLESNRFSGQIPNINLSDLQDFNVSGNNFNGQIPNSL 204



 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +1

Query: 562 LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLAN 735
           L G ++ +  SLT+L  L    N+L+G IP   S+LT +K ++L NN F+G     + + 
Sbjct: 80  LTGSISSL-TSLTSLRVLSLKHNNLSGPIPN-LSNLTALKLLFLSNNQFSGNFPTSITSL 137

Query: 736 LPLDNLNVENNHFTGWIPPQLQGINSLQT 822
             L  L++  N+F+G IPP L  +  L T
Sbjct: 138 TRLYRLDLSFNNFSGQIPPDLTDLTHLLT 166



>gb:AB025613_1516374 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2I5.
          Length = 1006

 Score =  101 bits (252), Expect = 2e-20
 Identities = 87/288 (30%), Positives = 133/288 (46%), Gaps = 41/288 (14%)
 Frame = +1

Query: 79  SERASLKMRELMGLPWA----VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ 246
           SE    K R  +GL  +    V +L+  L     S  A T+  DA  L+ L SSL  PP+
Sbjct: 62  SEAGKEKKRFFVGLKMSSRIEVFVLLILLSFQFCSVSAQTNGFDADALQYLKSSLTIPPR 121

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTN-N 423
             K    G DPCG +W G++C   RV  I +  L L G +   +  L  + T D+++N N
Sbjct: 122 NWK----GYDPCGTNWVGIACEYGRVVNISLGNLNLEGKLPAFITTLSELHTLDLTSNPN 177

Query: 424 LGNSLPY--------------------QLPPNVQK------LNLAGNGFTGGLPYSISQM 525
           L   LP                     Q+P ++        L+L  N F G +P SI  +
Sbjct: 178 LTGPLPLNIGNLKELTNLNLMGCGFSGQIPESIGSLEQLVTLSLNSNKFNGTIPASIGLL 237

Query: 526 APLEYLNVSHNQLQGEVTVM-FVSLTNLSTL------DFSFNSLAGNIPQ-TFSSLTNMK 681
           + L + +++ NQ++G++ V    SL  L  L       F  N L+G+IP+  FS+   +K
Sbjct: 238 SKLYWFDIADNQIEGKLPVSDGASLPGLDMLLQTKHFHFGKNKLSGDIPEKLFSANMTLK 297

Query: 682 NMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           ++    N+ TG I    +L   L  L ++ N  +G IPP L  + +LQ
Sbjct: 298 HLLFDGNLLTGEIPQSLSLVKTLTVLRLDRNRLSGEIPPSLNNLTNLQ 345



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 46/179 (25%), Positives = 83/179 (46%), Gaps = 11/179 (6%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL------- 477
           ++  + ++  +  G++   +  L  +  FDI+ N +   LP     ++  L++       
Sbjct: 215 QLVTLSLNSNKFNGTIPASIGLLSKLYWFDIADNQIEGKLPVSDGASLPGLDMLLQTKHF 274

Query: 478 --AGNGFTGGLPYSI-SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
               N  +G +P  + S    L++L    N L GE+      +  L+ L    N L+G I
Sbjct: 275 HFGKNKLSGDIPEKLFSANMTLKHLLFDGNLLTGEIPQSLSLVKTLTVLRLDRNRLSGEI 334

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTIDVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQT 822
           P + ++LTN++ +YL +N FTG++  L +L  L  L +      G IP  L  +  LQT
Sbjct: 335 PPSLNNLTNLQELYLSDNKFTGSLPSLTSLTSLSTLRMAGLQLQGPIPTSLFSLPELQT 393



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 44/152 (28%), Positives = 66/152 (43%), Gaps = 4/152 (2%)
 Frame = +1

Query: 343 GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSI 516
           G  LTG +   L  +K++T   +  N L   +P  L    N+Q+L L+ N FTG LP   
Sbjct: 303 GNLLTGEIPQSLSLVKTLTVLRLDRNRLSGEIPPSLNNLTNLQELYLSDNKFTGSLP--- 359

Query: 517 SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ 696
                                    SLT+LSTL  +   L G IP +  SL  ++ + L+
Sbjct: 360 ----------------------SLTSLTSLSTLRMAGLQLQGPIPTSLFSLPELQTVILK 397

Query: 697 NNVFTGTIDVLANLP--LDNLNVENNHFTGWI 786
            N    T+D   N    LD ++++ N  T +I
Sbjct: 398 RNWLNETLDFGTNKSQNLDFVDLQYNDITEYI 429



>pir|T01057|T01057 hypothetical protein YUP8H12R.40 - Arabidopsis
           thaliana>gb:AE005173_895419 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:YUP8H12R_1731333 Arabidopsis thaliana
           chromosome 1 YAC YUP8H12R sequence, complete sequence.
          Length = 150

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/146 (39%), Positives = 80/146 (54%)
 Frame = +1

Query: 178 ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           A TD  + S L  +F+SLNSP +L  W ANGGDPC +SW+GV C G+ VTE+Q+SG +L 
Sbjct: 22  AKTDNQEVSALNVMFTSLNSPSKLKGWKANGGDPCEDSWEGVKCKGSSVTELQLSGFELG 81

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE 537
           GS G+ L  LKS+TTF + +    +   Y +  +              LP     +    
Sbjct: 82  GSRGYLLSNLKSLTTFTVISAKTISKETYLINSHPT------------LP-----ICKFI 124

Query: 538 YLNVSHNQLQGEVTVMFVSLTNLSTL 615
           + N+  N+L GE+  MF  L+ L TL
Sbjct: 125 HFNLGQNKLNGELPDMFQKLSKLETL 150



>pir|H96707|H96707 probable receptor kinase T2E12.5 [imported] -
           Arabidopsis thaliana>gb:AE005173_894461 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC015986_1538060 Arabidopsis thaliana
           chromosome 1 BAC T2E12 genomic sequence, complete
           sequence.
          Length = 670

 Score =  101 bits (252), Expect = 2e-20
 Identities = 66/221 (29%), Positives = 102/221 (46%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           LL+  L+      ++ +  TD+  L     + +S  +L  W     +PC   W GVSC+ 
Sbjct: 11  LLLSLLILLQSCLLSSSSSTDSETLLNFKLTADSTGKLNSWNTTT-NPC--QWTGVSCNR 67

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT 495
           NRVT + +  + LTGS+   L  L S+    +  NNL   +P                  
Sbjct: 68  NRVTRLVLEDINLTGSIS-SLTSLTSLRVLSLKHNNLSGPIP------------------ 108

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
                ++S +  L+ L +S+NQ  G       SLT L  LD SFN+ +G IP   + LT+
Sbjct: 109 -----NLSNLTALKLLFLSNNQFSGNFPTSITSLTRLYRLDLSFNNFSGQIPPDLTDLTH 163

Query: 676 MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL 798
           +  + L++N F+G I  +    L + NV  N+F G IP  L
Sbjct: 164 LLTLRLESNRFSGQIPNINLSDLQDFNVSGNNFNGQIPNSL 204



 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = +1

Query: 562 LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLAN 735
           L G ++ +  SLT+L  L    N+L+G IP   S+LT +K ++L NN F+G     + + 
Sbjct: 80  LTGSISSL-TSLTSLRVLSLKHNNLSGPIPN-LSNLTALKLLFLSNNQFSGNFPTSITSL 137

Query: 736 LPLDNLNVENNHFTGWIPPQLQGINSLQT 822
             L  L++  N+F+G IPP L  +  L T
Sbjct: 138 TRLYRLDLSFNNFSGQIPPDLTDLTHLLT 166



>gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMI9.
          Length = 938

 Score =  100 bits (250), Expect = 3e-20
 Identities = 58/159 (36%), Positives = 90/159 (56%), Gaps = 4/159 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           E+ + G  L+GS+      L S+T  ++S+NN    +P +L    N+ KL+L+GN F+G 
Sbjct: 362 ELNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGS 421

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P ++  +  L  LN+S N L G++   F +L ++  +D SFN L+G IP     L N+ 
Sbjct: 422 IPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTELGQLQNLN 481

Query: 682 NMYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPP 792
           ++ L NN   G I D L N   L NLNV  N+ +G +PP
Sbjct: 482 SLILNNNKLHGKIPDQLTNCFTLVNLNVSFNNLSGIVPP 520



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 70/253 (27%), Positives = 107/253 (42%), Gaps = 8/253 (3%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT-ANGGD 276
           M+E M        ++GF++    SA+ + +      ++G FS+L +   L  W   +  D
Sbjct: 1   MKEKMQRMVLSLAMVGFMVFGVASAM-NNEGKALMAIKGSFSNLVN--MLLDWDDVHNSD 57

Query: 277 PCGESWKGVSCSG--NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL 450
            C  SW+GV C      V  + +S L L G +   +  L+                    
Sbjct: 58  LC--SWRGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLR-------------------- 95

Query: 451 PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
             N+Q ++L GN   G +P  I   A L YL++S N L G++      L  L TL+   N
Sbjct: 96  --NLQSIDLQGNKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNN 153

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLA--NLPLDNLNVENNHFTGWIPP---Q 795
            L G +P T + + N+K + L  N  TG I  L   N  L  L +  N  TG +     Q
Sbjct: 154 QLTGPVPATLTQIPNLKRLDLAGNHLTGEISRLLYWNEVLQYLGLRGNMLTGTLSSDMCQ 213

Query: 796 LQGINSLQTGGNS 834
           L G+      GN+
Sbjct: 214 LTGLWYFDVRGNN 226



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/170 (30%), Positives = 85/170 (50%), Gaps = 4/170 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +V  + + G +LTG +   +  ++++   D+S N L   +P  L       KL L GN  
Sbjct: 263 QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNML 322

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  +  M+ L YL ++ N+L G +      L  L  L+   N L+G+IP  F +L 
Sbjct: 323 TGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNVHGNLLSGSIPLAFRNLG 382

Query: 673 NMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL 816
           ++  + L +N F G I V     + LD L++  N+F+G IP  L  +  L
Sbjct: 383 SLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHL 432



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 47/156 (30%), Positives = 79/156 (50%), Gaps = 3/156 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S   L G + F + +LK + T ++  N L   +P  L   PN+++L+LAGN  TG +
Sbjct: 124 LDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI 183

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
              +     L+YL +  N L G ++     LT L   D   N+L G IP++  + T+ + 
Sbjct: 184 SRLLYWNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQI 243

Query: 685 MYLQNNVFTGTIDV-LANLPLDNLNVENNHFTGWIP 789
           + +  N  TG I   +  L +  L+++ N  TG IP
Sbjct: 244 LDISYNQITGEIPYNIGFLQVATLSLQGNRLTGRIP 279



>gb:AE005173_895101 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC006434_1534219 Genomic sequence
           for Arabidopsis thaliana BAC F10A5, complete sequence.
          Length = 1140

 Score =  100 bits (250), Expect = 3e-20
 Identities = 76/247 (30%), Positives = 115/247 (46%), Gaps = 30/247 (12%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSP-PQLTKWTANGGD-PCGESWKGVSCSGNRVTEIQISGLQLTGSM 366
           ++   L     SL+ P   L  W  +    PC   W GVSC   RV E+++  L LTG +
Sbjct: 27  SETQALTSFKLSLHDPLGALESWNQSSPSAPC--DWHGVSCFSGRVRELRLPRLHLTGHL 84

Query: 367 GFQLDQLKSVTTFDISTNNLGNSLPYQL--------------------PP------NVQK 468
             +L +L  +    + TN++  ++P  L                    PP      N+Q 
Sbjct: 85  SPRLGELTQLRKLSLHTNDINGAVPSSLSRCVFLRALYLHYNSFSGDFPPEILNLRNLQV 144

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           LN A N  TG L   ++    L Y+++S N + G++   F + ++L  ++ SFN  +G I
Sbjct: 145 LNAAHNSLTGNLS-DVTVSKSLRYVDLSSNAISGKIPANFSADSSLQLINLSFNHFSGEI 203

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQT 822
           P T   L +++ ++L +N   GTI   LAN   L + +V  NH TG IP  L  I SLQ 
Sbjct: 204 PATLGQLQDLEYLWLDSNQLQGTIPSALANCSSLIHFSVTGNHLTGLIPVTLGTIRSLQV 263

Query: 823 GGNSWNS 843
              S NS
Sbjct: 264 ISLSENS 270



 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 51/168 (30%), Positives = 93/168 (55%), Gaps = 7/168 (4%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
           LTG++  ++ +L ++T  ++S N     +P  +    ++  LN++G G TG +P SIS +
Sbjct: 446 LTGAIPSEITKLANLTILNLSFNRFSGEVPSNVGDLKSLSVLNISGCGLTGRIPVSISGL 505

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+ L++S  ++ G++ V    L +L  +    N L G +P+ FSSL ++K + L +N+
Sbjct: 506 MKLQVLDISKQRISGQLPVELFGLPDLQVVALGNNLLGGVVPEGFSSLVSLKYLNLSSNL 565

Query: 706 FTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT---GGNS 834
           F+G I         L  L++ +N  +G IPP++   +SL+    G NS
Sbjct: 566 FSGHIPKNYGFLKSLQVLSLSHNRISGTIPPEIGNCSSLEVLELGSNS 613



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 47/149 (31%), Positives = 78/149 (52%), Gaps = 4/149 (2%)
 Frame = +1

Query: 406 DISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           DI  N +    P  L    ++  L+++GNGF+GG+   +  +  L+ L V++N L GE+ 
Sbjct: 320 DIHENRINGDFPAWLTDLTSLVVLDISGNGFSGGVTAKVGNLMALQELRVANNSLVGEIP 379

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNL 753
               +  +L  +DF  N  +G IP   S L ++  + L  N F+G I  D+L+   L+ L
Sbjct: 380 TSIRNCKSLRVVDFEGNKFSGQIPGFLSQLRSLTTISLGRNGFSGRIPSDLLSLYGLETL 439

Query: 754 NVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           N+  NH TG IP ++  + +L     S+N
Sbjct: 440 NLNENHLTGAIPSEITKLANLTILNLSFN 468



 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 54/176 (30%), Positives = 86/176 (48%), Gaps = 4/176 (2%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNL 477
           +C   RV + +  G + +G +   L QL+S+TT  +  N     +P  L     ++ LNL
Sbjct: 384 NCKSLRVVDFE--GNKFSGQIPGFLSQLRSLTTISLGRNGFSGRIPSDLLSLYGLETLNL 441

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N  TG +P  I+++A L  LN+S N+  GEV      L +LS L+ S   L G IP +
Sbjct: 442 NENHLTGAIPSEITKLANLTILNLSFNRFSGEVPSNVGDLKSLSVLNISGCGLTGRIPVS 501

Query: 658 FSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
            S L  ++ + +     +G + V L  LP L  + + NN   G +P     + SL+
Sbjct: 502 ISGLMKLQVLDISKQRISGQLPVELFGLPDLQVVALGNNLLGGVVPEGFSSLVSLK 557



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 46/156 (29%), Positives = 81/156 (51%), Gaps = 9/156 (5%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQM 525
           LTG++   +   KS+   D+S+N +   +P  +    ++Q +NL+ N F+G +P ++ Q+
Sbjct: 152 LTGNLS-DVTVSKSLRYVDLSSNAISGKIPANFSADSSLQLINLSFNHFSGEIPATLGQL 210

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             LEYL +  NQLQG +     + ++L     + N L G IP T  ++ +++ + L  N 
Sbjct: 211 QDLEYLWLDSNQLQGTIPSALANCSSLIHFSVTGNHLTGLIPVTLGTIRSLQVISLSENS 270

Query: 706 FTGTIDVLA-------NLPLDNLNVENNHFTGWIPP 792
           FTGT+ V         N  +  + +  N+FTG   P
Sbjct: 271 FTGTVPVSLLCGYSGYNSSMRIIQLGVNNFTGIAKP 306



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 48/157 (30%), Positives = 79/157 (50%), Gaps = 4/157 (2%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            L S+   ++S+N     +P  Y    ++Q L+L+ N  +G +P  I   + LE L +  N
Sbjct: 553  LVSLKYLNLSSNLFSGHIPKNYGFLKSLQVLSLSHNRISGTIPPEIGNCSSLEVLELGSN 612

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLAN 735
             L+G + V    L+ L  LD S NSL G+IP   S  ++++++ L +N  +G I + L+ 
Sbjct: 613  SLKGHIPVYVSKLSLLKKLDLSHNSLTGSIPDQISKDSSLESLLLNSNSLSGRIPESLSR 672

Query: 736  LP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            L  L  L++ +N     IP  L  +  L     S NS
Sbjct: 673  LTNLTALDLSSNRLNSTIPSSLSRLRFLNYFNLSRNS 709



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 36/134 (26%), Positives = 69/134 (51%), Gaps = 2/134 (1%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNL 477
           +CS   V E+  + L+  G +   + +L  +   D+S N+L  S+P Q+  +  ++ L L
Sbjct: 600 NCSSLEVLELGSNSLK--GHIPVYVSKLSLLKKLDLSHNSLTGSIPDQISKDSSLESLLL 657

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N  +G +P S+S++  L  L++S N+L   +      L  L+  + S NSL G IP+ 
Sbjct: 658 NSNSLSGRIPESLSRLTNLTALDLSSNRLNSTIPSSLSRLRFLNYFNLSRNSLEGEIPEA 717

Query: 658 FSSLTNMKNMYLQN 699
            ++      ++++N
Sbjct: 718 LAARFTNPTVFVKN 731



>pir|D84889|D84889 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC002387_1530588 Arabidopsis
           thaliana chromosome 2 clone F4L23 map CIC02E07, complete
           sequence.
          Length = 691

 Score =  100 bits (249), Expect = 3e-20
 Identities = 67/222 (30%), Positives = 116/222 (52%), Gaps = 7/222 (3%)
 Frame = +1

Query: 169 SAVADTDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGE-SWKGVSCSGNR-VTEIQI 339
           S+   +  ++  +L  + SSL+   + LT WT +  DPC   S+ GV+C GNR V  I +
Sbjct: 17  SSALSSSSSELDILLDIKSSLDPEKRFLTSWTPDA-DPCSSGSFDGVACDGNRRVANISL 75

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYS 513
            G+ LTG++   +  L S+T   +  N+L   +P  +   P +  L L  N  +G +P  
Sbjct: 76  QGMGLTGTIPPSIGLLTSLTGLYLHFNSLTGHIPKDISNLPLLTDLYLNVNNLSGEIPPL 135

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           I  +  L+ + + +N+L G +   F SL  ++ L   +N L+G IP +   +  +  + L
Sbjct: 136 IGNLDNLQVIQLCYNKLSGSIPTQFGSLKKITVLALQYNQLSGAIPASLGDIDTLTRLDL 195

Query: 694 QNNVFTGTIDV-LANLPL-DNLNVENNHFTGWIPPQLQGINS 813
             N   G + V LA  PL + L++ NN F+G++P  L+ +N+
Sbjct: 196 SFNNLFGPVPVKLAGAPLLEVLDIRNNSFSGFVPSALKRLNN 237



>gb:AC116926_1739356 Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OJ1341F06,
           from chromosome 10, complete sequence.
          Length = 654

 Score =  100 bits (248), Expect = 5e-20
 Identities = 63/183 (34%), Positives = 94/183 (51%), Gaps = 7/183 (3%)
 Frame = +1

Query: 292 WKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--P 456
           W GV CS     RV  + ++   L G +   +  L  + + D+S N L   +P  +    
Sbjct: 62  WSGVICSHRHKQRVLALNLTSTGLHGYISASIGNLTYLRSLDLSCNQLYGEIPLTIGWLS 121

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
            +  L+L+ N F G +P +I Q+  L YL +S+N LQGE+T    + TNL+++    NSL
Sbjct: 122 KLSYLDLSNNSFQGEIPRTIGQLPQLSYLYLSNNSLQGEITDELRNCTNLASIKLDLNSL 181

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGIN 810
            G IP  F     + ++ +  N+FTG I   L NL  L  L +  NH TG IP  L  I+
Sbjct: 182 NGKIPDWFGGFLKLNSISVGKNIFTGIIPQSLGNLSALSELFLNENHLTGPIPEALGKIS 241

Query: 811 SLQ 819
           SL+
Sbjct: 242 SLE 244



 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 49/185 (26%), Positives = 89/185 (48%), Gaps = 8/185 (4%)
 Frame = +1

Query: 286 ESWKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPP 456
           + W+ ++   N  R+  + I   +L G++   +  L + +   DI  N +   +P  +  
Sbjct: 355 KDWRFITFLTNCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNKISGKIPDGINN 414

Query: 457 NVQ--KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
            ++  KL L+ N F+G +P SI ++  L+YL + +N L G +     +LT L  L    N
Sbjct: 415 FLKLIKLGLSNNRFSGPIPDSIGRLETLQYLTLENNLLSGIIPSSLGNLTQLQQLSLDNN 474

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLPLDN--LNVENNHFTGWIPPQLQ 801
           SL G +P +  +L  +      NN     +   + NLP  +  L++  NHF+G +P  + 
Sbjct: 475 SLEGPLPASIGNLQQLIIATFSNNKLRDQLPGDIFNLPSLSYILDLSRNHFSGSLPSAVG 534

Query: 802 GINSL 816
           G+  L
Sbjct: 535 GLTKL 539



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 4/151 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           QL G + F L  L  +   D+S N+   SLP  +     +  L +  N F+G LP S+S 
Sbjct: 503 QLPGDI-FNLPSLSYI--LDLSRNHFSGSLPSAVGGLTKLTYLYMYSNNFSGLLPNSLSN 559

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              L  L++  N   G + V    +  L  L+ + NSL G IPQ    +  +K +YL +N
Sbjct: 560 CQSLMELHLDDNFFNGTIPVSVSKMRGLVLLNLTKNSLLGAIPQDLRLMDGLKELYLSHN 619

Query: 703 VFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
             +  I + + N+  L  L++  N+  G +P
Sbjct: 620 NLSAQIPENMENMTSLYWLDISFNNLDGQVP 650



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 37/205 (18%)
 Frame = +1

Query: 313 GNRVTEIQISGLQL---TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---------- 453
           GN + +IQ   + L   TGS+   +    ++ + D+S+NN    +P ++           
Sbjct: 286 GNGLPKIQYFIVALNHFTGSIPPSIANATNMRSIDLSSNNFTGIIPPEIGMLCLKYLMLQ 345

Query: 454 ---------------------PNVQKLNLAGNGFTGGLPYSISQM-APLEYLNVSHNQLQ 567
                                  ++ + +  N   G LP SI+ + A LE L++  N++ 
Sbjct: 346 RNQLKATSVKDWRFITFLTNCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNKIS 405

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-P 741
           G++     +   L  L  S N  +G IP +   L  ++ + L+NN+ +G I   L NL  
Sbjct: 406 GKIPDGINNFLKLIKLGLSNNRFSGPIPDSIGRLETLQYLTLENNLLSGIIPSSLGNLTQ 465

Query: 742 LDNLNVENNHFTGWIPPQLQGINSL 816
           L  L+++NN   G +P  +  +  L
Sbjct: 466 LQQLSLDNNSLEGPLPASIGNLQQL 490



 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 42/156 (26%), Positives = 76/156 (48%), Gaps = 11/156 (7%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L  +  F ++ N+   S+P  +    N++ ++L+ N FTG +P  I  +  L+YL +  N
Sbjct: 289 LPKIQYFIVALNHFTGSIPPSIANATNMRSIDLSSNNFTGIIPPEIGMLC-LKYLMLQRN 347

Query: 559 QLQG------EVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT-NMKNMYLQNNVFTGT 717
           QL+              + T L  +    N L G +P + ++L+  ++ + +  N  +G 
Sbjct: 348 QLKATSVKDWRFITFLTNCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNKISGK 407

Query: 718 I-DVLAN-LPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           I D + N L L  L + NN F+G IP  +  + +LQ
Sbjct: 408 IPDGINNFLKLIKLGLSNNRFSGPIPDSIGRLETLQ 443



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 32/137 (23%), Positives = 70/137 (51%), Gaps = 3/137 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++  I +     TG +   L  L +++   ++ N+L   +P  L    ++++L L  N  
Sbjct: 194 KLNSISVGKNIFTGIIPQSLGNLSALSELFLNENHLTGPIPEALGKISSLERLALQVNHL 253

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           +G +P ++  ++ L ++ +  N+L G + + +   L  +     + N   G+IP + ++ 
Sbjct: 254 SGTIPRTLLNLSSLIHIGLQENELHGRLPSDLGNGLPKIQYFIVALNHFTGSIPPSIANA 313

Query: 670 TNMKNMYLQNNVFTGTI 720
           TNM+++ L +N FTG I
Sbjct: 314 TNMRSIDLSSNNFTGII 330



 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 2/113 (1%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++T + +     +G +   L   +S+    +  N    ++P  +     +  LNL  N  
Sbjct: 538 KLTYLYMYSNNFSGLLPNSLSNCQSLMELHLDDNFFNGTIPVSVSKMRGLVLLNLTKNSL 597

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
            G +P  +  M  L+ L +SHN L  ++     ++T+L  LD SFN+L G +P
Sbjct: 598 LGAIPQDLRLMDGLKELYLSHNNLSAQIPENMENMTSLYWLDISFNNLDGQVP 650



>gb:AY128385_1580684 Arabidopsis thaliana putative disease
           resistance protein (At2g15080) mRNA, complete cds.
          Length = 983

 Score =  100 bits (248), Expect = 5e-20
 Identities = 75/260 (28%), Positives = 129/260 (49%), Gaps = 21/260 (8%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFL--LNAPPSAVADTDPTDASV-LRGLFSSL-------NSPPQL 249
           M+  + L + + L+  FL    A    + D D +DA +  +  F +L       N P + 
Sbjct: 2   MKGYITLSFLIILIFNFLDEFAASTRHLCDPDQSDAILEFKNEFETLEESCFDSNIPLKT 61

Query: 250 TKWTANGGDPCGESWKGVSCSGN--RVTEIQISGLQLTGSMG-----FQLDQLKSVTTFD 408
             WT N  D C   W G+ C      V E+ +S   L G +      F+L QL+ +TT D
Sbjct: 62  ESWT-NNSDCC--YWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLD 118

Query: 409 ISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
           +S N+    +P  L    N+  L+L+ N F+G +P SI  ++ L +++ SHN   G++  
Sbjct: 119 LSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNFSGQIPS 178

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLN 756
               L++L++ + S+N+ +G +P +  +L+ +  + L  N F G +   L +L  L +L 
Sbjct: 179 SLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLI 238

Query: 757 VENNHFTGWIPPQLQGINSL 816
           ++ NHF G IP  L  ++ L
Sbjct: 239 LDTNHFVGKIPSSLGNLSHL 258



 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 51/173 (29%), Positives = 84/173 (48%), Gaps = 6/173 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T +++S     G +   L  L  +T   + TN+    +P  L    ++  ++L  N F 
Sbjct: 210 LTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFV 269

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P+S+  ++ L    +S N + GE+   F +L  L  L+   N L+G+ P    +L  
Sbjct: 270 GEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRK 329

Query: 676 MKNMYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           +  + L NN  TGT+      L+NL L   +   NHFTG +P  L  I SL+T
Sbjct: 330 LSTLSLFNNRLTGTLTSNMSSLSNLKL--FDATENHFTGPLPSSLFNIPSLKT 380



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 49/158 (31%), Positives = 75/158 (47%), Gaps = 5/158 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---LAGNGF 492
           +T++ +      G +   L  L  +T+ D+  NN    +P+ L  N+  L    L+ N  
Sbjct: 234 LTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLG-NLSCLTSFILSDNNI 292

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            G +P S   +  L+ LNV  N+L G   +  ++L  LSTL    N L G +    SSL+
Sbjct: 293 VGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLTSNMSSLS 352

Query: 673 NMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTG 780
           N+K      N FTG +   L N+P L  + +ENN   G
Sbjct: 353 NLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNG 390



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 45/154 (29%), Positives = 76/154 (49%), Gaps = 4/154 (2%)
 Frame = +1

Query: 340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL----PPNVQKLNLAGNGFTGGLP 507
            S    TG++   + +L  ++T D S N    S+P  +     P +Q LNL  N  +G LP
Sbjct: 587  SNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALNLRHNRLSGLLP 646

Query: 508  YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
             +I +   L  L+V HNQL G++      +++L  L+   N ++   P   SSL  ++ +
Sbjct: 647  ENIFES--LISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVL 704

Query: 688  YLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
             L++N F G I+      L  +++  N F G +P
Sbjct: 705  VLRSNAFYGPIEKTQFSKLRIIDISGNQFNGTLP 738



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 51/176 (28%), Positives = 84/176 (47%), Gaps = 11/176 (6%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFT 495
            ++++ +SG  +T    F   Q + + T DIS N +   +P  L   P +  +NL+ N F 
Sbjct: 504  ISQLYLSGCGITEFPKFLRSQ-ELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNNTFI 562

Query: 496  G-------GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            G       GL  SI +   +  L  S+N   G +      L  LSTLDFS N   G+IP 
Sbjct: 563  GFERSTKLGLT-SIQEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPT 621

Query: 655  TFSSLTN--MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
               ++ +  ++ + L++N  +G +       L +L+V +N   G +P  L  I+SL
Sbjct: 622  CMGNIQSPYLQALNLRHNRLSGLLPENIFESLISLDVGHNQLVGKLPRSLSHISSL 677



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 38/139 (27%), Positives = 69/139 (49%), Gaps = 3/139 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N++  + +   +L+GS    L  L+ ++T  +  N L  +L   +    N++  +   N 
Sbjct: 304 NQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENH 363

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFV-SLTNLSTLDFSFNSLAGNIPQTFSS 666
           FTG LP S+  +  L+ + + +NQL G +    + S +NL+ L    N+  G I ++ S 
Sbjct: 364 FTGPLPSSLFNIPSLKTITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISK 423

Query: 667 LTNMKNMYLQNNVFTGTID 723
           L N+K + L N    G +D
Sbjct: 424 LVNLKELDLSNYNTQGLVD 442



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 2/91 (2%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            LK  T  D S N     +P    L   +  LNL+ N  +G +  S+  +  LE L+VS N
Sbjct: 793  LKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQN 852

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
            +L GE+      LT L+ ++FS N L G +P
Sbjct: 853  KLSGEIPQELGKLTYLAYMNFSHNQLVGLLP 883



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 37/132 (28%), Positives = 67/132 (50%), Gaps = 7/132 (5%)
 Frame = +1

Query: 445 QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTN--LSTLD 618
           Q PP +++L  + N FTG +P  I ++  L  L+ S+N+  G +     ++ +  L  L+
Sbjct: 576 QEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALN 635

Query: 619 FSFNSLAGNIPQT-FSSLTNMKNMYLQNNVFTG----TIDVLANLPLDNLNVENNHFTGW 783
              N L+G +P+  F SL ++    + +N   G    ++  +++L L  LNVE+N  +  
Sbjct: 636 LRHNRLSGLLPENIFESLISLD---VGHNQLVGKLPRSLSHISSLGL--LNVESNKISDT 690

Query: 784 IPPQLQGINSLQ 819
            P  L  +  LQ
Sbjct: 691 FPLWLSSLQELQ 702



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 48/203 (23%), Positives = 81/203 (39%), Gaps = 53/203 (26%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
            QL G +   L  + S+   ++ +N + ++ P  L     +Q L L  N F G  P   +Q
Sbjct: 662  QLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAFYG--PIEKTQ 719

Query: 523  MAPLEYLNVSHNQLQGEV--------TVMFV-----------SLTNL------------- 606
             + L  +++S NQ  G +        T MF            +++N+             
Sbjct: 720  FSKLRIIDISGNQFNGTLPANFFVNWTAMFSLDENEDQSNGETMSNMYMSTDYFYFDSMV 779

Query: 607  -----------------STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLA 732
                             + +DFS N   G IP++   L  +  + L NN  +G I   + 
Sbjct: 780  LMNKGVEMELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMG 839

Query: 733  NL-PLDNLNVENNHFTGWIPPQL 798
            NL  L++L+V  N  +G IP +L
Sbjct: 840  NLMALESLDVSQNKLSGEIPQEL 862



 Score = 42.4 bits (98), Expect = 0.011
 Identities = 42/162 (25%), Positives = 72/162 (44%), Gaps = 9/162 (5%)
 Frame = +1

Query: 331 IQISGLQLTGSMGF-QLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           I +   QL GS+GF  +    ++T   +  NN    +   +    N+++L+L+     G 
Sbjct: 381 ITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGL 440

Query: 502 LPYSI-SQMAPLEYLNVSHNQLQGEVTV--MFVSLTNLSTLDFSFN--SLAGNIPQTFSS 666
           + ++I S +  +EYLN+SH      + +  +  S   L TLD S +  S       + SS
Sbjct: 441 VDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHVSTTNKSSLSNSS 500

Query: 667 LTNMKNMYLQNNVFTGTIDVLANLPLD-NLNVENNHFTGWIP 789
           L  +  +YL     T     L +  L   L++ NN   G +P
Sbjct: 501 LVLISQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVP 542



>gb:AB028616_1518004 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MMG15.
          Length = 1016

 Score =  100 bits (248), Expect = 5e-20
 Identities = 79/255 (30%), Positives = 119/255 (46%), Gaps = 57/255 (22%)
 Frame = +1

Query: 223 SSLNSP-PQLTKWTANGGDPCGESWKGVSCSG--NRVTEIQISGLQLTGSMGFQLDQLKS 393
           S LN P   L  WT +   PC  SW  V C+   +RV E+ + GL LTG +   + +L+ 
Sbjct: 45  SDLNDPFSHLESWTEDDNTPC--SWSYVKCNPKTSRVIELSLDGLALTGKINRGIQKLQR 102

Query: 394 VTTFDISTNNL-------------------GNSLPYQLP------PNVQKLNLAGNGFTG 498
           +    +S NN                     N+L  Q+P       ++Q L+L GN F+G
Sbjct: 103 LKVLSLSNNNFTGNINALSNNNHLQKLDLSHNNLSGQIPSSLGSITSLQHLDLTGNSFSG 162

Query: 499 GLPYSI-SQMAPLEYLNVSHNQLQGEV----------------------TVMFVS----L 597
            L   + +  + L YL++SHN L+G++                         FVS    L
Sbjct: 163 TLSDDLFNNCSSLRYLSLSHNHLEGQIPSTLFRCSVLNSLNLSRNRFSGNPSFVSGIWRL 222

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNH 771
             L  LD S NSL+G+IP    SL N+K + LQ N F+G +  D+     L+ +++ +NH
Sbjct: 223 ERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNH 282

Query: 772 FTGWIPPQLQGINSL 816
           F+G +P  LQ + SL
Sbjct: 283 FSGELPRTLQKLKSL 297



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 58/193 (30%), Positives = 93/193 (48%), Gaps = 28/193 (14%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           +  + +S    +G +   L +LKS+  FD+S N L    P  +     +  L+ + N  T
Sbjct: 273 LNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELT 332

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEV--------TVMFVSL---------------TNL 606
           G LP SIS +  L+ LN+S N+L GEV         +M V L                 L
Sbjct: 333 GKLPSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDLGL 392

Query: 607 STLDFSFNSLAGNIPQTFSSL-TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFT 777
             +DFS N L G+IP+  S L  ++  + L +N  TG+I  +V   + +  LN+  NHF 
Sbjct: 393 QEMDFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFN 452

Query: 778 GWIPPQLQGINSL 816
             +PP+++ + +L
Sbjct: 453 TRVPPEIEFLQNL 465



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 46/160 (28%), Positives = 81/160 (50%), Gaps = 7/160 (4%)
 Frame = +1

Query: 382 QLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH 555
           +L+ +   D+S+N+L  S+P  +    N+++L L  N F+G LP  I     L  +++S 
Sbjct: 221 RLERLRALDLSSNSLSGSIPLGILSLHNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSS 280

Query: 556 NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLA 732
           N   GE+      L +L+  D S N L+G+ P     +T + ++   +N  TG +   ++
Sbjct: 281 NHFSGELPRTLQKLKSLNHFDVSNNLLSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSIS 340

Query: 733 NL-PLDNLNVENNHFTGWIPPQLQGINSL---QTGGNSWN 840
           NL  L +LN+  N  +G +P  L+    L   Q  GN ++
Sbjct: 341 NLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFS 380



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 43/161 (26%), Positives = 80/161 (49%), Gaps = 3/161 (1%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           + + E+Q+   Q +G++   +     +   D+S+N+    LP  L    ++   +++ N 
Sbjct: 247 HNLKELQLQRNQFSGALPSDIGLCPHLNRVDLSSNHFSGELPRTLQKLKSLNHFDVSNNL 306

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G  P  I  M  L +L+ S N+L G++     +L +L  L+ S N L+G +P++  S 
Sbjct: 307 LSGDFPPWIGDMTGLVHLDFSSNELTGKLPSSISNLRSLKDLNLSENKLSGEVPESLESC 366

Query: 670 TNMKNMYLQNNVFTGTI-DVLANLPLDNLNVENNHFTGWIP 789
             +  + L+ N F+G I D   +L L  ++   N  TG IP
Sbjct: 367 KELMIVQLKGNDFSGNIPDGFFDLGLQEMDFSGNGLTGSIP 407



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 70/234 (29%), Positives = 110/234 (47%), Gaps = 17/234 (7%)
 Frame = +1

Query: 190  PTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE----SWKGVSCSGN--------RVTEI 333
            P+  S LR L     S  +L+       + C E      KG   SGN         + E+
Sbjct: 336  PSSISNLRSLKDLNLSENKLSGEVPESLESCKELMIVQLKGNDFSGNIPDGFFDLGLQEM 395

Query: 334  QISGLQLTGSMGFQLDQL-KSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGGL 504
              SG  LTGS+     +L +S+   D+S N+L  S+P +  L  +++ LNL+ N F   +
Sbjct: 396  DFSGNGLTGSIPRGSSRLFESLIRLDLSHNSLTGSIPGEVGLFIHMRYLNLSWNHFNTRV 455

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
            P  I  +  L  L++ ++ L G V        +L  L    NSL G+IP+   + +++K 
Sbjct: 456  PPEIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKL 515

Query: 685  MYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            + L +N  TG I   L+NL  L  L +E N  +G IP +L  + +L     S+N
Sbjct: 516  LSLSHNNLTGPIPKSLSNLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFN 569



 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 43/149 (28%), Positives = 72/149 (48%), Gaps = 5/149 (3%)
 Frame = +1

Query: 373 QLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLN 546
           +++ L+++T  D+  + L  S+P  +    ++Q L L GN  TG +P  I   + L+ L+
Sbjct: 458 EIEFLQNLTVLDLRNSALIGSVPADICESQSLQILQLDGNSLTGSIPEGIGNCSSLKLLS 517

Query: 547 VSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-- 720
           +SHN L G +     +L  L  L    N L+G IP+    L N+  + +  N   G +  
Sbjct: 518 LSHNNLTGPIPKSLSNLQELKILKLEANKLSGEIPKELGDLQNLLLVNVSFNRLIGRLPL 577

Query: 721 -DVLANLPLDNLNVENNHFTGWIPPQLQG 804
            DV  +  LD   ++ N   G   P L+G
Sbjct: 578 GDVFQS--LDQSAIQGN--LGICSPLLRG 602



>gb:AE016959_1022229 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC113338_1739022
           Oryza sativa (japonica cultivar-group) cultivar
           Nipponbare clone OSJNBa0091J06 from chromosome 10,
           complete sequence.>gb:AE017085_1752048 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 39 of
           77 of the complete sequence.
          Length = 1067

 Score =  100 bits (248), Expect = 5e-20
 Identities = 63/183 (34%), Positives = 94/183 (51%), Gaps = 7/183 (3%)
 Frame = +1

Query: 292 WKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--P 456
           W GV CS     RV  + ++   L G +   +  L  + + D+S N L   +P  +    
Sbjct: 62  WSGVICSHRHKQRVLALNLTSTGLHGYISASIGNLTYLRSLDLSCNQLYGEIPLTIGWLS 121

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
            +  L+L+ N F G +P +I Q+  L YL +S+N LQGE+T    + TNL+++    NSL
Sbjct: 122 KLSYLDLSNNSFQGEIPRTIGQLPQLSYLYLSNNSLQGEITDELRNCTNLASIKLDLNSL 181

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGIN 810
            G IP  F     + ++ +  N+FTG I   L NL  L  L +  NH TG IP  L  I+
Sbjct: 182 NGKIPDWFGGFLKLNSISVGKNIFTGIIPQSLGNLSALSELFLNENHLTGPIPEALGKIS 241

Query: 811 SLQ 819
           SL+
Sbjct: 242 SLE 244



 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 49/185 (26%), Positives = 89/185 (48%), Gaps = 8/185 (4%)
 Frame = +1

Query: 286 ESWKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPP 456
           + W+ ++   N  R+  + I   +L G++   +  L + +   DI  N +   +P  +  
Sbjct: 355 KDWRFITFLTNCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNKISGKIPDGINN 414

Query: 457 NVQ--KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
            ++  KL L+ N F+G +P SI ++  L+YL + +N L G +     +LT L  L    N
Sbjct: 415 FLKLIKLGLSNNRFSGPIPDSIGRLETLQYLTLENNLLSGIIPSSLGNLTQLQQLSLDNN 474

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLPLDN--LNVENNHFTGWIPPQLQ 801
           SL G +P +  +L  +      NN     +   + NLP  +  L++  NHF+G +P  + 
Sbjct: 475 SLEGPLPASIGNLQQLIIATFSNNKLRDQLPGDIFNLPSLSYILDLSRNHFSGSLPSAVG 534

Query: 802 GINSL 816
           G+  L
Sbjct: 535 GLTKL 539



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 4/151 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           QL G + F L  L  +   D+S N+   SLP  +     +  L +  N F+G LP S+S 
Sbjct: 503 QLPGDI-FNLPSLSYI--LDLSRNHFSGSLPSAVGGLTKLTYLYMYSNNFSGLLPNSLSN 559

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              L  L++  N   G + V    +  L  L+ + NSL G IPQ    +  +K +YL +N
Sbjct: 560 CQSLMELHLDDNFFNGTIPVSVSKMRGLVLLNLTKNSLLGAIPQDLRLMDGLKELYLSHN 619

Query: 703 VFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
             +  I + + N+  L  L++  N+  G +P
Sbjct: 620 NLSAQIPENMENMTSLYWLDISFNNLDGQVP 650



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 37/205 (18%)
 Frame = +1

Query: 313 GNRVTEIQISGLQL---TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---------- 453
           GN + +IQ   + L   TGS+   +    ++ + D+S+NN    +P ++           
Sbjct: 286 GNGLPKIQYFIVALNHFTGSIPPSIANATNMRSIDLSSNNFTGIIPPEIGMLCLKYLMLQ 345

Query: 454 ---------------------PNVQKLNLAGNGFTGGLPYSISQM-APLEYLNVSHNQLQ 567
                                  ++ + +  N   G LP SI+ + A LE L++  N++ 
Sbjct: 346 RNQLKATSVKDWRFITFLTNCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNKIS 405

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-P 741
           G++     +   L  L  S N  +G IP +   L  ++ + L+NN+ +G I   L NL  
Sbjct: 406 GKIPDGINNFLKLIKLGLSNNRFSGPIPDSIGRLETLQYLTLENNLLSGIIPSSLGNLTQ 465

Query: 742 LDNLNVENNHFTGWIPPQLQGINSL 816
           L  L+++NN   G +P  +  +  L
Sbjct: 466 LQQLSLDNNSLEGPLPASIGNLQQL 490



 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 4/125 (3%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++T + +     +G +   L   +S+    +  N    ++P  +     +  LNL  N  
Sbjct: 538 KLTYLYMYSNNFSGLLPNSLSNCQSLMELHLDDNFFNGTIPVSVSKMRGLVLLNLTKNSL 597

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ--TFSS 666
            G +P  +  M  L+ L +SHN L  ++     ++T+L  LD SFN+L G +P    F++
Sbjct: 598 LGAIPQDLRLMDGLKELYLSHNNLSAQIPENMENMTSLYWLDISFNNLDGQVPAHGVFAN 657

Query: 667 LTNMK 681
           LT  K
Sbjct: 658 LTGFK 662



 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 42/156 (26%), Positives = 76/156 (48%), Gaps = 11/156 (7%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L  +  F ++ N+   S+P  +    N++ ++L+ N FTG +P  I  +  L+YL +  N
Sbjct: 289 LPKIQYFIVALNHFTGSIPPSIANATNMRSIDLSSNNFTGIIPPEIGMLC-LKYLMLQRN 347

Query: 559 QLQG------EVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT-NMKNMYLQNNVFTGT 717
           QL+              + T L  +    N L G +P + ++L+  ++ + +  N  +G 
Sbjct: 348 QLKATSVKDWRFITFLTNCTRLRAVTIQNNRLGGALPNSITNLSAQLELLDIGFNKISGK 407

Query: 718 I-DVLAN-LPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           I D + N L L  L + NN F+G IP  +  + +LQ
Sbjct: 408 IPDGINNFLKLIKLGLSNNRFSGPIPDSIGRLETLQ 443



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 32/137 (23%), Positives = 70/137 (51%), Gaps = 3/137 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++  I +     TG +   L  L +++   ++ N+L   +P  L    ++++L L  N  
Sbjct: 194 KLNSISVGKNIFTGIIPQSLGNLSALSELFLNENHLTGPIPEALGKISSLERLALQVNHL 253

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           +G +P ++  ++ L ++ +  N+L G + + +   L  +     + N   G+IP + ++ 
Sbjct: 254 SGTIPRTLLNLSSLIHIGLQENELHGRLPSDLGNGLPKIQYFIVALNHFTGSIPPSIANA 313

Query: 670 TNMKNMYLQNNVFTGTI 720
           TNM+++ L +N FTG I
Sbjct: 314 TNMRSIDLSSNNFTGII 330



>pir|G84524|G84524 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC005957_1533258 Arabidopsis
           thaliana chromosome 2 clone T15J14 map mi398, complete
           sequence.
          Length = 983

 Score =  100 bits (248), Expect = 5e-20
 Identities = 75/260 (28%), Positives = 129/260 (49%), Gaps = 21/260 (8%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFL--LNAPPSAVADTDPTDASV-LRGLFSSL-------NSPPQL 249
           M+  + L + + L+  FL    A    + D D +DA +  +  F +L       N P + 
Sbjct: 2   MKGYITLSFLIILIFNFLDEFAASTRHLCDPDQSDAILEFKNEFETLEESCFDSNIPLKT 61

Query: 250 TKWTANGGDPCGESWKGVSCSGN--RVTEIQISGLQLTGSMG-----FQLDQLKSVTTFD 408
             WT N  D C   W G+ C      V E+ +S   L G +      F+L QL+ +TT D
Sbjct: 62  ESWT-NNSDCC--YWDGIKCDAKFGDVIELDLSFSCLRGQLNSNSSLFRLPQLRFLTTLD 118

Query: 409 ISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
           +S N+    +P  L    N+  L+L+ N F+G +P SI  ++ L +++ SHN   G++  
Sbjct: 119 LSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFSHNNFSGQIPS 178

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLN 756
               L++L++ + S+N+ +G +P +  +L+ +  + L  N F G +   L +L  L +L 
Sbjct: 179 SLGYLSHLTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLI 238

Query: 757 VENNHFTGWIPPQLQGINSL 816
           ++ NHF G IP  L  ++ L
Sbjct: 239 LDTNHFVGKIPSSLGNLSHL 258



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 50/158 (31%), Positives = 76/158 (48%), Gaps = 5/158 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---LAGNGF 492
           +T++ +      G +   L  L  +T+ D+  NN    +P+ L  N+  L    L+ N  
Sbjct: 234 LTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFVGEIPFSLG-NLSCLTSFILSDNNI 292

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            G +P S   +  L+ LNV  N+L G   +  ++L  LSTL    N L G +P   SSL+
Sbjct: 293 VGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLPSNMSSLS 352

Query: 673 NMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTG 780
           N+K      N FTG +   L N+P L  + +ENN   G
Sbjct: 353 NLKLFDATENHFTGPLPSSLFNIPSLKTITLENNQLNG 390



 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 51/173 (29%), Positives = 84/173 (48%), Gaps = 6/173 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T +++S     G +   L  L  +T   + TN+    +P  L    ++  ++L  N F 
Sbjct: 210 LTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFV 269

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P+S+  ++ L    +S N + GE+   F +L  L  L+   N L+G+ P    +L  
Sbjct: 270 GEIPFSLGNLSCLTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRK 329

Query: 676 MKNMYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           +  + L NN  TGT+      L+NL L   +   NHFTG +P  L  I SL+T
Sbjct: 330 LSTLSLFNNRLTGTLPSNMSSLSNLKL--FDATENHFTGPLPSSLFNIPSLKT 380



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 45/154 (29%), Positives = 76/154 (49%), Gaps = 4/154 (2%)
 Frame = +1

Query: 340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL----PPNVQKLNLAGNGFTGGLP 507
            S    TG++   + +L  ++T D S N    S+P  +     P +Q LNL  N  +G LP
Sbjct: 587  SNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALNLRHNRLSGLLP 646

Query: 508  YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
             +I +   L  L+V HNQL G++      +++L  L+   N ++   P   SSL  ++ +
Sbjct: 647  ENIFES--LISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVL 704

Query: 688  YLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
             L++N F G I+      L  +++  N F G +P
Sbjct: 705  VLRSNAFYGPIEKTQFSKLRIIDISGNQFNGTLP 738



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 39/139 (28%), Positives = 70/139 (50%), Gaps = 3/139 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N++  + +   +L+GS    L  L+ ++T  +  N L  +LP  +    N++  +   N 
Sbjct: 304 NQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLPSNMSSLSNLKLFDATENH 363

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFV-SLTNLSTLDFSFNSLAGNIPQTFSS 666
           FTG LP S+  +  L+ + + +NQL G +    + S +NL+ L    N+  G I ++ S 
Sbjct: 364 FTGPLPSSLFNIPSLKTITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISK 423

Query: 667 LTNMKNMYLQNNVFTGTID 723
           L N+K + L N    G +D
Sbjct: 424 LVNLKELDLSNYNTQGLVD 442



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 51/176 (28%), Positives = 84/176 (47%), Gaps = 11/176 (6%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFT 495
            ++++ +SG  +T    F   Q + + T DIS N +   +P  L   P +  +NL+ N F 
Sbjct: 504  ISQLYLSGCGITEFPKFLRSQ-ELMLTLDISNNKIKGQVPGWLWMLPVLNYVNLSNNTFI 562

Query: 496  G-------GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            G       GL  SI +   +  L  S+N   G +      L  LSTLDFS N   G+IP 
Sbjct: 563  GFERSTKLGLT-SIQEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPT 621

Query: 655  TFSSLTN--MKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
               ++ +  ++ + L++N  +G +       L +L+V +N   G +P  L  I+SL
Sbjct: 622  CMGNIQSPYLQALNLRHNRLSGLLPENIFESLISLDVGHNQLVGKLPRSLSHISSL 677



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 2/91 (2%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            LK  T  D S N     +P    L   +  LNL+ N  +G +  S+  +  LE L+VS N
Sbjct: 793  LKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQN 852

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
            +L GE+      LT L+ ++FS N L G +P
Sbjct: 853  KLSGEIPQELGKLTYLAYMNFSHNQLVGLLP 883



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 37/132 (28%), Positives = 67/132 (50%), Gaps = 7/132 (5%)
 Frame = +1

Query: 445 QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTN--LSTLD 618
           Q PP +++L  + N FTG +P  I ++  L  L+ S+N+  G +     ++ +  L  L+
Sbjct: 576 QEPPAMRQLFCSNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIPTCMGNIQSPYLQALN 635

Query: 619 FSFNSLAGNIPQT-FSSLTNMKNMYLQNNVFTG----TIDVLANLPLDNLNVENNHFTGW 783
              N L+G +P+  F SL ++    + +N   G    ++  +++L L  LNVE+N  +  
Sbjct: 636 LRHNRLSGLLPENIFESLISLD---VGHNQLVGKLPRSLSHISSLGL--LNVESNKISDT 690

Query: 784 IPPQLQGINSLQ 819
            P  L  +  LQ
Sbjct: 691 FPLWLSSLQELQ 702



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 48/203 (23%), Positives = 81/203 (39%), Gaps = 53/203 (26%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
            QL G +   L  + S+   ++ +N + ++ P  L     +Q L L  N F G  P   +Q
Sbjct: 662  QLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAFYG--PIEKTQ 719

Query: 523  MAPLEYLNVSHNQLQGEV--------TVMFV-----------SLTNL------------- 606
             + L  +++S NQ  G +        T MF            +++N+             
Sbjct: 720  FSKLRIIDISGNQFNGTLPANFFVNWTAMFSLDENEDQSNGETMSNMYMSTDYFYFDSMV 779

Query: 607  -----------------STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLA 732
                             + +DFS N   G IP++   L  +  + L NN  +G I   + 
Sbjct: 780  LMNKGVEMELERVLKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMG 839

Query: 733  NL-PLDNLNVENNHFTGWIPPQL 798
            NL  L++L+V  N  +G IP +L
Sbjct: 840  NLMALESLDVSQNKLSGEIPQEL 862



 Score = 42.4 bits (98), Expect = 0.011
 Identities = 42/162 (25%), Positives = 72/162 (44%), Gaps = 9/162 (5%)
 Frame = +1

Query: 331 IQISGLQLTGSMGF-QLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           I +   QL GS+GF  +    ++T   +  NN    +   +    N+++L+L+     G 
Sbjct: 381 ITLENNQLNGSLGFGNISSYSNLTVLRLGNNNFRGPIHRSISKLVNLKELDLSNYNTQGL 440

Query: 502 LPYSI-SQMAPLEYLNVSHNQLQGEVTV--MFVSLTNLSTLDFSFN--SLAGNIPQTFSS 666
           + ++I S +  +EYLN+SH      + +  +  S   L TLD S +  S       + SS
Sbjct: 441 VDFTIFSHLKSIEYLNLSHLNTTTTIDMYEILSSFKLLDTLDLSGSHVSTTNKSSLSNSS 500

Query: 667 LTNMKNMYLQNNVFTGTIDVLANLPLD-NLNVENNHFTGWIP 789
           L  +  +YL     T     L +  L   L++ NN   G +P
Sbjct: 501 LVLISQLYLSGCGITEFPKFLRSQELMLTLDISNNKIKGQVP 542



>gb:AF084034_1767051 Arabidopsis thaliana receptor-like protein
           kinase (RKL1) gene, complete cds.
          Length = 645

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 69/221 (31%), Positives = 107/221 (48%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE 330
           LL+ P  +  D +  D + L  L S++    +  +W      PC  +W GV C  NRVT 
Sbjct: 12  LLSLPLPSTQDLN-ADRTALLSLRSAVGG--RTFRWNIKQTSPC--NWAGVKCESNRVTA 66

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY 510
           +++ G+ L+G               DI     GN         ++ L+L  N  +G LP 
Sbjct: 67  LRLPGVALSG---------------DIPEGIFGNLT------QLRTLSLRLNALSGSLPK 105

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            +S  + L +L +  N+  GE+  +  SL++L  L+ + NS  G I   F++LT +K ++
Sbjct: 106 DLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRLNLASNSFTGEISSGFTNLTKLKTLF 165

Query: 691 LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINS 813
           L+NN  +G+I  L +LPL   NV NN   G IP  LQ   S
Sbjct: 166 LENNQLSGSIPDL-DLPLVQFNVSNNSLNGSIPKNLQRFES 205



>gb:AY244745_1592516 Arabidopsis thaliana ERECTA-like kinase 1
           (ERL1) mRNA, ERL1-erl1 allele, complete cds.
          Length = 966

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 59/167 (35%), Positives = 93/167 (55%), Gaps = 4/167 (2%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNL 477
           SC+   + +  + G  L+GS+      L S+T  ++S+NN    +P +L    N+ KL+L
Sbjct: 380 SCAA--LNQFNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDL 437

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           +GN F+G +P ++  +  L  LN+S N L G++   F +L ++  +D SFN L+G IP  
Sbjct: 438 SGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTE 497

Query: 658 FSSLTNMKNMYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPP 792
              L N+ ++ L NN   G I D L N   L NLNV  N+ +G +PP
Sbjct: 498 LGQLQNLNSLILNNNKLHGKIPDQLTNCFTLVNLNVSFNNLSGIVPP 544



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 70/253 (27%), Positives = 107/253 (42%), Gaps = 8/253 (3%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT-ANGGD 276
           M+E M        ++GF++    SA+ + +      ++G FS+L +   L  W   +  D
Sbjct: 1   MKEKMQRMVLSLAMVGFMVFGVASAM-NNEGKALMAIKGSFSNLVN--MLLDWDDVHNSD 57

Query: 277 PCGESWKGVSCSG--NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL 450
            C  SW+GV C      V  + +S L L G +   +  L+                    
Sbjct: 58  LC--SWRGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLR-------------------- 95

Query: 451 PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
             N+Q ++L GN   G +P  I   A L YL++S N L G++      L  L TL+   N
Sbjct: 96  --NLQSIDLQGNKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNN 153

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLA--NLPLDNLNVENNHFTGWIPP---Q 795
            L G +P T + + N+K + L  N  TG I  L   N  L  L +  N  TG +     Q
Sbjct: 154 QLTGPVPATLTQIPNLKRLDLAGNHLTGEISRLLYWNEVLQYLGLRGNMLTGTLSSDMCQ 213

Query: 796 LQGINSLQTGGNS 834
           L G+      GN+
Sbjct: 214 LTGLWYFDVRGNN 226



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 47/156 (30%), Positives = 79/156 (50%), Gaps = 3/156 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S   L G + F + +LK + T ++  N L   +P  L   PN+++L+LAGN  TG +
Sbjct: 124 LDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVPATLTQIPNLKRLDLAGNHLTGEI 183

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
              +     L+YL +  N L G ++     LT L   D   N+L G IP++  + T+ + 
Sbjct: 184 SRLLYWNEVLQYLGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQI 243

Query: 685 MYLQNNVFTGTIDV-LANLPLDNLNVENNHFTGWIP 789
           + +  N  TG I   +  L +  L+++ N  TG IP
Sbjct: 244 LDISYNQITGEIPYNIGFLQVATLSLQGNRLTGRIP 279



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 52/181 (28%), Positives = 89/181 (49%), Gaps = 7/181 (3%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +V  + + G +LTG +   +  ++++   D+S N L   +P  L       KL L GN  
Sbjct: 263 QVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKLYLHGNML 322

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  +  M+ L YL ++ N+L G +      L  L  L+ + + L G IP   SS  
Sbjct: 323 TGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANSRLVGPIPSNISSCA 382

Query: 673 NMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQ---GINSLQTGGNSW 837
            +    +  N+ +G+I +   NL  L  LN+ +N+F G IP +L     ++ L   GN++
Sbjct: 383 ALNQFNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKLDLSGNNF 442

Query: 838 N 840
           +
Sbjct: 443 S 443



>pir|G96524|G96524 protein T1N15.9 [imported] - Arabidopsis
           thaliana>gb:AE005173_892808 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC020889_1538634 Genomic sequence for
           Arabidopsis thaliana BAC T1N15 from chromosome I,
           complete sequence.
          Length = 655

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 69/221 (31%), Positives = 107/221 (48%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE 330
           LL+ P  +  D +  D + L  L S++    +  +W      PC  +W GV C  NRVT 
Sbjct: 22  LLSLPLPSTQDLN-ADRTALLSLRSAVGG--RTFRWNIKQTSPC--NWAGVKCESNRVTA 76

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY 510
           +++ G+ L+G               DI     GN         ++ L+L  N  +G LP 
Sbjct: 77  LRLPGVALSG---------------DIPEGIFGNLT------QLRTLSLRLNALSGSLPK 115

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            +S  + L +L +  N+  GE+  +  SL++L  L+ + NS  G I   F++LT +K ++
Sbjct: 116 DLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRLNLASNSFTGEISSGFTNLTKLKTLF 175

Query: 691 LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINS 813
           L+NN  +G+I  L +LPL   NV NN   G IP  LQ   S
Sbjct: 176 LENNQLSGSIPDL-DLPLVQFNVSNNSLNGSIPKNLQRFES 215



>pir|T04587|T04587 hypothetical protein F23E13.70 - Arabidopsis
           thaliana>gb:ATCHRIV84_1547578 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           84.>gb:ATF23E13_1549746 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII project).
          Length = 1134

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 74/288 (25%), Positives = 130/288 (45%), Gaps = 55/288 (19%)
 Frame = +1

Query: 142 IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSP-PQLTKWT-ANGGDPCGESWKGVSCSG 315
           I  ++ AP  + AD    +   L     +L+ P   LT W  +    PC   W+GV C+ 
Sbjct: 8   IFLVIYAPLVSYADESQAEIDALTAFKLNLHDPLGALTSWDPSTPAAPC--DWRGVGCTN 65

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLK----------------------------------- 390
           +RVTEI++  LQL+G +  ++  L+                                   
Sbjct: 66  HRVTEIRLPRLQLSGRISDRISGLRMLRKLSLRSNSFNGTIPTSLAYCTRLLSVFLQYNS 125

Query: 391 -------------SVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP 531
                        S+  F+++ N L   +P  LP ++Q L+++ N F+G +P  ++ +  
Sbjct: 126 LSGKLPPAMRNLTSLEVFNVAGNRLSGEIPVGLPSSLQFLDISSNTFSGQIPSGLANLTQ 185

Query: 532 LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT 711
           L+ LN+S+NQL GE+     +L +L  L   FN L G +P   S+ +++ ++    N   
Sbjct: 186 LQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFNLLQGTLPSAISNCSSLVHLSASENEIG 245

Query: 712 GTID-VLANLP-LDNLNVENNHFTGWIPPQL---QGINSLQTGGNSWN 840
           G I      LP L+ L++ NN+F+G +P  L     +  +Q G N+++
Sbjct: 246 GVIPAAYGALPKLEVLSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFS 293



 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 53/168 (31%), Positives = 90/168 (53%), Gaps = 4/168 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +SG   +G +   +  L  +T  D+S  N+   +P +L   PNVQ + L GN F+G +
Sbjct: 479 LNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNFSGVV 538

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P   S +  L Y+N+S N   GE+   F  L  L +L  S N ++G+IP    + + ++ 
Sbjct: 539 PEGFSSLVSLRYVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEV 598

Query: 685 MYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQT 822
           + L++N   G I   L+ LP L  L++  N+ +G IPP++   +SL +
Sbjct: 599 LELRSNRLMGHIPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNS 646



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/149 (31%), Positives = 84/149 (56%), Gaps = 4/149 (2%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMA 528
           +G +   +  L+ +   ++  NNL  S P +L    ++ +L+L+GN F+G +P SIS ++
Sbjct: 415 SGYVPSSMVNLQQLERLNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLS 474

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L +LN+S N   GE+     +L  L+ LD S  +++G +P   S L N++ + LQ N F
Sbjct: 475 NLSFLNLSGNGFSGEIPASVGNLFKLTALDLSKQNMSGEVPVELSGLPNVQVIALQGNNF 534

Query: 709 TGTI--DVLANLPLDNLNVENNHFTGWIP 789
           +G +     + + L  +N+ +N F+G IP
Sbjct: 535 SGVVPEGFSSLVSLRYVNLSSNSFSGEIP 563



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 45/141 (31%), Positives = 73/141 (51%), Gaps = 4/141 (2%)
 Frame = +1

Query: 406 DISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           D+  N +    P  L    +++ L+++GN F+G +P  I  +  LE L +++N L GE+ 
Sbjct: 312 DLQENRISGRFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIP 371

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNL 753
           V      +L  LDF  NSL G IP+    +  +K + L  N F+G +   + NL  L+ L
Sbjct: 372 VEIKQCGSLDVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERL 431

Query: 754 NVENNHFTGWIPPQLQGINSL 816
           N+  N+  G  P +L  + SL
Sbjct: 432 NLGENNLNGSFPVELMALTSL 452



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 38/146 (26%), Positives = 74/146 (50%), Gaps = 3/146 (2%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
            +  + +S   ++GS+  ++    ++   ++ +N L   +P  L   P ++ L+L  N  +
Sbjct: 572  LVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGHIPADLSRLPRLKVLDLGQNNLS 631

Query: 496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL-T 672
            G +P  ISQ + L  L++ HN L G +   F  L+NL+ +D S N+L G IP + + + +
Sbjct: 632  GEIPPEISQSSSLNSLSLDHNHLSGVIPGSFSGLSNLTKMDLSVNNLTGEIPASLALISS 691

Query: 673  NMKNMYLQNNVFTGTIDVLANLPLDN 750
            N+    + +N   G I       ++N
Sbjct: 692  NLVYFNVSSNNLKGEIPASLGSRINN 717



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 9/179 (5%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN----VQKLNLAGNGFTG 498
           + +S    +G++ F L    S+T   +  N   + +  +   N    +Q L+L  N  +G
Sbjct: 261 LSLSNNNFSGTVPFSLFCNTSLTIVQLGFNAFSDIVRPETTANCRTGLQVLDLQENRISG 320

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
             P  ++ +  L+ L+VS N   GE+     +L  L  L  + NSL G IP       ++
Sbjct: 321 RFPLWLTNILSLKNLDVSGNLFSGEIPPDIGNLKRLEELKLANNSLTGEIPVEIKQCGSL 380

Query: 679 KNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPP---QLQGINSLQTGGNSWN 840
             +  + N   G I         L  L++  N F+G++P     LQ +  L  G N+ N
Sbjct: 381 DVLDFEGNSLKGQIPEFLGYMKALKVLSLGRNSFSGYVPSSMVNLQQLERLNLGENNLN 439



>gb:AP003302_1827702 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0703B11.>gb:AP003348_1828476 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0485B12.
          Length = 947

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 81/272 (29%), Positives = 135/272 (49%), Gaps = 37/272 (13%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPP--QLTKWTANGGDPCGESWKGV 303
           +A L+  LL    +A A T  TD  +   +F +  + P  +L  WT +   PC  SW GV
Sbjct: 7   LARLLAALLAVAAAATAATALTDDVLALVVFKTGVADPMGRLAAWTEDDDRPC--SWPGV 64

Query: 304 SCS--GNRVTEIQISGLQLTGSMG---FQLDQLKSVT----------------------T 402
            C     RVT + + G  L+G +     +LD L S++                      +
Sbjct: 65  GCDARAGRVTSLSLPGASLSGRLPRALLRLDALASLSLPRNNLSGPVLPGLLAALPRLRS 124

Query: 403 FDISTNNLGNSLPYQL---PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGE 573
            D+S+N L   +P +L     +++ L+LA N  +G +P +++  A L  LN+S N+L G 
Sbjct: 125 LDLSSNRLAAPVPAELFAQCRSIRALSLARNELSGYIPPAVTSCASLVSLNLSSNRLAGP 184

Query: 574 VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLD 747
           +     SL +L +LD S N L+G++P  F   ++++ + L  N+  G I  DV     L 
Sbjct: 185 IPDGLWSLPSLRSLDLSGNELSGSVPGGFPGSSSLRAVDLSRNLLAGEIPADVGEAALLK 244

Query: 748 NLNVENNHFTGWIPPQLQGINSLQ---TGGNS 834
           +L+V +N FTG +P  L+ +++L+    GGN+
Sbjct: 245 SLDVGHNLFTGGLPESLRRLSALRFLGVGGNA 276



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 3/155 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGL 504
           + +SG +L+GS+        S+   D+S N L   +P  +     ++ L++  N FTGGL
Sbjct: 198 LDLSGNELSGSVPGGFPGSSSLRAVDLSRNLLAGEIPADVGEAALLKSLDVGHNLFTGGL 257

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P S+ +++ L +L V  N L GEV      +  L  LD S N  +G IP   +    M  
Sbjct: 258 PESLRRLSALRFLGVGGNALAGEVPSWIGEMWALERLDLSGNRFSGAIPDAIAKCKKMVE 317

Query: 685 MYLQNNVFTGTID-VLANLPLDNLNVENNHFTGWI 786
             L  N   G +   +  LPL  ++V  N   GW+
Sbjct: 318 ADLSRNALAGELPWWVFGLPLQRVSVAGNKLYGWV 352



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 63/231 (27%), Positives = 102/231 (44%), Gaps = 29/231 (12%)
 Frame = +1

Query: 214 GLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQL 387
           GL  SL     L      G    GE  SW G   +  R   + +SG + +G++   + + 
Sbjct: 256 GLPESLRRLSALRFLGVGGNALAGEVPSWIGEMWALER---LDLSGNRFSGAIPDAIAKC 312

Query: 388 KSVTTFDISTNNLGNSLPY---------------------QLPPN----VQKLNLAGNGF 492
           K +   D+S N L   LP+                     ++P +    ++ L+L+ NGF
Sbjct: 313 KKMVEADLSRNALAGELPWWVFGLPLQRVSVAGNKLYGWVKVPADAALALRALDLSSNGF 372

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +GG+P  I+  A L+YLN+S N    ++      +  L  LD S N L G +P       
Sbjct: 373 SGGIPPQITAFAGLQYLNMSSNSFARQLPAGIGGMRLLEVLDVSANRLDGGVPPEIGGAV 432

Query: 673 NMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            ++ + L  N FTG I   + N   L  L++ +N+ TG IP  +  + SL+
Sbjct: 433 ALRELRLGRNSFTGHIPSQIGNCSSLVALDLSHNNLTGSIPSTVGNLTSLE 483



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 53/187 (28%), Positives = 87/187 (46%), Gaps = 28/187 (14%)
 Frame = +1

Query: 313 GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGN 486
           G  +  + ++G +L G +    D   ++   D+S+N     +P Q+     +Q LN++ N
Sbjct: 335 GLPLQRVSVAGNKLYGWVKVPADAALALRALDLSSNGFSGGIPPQITAFAGLQYLNMSSN 394

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQG------------------------EVTVMFVS 594
            F   LP  I  M  LE L+VS N+L G                         +     +
Sbjct: 395 SFARQLPAGIGGMRLLEVLDVSANRLDGGVPPEIGGAVALRELRLGRNSFTGHIPSQIGN 454

Query: 595 LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENN 768
            ++L  LD S N+L G+IP T  +LT+++ + L  N   GT+ V L+NLP L   +V +N
Sbjct: 455 CSSLVALDLSHNNLTGSIPSTVGNLTSLEVVDLSKNKLNGTLPVELSNLPSLRIFDVSHN 514

Query: 769 HFTGWIP 789
             +G +P
Sbjct: 515 LLSGDLP 521



>gb:AC105364_1737972 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1743A09, complete sequence.
          Length = 675

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 72/225 (32%), Positives = 103/225 (45%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           AVAL +  LL+A P   +D   TDA  L+ L S++     L  W  N   P   +W+GV+
Sbjct: 8   AVALAVLVLLSAVPGYFSDDLNTDAQALQALRSAVGKSA-LPSW--NSSTPTC-NWQGVT 63

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN 486
           C   RVTE+++ G  L G++                +N LGN         ++ L+L  N
Sbjct: 64  CESGRVTELRLPGAGLMGTL---------------PSNVLGNLSA------LRTLSLRYN 102

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             TG +P  +S++  L  +   HN   GEV     +L NL  LD + N  +G I   F+ 
Sbjct: 103 ALTGPIPDDLSRLPELRAIYFQHNSFSGEVPASVFTLKNLVRLDLAGNKFSGEISPDFNK 162

Query: 667 LTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ 801
           L  +  ++L  N FTG I  L    L   NV  N   G IP  L+
Sbjct: 163 LNRLGTLFLDGNSFTGEIPKLDLPTLSQFNVSYNKLNGSIPRSLR 207



>gb:AE016959_1021913 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC090482_1734279
           Genomic sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0015I18, from chromosome 10, complete
           sequence.>gb:AE017078_1751732 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 32 of 77 of the
           complete sequence.
          Length = 1056

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 76/253 (30%), Positives = 123/253 (48%), Gaps = 15/253 (5%)
 Frame = +1

Query: 106 ELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSL--NSPPQLTKWTA-NGGD 276
           +L+ LP  V     FL  AP S   D    D   L    S +  +    L+ W+  + G 
Sbjct: 9   QLLALPSTVI----FLFLAPASRSIDAGD-DLHALLSFRSHIAKDHSDALSSWSVVSNGT 63

Query: 277 PCGE----SWKGVSCSGN----RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN 432
             G     SW+GV+CS      RV  +++ GL L G++   +  L  +   D+S N L  
Sbjct: 64  SDGTNGFCSWRGVTCSSGARHRRVVSLRVQGLGLVGTISPLVGNLTGLRELDLSDNKLEG 123

Query: 433 SLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL 606
            +P  L     +Q+LNL+ N  +G +P SI Q++ LE LN+ HN + G V   F +LT L
Sbjct: 124 EIPPSLARCLALQRLNLSVNFLSGVIPPSIGQLSKLEVLNIRHNNISGYVPSTFANLTAL 183

Query: 607 STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTG 780
           +    + N + G IP    +LT +++  +  N+  G++ + ++ L  L+ L +  N   G
Sbjct: 184 TMFSIADNYVHGQIPSWLGNLTALESFNIAGNMMRGSVPEAISQLTNLEALTISGNGLEG 243

Query: 781 WIPPQLQGINSLQ 819
            IP  L  ++SL+
Sbjct: 244 EIPASLFNLSSLK 256



 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 52/170 (30%), Positives = 88/170 (51%), Gaps = 7/170 (4%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           I++ G Q++G +   + +   +T+ + + N    ++P  +    N+ +L L  NGF G +
Sbjct: 386 IRLGGNQISGILPKGIGRYAKLTSLEFADNLFNGTIPSDIGKLTNLHELLLFSNGFQGEI 445

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ---TFSSLTN 675
           P SI  M  L  L +S N L+G +     +L+ L+++D S N L+G IP+     SSLT 
Sbjct: 446 PSSIGNMTQLNQLLLSGNYLEGRIPATIGNLSKLTSMDLSSNLLSGQIPEEIIRISSLTE 505

Query: 676 MKNMYLQNNVFTGTID-VLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
             N  L NN  +G I   + NL  +  +++ +N  +G IP  L    +LQ
Sbjct: 506 ALN--LSNNALSGPISPYIGNLVNVGIIDLSSNKLSGQIPSTLGNCLALQ 553



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 49/177 (27%), Positives = 85/177 (48%), Gaps = 2/177 (1%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG 498
           ++ ++ +SG  L G +   +  L  +T+ D+S+N L   +P ++                
Sbjct: 454 QLNQLLLSGNYLEGRIPATIGNLSKLTSMDLSSNLLSGQIPEEI---------------- 497

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
                IS +   E LN+S+N L G ++    +L N+  +D S N L+G IP T  +   +
Sbjct: 498 ---IRISSLT--EALNLSNNALSGPISPYIGNLVNVGIIDLSSNKLSGQIPSTLGNCLAL 552

Query: 679 KNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           + +YLQ N+  G I    N    L+ L++ NN F+G IP  L+    L+    S+N+
Sbjct: 553 QFLYLQANLLHGLIPKELNKLRGLEVLDLSNNKFSGPIPEFLESFQLLKNLNLSFNN 609



 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 48/174 (27%), Positives = 84/174 (48%), Gaps = 5/174 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +++  + I    ++G +      L ++T F I+ N +   +P  L     ++  N+AGN 
Sbjct: 157 SKLEVLNIRHNNISGYVPSTFANLTALTMFSIADNYVHGQIPSWLGNLTALESFNIAGNM 216

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS-S 666
             G +P +ISQ+  LE L +S N L+GE+     +L++L   +   N ++G++P     +
Sbjct: 217 MRGSVPEAISQLTNLEALTISGNGLEGEIPASLFNLSSLKVFNLGSNIISGSLPTDIGLT 276

Query: 667 LTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQT 822
           L N++      N   G I    +N+  L+   +  N F G IPP   GIN   T
Sbjct: 277 LPNLRYFIAFYNRLEGQIPASFSNISVLEKFILHRNRFRGRIPPN-SGINGQLT 329



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 45/151 (29%), Positives = 69/151 (45%), Gaps = 5/151 (3%)
 Frame = +1

Query: 406 DISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
           ++  NNL   LP     L   +Q + L GN  +G LP  I + A L  L  + N   G +
Sbjct: 362 NLQLNNLSGILPNTIANLSLELQSIRLGGNQISGILPKGIGRYAKLTSLEFADNLFNGTI 421

Query: 577 TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID-VLANL-PLDN 750
                 LTNL  L    N   G IP +  ++T +  + L  N   G I   + NL  L +
Sbjct: 422 PSDIGKLTNLHELLLFSNGFQGEIPSSIGNMTQLNQLLLSGNYLEGRIPATIGNLSKLTS 481

Query: 751 LNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           +++ +N  +G IP ++  I+SL    N  N+
Sbjct: 482 MDLSSNLLSGQIPEEIIRISSLTEALNLSNN 512



>gb:AP004769_1844738 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0017C12.
          Length = 1131

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 80/268 (29%), Positives = 127/268 (47%), Gaps = 34/268 (12%)
 Frame = +1

Query: 121 PWAVALLIGFLLNAP-PSAVADTDPTDASVLRGLFSSLNSPP-QLTKWTANGGDPCGESW 294
           P  + LL  F+++   P A++D   TD   L    S ++ P   L+ W+    + C  +W
Sbjct: 9   PKFIPLLAVFIISCSLPLAISDDTDTDREALLCFKSQISDPNGSLSSWSNTSQNFC--NW 66

Query: 295 KGVSCSGN----RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTN-------------- 420
           +GVSC+      RV  + +S   L+GS+   +  L S+ + D+S N              
Sbjct: 67  QGVSCNNTQTQLRVMVLNVSSKGLSGSIPPCIGNLSSIASLDLSRNAFLGKIPSELGRLG 126

Query: 421 -----NLG-NSLPYQLPP------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQL 564
                NL  NSL  ++P       N+Q L L+ N F G +P S++Q   L+ + + +N+L
Sbjct: 127 QISYLNLSINSLEGRIPDELSSCSNLQVLGLSNNSFEGEIPPSLTQCTRLQQVILYNNKL 186

Query: 565 QGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID--VLANL 738
           +G +   F +L  L TLD S N+L G+IP    S  +   + L  N  TG I   ++ + 
Sbjct: 187 EGSIPTRFGTLPELKTLDLSNNALRGDIPPLLGSSPSFVYVDLGGNQLTGGIPEFLVNSS 246

Query: 739 PLDNLNVENNHFTGWIPPQLQGINSLQT 822
            L  L +  N  TG IPP L   ++L T
Sbjct: 247 SLQVLRLTQNSLTGEIPPALFNSSTLTT 274



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/171 (28%), Positives = 88/171 (51%), Gaps = 4/171 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGF 492
           R+ ++ +   +L GS+  +   L  + T D+S N L   +P  L   P+   ++L GN  
Sbjct: 175 RLQQVILYNNKLEGSIPTRFGTLPELKTLDLSNNALRGDIPPLLGSSPSFVYVDLGGNQL 234

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TGG+P  +   + L+ L ++ N L GE+     + + L+T+    N+L G+IP   +   
Sbjct: 235 TGGIPEFLVNSSSLQVLRLTQNSLTGEIPPALFNSSTLTTIYLDRNNLVGSIPPITAIAA 294

Query: 673 NMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            ++ + L+ N  TG I   L NL  L +++++ N+  G IP  L  I +L+
Sbjct: 295 PIQYLSLEQNKLTGGIPASLGNLSSLVHVSLKANNLVGSIPKSLSKIPTLE 345



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 45/161 (27%), Positives = 77/161 (47%), Gaps = 27/161 (16%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLNLAGNG 489
            ++TE  + G    GS+   L Q + +   D S N+ G SLP   + +    Q L+L+ N 
Sbjct: 563  QLTEFHLDGNNFNGSIPSNLGQWRQLEKLDFSHNSFGGSLPSEVFNISSLSQSLDLSHNL 622

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM------------------------FVSL 597
            FTG +P  I  +  L  +++S+N+L GE+                           F++L
Sbjct: 623  FTGPIPLEIGNLINLGSISISNNRLTGEIPSTLGKCVLLEYLHMEGNLLTGSIPRSFMNL 682

Query: 598  TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
             ++  LD S NSL+G +P+  + L++++ + L  N F G I
Sbjct: 683  KSIKELDLSCNSLSGKVPEFLTLLSSLQKLNLSFNDFEGPI 723



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 42/160 (26%), Positives = 79/160 (49%), Gaps = 4/160 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + + G QLTG +   L    S+    ++ N+L   +P  L     +  + L  N   G +
Sbjct: 227 VDLGGNQLTGGIPEFLVNSSSLQVLRLTQNSLTGEIPPALFNSSTLTTIYLDRNNLVGSI 286

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P   +  AP++YL++  N+L G +     +L++L  +    N+L G+IP++ S +  ++ 
Sbjct: 287 PPITAIAAPIQYLSLEQNKLTGGIPASLGNLSSLVHVSLKANNLVGSIPKSLSKIPTLER 346

Query: 685 MYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQL 798
           + L  N  TG +   + N+  L  L++ NN   G +PP +
Sbjct: 347 LVLTYNNLTGHVPQAIFNISSLKYLSMANNSLIGQLPPDI 386



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 51/191 (26%), Positives = 89/191 (46%), Gaps = 15/191 (7%)
 Frame = +1

Query: 313 GNRVTEIQ---ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-YQLPPNVQKLNLA 480
           GNR+  ++   +S  QL G +   L  +  +    ++   L   +P +   PN+  L+L 
Sbjct: 387 GNRLPNLEALILSTTQLNGPIPASLRNMSKLEMVYLAAAGLTGIVPSFGSLPNLHDLDLG 446

Query: 481 GNGFTGG---LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL-TNLSTLDFSFNSLAGNI 648
            N    G      S++    L+ L +  N LQG +     +L + L+ L    N L+G I
Sbjct: 447 YNQLEAGDWSFLSSLANCTQLKKLALDANFLQGTLPSSVGNLPSQLNWLWLRQNKLSGTI 506

Query: 649 PQTFSSLTNMKNMYLQNNVFTG----TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           P    +L ++  +YL  N+F+G    TI  L+NL +  L++  N+ +G IP  +  +  L
Sbjct: 507 PSEIGNLKSLSVLYLDENMFSGSIPPTIGNLSNLLV--LSLAQNNLSGLIPDSIGNLAQL 564

Query: 817 ---QTGGNSWN 840
                 GN++N
Sbjct: 565 TEFHLDGNNFN 575



>gb:AC144737_1744140 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0018K15, complete sequence.
          Length = 917

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 69/204 (33%), Positives = 107/204 (52%), Gaps = 8/204 (3%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGN--RVTEIQISGLQLTGSMGFQ-LDQLKSVTTFDIST 417
           L  W+ +    C  +W GVSC     RV  + +    L+G +    L +L ++ +  +  
Sbjct: 44  LAAWSEDADRAC--AWPGVSCDARAGRVDAVALPSAGLSGRLPRSALLRLDALLSLALPG 101

Query: 418 NNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
           NNL   LP  LPP  + L+L+ N  +G LP +++    L  LN+S N L G V     SL
Sbjct: 102 NNLSGPLPDALPPRARALDLSANSLSGYLPAALASCGSLVSLNLSGNLLSGPVPDGIWSL 161

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNH 771
            +L +LD S N LAG++P  F   ++++ + L  N+  G I  DV     L +L+V +N 
Sbjct: 162 PSLRSLDLSGNQLAGSVPGGFPRSSSLRVLDLSRNLLEGEIPADVGEAGLLKSLDVGHNL 221

Query: 772 FTGWIPPQLQ---GINSLQTGGNS 834
           FTG +P  L+   G++SL  GGN+
Sbjct: 222 FTGELPESLRGLTGLSSLGAGGNA 245



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 51/178 (28%), Positives = 92/178 (51%), Gaps = 4/178 (2%)
 Frame = +1

Query: 298 GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL--PYQLPPNVQKL 471
           G+S   N V E+ +SG  LTG + + +  L ++    ++ N L   +  P      +Q+L
Sbjct: 277 GISGCKNLV-EVDLSGNALTGELPWWVFGLAALQRVSLAGNALSGWIKAPGDNASALQEL 335

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L+GN F+G +P  I+ ++ L++LN+S N + G++ V    +  L  +D S N L+G +P
Sbjct: 336 DLSGNAFSGVIPREIASLSRLQHLNLSSNTMSGKLPVSIGRMALLEVMDVSRNQLSGGVP 395

Query: 652 QTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
                   ++ + + +N  TG I   + N   L  L++ +N  TG IP  +  +  LQ
Sbjct: 396 PEIGGAAALRKLLMGSNSLTGIIPPQIGNCRNLIALDLSHNKLTGPIPATIGNLTGLQ 453



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/178 (27%), Positives = 85/178 (47%), Gaps = 6/178 (3%)
 Frame = +1

Query: 274 DPCGESWKGVS----CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP 441
           D  G ++ GV      S +R+  + +S   ++G +   + ++  +   D+S N L   +P
Sbjct: 336 DLSGNAFSGVIPREIASLSRLQHLNLSSNTMSGKLPVSIGRMALLEVMDVSRNQLSGGVP 395

Query: 442 YQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTL 615
            ++     ++KL +  N  TG +P  I     L  L++SHN+L G +     +LT L  +
Sbjct: 396 PEIGGAAALRKLLMGSNSLTGIIPPQIGNCRNLIALDLSHNKLTGPIPATIGNLTGLQMV 455

Query: 616 DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
           DFS N L G +P   S L N++   + +N+ +G      NLP+       +HF   IP
Sbjct: 456 DFSENKLNGTLPVELSKLANLRVFNVSHNLLSG------NLPI-------SHFFDTIP 500



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 69/252 (27%), Positives = 105/252 (41%), Gaps = 4/252 (1%)
 Frame = +1

Query: 76  LSERASLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTK 255
           L   A L++  L+ L      L G L +A P      D +  S+   L ++L S   L  
Sbjct: 83  LPRSALLRLDALLSLALPGNNLSGPLPDALPPRARALDLSANSLSGYLPAALASCGSLVS 142

Query: 256 WTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS 435
              +G    G    G+  S   +  + +SG QL GS+     +  S+   D+S N L   
Sbjct: 143 LNLSGNLLSGPVPDGI-WSLPSLRSLDLSGNQLAGSVPGGFPRSSSLRVLDLSRNLLEGE 201

Query: 436 LPYQLPPN--VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
           +P  +     ++ L++  N FTG LP S+  +  L  L    N L GE+      +  L 
Sbjct: 202 IPADVGEAGLLKSLDVGHNLFTGELPESLRGLTGLSSLGAGGNALAGELPGWIGEMAALE 261

Query: 610 TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGW 783
           TLD S N   G IP   S   N+  + L  N  TG +   V     L  +++  N  +GW
Sbjct: 262 TLDLSGNRFVGAIPDGISGCKNLVEVDLSGNALTGELPWWVFGLAALQRVSLAGNALSGW 321

Query: 784 IPPQLQGINSLQ 819
           I       ++LQ
Sbjct: 322 IKAPGDNASALQ 333



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 51/191 (26%), Positives = 86/191 (45%), Gaps = 31/191 (16%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGLPYSISQMA 528
           TG +   L  L  +++     N L   LP  +     ++ L+L+GN F G +P  IS   
Sbjct: 223 TGELPESLRGLTGLSSLGAGGNALAGELPGWIGEMAALETLDLSGNRFVGAIPDGISGCK 282

Query: 529 PLEYLNVSHNQLQGEV--------TVMFVSLTN----------------LSTLDFSFNSL 636
            L  +++S N L GE+         +  VSL                  L  LD S N+ 
Sbjct: 283 NLVEVDLSGNALTGELPWWVFGLAALQRVSLAGNALSGWIKAPGDNASALQELDLSGNAF 342

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQG-- 804
           +G IP+  +SL+ ++++ L +N  +G + V       L+ ++V  N  +G +PP++ G  
Sbjct: 343 SGVIPREIASLSRLQHLNLSSNTMSGKLPVSIGRMALLEVMDVSRNQLSGGVPPEIGGAA 402

Query: 805 -INSLQTGGNS 834
            +  L  G NS
Sbjct: 403 ALRKLLMGSNS 413



>gb:AB019228_1514104 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCK7.>gb:AY065009_1566175 Arabidopsis thaliana
           unknown protein mRNA, complete cds.>gb:BT001138_1635393
           Arabidopsis thaliana At5g58299/At5g58299 mRNA, complete
           cds.
          Length = 654

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 73/223 (32%), Positives = 104/223 (46%), Gaps = 2/223 (0%)
 Frame = +1

Query: 172 AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS--GNRVTEIQISG 345
           A+AD +    S  + L +   S P L +   N  +   +SW GV+C+  G  V  +++ G
Sbjct: 41  AIADLN----SDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGTSVHALRLPG 96

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM 525
           + L G                I  N LG         +++ L+L  N  +G LP  I  +
Sbjct: 97  IGLLGP---------------IPPNTLGKL------ESLRILSLRSNLLSGNLPPDIHSL 135

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+Y+ + HN   GEV   FVS   L+ LD SFNS  G IP TF +L  +  + LQNN 
Sbjct: 136 PSLDYIYLQHNNFSGEVP-SFVS-RQLNILDLSFNSFTGKIPATFQNLKQLTGLSLQNNK 193

Query: 706 FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS 834
            +G +  L  + L  LN+ NNH  G IP  L G  S    GN+
Sbjct: 194 LSGPVPNLDTVSLRRLNLSNNHLNGSIPSALGGFPSSSFSGNT 236



>gb:AE016959_1021899 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC134517_1741818
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OJA1325D05, complete sequence.>gb:AE017077_1751718
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 31 of 77 of the complete sequence.
          Length = 751

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 60/184 (32%), Positives = 98/184 (53%), Gaps = 8/184 (4%)
 Frame = +1

Query: 292 WKGVSCSGN----RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN 459
           WKGV+CS +    RVT +++  L L G++  QL  L  +   D+S N L   +P+ L   
Sbjct: 16  WKGVTCSSHAHPGRVTALRMRDLGLVGAISPQLSNLTYLQALDLSNNRLQGEIPHDLGSC 75

Query: 460 V--QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
           V  + +NL+ N  +G +P+SI  +  L  LNV +N++ G V     +LT L+ L  + N 
Sbjct: 76  VALRAINLSVNSLSGQIPWSIGNLPKLAVLNVRNNKISGNVPASLGNLTALTMLSIADNY 135

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGI 807
           + G IP    ++TN+ ++ +  NVF G +  ++     L  L++  N   G  PP+L  I
Sbjct: 136 VNGRIPPWIGNMTNLTDLNVAGNVFHGYVPSNIAGLTNLLALSLLGNKLQGVFPPELFNI 195

Query: 808 NSLQ 819
            SL+
Sbjct: 196 TSLE 199



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 47/165 (28%), Positives = 73/165 (44%), Gaps = 12/165 (7%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP---NVQKLNLAGNGFTGG 501
           + + G +L G    +L  + S+    I  N L   LP  + P   N+  L+   N F G 
Sbjct: 177 LSLLGNKLQGVFPPELFNITSLEIMYIGLNMLSGFLPMDIGPKLPNLVFLSTIYNQFEGP 236

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P S+S ++ LEYL +  N+ QG +     S   ++ L+   N L    P     LT++ 
Sbjct: 237 IPDSLSNISKLEYLQLHGNKFQGRIPPNIWSSGTITRLNLGNNILEAKTPNDRDFLTSLT 296

Query: 682 N------MYLQNNVFTGTI-DVLANL--PLDNLNVENNHFTGWIP 789
           N      + LQ N  +G I + L NL   L  + +  N   G IP
Sbjct: 297 NCSELVTLDLQFNRLSGFIPNTLVNLSQELIWIGLGGNQIFGTIP 341



>gb:AP004747_1844315 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0407A09.
          Length = 1031

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 70/188 (37%), Positives = 99/188 (52%), Gaps = 12/188 (6%)
 Frame = +1

Query: 292 WKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-- 456
           W GV C  N   RVT ++++G  L+G +   L  L  + T D+S+NN       Q+PP  
Sbjct: 83  WSGVKCKPNTRGRVTALKLAGQGLSGQITSFLGNLTDLHTLDLSSNNFSG----QIPPLT 138

Query: 457 NVQKLN---LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSF 627
           N+QKL    L  N   G +P S++  + L YL++S+N L+G +      L NLS L F  
Sbjct: 139 NLQKLKYLRLGQNSLDGIIPDSLTNCSNLFYLDLSNNMLEGTIPPKIGFLNNLSVLAFPL 198

Query: 628 NSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQ 795
           N L GNIP T  +LTN+  M L NN   G I      L+NL   +L+ ENN   G+    
Sbjct: 199 NFLTGNIPSTLGNLTNLNIMLLANNKIDGNIPQELGQLSNLGWLSLS-ENNLSGGFPQGF 257

Query: 796 LQGINSLQ 819
            + ++SLQ
Sbjct: 258 FKNLSSLQ 265



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 47/168 (27%), Positives = 78/168 (46%), Gaps = 3/168 (1%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY-QLPPNVQKLNLAGNGFTG 498
           +T + + G  LTG +   +  L+ + +  +  N    ++ +     N+Q L L  N FTG
Sbjct: 392 LTILLLGGNNLTGIVPLSIGNLQGLISLGLDNNGFSGTIEWIGKLKNLQSLCLRNNNFTG 451

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
            +PYSI ++  L  L + +N  +G +     +   L  LD S+N L G IP   S+L  +
Sbjct: 452 PIPYSIGKLTQLTELYLRNNAFEGHIPPSLGNPQLLLKLDLSYNKLQGTIPLEISNLRQL 511

Query: 679 KNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
             + L +N   G I D L     L  + ++ N   G +P     +NSL
Sbjct: 512 IYLQLASNKLNGEIPDALGMCQNLVTIQMDQNFLRGDMPISFGNLNSL 559



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 2/127 (1%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGG 501
           ++ +S  +L G++  ++  L+ +    +++N L   +P  L    N+  + +  N   G 
Sbjct: 489 KLDLSYNKLQGTIPLEISNLRQLIYLQLASNKLNGEIPDALGMCQNLVTIQMDQNFLRGD 548

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P S   +  L  LN+SHN L G + V    L  LS LD S+N+L G +P T     N+ 
Sbjct: 549 MPISFGNLNSLTILNISHNNLSGTIPVALGYLPLLSKLDLSYNNLQGEVP-TVGVFRNVT 607

Query: 682 NMYLQNN 702
           + YL  N
Sbjct: 608 SAYLDGN 614



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 54/203 (26%), Positives = 84/203 (41%), Gaps = 59/203 (29%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNGF--------------------- 492
           L S+    I T  LG +LP+ +    PN+ KL LA N F                     
Sbjct: 261 LSSLQILSIQTTLLGGTLPFDIGNTLPNLTKLFLADNMFEGHIPASLGNASLLRGIDLSL 320

Query: 493 ---TGGLPYSISQMAPLEYLNVSHNQLQ------------------------------GE 573
              TG +P S  +++ L  LN+  N+L+                              G+
Sbjct: 321 NNSTGHIPNSFGRLSGLSTLNLETNKLEARDNQGWEFLEALRGCNNLNVLSLADNLLFGD 380

Query: 574 VTVMFVSLT-NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP-LD 747
           V      L+ NL+ L    N+L G +P +  +L  + ++ L NN F+GTI+ +  L  L 
Sbjct: 381 VPNSIGGLSINLTILLLGGNNLTGIVPLSIGNLQGLISLGLDNNGFSGTIEWIGKLKNLQ 440

Query: 748 NLNVENNHFTGWIPPQLQGINSL 816
           +L + NN+FTG IP  +  +  L
Sbjct: 441 SLCLRNNNFTGPIPYSIGKLTQL 463



>gb:AY070033_1566676 Arabidopsis thaliana unknown protein
           (At3g56370) mRNA, complete cds.
          Length = 964

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 81/273 (29%), Positives = 125/273 (45%), Gaps = 39/273 (14%)
 Frame = +1

Query: 133 ALLIGFLLNAPPSAVADTDPTDASVLRGLF---SSLNSPPQ-LTKWTANGGDPCGESWKG 300
           AL+   LL +  + V   DP     + GL    + L  P Q L  W  +   PC  SW G
Sbjct: 4   ALIFTVLLVSAVAPVRSLDPPLNGDVLGLIVFKADLRDPEQKLASWNEDDYTPC--SWNG 61

Query: 301 VSCSG--NRVTEIQISGLQLTGSMGFQLDQLK-------------------------SVT 399
           V C    NRVTE+ + G  L+G +G  L QL+                         ++ 
Sbjct: 62  VKCHPRTNRVTELNLDGFSLSGRIGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLK 121

Query: 400 TFDISTNNLGNSLP---YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQG 570
             D+S+N L  SLP   ++   +++ L+LA N  TG +P SIS  + L  LN+S N   G
Sbjct: 122 VVDLSSNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSG 181

Query: 571 EVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPL 744
            + +   SL  L +LD S N L G  P+    L N++ + L  N  +G I  ++ + + L
Sbjct: 182 SMPLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLL 241

Query: 745 DNLNVENNHFTGWIPPQLQGIN---SLQTGGNS 834
             +++  N  +G +P   Q ++   SL  G N+
Sbjct: 242 KTIDLSENSLSGSLPNTFQQLSLCYSLNLGKNA 274



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 45/162 (27%), Positives = 83/162 (51%), Gaps = 4/162 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNG 489
           N +  + +S  +L G    ++D+L ++   D+S N L   +P ++   +  + ++L+ N 
Sbjct: 191 NTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKTIDLSENS 250

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G LP +  Q++    LN+  N L+GEV      + +L TLD S N  +G +P +  +L
Sbjct: 251 LSGSLPNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNL 310

Query: 670 TNMKNMYLQNNVFTGTIDV-LAN-LPLDNLNVENNHFTGWIP 789
             +K +    N   G++ V  AN + L  L++  N  TG +P
Sbjct: 311 LALKVLNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLP 352



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 2/132 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + +S   LTG +   + +LK ++  D+S N L   +P +     ++++L L  N   G +
Sbjct: 405 LHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNLLEGNI 464

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P SI   + L  L +SHN+L G +      LT L  +D SFN LAG +P+  ++L  +  
Sbjct: 465 PSSIKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANLGYLHT 524

Query: 685 MYLQNNVFTGTI 720
             + +N   G +
Sbjct: 525 FNISHNHLFGEL 536



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 53/191 (27%), Positives = 88/191 (46%), Gaps = 21/191 (10%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQ-----------------LKSVTTFDISTNNLGNSLPYQLPP- 456
           + +SG  LTG +   L Q                 +K +   D+S N     +   L   
Sbjct: 340 LDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIGAGLGDL 399

Query: 457 -NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
            +++ L+L+ N  TG +P +I ++  L  L+VSHNQL G +        +L  L    N 
Sbjct: 400 RDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNL 459

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGI 807
           L GNIP +  + ++++++ L +N   G+I   LA L  L+ +++  N   G +P QL  +
Sbjct: 460 LEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANL 519

Query: 808 NSLQTGGNSWN 840
             L T   S N
Sbjct: 520 GYLHTFNISHN 530



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 52/191 (27%), Positives = 84/191 (43%), Gaps = 21/191 (10%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL-------------------P 453
           +  SG  L GS+        ++   D+S N+L   LP  L                    
Sbjct: 316 LNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGI 375

Query: 454 PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
             +Q L+L+ N F+G +   +  +  LE L++S N L G +      L +LS LD S N 
Sbjct: 376 KKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQ 435

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGI 807
           L G IP+      +++ + L+NN+  G I   +     L +L + +N   G IPP+L  +
Sbjct: 436 LNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAKL 495

Query: 808 NSLQTGGNSWN 840
             L+    S+N
Sbjct: 496 TRLEEVDLSFN 506



>gb:AE016959_1020720 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079179_1732391
           Oryza sativa chromosome 10 clone OSJNBa0079B05, complete
           sequence.>gb:AC116601_1739317 Oryza sativa chromosome 10
           clone OSJNAa0079B05, complete
           sequence.>gb:AE017051_1750539 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 5 of 77 of the
           complete sequence.
          Length = 394

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 61/173 (35%), Positives = 93/173 (53%), Gaps = 6/173 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFT 495
           +T + +S   LTG +   L  L  VTTF +  N + + +P +  L  N+Q L+L+ N  T
Sbjct: 125 LTTLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLANLQSLSLSNNTLT 184

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P +++ +  L  L +  N+L G +      LT +  L+ S N L G +P   S+LT 
Sbjct: 185 GEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGELPSCLSNLTK 244

Query: 676 MKNMYLQNNVFTGT----IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           MK +YL  N  TG+    I +LANL L  L++ NN F+G IP  L  + +L T
Sbjct: 245 MKELYLHQNQITGSIPKEIGMLANLQL--LSLGNNTFSGEIPTTLANLTNLAT 295



 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 58/178 (32%), Positives = 91/178 (51%), Gaps = 6/178 (3%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLA 480
           C   ++  +++SG +LTG +   L  L  +    +  N +  S+P ++    N+Q L+L 
Sbjct: 216 CMLTKIQYLELSGNKLTGELPSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLG 275

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
            N F+G +P +++ +  L  L +  N+L G +      LT +  L  + N L   IP   
Sbjct: 276 NNTFSGEIPTTLANLTNLATLYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACL 335

Query: 661 SSLTNMKNMYLQNNVFTGT----IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           S LT M+ +YL  N  TG+    I +LANL L  LNV NN F+G IP  L  + +L T
Sbjct: 336 SDLTKMEKLYLYQNQITGSIPKEIGMLANLHL--LNVGNNAFSGEIPITLSNLTNLAT 391



 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 48/167 (28%), Positives = 79/167 (47%), Gaps = 4/167 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S   LTG +   L  L ++ T  +  N L   +P +L     +Q L L+GN  TG L
Sbjct: 176 LSLSNNTLTGEIPRTLANLTNLATLQLYGNELSGPIPQKLCMLTKIQYLELSGNKLTGEL 235

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  +S +  ++ L +  NQ+ G +      L NL  L    N+ +G IP T ++LTN+  
Sbjct: 236 PSCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLAT 295

Query: 685 MYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +YL  N  +G I   +     +  L + +N  T  IP  L  +  ++
Sbjct: 296 LYLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKME 342



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 43/135 (31%), Positives = 74/135 (54%), Gaps = 4/135 (2%)
 Frame = +1

Query: 430 NSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
           +SLPY     +  ++L+ N  +G +P +I+ ++ L +L +  N L G +      L +L+
Sbjct: 72  SSLPY-----LTYIDLSKNSLSGPIPSNINSLSALVHLELQLNLLTGRIPDEIGELRSLT 126

Query: 610 TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG----TIDVLANLPLDNLNVENNHFT 777
           TL  SFN+L G+IP +  +LT +   ++  N+ +      I +LAN  L +L++ NN  T
Sbjct: 127 TLSLSFNNLTGHIPASLGNLTMVTTFFVHQNMISSFIPKEIGLLAN--LQSLSLSNNTLT 184

Query: 778 GWIPPQLQGINSLQT 822
           G IP  L  + +L T
Sbjct: 185 GEIPRTLANLTNLAT 199



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 28/158 (17%)
 Frame = +1

Query: 304 SCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKL 471
           SC  N  ++ E+ +   Q+TGS+  ++  L ++    +  N     +P  L    N+  L
Sbjct: 237 SCLSNLTKMKELYLHQNQITGSIPKEIGMLANLQLLSLGNNTFSGEIPTTLANLTNLATL 296

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT----------------- 600
            L GN  +G +P  +  +  ++YL ++ N+L  E+      LT                 
Sbjct: 297 YLWGNELSGPIPQKLCMLTKMQYLGLNSNKLTSEIPACLSDLTKMEKLYLYQNQITGSIP 356

Query: 601 -------NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
                  NL  L+   N+ +G IP T S+LTN+  +YL
Sbjct: 357 KEIGMLANLHLLNVGNNAFSGEIPITLSNLTNLATLYL 394



>pir|T49038|T49038 hypothetical protein T5P19.20 - Arabidopsis
           thaliana>gb:AB076906_1523529 Arabidopsis thaliana IRK
           mRNA for inflorescence and root apices receptor-like
           kinase, complete cds.>gb:AB076907_1523530 Arabidopsis
           thaliana IRK gene for inflorescence and root apices
           receptor-like kinase, complete cds.>gb:ATT5P19_1556242
           Arabidopsis thaliana DNA chromosome 3, BAC clone T5P19.
          Length = 964

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 81/273 (29%), Positives = 125/273 (45%), Gaps = 39/273 (14%)
 Frame = +1

Query: 133 ALLIGFLLNAPPSAVADTDPTDASVLRGLF---SSLNSPPQ-LTKWTANGGDPCGESWKG 300
           AL+   LL +  + V   DP     + GL    + L  P Q L  W  +   PC  SW G
Sbjct: 4   ALIFTVLLVSAVAPVRSLDPPLNDDVLGLIVFKADLRDPEQKLASWNEDDYTPC--SWNG 61

Query: 301 VSCSG--NRVTEIQISGLQLTGSMGFQLDQLK-------------------------SVT 399
           V C    NRVTE+ + G  L+G +G  L QL+                         ++ 
Sbjct: 62  VKCHPRTNRVTELNLDGFSLSGRIGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLK 121

Query: 400 TFDISTNNLGNSLP---YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQG 570
             D+S+N L  SLP   ++   +++ L+LA N  TG +P SIS  + L  LN+S N   G
Sbjct: 122 VVDLSSNGLSGSLPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSNGFSG 181

Query: 571 EVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPL 744
            + +   SL  L +LD S N L G  P+    L N++ + L  N  +G I  ++ + + L
Sbjct: 182 SMPLGIWSLNTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLL 241

Query: 745 DNLNVENNHFTGWIPPQLQGIN---SLQTGGNS 834
             +++  N  +G +P   Q ++   SL  G N+
Sbjct: 242 KTIDLSENSLSGSLPNTFQQLSLCYSLNLGKNA 274



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 45/162 (27%), Positives = 83/162 (51%), Gaps = 4/162 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNG 489
           N +  + +S  +L G    ++D+L ++   D+S N L   +P ++   +  + ++L+ N 
Sbjct: 191 NTLRSLDLSRNELEGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKTIDLSENS 250

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G LP +  Q++    LN+  N L+GEV      + +L TLD S N  +G +P +  +L
Sbjct: 251 LSGSLPNTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPDSIGNL 310

Query: 670 TNMKNMYLQNNVFTGTIDV-LAN-LPLDNLNVENNHFTGWIP 789
             +K +    N   G++ V  AN + L  L++  N  TG +P
Sbjct: 311 LALKVLNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLP 352



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 2/132 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + +S   LTG +   + +LK ++  D+S N L   +P +     ++++L L  N   G +
Sbjct: 405 LHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNLLEGNI 464

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P SI   + L  L +SHN+L G +      LT L  +D SFN LAG +P+  ++L  +  
Sbjct: 465 PSSIKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANLGYLHT 524

Query: 685 MYLQNNVFTGTI 720
             + +N   G +
Sbjct: 525 FNISHNHLFGEL 536



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 53/191 (27%), Positives = 88/191 (46%), Gaps = 21/191 (10%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQ-----------------LKSVTTFDISTNNLGNSLPYQLPP- 456
           + +SG  LTG +   L Q                 +K +   D+S N     +   L   
Sbjct: 340 LDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGIKKIQVLDLSHNAFSGEIGAGLGDL 399

Query: 457 -NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
            +++ L+L+ N  TG +P +I ++  L  L+VSHNQL G +        +L  L    N 
Sbjct: 400 RDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNL 459

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGI 807
           L GNIP +  + ++++++ L +N   G+I   LA L  L+ +++  N   G +P QL  +
Sbjct: 460 LEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANL 519

Query: 808 NSLQTGGNSWN 840
             L T   S N
Sbjct: 520 GYLHTFNISHN 530



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 52/191 (27%), Positives = 84/191 (43%), Gaps = 21/191 (10%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL-------------------P 453
           +  SG  L GS+        ++   D+S N+L   LP  L                    
Sbjct: 316 LNFSGNGLIGSLPVSTANCINLLALDLSGNSLTGKLPMWLFQDGSRDVSALKNDNSTGGI 375

Query: 454 PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
             +Q L+L+ N F+G +   +  +  LE L++S N L G +      L +LS LD S N 
Sbjct: 376 KKIQVLDLSHNAFSGEIGAGLGDLRDLEGLHLSRNSLTGPIPSTIGELKHLSVLDVSHNQ 435

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGI 807
           L G IP+      +++ + L+NN+  G I   +     L +L + +N   G IPP+L  +
Sbjct: 436 LNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLRSLILSHNKLLGSIPPELAKL 495

Query: 808 NSLQTGGNSWN 840
             L+    S+N
Sbjct: 496 TRLEEVDLSFN 506



>gb:AY086189_1571244 Arabidopsis thaliana clone 22221 mRNA, complete
           sequence.
          Length = 639

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 72/228 (31%), Positives = 105/228 (46%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE 330
           LL+ P  ++ D    D S L    S++     L  W      PC  +W GV C G RVT 
Sbjct: 12  LLSLPLPSIGDL-AADKSALLSFRSAVGGRTLL--WDVKQTSPC--NWTGVLCDGGRVTA 66

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY 510
           +++ G  L+G                I     GN         ++ L+L  NG TG LP 
Sbjct: 67  LRLPGETLSGH---------------IPEGIFGNLT------QLRTLSLRLNGLTGSLPL 105

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            + + + L  L +  N+  GE+  +  SL+NL  L+ + N  +G I   F +LT +K +Y
Sbjct: 106 DLGRCSDLRRLYLQGNRFSGEIPEVLFSLSNLVRLNLAENEFSGEISSGFKNLTRLKTLY 165

Query: 691 LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS 834
           L+NN  +G++  L +L LD  NV NN   G IP  LQ  +S    G S
Sbjct: 166 LENNKLSGSLLDL-DLSLDQFNVSNNLLNGSIPKSLQKFDSDSFVGTS 212



>gb:AB019230_1514140 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MEB5.>gb:AY095994_1575868 Arabidopsis thaliana
           AT3g17840/MEB5_6 mRNA, complete cds.>gb:BT002283_1635886
           Arabidopsis thaliana At3g17840/MEB5_6 mRNA, complete
           cds.
          Length = 647

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 72/228 (31%), Positives = 104/228 (45%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE 330
           LL+ P  ++ D    D S L    S++     L  W      PC  +W GV C G RVT 
Sbjct: 20  LLSLPLPSIGDL-AADKSALLSFRSAVGGRTLL--WDVKQTSPC--NWTGVLCDGGRVTA 74

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY 510
           +++ G  L+G                I     GN         ++ L+L  NG TG LP 
Sbjct: 75  LRLPGETLSGH---------------IPEGIFGNLT------QLRTLSLRLNGLTGSLPL 113

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            +   + L  L +  N+  GE+  +  SL+NL  L+ + N  +G I   F +LT +K +Y
Sbjct: 114 DLGSCSDLRRLYLQGNRFSGEIPEVLFSLSNLVRLNLAENEFSGEISSGFKNLTRLKTLY 173

Query: 691 LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS 834
           L+NN  +G++  L +L LD  NV NN   G IP  LQ  +S    G S
Sbjct: 174 LENNKLSGSLLDL-DLSLDQFNVSNNLLNGSIPKSLQKFDSDSFVGTS 220



>gb:AP005420_1851511 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0418B08.>gb:AP005579_1854425 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1740_D06.
          Length = 1080

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 73/234 (31%), Positives = 116/234 (49%), Gaps = 4/234 (1%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           A A++ G+       A+     T  ++ RGL  +L SP  L  W  +  D CG  + GV+
Sbjct: 32  AEAIVGGWRQRRRLQALMQEKATLLALKRGL--TLLSPKLLADWNDSNTDVCG--FTGVA 87

Query: 307 CSGNR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA 480
           C   R  V  +Q+S + + GS+   L QL                      P+++ L+L+
Sbjct: 88  CDRRRQHVVGLQLSNMSINGSIPLALAQL----------------------PHLRYLDLS 125

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
            N  +G +P  +S +  L  L++S NQL G +   F +LT L  LD S N L+G IP +F
Sbjct: 126 DNHISGAVPSFLSNLTQLLMLDMSENQLSGAIPPSFGNLTQLRKLDISKNQLSGAIPPSF 185

Query: 661 SSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
            +LTN++ + +  NV TG I + L+N+  L+ LN+  N+  G IP     + +L
Sbjct: 186 GNLTNLEILDMSINVLTGRIPEELSNIGKLEGLNLGQNNLVGSIPASFTQLKNL 239



 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 63/228 (27%), Positives = 100/228 (43%), Gaps = 3/228 (1%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGL--FSSLNSPPQLTKWTANGGDPCGESWK 297
           W     I +LL+   +++AD  PT  S++ GL     L+    +   + +G    G  + 
Sbjct: 307 WLANCTILYLLDVENNSLADDLPT--SIISGLRNLRYLHLSNNVHFASGDGNTNLGPFFA 364

Query: 298 GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL 477
            VS +   + EI+   L + G +   L  L                    LPPN+  LNL
Sbjct: 365 AVS-NCTSILEIEAGALGIGGRLPSLLGSL--------------------LPPNMSHLNL 403

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N   G +P  I  +  +  +N+S N L G +      L NL  LD S NSL G +P  
Sbjct: 404 ELNAIEGPIPADIGDVINITLMNLSSNLLNGTIPTSICWLPNLQQLDLSRNSLTGAVPAC 463

Query: 658 FSSLTNMKNMYLQNNVFTGTI-DVLANLPLDNLNVENNHFTGWIPPQL 798
            S+ T++  + L +N  +G+I   + +L L  L++  N  +G IP  L
Sbjct: 464 ISNATSLGELDLSSNALSGSIPSSIGSLKLSYLSLHRNQLSGEIPASL 511



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 50/178 (28%), Positives = 89/178 (50%), Gaps = 4/178 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T + +S   L G++   +  L ++   D+S N+L  ++P  +    ++ +L+L+ N  +
Sbjct: 422 ITLMNLSSNLLNGTIPTSICWLPNLQQLDLSRNSLTGAVPACISNATSLGELDLSSNALS 481

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P SI  +  L YL++  NQL GE+         +  LD S N L G IP   + +  
Sbjct: 482 GSIPSSIGSLK-LSYLSLHRNQLSGEIPASLGQHLGIVRLDLSSNRLTGEIPDAVAGIVQ 540

Query: 676 MKNMYLQNNVFTGTID-VLANLPL-DNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           M ++ L  N+  G +   L+ L + + +++  N+ TG I P+L     LQ    S NS
Sbjct: 541 M-SLNLSRNLLGGRLPRGLSRLQMAEVIDLSWNNLTGAIFPELGACAELQVLDLSHNS 597



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 2/132 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           + +S   L G +   L +L+     D+S NNL  ++  +L     +Q L+L+ N  TG L
Sbjct: 543 LNLSRNLLGGRLPRGLSRLQMAEVIDLSWNNLTGAIFPELGACAELQVLDLSHNSLTGVL 602

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P S+  +  +E L+VS N L GE+       T L+ L+ S+N LAG +P           
Sbjct: 603 PSSLDGLESIERLDVSDNSLTGEIPQTLTKCTTLTYLNLSYNDLAGVVPTAGVFANFTST 662

Query: 685 MYLQNNVFTGTI 720
            YL N    G +
Sbjct: 663 SYLGNPRLCGAV 674



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 47/186 (25%), Positives = 80/186 (43%), Gaps = 34/186 (18%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++ ++ IS  QL+G++      L ++   D+S N L   +P +L     ++ LNL  N  
Sbjct: 166 QLRKLDISKNQLSGAIPPSFGNLTNLEILDMSINVLTGRIPEELSNIGKLEGLNLGQNNL 225

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFS--------------- 624
            G +P S +Q+  L YL++  N L G +   +F + T +   D                 
Sbjct: 226 VGSIPASFTQLKNLFYLSLEKNSLSGSIPATIFTNCTQMGVFDLGDNNITGEIPGDASDS 285

Query: 625 -----------FNSLAGNIPQ-----TFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN 756
                       NSL G +P+     T   L +++N  L +++ T  I  L NL   +L+
Sbjct: 286 LSDRFAVLNLYSNSLTGRLPRWLANCTILYLLDVENNSLADDLPTSIISGLRNLRYLHLS 345

Query: 757 VENNHF 774
             N HF
Sbjct: 346 -NNVHF 350



>gb:BT006486_1639373 Arabidopsis thaliana At5g49760 gene, complete
           cds.>gb:AK117123_1815170 Arabidopsis thaliana At5g49760
           mRNA for putative receptor protein kinase, complete cds,
           clone: RAFL16-66-A16.
          Length = 953

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 69/232 (29%), Positives = 105/232 (45%), Gaps = 16/232 (6%)
 Frame = +1

Query: 169 SAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGL 348
           S  A T+  DAS L  L S   +PP    W   G DPCG +W G++C  +RV  I +  L
Sbjct: 20  SVSALTNGLDASALNALKSEWTTPPD--GW--EGSDPCGTNWVGITCQNDRVVSISLGNL 75

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV------QKLNLAGNGFTGGLPY 510
            L G +   +  L  +   D+S N     L   LPPN+      + L L G  F+G +P 
Sbjct: 76  DLEGKLPADISFLSELRILDLSYN---PKLSGPLPPNIGNLGKLRNLILVGCSFSGQIPE 132

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT-------FSSL 669
           SI  +  L YL+++ N+  G +      L+ L   D + N + G +P +          L
Sbjct: 133 SIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAPGLDML 192

Query: 670 TNMKNMYLQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
              K+ +   N  +G I      +N+ L ++  + N FTG IP  L  + +L
Sbjct: 193 LQTKHFHFGKNKLSGNIPKELFSSNMSLIHVLFDGNQFTGEIPETLSLVKTL 244



>gb:AB025613_1516372 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2I5.
          Length = 941

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 69/232 (29%), Positives = 105/232 (45%), Gaps = 16/232 (6%)
 Frame = +1

Query: 169 SAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGL 348
           S  A T+  DAS L  L S   +PP    W   G DPCG +W G++C  +RV  I +  L
Sbjct: 20  SVSALTNGLDASALNALKSEWTTPPD--GW--EGSDPCGTNWVGITCQNDRVVSISLGNL 75

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV------QKLNLAGNGFTGGLPY 510
            L G +   +  L  +   D+S N     L   LPPN+      + L L G  F+G +P 
Sbjct: 76  DLEGKLPADISFLSELRILDLSYN---PKLSGPLPPNIGNLGKLRNLILVGCSFSGQIPE 132

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT-------FSSL 669
           SI  +  L YL+++ N+  G +      L+ L   D + N + G +P +          L
Sbjct: 133 SIGTLKELIYLSLNLNKFSGTIPPSIGLLSKLYWFDIADNQIEGELPVSNGTSAPGLDML 192

Query: 670 TNMKNMYLQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
              K+ +   N  +G I      +N+ L ++  + N FTG IP  L  + +L
Sbjct: 193 LQTKHFHFGKNKLSGNIPKELFSSNMSLIHVLFDGNQFTGEIPETLSLVKTL 244



>gb:AX196315_1463942 Sequence 22 from Patent WO0151627.
          Length = 877

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 58/199 (29%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 116 LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 175

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 176 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 235

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 236 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 295

Query: 760 ENNHFTGWIPPQLQGINSL 816
           +NN FTG +P  L  +  L
Sbjct: 296 DNNFFTGDVPASLGSLREL 314



 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 240 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDNNF 299

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 300 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 359

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 360 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 411



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 278 SWGGNSKNGFFRLQNLILDNNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 337

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 338 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 397

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 398 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 457

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 458 SSSFVGN 464



>gb:AX196312_1463939 Sequence 19 from Patent
           WO0151627.>gb:AX196314_1463941 Sequence 21 from Patent
           WO0151627.>gb:AX196316_1463943 Sequence 23 from Patent
           WO0151627.
          Length = 854

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 58/199 (29%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 93  LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 152

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 153 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 212

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 213 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 272

Query: 760 ENNHFTGWIPPQLQGINSL 816
           +NN FTG +P  L  +  L
Sbjct: 273 DNNFFTGDVPASLGSLREL 291



 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 217 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDNNF 276

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 277 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 336

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 337 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 388



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 255 SWGGNSKNGFFRLQNLILDNNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 314

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 315 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 374

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 375 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 434

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 435 SSSFVGN 441



>gb:AX196311_1463938 Sequence 18 from Patent
           WO0151627.>gb:AX196313_1463940 Sequence 20 from Patent
           WO0151627.
          Length = 877

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 58/199 (29%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 116 LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 175

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 176 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 235

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 236 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 295

Query: 760 ENNHFTGWIPPQLQGINSL 816
           +NN FTG +P  L  +  L
Sbjct: 296 DNNFFTGDVPASLGSLREL 314



 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 240 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDNNF 299

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 300 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 359

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 360 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 411



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 278 SWGGNSKNGFFRLQNLILDNNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 337

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 338 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 397

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 398 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 457

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 458 SSSFVGN 464



>gb:AP005966_1860372 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1047H05.
          Length = 837

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 74/250 (29%), Positives = 122/250 (48%), Gaps = 17/250 (6%)
 Frame = +1

Query: 118 LPWAVALLIG----FLLNA----PPSAVAD-TDPTDASVLRGLFSSLN-SPPQLTKWTAN 267
           +P  V +L+     FL+ A    P + + D +D TD   L  L   LN +   +  W  +
Sbjct: 9   IPVLVTILLACFSFFLITAFSLVPTAPLHDASDTTDFQALLCLKLHLNDNAGVMASWRND 68

Query: 268 GGDPCGESWKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
               C   W GV+CS +   RVTE+ +    L G +   +  L  +T   +  N L  ++
Sbjct: 69  SSQYC--QWPGVTCSKSHTSRVTELNLESSNLHGQIPPCIGNLTFLTIIHLPFNQLTGNI 126

Query: 439 PYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLST 612
           P ++     +  LNL  NG TG +P ++S  + L+ +++S+N + GE+       +NL  
Sbjct: 127 PPEIGHLRRLTYLNLTSNGLTGTIPEALSSCSNLQIIDISNNSIDGEIPSSMNKCSNLQA 186

Query: 613 LDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWI 786
           +    N L G IP+   +L+N+  +YL NN  +G I   + +N  L+ + + NN  TG I
Sbjct: 187 ICLFDNKLQGVIPEGLGTLSNLSVLYLSNNNLSGNIPFSLGSNSFLNVVILTNNSLTGGI 246

Query: 787 PPQLQGINSL 816
           PP L   +SL
Sbjct: 247 PPLLANSSSL 256



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/175 (27%), Positives = 88/175 (50%), Gaps = 5/175 (2%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
            + +S  +++G +      L  ++   +  NNL   +P  L    N++ LNL+ N F   +
Sbjct: 551  LSLSQNKISGQIPTSFGNLSHLSELYLQENNLSGPIPSSLGSCKNLEALNLSCNSFDSSI 610

Query: 505  PYSISQMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
            P  +  ++ L E+L++SHNQL GE+        NL  L+ S N L+G IP       ++ 
Sbjct: 611  PEELVTLSSLSEWLDLSHNQLDGEIPSEIGGSINLDILNISNNRLSGQIPSALGDCVHLS 670

Query: 682  NMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            ++ ++ N+  G I D   NL  +  L++  N+ +G IP  ++   S++    S+N
Sbjct: 671  SLRMEGNLLDGRIPDSFINLRGIVELDLSQNNLSGKIPEFMESFGSMKLLNLSFN 725



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 49/150 (32%), Positives = 78/150 (52%), Gaps = 4/150 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S   L+GS+   ++ L S+    +S NN   ++P  L   PN+Q+L+L  N  +G +
Sbjct: 307 LSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLSRIPNLQELDLTYNNLSGTV 366

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMF-VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P S+  M+ L YL +  N+L GE+      +L N+ TL    N   G IP +     N++
Sbjct: 367 PASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQGNQFQGQIPTSLGIAKNLQ 426

Query: 682 NMYLQNNVFTGTIDVLANLP-LDNLNVENN 768
            + L++N F G I    NLP L  LN+  N
Sbjct: 427 VINLRDNAFHGIIPSFGNLPDLMELNLGMN 456



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 53/184 (28%), Positives = 89/184 (48%), Gaps = 8/184 (4%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAG 483
           S + +  + ++   LTG +   L    S+   D++ N LG  +P+ L    ++  ++LA 
Sbjct: 228 SNSFLNVVILTNNSLTGGIPPLLANSSSLILLDLTNNRLGGEIPFALFNSSSLNLISLAV 287

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N F G +P   +  +PL YL++S N L G +     +L++L  L  S N+  G IP + S
Sbjct: 288 NNFVGSIPPISNISSPLWYLSLSQNNLSGSIPSSIENLSSLEILYLSQNNFQGTIPSSLS 347

Query: 664 SLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQ----LQGINSLQTG 825
            + N++ + L  N  +GT+   L N+  L  L +  N   G IP      L  I +L   
Sbjct: 348 RIPNLQELDLTYNNLSGTVPASLYNMSNLVYLGMGTNKLIGEIPDNIGYTLPNIKTLILQ 407

Query: 826 GNSW 837
           GN +
Sbjct: 408 GNQF 411



>pir|T47727|T47727 hypothetical protein F18O21.60 - Arabidopsis
           thaliana>gb:ATF18O21_1549200 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F18O21.
          Length = 719

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 75/266 (28%), Positives = 122/266 (45%), Gaps = 22/266 (8%)
 Frame = +1

Query: 85  RASLKMRELMGLPWAVALLIGFLLNAPPSAVADTD-----PTDASVLRGLFSSLNSPPQ- 246
           +ASL+ R L+ L      +I  L   PP +    D       D   L+ +   L  P   
Sbjct: 24  KASLRSRFLLHL------IICLLFFVPPCSSQAWDGVVITQADYQGLQAVKQELIDPRGF 77

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+++    +  NNL
Sbjct: 78  LRSWNGSGFSACSGGWAGIKCAQGQVIVIQLPWKSLGGRISEKIGQLQALRKLSLHDNNL 137

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L   +       +
Sbjct: 138 GGSIPMSLGLIPNLRGVQLFNNRLTGSIPASLGVSHFLQTLDLSNNLLSEIIPPNLADSS 197

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI------DVLANLP------- 741
            L  L+ SFNSL+G IP + S  ++++ + L +N  +G I       +   LP       
Sbjct: 198 KLLRLNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSGPILDTWGSKIRGTLPSELSKLT 257

Query: 742 -LDNLNVENNHFTGWIPPQLQGINSL 816
            L  +++  N  +G IP  L  I+SL
Sbjct: 258 KLRKMDISGNSVSGHIPETLGNISSL 283



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 34/147 (23%), Positives = 76/147 (51%), Gaps = 14/147 (9%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN------------SLPYQLPP- 456
           +++  + +S   L+G +   L +  S+    +  NNL              +LP +L   
Sbjct: 197 SKLLRLNLSFNSLSGQIPVSLSRSSSLQFLALDHNNLSGPILDTWGSKIRGTLPSELSKL 256

Query: 457 -NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
             ++K++++GN  +G +P ++  ++ L +L++S N+L GE+ +    L +L+  + S+N+
Sbjct: 257 TKLRKMDISGNSVSGHIPETLGNISSLIHLDLSQNKLTGEIPISISDLESLNFFNVSYNN 316

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTG 714
           L+G +P   S   N  + ++ N++  G
Sbjct: 317 LSGPVPTLLSQKFN-SSSFVGNSLLCG 342



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 5/126 (3%)
 Frame = +1

Query: 481 GNGFT---GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           G+GF+   GG          +  + +    L G ++     L  L  L    N+L G+IP
Sbjct: 83  GSGFSACSGGWAGIKCAQGQVIVIQLPWKSLGGRISEKIGQLQALRKLSLHDNNLGGSIP 142

Query: 652 QTFSSLTNMKNMYLQNNVFTGTIDVLANLP--LDNLNVENNHFTGWIPPQLQGINSLQTG 825
            +   + N++ + L NN  TG+I     +   L  L++ NN  +  IPP L   + L   
Sbjct: 143 MSLGLIPNLRGVQLFNNRLTGSIPASLGVSHFLQTLDLSNNLLSEIIPPNLADSSKLLRL 202

Query: 826 GNSWNS 843
             S+NS
Sbjct: 203 NLSFNS 208



 Score = 37.7 bits (86), Expect = 0.28
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 1/114 (0%)
 Frame = +1

Query: 193 TDASVLRG-LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG 369
           T  S +RG L S L+   +L K   +G    G   + +    + +  + +S  +LTG + 
Sbjct: 240 TWGSKIRGTLPSELSKLTKLRKMDISGNSVSGHIPETLGNISSLI-HLDLSQNKLTGEIP 298

Query: 370 FQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP 531
             +  L+S+  F++S NNL   +P  L       +  GN    G  YS+S   P
Sbjct: 299 ISISDLESLNFFNVSYNNLSGPVPTLLSQKFNSSSFVGNSLLCG--YSVSTPCP 350



>gb:AC087553_1734109 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0685E10, complete sequence.
          Length = 1007

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 72/235 (30%), Positives = 119/235 (50%), Gaps = 6/235 (2%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           L  G LL AP    A  D T A++L+      +    L+ W+    D C  SW GV+C  
Sbjct: 35  LFCGILL-APSCEAATVDTTSATLLQVKSGFTDPNGVLSGWSPEA-DVC--SWHGVTCLT 90

Query: 316 NR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAG 483
               VT + +SG  L+G++   +  L SV + D+S+N+L  ++P +L    +++ L L  
Sbjct: 91  GEGIVTGLNLSGYGLSGTISPAIAGLVSVESIDLSSNSLTGAIPPELGTMKSLKTLLLHS 150

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N  TG +P  +  +  L+ L + +N L+GE+       + L T+  ++  L G IP    
Sbjct: 151 NLLTGAIPPELGGLKNLKLLRIGNNPLRGEIPPELGDCSELETIGMAYCQLIGAIPHQIG 210

Query: 664 SLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQT 822
           +L  ++ + L NN  TG + + LA    L  L+V +N   G IP  + G++SLQ+
Sbjct: 211 NLKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQS 265



 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 53/170 (31%), Positives = 83/170 (48%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
            +  +Q++G +L G++  +L  L  +   D+S NN    +P +L     +  LNL GN  T
Sbjct: 629  MVRLQLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIPPELSNCSRLTHLNLDGNSLT 688

Query: 496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
            G +P  +  +  L  L++S N L G + V     + L  L  S N L+G+IP     LT+
Sbjct: 689  GAVPPWLGGLRSLGELDLSSNALTGGIPVELGGCSGLLKLSLSGNRLSGSIPPEIGKLTS 748

Query: 676  MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +  + LQ N FTG I  ++     L  L +  N   G IP +L  +  LQ
Sbjct: 749  LNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPIPAELGQLPELQ 798



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 60/201 (29%), Positives = 89/201 (44%), Gaps = 29/201 (14%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--------------------GNS 435
            +R+T + + G  LTG++   L  L+S+   D+S+N L                    GN 
Sbjct: 675  SRLTHLNLDGNSLTGAVPPWLGGLRSLGELDLSSNALTGGIPVELGGCSGLLKLSLSGNR 734

Query: 436  LPYQLPPNVQK------LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
            L   +PP + K      LNL  NGFTG +P  + +   L  L +S N L+G +      L
Sbjct: 735  LSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPIPAELGQL 794

Query: 598  TNLST-LDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENN 768
              L   LD S N L+G IP +   L  ++ + L +N   G I   +L    L  LN+ +N
Sbjct: 795  PELQVILDLSRNKLSGEIPASLGDLVKLERLNLSSNQLHGQIPPSLLQLTSLHLLNLSDN 854

Query: 769  HFTGWIPPQLQGINSLQTGGN 831
              +G IP  L    +    GN
Sbjct: 855  LLSGGIPGALSAFPAASFAGN 875



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 61/222 (27%), Positives = 107/222 (48%), Gaps = 35/222 (15%)
 Frame = +1

Query: 259 TANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
           T  GG P  E   G  C+  RV  + ++  +L G +   +  L S+ + +++ N     +
Sbjct: 224 TLTGGLP--EQLAG--CANLRV--LSVADNKLDGVIPSSIGGLSSLQSLNLANNQFSGVI 277

Query: 439 PYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVS-LTNLS 609
           P ++     +  LNL GN  TGG+P  +++++ L+ +++S N L GE++ +  S L NL 
Sbjct: 278 PPEIGNLSGLTYLNLLGNRLTGGIPEELNRLSQLQVVDLSKNNLSGEISAISASQLKNLK 337

Query: 610 TLDFSFNSLAGNIPQTF-------SSLTNMKNMYLQNNVFTGTIDVLAN----------- 735
            L  S N L G IP+         +  ++++N++L  N   G+ID L +           
Sbjct: 338 YLVLSENLLEGTIPEGLCNGDGNGNGNSSLENLFLAGNDLGGSIDALLSCTSLKSIDVSN 397

Query: 736 -------------LP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
                        LP L NL + NN F G +PPQ+  +++L+
Sbjct: 398 NSLTGEIPPAIDRLPGLVNLALHNNSFAGVLPPQIGNLSNLE 439



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 57/189 (30%), Positives = 85/189 (44%), Gaps = 27/189 (14%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
            +Q+    LTG +   L + +S+    ++ N L   LP        +  + L  N   G L
Sbjct: 513  LQLRQNDLTGPIPASLGECRSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGAL 572

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMF-------VSLTNLS----------------TL 615
            P S+ ++  L  +N SHN+  G V  +        ++LTN S                 L
Sbjct: 573  PESMFELKNLTVINFSHNRFTGAVVPLLGSSSLTVLALTNNSFSGVIPAAVARSTGMVRL 632

Query: 616  DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
              + N LAG IP     LT +K + L NN F+G I   L+N   L +LN++ N  TG +P
Sbjct: 633  QLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIPPELSNCSRLTHLNLDGNSLTGAVP 692

Query: 790  PQLQGINSL 816
            P L G+ SL
Sbjct: 693  PWLGGLRSL 701



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 49/166 (29%), Positives = 84/166 (50%), Gaps = 8/166 (4%)
 Frame = +1

Query: 325 TEIQISGL---QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +E++  G+   QL G++  Q+  LK +    +  N L   LP QL    N++ L++A N 
Sbjct: 189 SELETIGMAYCQLIGAIPHQIGNLKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNK 248

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G +P SI  ++ L+ LN+++NQ  G +     +L+ L+ L+   N L G IP+  + L
Sbjct: 249 LDGVIPSSIGGLSSLQSLNLANNQFSGVIPPEIGNLSGLTYLNLLGNRLTGGIPEELNRL 308

Query: 670 TNMKNMYLQNNVFTGTIDVLANLPLDNLN---VENNHFTGWIPPQL 798
           + ++ + L  N  +G I  ++   L NL    +  N   G IP  L
Sbjct: 309 SQLQVVDLSKNNLSGEISAISASQLKNLKYLVLSENLLEGTIPEGL 354



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 6/167 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           ++TG++  ++    S+   D   N+    +P  +    N+  L L  N  TG +P S+ +
Sbjct: 471 EMTGAIPDEMTNCSSLEEVDFFGNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGE 530

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              L+ L ++ N+L GE+   F  L  LS +    NSL G +P++   L N+  +   +N
Sbjct: 531 CRSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGALPESMFELKNLTVINFSHN 590

Query: 703 VFTG-TIDVLANLPLDNLNVENNHFTGWIPPQL---QGINSLQTGGN 831
            FTG  + +L +  L  L + NN F+G IP  +    G+  LQ  GN
Sbjct: 591 RFTGAVVPLLGSSSLTVLALTNNSFSGVIPAAVARSTGMVRLQLAGN 637



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 4/178 (2%)
 Frame = +1

Query: 268 GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ 447
           G D  G     +SC+   +  I +S   LTG +   +D+L  +    +  N+    LP Q
Sbjct: 374 GNDLGGSIDALLSCTS--LKSIDVSNNSLTGEIPPAIDRLPGLVNLALHNNSFAGVLPPQ 431

Query: 448 LP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF 621
           +    N++ L+L  NG TGG+P  I ++  L+ L +  N++ G +     + ++L  +DF
Sbjct: 432 IGNLSNLEVLSLYHNGLTGGIPPEIGRLQRLKLLFLYENEMTGAIPDEMTNCSSLEEVDF 491

Query: 622 SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIP 789
             N   G IP +  +L N+  + L+ N  TG I         L  L + +N  +G +P
Sbjct: 492 FGNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGECRSLQALALADNRLSGELP 549



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 44/139 (31%), Positives = 68/139 (48%), Gaps = 17/139 (12%)
 Frame = +1

Query: 301  VSCSGNRV-----------TEIQISGLQLTGSMGF---QLDQLKSVTTFDISTNNLGNSL 438
            +S SGNR+           T + +  LQ  G  G    +L +   +    +S N+L   +
Sbjct: 728  LSLSGNRLSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPI 787

Query: 439  PY---QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
            P    QLP     L+L+ N  +G +P S+  +  LE LN+S NQL G++    + LT+L 
Sbjct: 788  PAELGQLPELQVILDLSRNKLSGEIPASLGDLVKLERLNLSSNQLHGQIPPSLLQLTSLH 847

Query: 610  TLDFSFNSLAGNIPQTFSS 666
             L+ S N L+G IP   S+
Sbjct: 848  LLNLSDNLLSGGIPGALSA 866



>gb:AC084817_1733844 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0419C04, complete sequence.
          Length = 1117

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 72/235 (30%), Positives = 119/235 (50%), Gaps = 6/235 (2%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           L  G LL AP    A  D T A++L+      +    L+ W+    D C  SW GV+C  
Sbjct: 145 LFCGILL-APSCEAATVDTTSATLLQVKSGFTDPNGVLSGWSPEA-DVC--SWHGVTCLT 200

Query: 316 NR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAG 483
               VT + +SG  L+G++   +  L SV + D+S+N+L  ++P +L    +++ L L  
Sbjct: 201 GEGIVTGLNLSGYGLSGTISPAIAGLVSVESIDLSSNSLTGAIPPELGTMKSLKTLLLHS 260

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N  TG +P  +  +  L+ L + +N L+GE+       + L T+  ++  L G IP    
Sbjct: 261 NLLTGAIPPELGGLKNLKLLRIGNNPLRGEIPPELGDCSELETIGMAYCQLIGAIPHQIG 320

Query: 664 SLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQT 822
           +L  ++ + L NN  TG + + LA    L  L+V +N   G IP  + G++SLQ+
Sbjct: 321 NLKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQS 375



 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 53/170 (31%), Positives = 83/170 (48%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
            +  +Q++G +L G++  +L  L  +   D+S NN    +P +L     +  LNL GN  T
Sbjct: 739  MVRLQLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIPPELSNCSRLTHLNLDGNSLT 798

Query: 496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
            G +P  +  +  L  L++S N L G + V     + L  L  S N L+G+IP     LT+
Sbjct: 799  GAVPPWLGGLRSLGELDLSSNALTGGIPVELGGCSGLLKLSLSGNRLSGSIPPEIGKLTS 858

Query: 676  MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +  + LQ N FTG I  ++     L  L +  N   G IP +L  +  LQ
Sbjct: 859  LNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPIPAELGQLPELQ 908



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 60/201 (29%), Positives = 89/201 (44%), Gaps = 29/201 (14%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--------------------GNS 435
            +R+T + + G  LTG++   L  L+S+   D+S+N L                    GN 
Sbjct: 785  SRLTHLNLDGNSLTGAVPPWLGGLRSLGELDLSSNALTGGIPVELGGCSGLLKLSLSGNR 844

Query: 436  LPYQLPPNVQK------LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
            L   +PP + K      LNL  NGFTG +P  + +   L  L +S N L+G +      L
Sbjct: 845  LSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPIPAELGQL 904

Query: 598  TNLST-LDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENN 768
              L   LD S N L+G IP +   L  ++ + L +N   G I   +L    L  LN+ +N
Sbjct: 905  PELQVILDLSRNKLSGEIPASLGDLVKLERLNLSSNQLHGQIPPSLLQLTSLHLLNLSDN 964

Query: 769  HFTGWIPPQLQGINSLQTGGN 831
              +G IP  L    +    GN
Sbjct: 965  LLSGGIPGALSAFPAASFAGN 985



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 61/222 (27%), Positives = 107/222 (48%), Gaps = 35/222 (15%)
 Frame = +1

Query: 259 TANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
           T  GG P  E   G  C+  RV  + ++  +L G +   +  L S+ + +++ N     +
Sbjct: 334 TLTGGLP--EQLAG--CANLRV--LSVADNKLDGVIPSSIGGLSSLQSLNLANNQFSGVI 387

Query: 439 PYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVS-LTNLS 609
           P ++     +  LNL GN  TGG+P  +++++ L+ +++S N L GE++ +  S L NL 
Sbjct: 388 PPEIGNLSGLTYLNLLGNRLTGGIPEELNRLSQLQVVDLSKNNLSGEISAISASQLKNLK 447

Query: 610 TLDFSFNSLAGNIPQTF-------SSLTNMKNMYLQNNVFTGTIDVLAN----------- 735
            L  S N L G IP+         +  ++++N++L  N   G+ID L +           
Sbjct: 448 YLVLSENLLEGTIPEGLCNGDGNGNGNSSLENLFLAGNDLGGSIDALLSCTSLKSIDVSN 507

Query: 736 -------------LP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
                        LP L NL + NN F G +PPQ+  +++L+
Sbjct: 508 NSLTGEIPPAIDRLPGLVNLALHNNSFAGVLPPQIGNLSNLE 549



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 57/189 (30%), Positives = 85/189 (44%), Gaps = 27/189 (14%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
            +Q+    LTG +   L + +S+    ++ N L   LP        +  + L  N   G L
Sbjct: 623  LQLRQNDLTGPIPASLGECRSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGAL 682

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMF-------VSLTNLS----------------TL 615
            P S+ ++  L  +N SHN+  G V  +        ++LTN S                 L
Sbjct: 683  PESMFELKNLTVINFSHNRFTGAVVPLLGSSSLTVLALTNNSFSGVIPAAVARSTGMVRL 742

Query: 616  DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
              + N LAG IP     LT +K + L NN F+G I   L+N   L +LN++ N  TG +P
Sbjct: 743  QLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIPPELSNCSRLTHLNLDGNSLTGAVP 802

Query: 790  PQLQGINSL 816
            P L G+ SL
Sbjct: 803  PWLGGLRSL 811



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 49/166 (29%), Positives = 84/166 (50%), Gaps = 8/166 (4%)
 Frame = +1

Query: 325 TEIQISGL---QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +E++  G+   QL G++  Q+  LK +    +  N L   LP QL    N++ L++A N 
Sbjct: 299 SELETIGMAYCQLIGAIPHQIGNLKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNK 358

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G +P SI  ++ L+ LN+++NQ  G +     +L+ L+ L+   N L G IP+  + L
Sbjct: 359 LDGVIPSSIGGLSSLQSLNLANNQFSGVIPPEIGNLSGLTYLNLLGNRLTGGIPEELNRL 418

Query: 670 TNMKNMYLQNNVFTGTIDVLANLPLDNLN---VENNHFTGWIPPQL 798
           + ++ + L  N  +G I  ++   L NL    +  N   G IP  L
Sbjct: 419 SQLQVVDLSKNNLSGEISAISASQLKNLKYLVLSENLLEGTIPEGL 464



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 6/167 (3%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
            ++TG++  ++    S+   D   N+    +P  +    N+  L L  N  TG +P S+ +
Sbjct: 581  EMTGAIPDEMTNCSSLEEVDFFGNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGE 640

Query: 523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
               L+ L ++ N+L GE+   F  L  LS +    NSL G +P++   L N+  +   +N
Sbjct: 641  CRSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGALPESMFELKNLTVINFSHN 700

Query: 703  VFTG-TIDVLANLPLDNLNVENNHFTGWIPPQL---QGINSLQTGGN 831
             FTG  + +L +  L  L + NN F+G IP  +    G+  LQ  GN
Sbjct: 701  RFTGAVVPLLGSSSLTVLALTNNSFSGVIPAAVARSTGMVRLQLAGN 747



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 4/178 (2%)
 Frame = +1

Query: 268  GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ 447
            G D  G     +SC+   +  I +S   LTG +   +D+L  +    +  N+    LP Q
Sbjct: 484  GNDLGGSIDALLSCTS--LKSIDVSNNSLTGEIPPAIDRLPGLVNLALHNNSFAGVLPPQ 541

Query: 448  LP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF 621
            +    N++ L+L  NG TGG+P  I ++  L+ L +  N++ G +     + ++L  +DF
Sbjct: 542  IGNLSNLEVLSLYHNGLTGGIPPEIGRLQRLKLLFLYENEMTGAIPDEMTNCSSLEEVDF 601

Query: 622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIP 789
              N   G IP +  +L N+  + L+ N  TG I         L  L + +N  +G +P
Sbjct: 602  FGNHFHGPIPASIGNLKNLAVLQLRQNDLTGPIPASLGECRSLQALALADNRLSGELP 659



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 44/139 (31%), Positives = 68/139 (48%), Gaps = 17/139 (12%)
 Frame = +1

Query: 301  VSCSGNRV-----------TEIQISGLQLTGSMGF---QLDQLKSVTTFDISTNNLGNSL 438
            +S SGNR+           T + +  LQ  G  G    +L +   +    +S N+L   +
Sbjct: 838  LSLSGNRLSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPI 897

Query: 439  PY---QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
            P    QLP     L+L+ N  +G +P S+  +  LE LN+S NQL G++    + LT+L 
Sbjct: 898  PAELGQLPELQVILDLSRNKLSGEIPASLGDLVKLERLNLSSNQLHGQIPPSLLQLTSLH 957

Query: 610  TLDFSFNSLAGNIPQTFSS 666
             L+ S N L+G IP   S+
Sbjct: 958  LLNLSDNLLSGGIPGALSA 976



>gb:AC013288_1537852 Arabidopsis thaliana chromosome 1 BAC F4N21
           genomic sequence, complete sequence.
          Length = 685

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 66/206 (32%), Positives = 110/206 (53%), Gaps = 8/206 (3%)
 Frame = +1

Query: 250 TKWTANGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           T W ++  +PC  SW+GV+C+ + RV  I++   +L+GS+   +  L S+   ++  N+ 
Sbjct: 45  TNWNSSDSNPC--SWQGVTCNYDMRVVSIRLPNKRLSGSLDPSIGSLLSLRHINLRDNDF 102

Query: 427 GNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
              LP +L     +Q L L+GN F+G +P  I  +  L  L++S N   G +++  +   
Sbjct: 103 QGKLPVELFGLKGLQSLVLSGNSFSGFVPEEIGSLKSLMTLDLSENSFNGSISLSLIPCK 162

Query: 601 NLSTLDFSFNSLAGNIPQTF-SSLTNMKNMYLQNNVFTGTI--DV--LANLPLDNLNVEN 765
            L TL  S NS +G++P    S+L +++ + L  N  TGTI  DV  L NL    L++ +
Sbjct: 163 KLKTLVLSKNSFSGDLPTGLGSNLVHLRTLNLSFNRLTGTIPEDVGSLENLK-GTLDLSH 221

Query: 766 NHFTGWIPPQLQGINSLQTGGNSWNS 843
           N F+G IP  L  +  L     S+N+
Sbjct: 222 NFFSGMIPTSLGNLPELLYVDLSYNN 247



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 40/130 (30%), Positives = 63/130 (48%), Gaps = 4/130 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV---QKLNLAGNGFTGG 501
           + +S     GS+   L   K + T  +S N+    LP  L  N+   + LNL+ N  TG 
Sbjct: 143 LDLSENSFNGSISLSLIPCKKLKTLVLSKNSFSGDLPTGLGSNLVHLRTLNLSFNRLTGT 202

Query: 502 LPYSISQMAPLE-YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
           +P  +  +  L+  L++SHN   G +     +L  L  +D S+N+L+G IP+ F+ L N 
Sbjct: 203 IPEDVGSLENLKGTLDLSHNFFSGMIPTSLGNLPELLYVDLSYNNLSGPIPK-FNVLLNA 261

Query: 679 KNMYLQNNVF 708
                Q N F
Sbjct: 262 GPNAFQGNPF 271



>gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1
           mRNA for putative leucin-rich repeat protein kinase,
           complete cds.>gb:AP003451_1829652 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0413C03.
          Length = 1294

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 72/245 (29%), Positives = 118/245 (48%), Gaps = 5/245 (2%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKG 300
           W   LL+ F+   P SA A++   D S L  L  S+      L  W  +   PC  SW G
Sbjct: 7   WLFILLVSFI---PISAWAES--RDISTLFTLRDSITEGKGFLRNWFDSETPPC--SWSG 59

Query: 301 VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLN 474
           ++C G+ V  I +S + L       +   +S+   + S       LP  L    N+Q L+
Sbjct: 60  ITCIGHNVVAIDLSSVPLYAPFPLCIGAFQSLVRLNFSGCGFSGELPEALGNLQNLQYLD 119

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           L+ N  TG +P S+  +  L+ + + +N L G+++     L +L+ L  S NS++G++P 
Sbjct: 120 LSNNELTGPIPISLYNLKMLKEMVLDYNSLSGQLSPAIAQLQHLTKLSISMNSISGSLPP 179

Query: 655 TFSSLTNMKNMYLQNNVFTGTID-VLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGG 828
              SL N++ + ++ N F G+I     NL  L + +   N+ TG I P +  + +L T  
Sbjct: 180 DLGSLKNLELLDIKMNTFNGSIPATFGNLSCLLHFDASQNNLTGSIFPGITSLTNLLTLD 239

Query: 829 NSWNS 843
            S NS
Sbjct: 240 LSSNS 244



 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 55/159 (34%), Positives = 85/159 (53%), Gaps = 4/159 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
           L+G +   + QL+ +T   IS N++  SLP  L    N++ L++  N F G +P +   +
Sbjct: 149 LSGQLSPAIAQLQHLTKLSISMNSISGSLPPDLGSLKNLELLDIKMNTFNGSIPATFGNL 208

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L + + S N L G +     SLTNL TLD S NS  G IP+    L N++ + L  N 
Sbjct: 209 SCLLHFDASQNNLTGSIFPGITSLTNLLTLDLSSNSFEGTIPREIGQLENLELLILGKND 268

Query: 706 FTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            TG I  ++ +   L  L++E   FTG IP  + G++SL
Sbjct: 269 LTGRIPQEIGSLKQLKLLHLEECQFTGKIPWSISGLSSL 307



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 46/166 (27%), Positives = 75/166 (45%), Gaps = 2/166 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           + +   Q TG + + +  L S+T  DIS NN    LP  +    N+ +L     G +G +
Sbjct: 286 LHLEECQFTGKIPWSISGLSSLTELDISDNNFDAELPSSMGELGNLTQLIAKNAGLSGNM 345

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  +     L  +N+S N L G +   F  L  + +     N L+G +P       N ++
Sbjct: 346 PKELGNCKKLTVINLSFNALIGPIPEEFADLEAIVSFFVEGNKLSGRVPDWIQKWKNARS 405

Query: 685 MYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           + L  N F+G + VL    L +   E+N  +G IP  +   NSL +
Sbjct: 406 IRLGQNKFSGPLPVLPLQHLLSFAAESNLLSGSIPSHICQANSLHS 451



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 43/173 (24%), Positives = 84/173 (48%), Gaps = 16/173 (9%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGL 504
            +++S  +  G +  +L + K++    +S N +   +P  +     +Q+L++  N   G +
Sbjct: 499  LELSQNKFAGMLPAELWESKTLLEISLSNNEITGPIPESIGKLSVLQRLHIDNNLLEGPI 558

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
            P S+  +  L  L++  N+L G + +   +   L+TLD S+N+L GNIP   S LT + +
Sbjct: 559  PQSVGDLRNLTNLSLRGNRLSGIIPLALFNCRKLATLDLSYNNLTGNIPSAISHLTLLDS 618

Query: 685  MYLQNNVFTGTIDVLANLPLDN--------------LNVENNHFTGWIPPQLQ 801
            + L +N  +G+I     +  +N              L++  N  TG IP  ++
Sbjct: 619  LILSSNQLSGSIPAEICVGFENEAHPDSEFLQHHGLLDLSYNQLTGQIPTSIK 671



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 46/177 (25%), Positives = 80/177 (45%), Gaps = 17/177 (9%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK---------- 468
            ++  + +S   LTG++   +  L  + +  +S+N L  S+P ++    +           
Sbjct: 591  KLATLDLSYNNLTGNIPSAISHLTLLDSLILSSNQLSGSIPAEICVGFENEAHPDSEFLQ 650

Query: 469  ----LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
                L+L+ N  TG +P SI   A +  LN+  N L G + V    LTNL++++ SFN  
Sbjct: 651  HHGLLDLSYNQLTGQIPTSIKNCAMVMVLNLQGNLLNGTIPVELGELTNLTSINLSFNEF 710

Query: 637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDN---LNVENNHFTGWIPPQL 798
             G +      L  ++ + L NN   G+I       L     L++ +N  TG +P  L
Sbjct: 711  VGPMLPWSGPLVQLQGLILSNNHLDGSIPAKIGQILPKIAVLDLSSNALTGTLPQSL 767



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 47/175 (26%), Positives = 84/175 (48%), Gaps = 16/175 (9%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
            +T + + G +L+G +   L   + + T D+S NNL  ++P  +     +  L L+ N  +
Sbjct: 568  LTNLSLRGNRLSGIIPLALFNCRKLATLDLSYNNLTGNIPSAISHLTLLDSLILSSNQLS 627

Query: 496  GGLPYSI-----SQMAP----LEY---LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
            G +P  I     ++  P    L++   L++S+NQL G++     +   +  L+   N L 
Sbjct: 628  GSIPAEICVGFENEAHPDSEFLQHHGLLDLSYNQLTGQIPTSIKNCAMVMVLNLQGNLLN 687

Query: 640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQL 798
            G IP     LTN+ ++ L  N F G +   +   + L  L + NNH  G IP ++
Sbjct: 688  GTIPVELGELTNLTSINLSFNEFVGPMLPWSGPLVQLQGLILSNNHLDGSIPAKI 742



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 62/260 (23%), Positives = 108/260 (41%), Gaps = 26/260 (10%)
 Frame = +1

Query: 118  LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK 297
            +PW+++ L         S++ + D +D +    L SS+     LT+  A      G   K
Sbjct: 297  IPWSISGL---------SSLTELDISDNNFDAELPSSMGELGNLTQLIAKNAGLSGNMPK 347

Query: 298  GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKL 471
             +  +  ++T I +S   L G +  +   L+++ +F +  N L   +P   Q   N + +
Sbjct: 348  ELG-NCKKLTVINLSFNALIGPIPEEFADLEAIVSFFVEGNKLSGRVPDWIQKWKNARSI 406

Query: 472  NLAGNGFTGGLPY----------------------SISQMAPLEYLNVSHNQLQGEVTVM 585
             L  N F+G LP                        I Q   L  L + HN L G +   
Sbjct: 407  RLGQNKFSGPLPVLPLQHLLSFAAESNLLSGSIPSHICQANSLHSLLLHHNNLTGTIDEA 466

Query: 586  FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNV 759
            F   TNL+ L+   N + G +P   + L  +  + L  N F G +  ++  +  L  +++
Sbjct: 467  FKGCTNLTELNLLDNHIHGEVPGYLAELP-LVTLELSQNKFAGMLPAELWESKTLLEISL 525

Query: 760  ENNHFTGWIPPQLQGINSLQ 819
             NN  TG IP  +  ++ LQ
Sbjct: 526  SNNEITGPIPESIGKLSVLQ 545



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 42/142 (29%), Positives = 68/142 (47%), Gaps = 12/142 (8%)
 Frame = +1

Query: 331  IQISGL-----QLTGSMGFQLDQ-LKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGN 486
            +Q+ GL      L GS+  ++ Q L  +   D+S+N L  +LP  L  N  +  L+++ N
Sbjct: 722  VQLQGLILSNNHLDGSIPAKIGQILPKIAVLDLSSNALTGTLPQSLLCNNYLNHLDVSNN 781

Query: 487  GFTGGLPYSISQ----MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
              +G + +S        + L + N S N   G +     + T LSTLD   NSL G +P 
Sbjct: 782  HLSGHIQFSCPDGKEYSSTLLFFNSSSNHFSGSLDESISNFTQLSTLDIHNNSLTGRLPS 841

Query: 655  TFSSLTNMKNMYLQNNVFTGTI 720
              S L+++  + L +N   G I
Sbjct: 842  ALSDLSSLNYLDLSSNNLYGAI 863



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 4/168 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQM 525
           L+GS+   + Q  S+ +  +  NNL  ++   ++   N+ +LNL  N   G +P  ++++
Sbjct: 435 LSGSIPSHICQANSLHSLLLHHNNLTGTIDEAFKGCTNLTELNLLDNHIHGEVPGYLAEL 494

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
            PL  L +S N+  G +         L  +  S N + G IP++   L+ ++ +++ NN+
Sbjct: 495 -PLVTLELSQNKFAGMLPAELWESKTLLEISLSNNEITGPIPESIGKLSVLQRLHIDNNL 553

Query: 706 FTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
             G I   V     L NL++  N  +G IP  L     L T   S+N+
Sbjct: 554 LEGPIPQSVGDLRNLTNLSLRGNRLSGIIPLALFNCRKLATLDLSYNN 601



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 6/117 (5%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK------LNLA 480
            ++  + +S   LTG++   L     +   D+S N+L   + +  P   +        N +
Sbjct: 748  KIAVLDLSSNALTGTLPQSLLCNNYLNHLDVSNNHLSGHIQFSCPDGKEYSSTLLFFNSS 807

Query: 481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
             N F+G L  SIS    L  L++ +N L G +      L++L+ LD S N+L G IP
Sbjct: 808  SNHFSGSLDESISNFTQLSTLDIHNNSLTGRLPSALSDLSSLNYLDLSSNNLYGAIP 864



>pir|H84421|H84421 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006200_1533560 Arabidopsis
           thaliana chromosome 2 clone F10A8 map rga, complete
           sequence.
          Length = 716

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 66/191 (34%), Positives = 98/191 (51%), Gaps = 7/191 (3%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W ++  + C  SW GV+C   RV  + I    L GS+   L  L S+   ++ +N  
Sbjct: 43  LNNWNSSDENAC--SWNGVTCKELRVVSLSIPRKNLYGSLPSSLGFLSSLRHLNLRSNRF 100

Query: 427 GNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
             SLP QL     +Q L L GN F G L   I ++  L+ L++S N   G + +  +   
Sbjct: 101 YGSLPIQLFHLQGLQSLVLYGNSFDGSLSEEIGKLKLLQTLDLSQNLFNGSLPLSILQCN 160

Query: 601 NLSTLDFSFNSLAGNIPQTF-SSLTNMKNMYLQNNVFTGTI--DV--LANLPLDNLNVEN 765
            L TLD S N+L+G +P  F S+  +++ + L  N F G+I  D+  L+NL     +  +
Sbjct: 161 RLKTLDVSRNNLSGPLPDGFGSAFVSLEKLDLAFNQFNGSIPSDIGNLSNLQ-GTADFSH 219

Query: 766 NHFTGWIPPQL 798
           NHFTG IPP L
Sbjct: 220 NHFTGSIPPAL 230



 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 38/132 (28%), Positives = 62/132 (46%), Gaps = 4/132 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP---NVQKLNLAGNGFTGG 501
           + +S     GS+   + Q   + T D+S NNL   LP        +++KL+LA N F G 
Sbjct: 141 LDLSQNLFNGSLPLSILQCNRLKTLDVSRNNLSGPLPDGFGSAFVSLEKLDLAFNQFNGS 200

Query: 502 LPYSISQMAPLE-YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
           +P  I  ++ L+   + SHN   G +      L     +D +FN+L+G IPQT + +   
Sbjct: 201 IPSDIGNLSNLQGTADFSHNHFTGSIPPALGDLPEKVYIDLTFNNLSGPIPQTGALMNRG 260

Query: 679 KNMYLQNNVFTG 714
              ++ N    G
Sbjct: 261 PTAFIGNTGLCG 272



>gb:AY244746_1592517 Arabidopsis thaliana ERECTA-like kinase 2
           (ERL2) mRNA, ERL2-erl2 allele, complete cds.
          Length = 967

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 57/167 (34%), Positives = 92/167 (55%), Gaps = 4/167 (2%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNL 477
           SC+   + +  + G  L+G++  +   L S+T  ++S+N+    +P +L    N+  L+L
Sbjct: 382 SCAA--LNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDL 439

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           +GN F+G +P ++  +  L  LN+S N L G +   F +L ++  +D SFN LAG IP  
Sbjct: 440 SGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTE 499

Query: 658 FSSLTNMKNMYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPP 792
              L N+ ++ L NN   G I D L N   L NLN+  N+ +G IPP
Sbjct: 500 LGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIPP 546



 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 58/190 (30%), Positives = 95/190 (50%), Gaps = 6/190 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
           SW+GV C      V  + +S L L G +   L  L ++ + D+  N LG  +P ++   V
Sbjct: 62  SWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCV 121

Query: 463 QK--LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
               ++ + N   G +P+SIS++  LE+LN+ +NQL G +      + NL TLD + N L
Sbjct: 122 SLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQL 181

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGIN 810
            G IP+       ++ + L+ N+ TGT+  D+     L   +V  N+ TG IP  +    
Sbjct: 182 TGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCT 241

Query: 811 SLQTGGNSWN 840
           S +    S+N
Sbjct: 242 SFEILDVSYN 251



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/181 (29%), Positives = 89/181 (49%), Gaps = 7/181 (3%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +V  + + G +LTG +   +  ++++   D+S N L   +P  L       KL L GN  
Sbjct: 265 QVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKL 324

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  +  M+ L YL ++ N+L G++      L  L  L+ + N+L G IP   SS  
Sbjct: 325 TGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCA 384

Query: 673 NMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQT---GGNSW 837
            +    +  N  +G + +   NL  L  LN+ +N F G IP +L  I +L T    GN++
Sbjct: 385 ALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNF 444

Query: 838 N 840
           +
Sbjct: 445 S 445



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 3/149 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G + F + +LK +   ++  N L   +P  L   PN++ L+LA N  TG +P  +   
Sbjct: 133 LFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWN 192

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+YL +  N L G ++     LT L   D   N+L G IP++  + T+ + + +  N 
Sbjct: 193 EVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQ 252

Query: 706 FTGTIDV-LANLPLDNLNVENNHFTGWIP 789
            TG I   +  L +  L+++ N  TG IP
Sbjct: 253 ITGVIPYNIGFLQVATLSLQGNKLTGRIP 281



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 50/171 (29%), Positives = 77/171 (45%), Gaps = 6/171 (3%)
 Frame = +1

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-PNVQKLNLAGNGFTGGLPYS 513
           + G  LTG++   +    S    D+S N +   +PY +    V  L+L GN  TG +P  
Sbjct: 224 VRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEV 283

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           I  M  L  L++S N+L G +  +  +L+    L    N L G IP    +++ +  + L
Sbjct: 284 IGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQL 343

Query: 694 QNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQ---GINSLQTGGN 831
            +N   G I   L  L  L  LN+ NN+  G IP  +     +N     GN
Sbjct: 344 NDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGN 394



>pir|T48489|T48489 receptor-like protein kinase - Arabidopsis
           thaliana>gb:ATT28J14_1555599 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 932

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 57/167 (34%), Positives = 92/167 (55%), Gaps = 4/167 (2%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNL 477
           SC+   + +  + G  L+G++  +   L S+T  ++S+N+    +P +L    N+  L+L
Sbjct: 347 SCAA--LNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDL 404

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           +GN F+G +P ++  +  L  LN+S N L G +   F +L ++  +D SFN LAG IP  
Sbjct: 405 SGNNFSGSIPLTLGDLEHLLILNLSRNHLNGTLPAEFGNLRSIQIIDVSFNFLAGVIPTE 464

Query: 658 FSSLTNMKNMYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPP 792
              L N+ ++ L NN   G I D L N   L NLN+  N+ +G IPP
Sbjct: 465 LGQLQNINSLILNNNKIHGKIPDQLTNCFSLANLNISFNNLSGIIPP 511



 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 58/190 (30%), Positives = 95/190 (50%), Gaps = 6/190 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
           SW+GV C      V  + +S L L G +   L  L ++ + D+  N LG  +P ++   V
Sbjct: 27  SWRGVFCDNVSLNVVSLNLSNLNLGGEISSALGDLMNLQSIDLQGNKLGGQIPDEIGNCV 86

Query: 463 QK--LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
               ++ + N   G +P+SIS++  LE+LN+ +NQL G +      + NL TLD + N L
Sbjct: 87  SLAYVDFSTNLLFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQL 146

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGIN 810
            G IP+       ++ + L+ N+ TGT+  D+     L   +V  N+ TG IP  +    
Sbjct: 147 TGEIPRLLYWNEVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCT 206

Query: 811 SLQTGGNSWN 840
           S +    S+N
Sbjct: 207 SFEILDVSYN 216



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 54/181 (29%), Positives = 89/181 (49%), Gaps = 7/181 (3%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +V  + + G +LTG +   +  ++++   D+S N L   +P  L       KL L GN  
Sbjct: 230 QVATLSLQGNKLTGRIPEVIGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKL 289

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  +  M+ L YL ++ N+L G++      L  L  L+ + N+L G IP   SS  
Sbjct: 290 TGQIPPELGNMSRLSYLQLNDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCA 349

Query: 673 NMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQT---GGNSW 837
            +    +  N  +G + +   NL  L  LN+ +N F G IP +L  I +L T    GN++
Sbjct: 350 ALNQFNVHGNFLSGAVPLEFRNLGSLTYLNLSSNSFKGKIPAELGHIINLDTLDLSGNNF 409

Query: 838 N 840
           +
Sbjct: 410 S 410



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 3/149 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G + F + +LK +   ++  N L   +P  L   PN++ L+LA N  TG +P  +   
Sbjct: 98  LFGDIPFSISKLKQLEFLNLKNNQLTGPIPATLTQIPNLKTLDLARNQLTGEIPRLLYWN 157

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+YL +  N L G ++     LT L   D   N+L G IP++  + T+ + + +  N 
Sbjct: 158 EVLQYLGLRGNMLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDVSYNQ 217

Query: 706 FTGTIDV-LANLPLDNLNVENNHFTGWIP 789
            TG I   +  L +  L+++ N  TG IP
Sbjct: 218 ITGVIPYNIGFLQVATLSLQGNKLTGRIP 246



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 50/171 (29%), Positives = 77/171 (45%), Gaps = 6/171 (3%)
 Frame = +1

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-PNVQKLNLAGNGFTGGLPYS 513
           + G  LTG++   +    S    D+S N +   +PY +    V  L+L GN  TG +P  
Sbjct: 189 VRGNNLTGTIPESIGNCTSFEILDVSYNQITGVIPYNIGFLQVATLSLQGNKLTGRIPEV 248

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           I  M  L  L++S N+L G +  +  +L+    L    N L G IP    +++ +  + L
Sbjct: 249 IGLMQALAVLDLSDNELTGPIPPILGNLSFTGKLYLHGNKLTGQIPPELGNMSRLSYLQL 308

Query: 694 QNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQ---GINSLQTGGN 831
            +N   G I   L  L  L  LN+ NN+  G IP  +     +N     GN
Sbjct: 309 NDNELVGKIPPELGKLEQLFELNLANNNLVGLIPSNISSCAALNQFNVHGN 359



>gb:AP005966_1860364 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863472 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 1036

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 69/226 (30%), Positives = 108/226 (47%), Gaps = 8/226 (3%)
 Frame = +1

Query: 166 PSAVADTDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCSGN---RVTEI 333
           P A +D    D   L    S L+ P   L  W+    + C  SW GV+CS     RV  I
Sbjct: 24  PLATSDDHENDRQTLLCFKSQLSGPTGVLDSWSNASLEFC--SWHGVTCSTQSPRRVASI 81

Query: 334 QISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLP 507
            ++   ++G +   +  L  +T   +S N+   S+P +L     +  LNL+ N   G +P
Sbjct: 82  DLASEGISGFISPCIANLTFLTRLQLSNNSFHGSIPSELGLLSQLNTLNLSTNALEGNIP 141

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
             +S  + LE L++S+N +QGE+        +L  +D S N L G IP  F +L  M+ +
Sbjct: 142 SELSSCSQLEILDLSNNFIQGEIPASLSQCNHLKDIDLSKNKLKGMIPSDFGNLPKMQII 201

Query: 688 YLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            L +N  TG I   + +   L  +++ +N  TG IP  L   +SLQ
Sbjct: 202 VLASNRLTGDIPPSLGSGHSLTYVDLGSNDLTGSIPESLVNSSSLQ 247



 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 61/212 (28%), Positives = 100/212 (47%), Gaps = 11/212 (5%)
 Frame = +1

Query: 214 GLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKS 393
           GL S LN+   L+     G  P   S    SCS   + ++  + +Q  G +   L Q   
Sbjct: 121 GLLSQLNTL-NLSTNALEGNIPSELS----SCSQLEILDLSNNFIQ--GEIPASLSQCNH 173

Query: 394 VTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ 567
           +   D+S N L   +P      P +Q + LA N  TG +P S+     L Y+++  N L 
Sbjct: 174 LKDIDLSKNKLKGMIPSDFGNLPKMQIIVLASNRLTGDIPPSLGSGHSLTYVDLGSNDLT 233

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID--VLANLP 741
           G +    V+ ++L  L  + N+L+G +P+   + +++  +YL  N F G+I      +LP
Sbjct: 234 GSIPESLVNSSSLQVLVLTSNTLSGELPKALFNSSSLIAIYLDENSFVGSIPPATAISLP 293

Query: 742 L-------DNLNVENNHFTGWIPPQLQGINSL 816
           L       + L++ NN F G+IPP L   + L
Sbjct: 294 LKYLYLGGNKLSLSNNRFKGFIPPTLLNASDL 325



 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 62/228 (27%), Positives = 105/228 (46%), Gaps = 29/228 (12%)
 Frame = +1

Query: 223  SSLNSPPQLTKWTANGGDPCGE------------SWKGV---SCSGNRVTEI-QISGLQ- 351
            SSL++  +LTK   +G +  G+             W  +     SGN   EI  +  L+ 
Sbjct: 367  SSLSNCSKLTKLLIDGNNLKGKLPHSIGNLSSSLKWLWIRDNKISGNIPPEIGNLKSLEM 426

Query: 352  -------LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--KLNLAGNGFTGGL 504
                   LTG +   +  L ++    I+ N L   +P  +   V+   L L  N F+GG+
Sbjct: 427  LYMDYNLLTGDIPPTIGNLHNLVVLAIAQNKLSGQIPDTIGNLVKLTDLKLDRNNFSGGI 486

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS-TLDFSFNSLAGNIPQTFSSLTNMK 681
            P ++     LE LN++HN L G +      +++ S  LD S N L G IP+   +L N+K
Sbjct: 487  PVTLEHCTQLEILNLAHNSLDGRIPNQIFKISSFSQELDLSHNYLYGGIPEEVGNLINLK 546

Query: 682  NMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQ 819
             + + +N  +G I       + L++L +++N F G IP   + +  +Q
Sbjct: 547  KLSISDNRLSGNIPSTLGQCVVLESLEMQSNLFAGSIPNSFENLVGIQ 594



 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 51/176 (28%), Positives = 89/176 (50%), Gaps = 5/176 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + I+  +L+G +   +  L  +T   +  NN    +P  L     ++ LNLA N   G +
Sbjct: 451 LAIAQNKLSGQIPDTIGNLVKLTDLKLDRNNFSGGIPVTLEHCTQLEILNLAHNSLDGRI 510

Query: 505 PYSISQMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P  I +++   + L++SHN L G +     +L NL  L  S N L+GNIP T      ++
Sbjct: 511 PNQIFKISSFSQELDLSHNYLYGGIPEEVGNLINLKKLSISDNRLSGNIPSTLGQCVVLE 570

Query: 682 NMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           ++ +Q+N+F G+I +   NL  +  L++  N+ +G IP  L   + L     S+N+
Sbjct: 571 SLEMQSNLFAGSIPNSFENLVGIQKLDISRNNMSGKIPDFLGNFSLLYDLNLSFNN 626



 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 54/209 (25%), Positives = 86/209 (41%), Gaps = 39/209 (18%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL------------- 450
           SG+ +T + +    LTGS+   L    S+    +++N L   LP  L             
Sbjct: 218 SGHSLTYVDLGSNDLTGSIPESLVNSSSLQVLVLTSNTLSGELPKALFNSSSLIAIYLDE 277

Query: 451 -------PPNV-------------QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQG 570
                  PP                KL+L+ N F G +P ++   + L  L + +N L G
Sbjct: 278 NSFVGSIPPATAISLPLKYLYLGGNKLSLSNNRFKGFIPPTLLNASDLSLLYMRNNSLTG 337

Query: 571 EVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN---MKNMYLQNNVFTGTI-DVLANL 738
            +   F SL NL  L  S+N L        SSL+N   +  + +  N   G +   + NL
Sbjct: 338 LIP-FFGSLKNLKELMLSYNKLEAADWSFISSLSNCSKLTKLLIDGNNLKGKLPHSIGNL 396

Query: 739 --PLDNLNVENNHFTGWIPPQLQGINSLQ 819
              L  L + +N  +G IPP++  + SL+
Sbjct: 397 SSSLKWLWIRDNKISGNIPPEIGNLKSLE 425



 Score = 40.0 bits (92), Expect = 0.056
 Identities = 23/85 (27%), Positives = 46/85 (54%), Gaps = 2/85 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGG 501
           ++ IS  +L+G++   L Q   + + ++ +N    S+P  ++    +QKL+++ N  +G 
Sbjct: 547 KLSISDNRLSGNIPSTLGQCVVLESLEMQSNLFAGSIPNSFENLVGIQKLDISRNNMSGK 606

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEV 576
           +P  +   + L  LN+S N   GEV
Sbjct: 607 IPDFLGNFSLLYDLNLSFNNFDGEV 631



>gb:AP003977_1835846 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1006_A02.
          Length = 1144

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 72/244 (29%), Positives = 113/244 (46%), Gaps = 11/244 (4%)
 Frame = +1

Query: 121 PWAVALLIGFLLNAPPSAVA---DTDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGE 288
           P    +L+    + P S+ A   D +  D   L    S ++ P + L  W     D C  
Sbjct: 25  PALFLVLLALTCSWPSSSSAGHGDGNDIDRQALLSFRSLVSDPARALESWRITSLDFC-- 82

Query: 289 SWKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-- 453
            W GV+CS     RVT + +S  QL G +   +  L S+   D+S N+    +P +L   
Sbjct: 83  HWHGVTCSTTMPGRVTVLDLSSCQLDGLIPPCIANLSSIERLDLSNNSFHGRIPAELSRL 142

Query: 454 PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
             ++ LNL+ N   G +P  +S  + LE L++ +N LQGE+      L ++  +D S N 
Sbjct: 143 EQLRHLNLSVNSLDGRIPAELSSCSRLEVLSLWNNSLQGEIPASLAQLVHIQLIDLSNNK 202

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQLQGI 807
           L G+IP  F +L  +K + L  N   G I  L  +   L  +++  N  +  IP  L   
Sbjct: 203 LQGSIPSGFGTLRELKILNLATNTLVGNIPWLLGSGSSLTYVDLGGNGLSEGIPEFLANS 262

Query: 808 NSLQ 819
           +SLQ
Sbjct: 263 SSLQ 266



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 48/168 (28%), Positives = 87/168 (51%), Gaps = 5/168 (2%)
 Frame = +1

Query: 352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
            L+G +   +  L  +T   +  NN   ++P  L    +++KLNL+ N F G +P  +  +
Sbjct: 567  LSGHVPDSIGNLVKLTELYLDGNNFSGTIPASLGQWRHLEKLNLSHNSFGGSIPSEVFNI 626

Query: 526  APL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
            + L + L++SHN   G + +    L NL +L  S N L  NIP T      +++++++ N
Sbjct: 627  SSLSQSLDLSHNSFAGPIPLEIGGLINLGSLSISNNRLTSNIPSTLGKCVLLESLHMEEN 686

Query: 703  VFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            +  G+I   L NL  +  L++ +N+ +G IP     +N L+    S+N
Sbjct: 687  LLVGSIPHFLMNLRSIKELDLSSNNLSGSIPDFFASMNYLKDLNLSFN 734



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/162 (28%), Positives = 84/162 (51%), Gaps = 5/162 (3%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLNLAGNG 489
            ++TE+ + G   +G++   L Q + +   ++S N+ G S+P   + +    Q L+L+ N 
Sbjct: 580  KLTELYLDGNNFSGTIPASLGQWRHLEKLNLSHNSFGGSIPSEVFNISSLSQSLDLSHNS 639

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            F G +P  I  +  L  L++S+N+L   +         L +L    N L G+IP    +L
Sbjct: 640  FAGPIPLEIGGLINLGSLSISNNRLTSNIPSTLGKCVLLESLHMEENLLVGSIPHFLMNL 699

Query: 670  TNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
             ++K + L +N  +G+I D  A++  L +LN+  N F G +P
Sbjct: 700  RSIKELDLSSNNLSGSIPDFFASMNYLKDLNLSFNDFDGPVP 741



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 45/138 (32%), Positives = 70/138 (50%), Gaps = 5/138 (3%)
 Frame = +1

Query: 418 NNLGNSLPYQ---LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
           N L   LP     LP  ++ L L  N  +G +P  I  +  LE L +  N   G +    
Sbjct: 492 NGLQGHLPSSVGNLPSELKWLWLKQNKLSGTIPLEIGNLRSLEVLYMDQNLFTGTIPPSV 551

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVE 762
            +L+NL  L F+ N+L+G++P +  +L  +  +YL  N F+GTI         L+ LN+ 
Sbjct: 552 GNLSNLLVLSFAQNNLSGHVPDSIGNLVKLTELYLDGNNFSGTIPASLGQWRHLEKLNLS 611

Query: 763 NNHFTGWIPPQLQGINSL 816
           +N F G IP ++  I+SL
Sbjct: 612 HNSFGGSIPSEVFNISSL 629



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 49/189 (25%), Positives = 90/189 (47%), Gaps = 5/189 (2%)
 Frame = +1

Query: 268 GGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-- 441
           GG+   E       + + +  + ++  +LTG++   L    S+T   +  N L  S+P  
Sbjct: 247 GGNGLSEGIPEFLANSSSLQFLSLTQNKLTGALPRALFNTSSLTAIYLDRNKLIGSIPPV 306

Query: 442 YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF 621
             +   +Q L+LA N  T  +P SI  ++ L  ++++ N L G +      +  L  L  
Sbjct: 307 TAVAAPIQYLSLAENNLTSEIPASIGNLSSLVGVSLAANNLVGSIPESLSRIPTLEMLIL 366

Query: 622 SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLP-LDNLNVENNHFTGWIPP 792
           S N+L+G +PQ+  +++++K + L NN   G +  D+   LP L  L +     +G IP 
Sbjct: 367 SINNLSGQVPQSIFNISSLKYLELANNSLIGRLPPDIGYKLPNLQRLILSKTRLSGPIPA 426

Query: 793 QLQGINSLQ 819
            L   + L+
Sbjct: 427 SLVNASKLE 435



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 41/167 (24%), Positives = 81/167 (48%), Gaps = 4/167 (2%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAG 483
           SG+ +T + + G  L+  +   L    S+    ++ N L  +LP  L    ++  + L  
Sbjct: 237 SGSSLTYVDLGGNGLSEGIPEFLANSSSLQFLSLTQNKLTGALPRALFNTSSLTAIYLDR 296

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N   G +P   +  AP++YL+++ N L  E+     +L++L  +  + N+L G+IP++ S
Sbjct: 297 NKLIGSIPPVTAVAAPIQYLSLAENNLTSEIPASIGNLSSLVGVSLAANNLVGSIPESLS 356

Query: 664 SLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
            +  ++ + L  N  +G +   +     L  L + NN   G +PP +
Sbjct: 357 RIPTLEMLILSINNLSGQVPQSIFNISSLKYLELANNSLIGRLPPDI 403



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 2/126 (1%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGFTGGL 504
            + +S     G +  ++  L ++ +  IS N L +++P  L   V  + L++  N   G +
Sbjct: 633  LDLSHNSFAGPIPLEIGGLINLGSLSISNNRLTSNIPSTLGKCVLLESLHMEENLLVGSI 692

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
            P+ +  +  ++ L++S N L G +   F S+  L  L+ SFN   G +P T     N   
Sbjct: 693  PHFLMNLRSIKELDLSSNNLSGSIPDFFASMNYLKDLNLSFNDFDGPVPST-GIFRNASR 751

Query: 685  MYLQNN 702
            + LQ N
Sbjct: 752  VSLQGN 757



>gb:AF506516_1806898 Glycine max receptor-like kinase RHG1 gene,
           complete cds.>gb:AF506517_1806899 Glycine max
           receptor-like kinase RHG1 mRNA, complete cds.
          Length = 855

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 93  LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 152

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 153 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 212

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 213 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 272

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 273 DHNFFTGDVPASLGSLREL 291



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 217 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 276

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 277 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 336

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 337 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 388



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 255 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 314

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 315 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 374

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 375 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 434

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 435 SSSFVGN 441



>gb:AY182165_1587873 Elaeis guineensis clone Rlk-OPff receptor-like
           protein kinase mRNA, complete cds.
          Length = 938

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 63/221 (28%), Positives = 108/221 (48%), Gaps = 31/221 (14%)
 Frame = +1

Query: 244 QLTKWTANGGDPCGESWKGVSCSG--NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDIST 417
           +L  W  +  +PC   W G+ C    NRVTE+ ++G  L+G +G  L QL+S+ T  +S 
Sbjct: 46  KLVSWNEDDDEPC--CWTGIKCEPKTNRVTELSLNGFSLSGKIGRGLLQLQSLRTLSLSK 103

Query: 418 NNLG--------------------NSLPYQLPP-------NVQKLNLAGNGFTGGLPYSI 516
           NN                      N L   +P        +++ ++LA N F G +P ++
Sbjct: 104 NNFSGTLSSDLLRLESLRNLDLSENKLSGPIPDDFFGQCRSIRAISLAKNAFFGAIPSNV 163

Query: 517 SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ 696
              + L  LN+S N+L G +     SL  L +LD S N+L G IP   S + N++++ L 
Sbjct: 164 GFCSTLAALNLSSNRLSGSLPWRLWSLNALRSLDLSDNTLVGEIPVGISKMYNLRSISLH 223

Query: 697 NNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINS 813
            N  +G +  D+   L L +L++  N  +G +P  ++ +++
Sbjct: 224 GNRLSGHLPDDIGDCLLLKSLDLAGNSLSGSLPESMRKLST 264



 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/141 (31%), Positives = 76/141 (53%), Gaps = 2/141 (1%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNL 477
           S S + +  + +S    +GS+   L +LKS+   D+S N L  S+P ++    ++++L L
Sbjct: 378 SSSASNLQVLVLSSNAFSGSIPEGLGKLKSLEVLDLSGNRLNGSIPLEIGGAVSLKELRL 437

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N   G +P  I   A L  L++S N L G +     +LTNL  ++FS N L G IP+ 
Sbjct: 438 EKNSLKGAIPTQIGNCASLTSLDLSQNNLTGPIPPTLANLTNLQIINFSRNRLTGTIPKQ 497

Query: 658 FSSLTNMKNMYLQNNVFTGTI 720
            S+L ++ +  + +NV +G I
Sbjct: 498 LSNLPHLLSFNIAHNVLSGDI 518



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 49/158 (31%), Positives = 84/158 (53%), Gaps = 4/158 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           ++ +S  +L GS+        ++    +S+N    S+P  L    +++ L+L+GN   G 
Sbjct: 362 QVLVSENKLNGSIVIPSSSASNLQVLVLSSNAFSGSIPEGLGKLKSLEVLDLSGNRLNGS 421

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P  I     L+ L +  N L+G +     +  +L++LD S N+L G IP T ++LTN++
Sbjct: 422 IPLEIGGAVSLKELRLEKNSLKGAIPTQIGNCASLTSLDLSQNNLTGPIPPTLANLTNLQ 481

Query: 682 NMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
            +    N  TGTI   L+NLP L + N+ +N  +G IP
Sbjct: 482 IINFSRNRLTGTIPKQLSNLPHLLSFNIAHNVLSGDIP 519



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 51/181 (28%), Positives = 87/181 (48%), Gaps = 28/181 (15%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--------------------GNSLPYQL 450
           + +S  +L+GS+ ++L  L ++ + D+S N L                    GN L   L
Sbjct: 172 LNLSSNRLSGSLPWRLWSLNALRSLDLSDNTLVGEIPVGISKMYNLRSISLHGNRLSGHL 231

Query: 451 PPNV------QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLST 612
           P ++      + L+LAGN  +G LP S+ +++   YL++S N   GEV      + +L T
Sbjct: 232 PDDIGDCLLLKSLDLAGNSLSGSLPESMRKLSTCSYLSLSSNFFSGEVPTWIGEMKSLET 291

Query: 613 LDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWI 786
           LD S N   G +P +   L  +K + L  N FTG+    + +   L ++++  N  TG +
Sbjct: 292 LDLSRNGFFGQLPGSLGDLQLLKALKLSRNGFTGSFPESLCSCKSLVDVDLSQNSLTGKL 351

Query: 787 P 789
           P
Sbjct: 352 P 352



>gb:AY059802_1564646 Arabidopsis thaliana leucine-rich repeat
           protein FLR1 (T23B7.10) mRNA, complete
           cds.>gb:AY085937_1570999 Arabidopsis thaliana clone
           19879 mRNA, complete sequence.>gb:BT001172_1635427
           Arabidopsis thaliana leucine-rich repeat protein FLR1
           mRNA, complete cds.>gb:AP002063_1821825 Arabidopsis
           thaliana genomic DNA, chromosome 3, BAC clone: T23B7.
          Length = 325

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 65/243 (26%), Positives = 112/243 (46%), Gaps = 7/243 (2%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           +++    L    PS+ + T+  D + L  +  +L +PP L+ W  N    C   W GV C
Sbjct: 7   LSIFFSILFITLPSSYSCTE-NDKNALLQIKKALGNPPLLSSW--NPRTDCCTGWTGVEC 63

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
           +  RVT + ++  +++G + +Q+  L  + T D S       LP+               
Sbjct: 64  TNRRVTGLSVTSGEVSGQISYQIGDLVDLRTLDFSY------LPH--------------- 102

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +P +I+++  L  L + H  L G +      L +L+ LD SFN   G IP + S +
Sbjct: 103 LTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLDLSFNQFTGPIPGSLSQM 162

Query: 670 TNMKNMYLQNNVFTGTI-----DVLANLPLDNLNVENNHFTGWIPPQLQ--GINSLQTGG 828
             ++ + + +N  TG+I       + N+P  NL + NN  +G IP  L     N++   G
Sbjct: 163 PKLEAIQINDNKLTGSIPNSFGSFVGNVP--NLYLSNNKLSGKIPESLSKYDFNAVDLSG 220

Query: 829 NSW 837
           N +
Sbjct: 221 NGF 223



>gb:AY057648_1564061 Arabidopsis thaliana At3g12148/T23B7.11 mRNA,
           complete cds.
          Length = 325

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 65/243 (26%), Positives = 112/243 (46%), Gaps = 7/243 (2%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           +++    L    PS+ + T+  D + L  +  +L +PP L+ W  N    C   W GV C
Sbjct: 7   LSIFFSILFITLPSSYSCTE-NDKNALLQIKKALGNPPLLSSW--NPRTDCCTGWTGVEC 63

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
           +  RVT + ++  +++G + +Q+  L  + T D S       LP+               
Sbjct: 64  TNRRVTGLSVTSGEVSGQISYQIGDLVDLRTLDFSY------LPH--------------- 102

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +P +I+++  L  L + H  L G +      L +L+ LD SFN   G IP + S +
Sbjct: 103 LTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLDLSFNQFTGPIPGSLSQM 162

Query: 670 TNMKNMYLQNNVFTGTI-----DVLANLPLDNLNVENNHFTGWIPPQLQ--GINSLQTGG 828
             ++ + + +N  TG+I       + N+P  NL + NN  +G IP  L     N++   G
Sbjct: 163 PKLEAIQINDNKLTGSIPNSFSSFVGNVP--NLYLSNNKLSGKIPESLSKYDFNAVDLSG 220

Query: 829 NSW 837
           N +
Sbjct: 221 NGF 223



>gb:AC073395_1541016 Arabidopsis thaliana chromosome 3 BAC F11B9
           genomic sequence, complete
           sequence.>gb:ATAC009991_1543114 Arabidopsis thaliana
           chromosome III BAC F9F8 genomic sequence, complete
           sequence.
          Length = 943

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/173 (32%), Positives = 90/173 (52%), Gaps = 6/173 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +R+T + +S  Q +G +   +  L  +T+ ++S+N     +P  +    N+  L+L  N 
Sbjct: 173 SRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNLTFLSLPSND 232

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           F G +P SI  +A L YL +S+N   GE+   F +L  L  L    N L+GN+P +  +L
Sbjct: 233 FFGQIPSSIGNLARLTYLYLSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNL 292

Query: 670 TNMKNMYLQNNVFTGT----IDVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           T +  + L +N FTGT    I +L+NL   +    NN FTG +P  L  I  L
Sbjct: 293 TRLSALLLSHNQFTGTIPNNISLLSNLM--DFEASNNAFTGTLPSSLFNIPPL 343



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 48/155 (30%), Positives = 77/155 (49%), Gaps = 3/155 (1%)
 Frame = +1

Query: 340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLPY 510
            S    TG +   +  L+S+ T D+S NN   S+P    +L   +  LNL  N  +GGLP 
Sbjct: 553  SNNNFTGKIPSFICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPK 612

Query: 511  SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
             I +   L  L+V HN L G++    +  +NL  L+   N +    P   SSL+ ++ + 
Sbjct: 613  HIFES--LRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLV 670

Query: 691  LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQ 795
            L++N F G I       L  +++ +NHF G +P +
Sbjct: 671  LRSNAFHGPIHEATFPELRIIDISHNHFNGTLPTE 705



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 31/104 (29%), Positives = 62/104 (59%), Gaps = 2/104 (1%)
 Frame = +1

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
           S+ ++  L  L+++ N L GE+     +L++L++L  S+N   G IP +  +L+ + +++
Sbjct: 120 SLFRLQNLRVLDLTQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLH 179

Query: 691 LQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           L +N F+G I   + NL  L +L + +N F+G IP  +  +++L
Sbjct: 180 LSSNQFSGQIPSSIGNLSHLTSLELSSNQFSGQIPSSIGNLSNL 223



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 36/124 (29%), Positives = 62/124 (50%), Gaps = 3/124 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNG 489
           N++  +Q+   +L+G++   L  L  ++   +S N    ++P    L  N+     + N 
Sbjct: 269 NQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNA 328

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL-TNLSTLDFSFNSLAGNIPQTFSS 666
           FTG LP S+  + PL  L++S NQL G +    +S  +NL  L    N+  G IP++ S 
Sbjct: 329 FTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSNNFIGTIPRSLSR 388

Query: 667 LTNM 678
             N+
Sbjct: 389 FVNL 392



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = +1

Query: 397  TTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQG 570
            T  D S N     +P    L   +  LNL+ N F G +P S+  +  LE L+VS N+L G
Sbjct: 757  TALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTG 816

Query: 571  EVTVMFVSLTNLSTLDFSFNSLAGNIP 651
            E+      L+ L+ ++FS N LAG +P
Sbjct: 817  EIPQELGDLSFLAYMNFSHNQLAGLVP 843



 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 50/203 (24%), Positives = 79/203 (38%), Gaps = 48/203 (23%)
 Frame = +1

Query: 352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
            L G +   L +  ++   ++ +N + ++ P+ L     +Q L L  N F G  P   +  
Sbjct: 628  LVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAFHG--PIHEATF 685

Query: 526  APLEYLNVSHNQLQGEV-TVMFVS------------------------------------ 594
              L  +++SHN   G + T  FV                                     
Sbjct: 686  PELRIIDISHNHFNGTLPTEYFVKWSAMSSLGKNEDQSNEKYMGSGLYYQDSMVLMNKGL 745

Query: 595  -------LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLD 747
                   LT  + LDFS N   G IP++   L  +  + L NN F G I   + NL  L+
Sbjct: 746  AMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALE 805

Query: 748  NLNVENNHFTGWIPPQLQGINSL 816
            +L+V  N  TG IP +L  ++ L
Sbjct: 806  SLDVSQNKLTGEIPQELGDLSFL 828



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 49/199 (24%), Positives = 90/199 (45%), Gaps = 9/199 (4%)
 Frame = +1

Query: 250  TKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG 429
            T  ++   DP  +S + +  SG  +T+     L+    +GF           D+S N + 
Sbjct: 456  TNKSSVSSDPPSQSIQSLYLSGCGITDFP-EILRTQHELGF----------LDVSNNKIK 504

Query: 430  NSLPYQL--PPNVQKLNLAGNGF----TGGLPYSISQMAP--LEYLNVSHNQLQGEVTVM 585
              +P  L   PN+  LNL+ N F    +    + +S +    + +L  S+N   G++   
Sbjct: 505  GQVPGWLWTLPNLFYLNLSNNTFISFESSSKKHGLSSVRKPSMIHLFASNNNFTGKIPSF 564

Query: 586  FVSLTNLSTLDFSFNSLAGNIPQTFSSL-TNMKNMYLQNNVFTGTIDVLANLPLDNLNVE 762
               L +L+TLD S N+  G+IP+    L + +  + L+ N  +G +       L +L+V 
Sbjct: 565  ICGLRSLNTLDLSENNYNGSIPRCMEKLKSTLFVLNLRQNNLSGGLPKHIFESLRSLDVG 624

Query: 763  NNHFTGWIPPQLQGINSLQ 819
            +N   G +P  L   ++L+
Sbjct: 625  HNLLVGKLPRSLIRFSNLE 643



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 44/154 (28%), Positives = 73/154 (47%), Gaps = 5/154 (3%)
 Frame = +1

Query: 376 LDQLKSVTTFDISTNNLGNSLPYQL---PPN--VQKLNLAGNGFTGGLPYSISQMAPLEY 540
           L   K++ + DIS N +  +    +   PP+  +Q L L+G G T   P  +     L +
Sbjct: 437 LPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITD-FPEILRTQHELGF 495

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           L+VS+N+++G+V     +L NL  L+ S N        TF S  +    +  ++V   + 
Sbjct: 496 LDVSNNKIKGQVPGWLWTLPNLFYLNLSNN--------TFISFESSSKKHGLSSVRKPS- 546

Query: 721 DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
                  + +L   NN+FTG IP  + G+ SL T
Sbjct: 547 -------MIHLFASNNNFTGKIPSFICGLRSLNT 573



 Score = 42.4 bits (98), Expect = 0.011
 Identities = 44/201 (21%), Positives = 84/201 (41%), Gaps = 34/201 (16%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGN 486
           + + + + S    TG++   L  +  +   D+S N L  +L +     P N+Q L +  N
Sbjct: 317 SNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLNGTLHFGNISSPSNLQYLIIGSN 376

Query: 487 GFTGGLPYSIS---------------QMAPLEYLNVSHNQLQGEVTVMFVSLT------- 600
            F G +P S+S               Q  P+++   SH +   ++ + +++ T       
Sbjct: 377 NFIGTIPRSLSRFVNLTLFDLSHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDI 436

Query: 601 -----NLSTLDFSFNSLAGNIPQTFSS---LTNMKNMYLQNNVFTGTIDVL-ANLPLDNL 753
                 L +LD S N ++     + SS     +++++YL     T   ++L     L  L
Sbjct: 437 LPYFKTLRSLDISGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFL 496

Query: 754 NVENNHFTGWIPPQLQGINSL 816
           +V NN   G +P  L  + +L
Sbjct: 497 DVSNNKIKGQVPGWLWTLPNL 517



 Score = 42.0 bits (97), Expect = 0.015
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 2/85 (2%)
 Frame = +1

Query: 541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
            L+ S N+ +GE+      L  L  L+ S N+  G+IP +  +LT ++++ +  N  TG I
Sbjct: 759  LDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGEI 818

Query: 721  -DVLANLP-LDNLNVENNHFTGWIP 789
               L +L  L  +N  +N   G +P
Sbjct: 819  PQELGDLSFLAYMNFSHNQLAGLVP 843



>gb:AX196310_1463937 Sequence 17 from Patent WO0151627.
          Length = 854

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 93  LRSWNDSGYGACSGGWVGIKCAKGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 152

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 153 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 212

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 213 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 272

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 273 DHNFFTGDVPASLGSLREL 291



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 217 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 276

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 277 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 336

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 337 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 388



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 255 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 314

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 315 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 374

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 375 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 434

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 435 SSSFVGN 441



>gb:AX196309_1463936 Sequence 16 from Patent WO0151627.
          Length = 877

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 116 LRSWNDSGYGACSGGWVGIKCAKGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 175

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 176 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 235

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 236 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 295

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 296 DHNFFTGDVPASLGSLREL 314



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 240 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 299

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 300 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 359

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 360 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 411



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 278 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 337

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 338 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 397

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 398 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 457

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 458 SSSFVGN 464



>gb:AX196306_1463933 Sequence 13 from Patent WO0151627.
          Length = 854

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 93  LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 152

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 153 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 212

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 213 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 272

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 273 DHNFFTGDVPASLGSLREL 291



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 217 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 276

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 277 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 336

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 337 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 388



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 255 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 314

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 315 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 374

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 375 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 434

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 435 SSSFVGN 441



>gb:AX196305_1463932 Sequence 12 from Patent WO0151627.
          Length = 877

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 116 LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 175

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 176 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 235

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 236 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 295

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 296 DHNFFTGDVPASLGSLREL 314



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 240 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 299

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 300 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 359

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 360 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 411



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 278 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 337

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 338 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 397

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 398 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 457

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 458 SSSFVGN 464



>gb:AX196304_1463931 Sequence 11 from Patent WO0151627.
          Length = 854

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 93  LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 152

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 153 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 212

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 213 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 272

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 273 DHNFFTGDVPASLGSLREL 291



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 217 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 276

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 277 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 336

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 337 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 388



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 255 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 314

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 315 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 374

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 375 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 434

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 435 SSSFVGN 441



>gb:AX196303_1463930 Sequence 10 from Patent WO0151627.
          Length = 877

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 116 LRSWNDSGYGACSGGWVGIKCAQGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 175

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 176 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 235

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 236 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 295

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 296 DHNFFTGDVPASLGSLREL 314



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 240 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 299

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 300 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 359

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 360 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 411



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 278 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 337

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 338 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 397

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 398 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 457

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 458 SSSFVGN 464



>gb:AX196296_1463926 Sequence 3 from Patent
           WO0151627.>gb:AX196302_1463929 Sequence 9 from Patent
           WO0151627.>gb:AX196308_1463935 Sequence 15 from Patent
           WO0151627.
          Length = 854

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 93  LRSWNDSGYGACSGGWVGIKCAKGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 152

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 153 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 212

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 213 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 272

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 273 DHNFFTGDVPASLGSLREL 291



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 217 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 276

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 277 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 336

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 337 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 388



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 255 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 314

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 315 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 374

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 375 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 434

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 435 SSSFVGN 441



>gb:AX196295_1463925 Sequence 2 from Patent
           WO0151627.>gb:AX196301_1463928 Sequence 8 from Patent
           WO0151627.>gb:AX196307_1463934 Sequence 14 from Patent
           WO0151627.
          Length = 877

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 57/199 (28%), Positives = 97/199 (48%), Gaps = 9/199 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +G   C   W G+ C+  +V  IQ+    L G +  ++ QL+ +    +  N +
Sbjct: 116 LRSWNDSGYGACSGGWVGIKCAKGQVIVIQLPWKGLRGRITDKIGQLQGLRKLSLHDNQI 175

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           G S+P  L   PN++ + L  N  TG +P S+     L+ L++S+N L G +     + T
Sbjct: 176 GGSIPSTLGLLPNLRGVQLFNNRLTGSIPLSLGFCPLLQSLDLSNNLLTGAIPYSLANST 235

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-------DVLANLPLDNLNV 759
            L  L+ SFNS +G +P + +   ++  + LQNN  +G++              L NL +
Sbjct: 236 KLYWLNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLIL 295

Query: 760 ENNHFTGWIPPQLQGINSL 816
           ++N FTG +P  L  +  L
Sbjct: 296 DHNFFTGDVPASLGSLREL 314



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 11/174 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-------VQKLNLAGNG 489
           + +S    +G +   L    S+T   +  NNL  SLP     N       +Q L L  N 
Sbjct: 240 LNLSFNSFSGPLPASLTHSFSLTFLSLQNNNLSGSLPNSWGGNSKNGFFRLQNLILDHNF 299

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P S+  +  L  +++SHN+  G +     +L+ L TLD S N+L GN+P T S+L
Sbjct: 300 FTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSRLKTLDISNNALNGNLPATLSNL 359

Query: 670 TNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++  +  +NN+    I      L NL +  L +  N F+G IP  +  I+SL+
Sbjct: 360 SSLTLLNAENNLLDNQIPQSLGRLRNLSV--LILSRNQFSGHIPSSIANISSLR 411



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/187 (27%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = +1

Query: 289 SWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--N 459
           SW G S +G  R+  + +     TG +   L  L+ +    +S N    ++P ++     
Sbjct: 278 SWGGNSKNGFFRLQNLILDHNFFTGDVPASLGSLRELNEISLSHNKFSGAIPNEIGTLSR 337

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           ++ L+++ N   G LP ++S ++ L  LN  +N L  ++      L NLS L  S N  +
Sbjct: 338 LKTLDISNNALNGNLPATLSNLSSLTLLNAENNLLDNQIPQSLGRLRNLSVLILSRNQFS 397

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQL-QGIN 810
           G+IP + +++++++ + L  N F+G I V   +   L+  NV  N  +G +PP L +  N
Sbjct: 398 GHIPSSIANISSLRQLDLSLNNFSGEIPVSFDSQRSLNLFNVSYNSLSGSVPPLLAKKFN 457

Query: 811 SLQTGGN 831
           S    GN
Sbjct: 458 SSSFVGN 464



>gb:AP005321_1850585 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0650H04.>gb:AP005421_1851563 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0435D08.
          Length = 672

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 74/236 (31%), Positives = 102/236 (43%), Gaps = 4/236 (1%)
 Frame = +1

Query: 109 LMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE 288
           ++ L W  AL IG    A     ADT          L +  ++      W ++   PCG 
Sbjct: 33  VVALLWCAAL-IGGGAGAGQDLAADT--------AALLAFRDAVGPRLPWASSSSSPCG- 82

Query: 289 SWKGVSCS--GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
            W+GV C   G RV  +Q+ G +L G                + T  +GN         +
Sbjct: 83  -WRGVRCDAGGGRVVALQLPGAKLVGR---------------VPTGTVGNLTA------L 120

Query: 463 QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAG 642
           + L+L  N  +GG+P  I     L  L +  NQL GEV   F SL  L  LD S N + G
Sbjct: 121 RTLSLRSNALSGGIPVDIGNCGELRALYLQGNQLAGEVPEGFFSLLLLQRLDLSRNRITG 180

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP-LDNLNVENN-HFTGWIPPQLQG 804
           +I   F+ L  +  +YL+NN   GT+    +LP L   NV NN   TG +P  L G
Sbjct: 181 SISPEFNKLRRLATLYLENNGLNGTLPADLDLPKLQLFNVSNNDQLTGAVPASLAG 236



>pir|G84652|G84652 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC005395_1532623 Arabidopsis
           thaliana chromosome 2 clone F17H15 map B68, complete
           sequence.
          Length = 960

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 56/171 (32%), Positives = 100/171 (58%), Gaps = 4/171 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +R+  + ++  QLTG +  +L ++K++    +  NNL   +PYQ+    ++  L+L  N 
Sbjct: 193 SRLEFLTLASNQLTGGVPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNN 252

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P S+  +  LEY+ +  N+L G++     SL NL +LDFS NSL+G IP+  + +
Sbjct: 253 LSGPIPPSLGDLKKLEYMFLYQNKLSGQIPPSIFSLQNLISLDFSDNSLSGEIPELVAQM 312

Query: 670 TNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
            +++ ++L +N  TG I + + +LP L  L + +N F+G IP  L   N+L
Sbjct: 313 QSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANLGKHNNL 363



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 63/240 (26%), Positives = 108/240 (45%), Gaps = 32/240 (13%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSP-PQLTKWT-ANGGDPCGESWKGVSCSG-NRVTEIQISGLQLTGSM 366
           +  +L    SS+  P   L+ W+ ++  D C   W GV C+  +RV  + +SG  ++G +
Sbjct: 31  ELELLLSFKSSIQDPLKHLSSWSYSSTNDVC--LWSGVVCNNISRVVSLDLSGKNMSGQI 88

Query: 367 ----GFQLDQLKSVTT-----------------------FDISTNNLGNSLPYQLPPNVQ 465
                F+L  L+++                          ++S NN   S+P    PN+ 
Sbjct: 89  LTAATFRLPFLQTINLSNNNLSGPIPHDIFTTSSPSLRYLNLSNNNFSGSIPRGFLPNLY 148

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
            L+L+ N FTG +   I   + L  L++  N L G V     +L+ L  L  + N L G 
Sbjct: 149 TLDLSNNMFTGEIYNDIGVFSNLRVLDLGGNVLTGHVPGYLGNLSRLEFLTLASNQLTGG 208

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +P     + N+K +YL  N  +G I   +     L++L++  N+ +G IPP L  +  L+
Sbjct: 209 VPVELGKMKNLKWIYLGYNNLSGEIPYQIGGLSSLNHLDLVYNNLSGPIPPSLGDLKKLE 268



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 53/194 (27%), Positives = 91/194 (46%), Gaps = 28/194 (14%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--------------------GNSL 438
           R+  +Q+   + +G +   L +  ++T  D+STNNL                     NSL
Sbjct: 338 RLKVLQLWSNRFSGGIPANLGKHNNLTVLDLSTNNLTGKLPDTLCDSGHLTKLILFSNSL 397

Query: 439 PYQLPP------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
             Q+PP      +++++ L  NGF+G LP   +++  + +L++S+N LQG +      + 
Sbjct: 398 DSQIPPSLGMCQSLERVRLQNNGFSGKLPRGFTKLQLVNFLDLSNNNLQGNINTW--DMP 455

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHF 774
            L  LD S N   G +P  FS    +K + L  N  +G +   L   P + +L++  N  
Sbjct: 456 QLEMLDLSVNKFFGELPD-FSRSKRLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEI 514

Query: 775 TGWIPPQLQGINSL 816
           TG IP +L    +L
Sbjct: 515 TGVIPRELSSCKNL 528



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 50/164 (30%), Positives = 82/164 (50%), Gaps = 2/164 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPY 510
           +++     +G +     +L+ V   D+S NNL  ++     P ++ L+L+ N F G LP 
Sbjct: 414 VRLQNNGFSGKLPRGFTKLQLVNFLDLSNNNLQGNINTWDMPQLEMLDLSVNKFFGELP- 472

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
             S+   L+ L++S N++ G V    ++   +  LD S N + G IP+  SS  N+ N+ 
Sbjct: 473 DFSRSKRLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEITGVIPRELSSCKNLVNLD 532

Query: 691 LQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           L +N FTG I         L +L++  N  +G IP  L  I SL
Sbjct: 533 LSHNNFTGEIPSSFAEFQVLSDLDLSCNQLSGEIPKNLGNIESL 576



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 3/130 (2%)
 Frame = +1

Query: 388 KSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ 561
           K +   D+S N +   +P  L   P +  L+L+ N  TG +P  +S    L  L++SHN 
Sbjct: 478 KRLKKLDLSRNKISGVVPQGLMTFPEIMDLDLSENEITGVIPRELSSCKNLVNLDLSHNN 537

Query: 562 LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVL-ANL 738
             GE+   F     LS LD S N L+G IP+   ++ ++  + + +N+  G++    A L
Sbjct: 538 FTGEIPSSFAEFQVLSDLDLSCNQLSGEIPKNLGNIESLVQVNISHNLLHGSLPFTGAFL 597

Query: 739 PLDNLNVENN 768
            ++   VE N
Sbjct: 598 AINATAVEGN 607



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 46/166 (27%), Positives = 82/166 (49%), Gaps = 9/166 (5%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           +  S   L+G +   + Q++S+    + +NNL   +P  +   P ++ L L  N F+GG+
Sbjct: 294 LDFSDNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGI 353

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P ++ +   L  L++S N L G++        +L+ L    NSL   IP +     +++ 
Sbjct: 354 PANLGKHNNLTVLDLSTNNLTGKLPDTLCDSGHLTKLILFSNSLDSQIPPSLGMCQSLER 413

Query: 685 MYLQNNVFTG-------TIDVLANLPLDNLNVENNHFTGWIPPQLQ 801
           + LQNN F+G        + ++  L L N N++ N  T W  PQL+
Sbjct: 414 VRLQNNGFSGKLPRGFTKLQLVNFLDLSNNNLQGNINT-WDMPQLE 458



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 29/112 (25%), Positives = 53/112 (47%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG 501
           + ++ +S  ++TG +  +L   K++   D+S NN                      FTG 
Sbjct: 504 IMDLDLSENEITGVIPRELSSCKNLVNLDLSHNN----------------------FTGE 541

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           +P S ++   L  L++S NQL GE+     ++ +L  ++ S N L G++P T
Sbjct: 542 IPSSFAEFQVLSDLDLSCNQLSGEIPKNLGNIESLVQVNISHNLLHGSLPFT 593



>pir|B86465|B86465 probable Protein kinase [imported] - Arabidopsis
           thaliana>gb:AE005172_892214 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC015446_1537977 Arabidopsis thaliana
           chromosome I BAC F12G12 genomic sequence, complete
           sequence.
          Length = 1064

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 57/170 (33%), Positives = 94/170 (55%), Gaps = 4/170 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           R++++ + G  L+G +   + + +S+    +  N L   +P ++    N+  L+L  N F
Sbjct: 429 RLSKLLLLGNSLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEIGELQNLVFLDLYMNHF 488

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +GGLPY IS +  LE L+V +N + G++     +L NL  LD S NS  GNIP +F +L+
Sbjct: 489 SGGLPYEISNITVLELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNLS 548

Query: 673 NMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
            +  + L NN+ TG I   + NL  L  L++  N  +G IP +L  + SL
Sbjct: 549 YLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSL 598



 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 55/150 (36%), Positives = 86/150 (57%), Gaps = 4/150 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           +TG +  QL  L ++   D+S N+   ++P        + KL L  N  TG +P SI  +
Sbjct: 512 ITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNLSYLNKLILNNNLLTGQIPKSIKNL 571

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLS-TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
             L  L++S+N L GE+      +T+L+  LD S+N+  GNIP+TFS LT ++++ L +N
Sbjct: 572 QKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTGNIPETFSDLTQLQSLDLSSN 631

Query: 703 VFTGTIDVLANL-PLDNLNVENNHFTGWIP 789
              G I VL +L  L +LN+  N+F+G IP
Sbjct: 632 SLHGDIKVLGSLTSLASLNISCNNFSGPIP 661



 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 74/257 (28%), Positives = 107/257 (41%), Gaps = 57/257 (22%)
 Frame = +1

Query: 235 SPPQLTKWTANGGDPCGESWKGVSCSG-NRVTEIQI------------------------ 339
           SP   + W      PC  SW G++CS  NRV  + I                        
Sbjct: 41  SPSLFSSWDPQDQTPC--SWYGITCSADNRVISVSIPDTFLNLSSIPDLSSLSSLQFLNL 98

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYS 513
           S   L+G +     +L  +   D+S+N+L   +P +L     +Q L L  N  +G +P  
Sbjct: 99  SSTNLSGPIPPSFGKLTHLRLLDLSSNSLSGPIPSELGRLSTLQFLILNANKLSGSIPSQ 158

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLT-------------------------NLSTLD 618
           IS +  L+ L +  N L G +   F SL                          NL+TL 
Sbjct: 159 ISNLFALQVLCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFLKNLTTLG 218

Query: 619 FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPP 792
           F+ + L+G+IP TF +L N++ + L +   +GTI     L   L NL +  N  TG IP 
Sbjct: 219 FAASGLSGSIPSTFGNLVNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLTGSIPK 278

Query: 793 Q---LQGINSLQTGGNS 834
           +   LQ I SL   GNS
Sbjct: 279 ELGKLQKITSLLLWGNS 295



 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 43/127 (33%), Positives = 70/127 (55%), Gaps = 3/127 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ---KLNLAGNGFTGGLPYSISQ 522
           LTG +   +  L+ +T  D+S N+L   +P +L         L+L+ N FTG +P + S 
Sbjct: 560 LTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTGNIPETFSD 619

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L+ L++S N L G++ V+  SLT+L++L+ S N+ +G IP T    T     YLQN 
Sbjct: 620 LTQLQSLDLSSNSLHGDIKVLG-SLTSLASLNISCNNFSGPIPSTPFFKTISTTSYLQNT 678

Query: 703 VFTGTID 723
               ++D
Sbjct: 679 NLCHSLD 685



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 45/164 (27%), Positives = 81/164 (49%), Gaps = 8/164 (4%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK------LNLAGNGFTGGLPY 510
           +LTGS+  +L +L+ +T+  +     GNSL   +PP +         +++ N  TG +P 
Sbjct: 271 KLTGSIPKELGKLQKITSLLL----WGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPG 326

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            + ++  LE L +S N   G++     + ++L  L    N L+G+IP    +L ++++ +
Sbjct: 327 DLGKLVWLEQLQLSDNMFTGQIPWELSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQSFF 386

Query: 691 LQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL 816
           L  N  +GTI         L  L++  N  TG IP +L  +  L
Sbjct: 387 LWENSISGTIPSSFGNCTDLVALDLSRNKLTGRIPEELFSLKRL 430



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 46/171 (26%), Positives = 82/171 (47%), Gaps = 4/171 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T +  +   L+GS+      L ++ T  +    +  ++P QL     ++ L L  N  T
Sbjct: 214 LTTLGFAASGLSGSIPSTFGNLVNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLT 273

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  + ++  +  L +  N L G +     + ++L   D S N L G+IP     L  
Sbjct: 274 GSIPKELGKLQKITSLLLWGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVW 333

Query: 676 MKNMYLQNNVFTGTID-VLANL-PLDNLNVENNHFTGWIPPQLQGINSLQT 822
           ++ + L +N+FTG I   L+N   L  L ++ N  +G IP Q+  + SLQ+
Sbjct: 334 LEQLQLSDNMFTGQIPWELSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQS 384



>gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 map
           MAP_LOC, complete sequence.
          Length = 1250

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 52/174 (29%), Positives = 91/174 (52%), Gaps = 7/174 (4%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           R+  + +   QL   +  ++    S+  F ++ NNL  S+P +L    N+Q +NLA N  
Sbjct: 191 RIENMNLQENQLENEIPSEIGNCSSLVAFSVAVNNLNGSIPEELSMLKNLQVMNLANNSI 250

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +G +P  + +M  L+YLN+  NQL+G + +    L+N+  LD S N L G IP  F ++ 
Sbjct: 251 SGQIPTQLGEMIELQYLNLLGNQLEGSIPMSLAKLSNVRNLDLSGNRLTGEIPGEFGNMD 310

Query: 673 NMKNMYLQNNVFTGTIDVL-----ANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            ++ + L +N  +G I         N  L+++ +  N  +G IP +L+   SL+
Sbjct: 311 QLQVLVLTSNNLSGGIPKTICSSNGNSSLEHMMLSENQLSGEIPVELRECISLK 364



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 58/181 (32%), Positives = 90/181 (49%), Gaps = 6/181 (3%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL---NLAGNG 489
            ++T + ++  +L GS+ F L  L  +    +S+N     LP +L  N  KL   +L  N 
Sbjct: 649  KLTHLDLNNNRLYGSIPFWLGNLPLLGELKLSSNKFSGPLPRELF-NCSKLLVLSLEDNS 707

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
              G LP  I ++  L  LN   NQL G +     +L+ L  L  S NSL G IP     L
Sbjct: 708  INGTLPLEIGELKSLNILNFDKNQLSGPIPSTIGNLSKLYILRLSGNSLTGEIPSELGQL 767

Query: 670  TNMKNMY-LQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
             N++++  L  N  +G I   V     L+ L++ +NH TG +PPQ+  ++SL     S+N
Sbjct: 768  KNLQSILDLSFNNISGQIPPSVGTLTKLETLDLSHNHLTGEVPPQVGEMSSLGKLNLSYN 827

Query: 841  S 843
            +
Sbjct: 828  N 828



 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 45/140 (32%), Positives = 78/140 (55%), Gaps = 4/140 (2%)
 Frame = +1

Query: 409 ISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
           +S N L   +P +L    ++++L+L+ N   G +P  + ++  L  L +++N L G V+ 
Sbjct: 344 LSENQLSGEIPVELRECISLKQLDLSNNTLNGSIPVELYELVELTDLLLNNNTLVGSVSP 403

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLN 756
           +  +LTNL TL  S NSL GNIP+    + N++ ++L  N F+G I + + N   L  ++
Sbjct: 404 LIANLTNLQTLALSHNSLHGNIPKEIGMVENLEILFLYENQFSGEIPMEIGNCSRLQMID 463

Query: 757 VENNHFTGWIPPQLQGINSL 816
              N F+G IP  + G+  L
Sbjct: 464 FYGNAFSGRIPITIGGLKEL 483



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 48/171 (28%), Positives = 87/171 (50%), Gaps = 4/171 (2%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNG 489
            + +T I  S  +L GS+   L    S  +FD++ N   + +P  L   P +++L L  N 
Sbjct: 553  SNLTRINFSHNKLNGSIA-SLCSSTSFLSFDVTNNAFDHEVPPHLGYSPFLERLRLGNNR 611

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            FTG +P+++  +  L  L++S N+L G +         L+ LD + N L G+IP    +L
Sbjct: 612  FTGEIPWTLGLIRELSLLDLSGNELTGLIPPQLSLCRKLTHLDLNNNRLYGSIPFWLGNL 671

Query: 670  TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
              +  + L +N F+G +  ++     L  L++E+N   G +P ++  + SL
Sbjct: 672  PLLGELKLSSNKFSGPLPRELFNCSKLLVLSLEDNSINGTLPLEIGELKSL 722



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 71/296 (23%), Positives = 119/296 (40%), Gaps = 60/296 (20%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWK 297
           + V L++G++ +           T+  VL  +  S    P+  L+ W+    + C   W 
Sbjct: 13  FVVTLVLGYVFSE----------TEFEVLLEIKKSFLDDPENVLSNWSDKNQNFC--QWS 60

Query: 298 GVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP------ 453
           GVSC  +  +V  + +S   ++GS+   +  L  +   D+S+N L   +P  L       
Sbjct: 61  GVSCEEDTLKVVRLNLSDCSISGSISPSIGFLHDLLHLDLSSNLLSGPIPPTLSNLSSLQ 120

Query: 454 --------------------PNVQKLNLAGN-GFTGGLPYSI----------------SQ 522
                                N+Q L +  N G TG +P S+                S 
Sbjct: 121 SLLLYSNQLTGPIPNEIGLLKNLQVLRIGDNVGLTGLIPSSLGDLENLVTLGLASCSLSG 180

Query: 523 MAP--------LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
           M P        +E +N+  NQL+ E+     + ++L     + N+L G+IP+  S L N+
Sbjct: 181 MIPPELGKLGRIENMNLQENQLENEIPSEIGNCSSLVAFSVAVNNLNGSIPEELSMLKNL 240

Query: 679 KNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIP---PQLQGINSLQTGGN 831
           + M L NN  +G I       + L  LN+  N   G IP    +L  + +L   GN
Sbjct: 241 QVMNLANNSISGQIPTQLGEMIELQYLNLLGNQLEGSIPMSLAKLSNVRNLDLSGN 296



 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 40/156 (25%), Positives = 76/156 (48%), Gaps = 4/156 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S   L G++  ++  ++++    +  N     +P ++     +Q ++  GN F+G +
Sbjct: 414 LALSHNSLHGNIPKEIGMVENLEILFLYENQFSGEIPMEIGNCSRLQMIDFYGNAFSGRI 473

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P +I  +  L +++   N L GE+     +   L  LD + N L+G++P TF  L  ++ 
Sbjct: 474 PITIGGLKELNFIDFRQNDLSGEIPASVGNCHQLKILDLADNRLSGSVPATFGYLRALEQ 533

Query: 685 MYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWI 786
           + L NN   G + D L NL  L  +N  +N   G I
Sbjct: 534 LMLYNNSLEGNLPDELINLSNLTRINFSHNKLNGSI 569



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 29/201 (14%)
 Frame = +1

Query: 304 SCSGNRVTE-IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-------- 456
           S +GN   E + +S  QL+G +  +L +  S+   D+S N L  S+P +L          
Sbjct: 332 SSNGNSSLEHMMLSENQLSGEIPVELRECISLKQLDLSNNTLNGSIPVELYELVELTDLL 391

Query: 457 ------------------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
                             N+Q L L+ N   G +P  I  +  LE L +  NQ  GE+ +
Sbjct: 392 LNNNTLVGSVSPLIANLTNLQTLALSHNSLHGNIPKEIGMVENLEILFLYENQFSGEIPM 451

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLN 756
              + + L  +DF  N+ +G IP T   L  +  +  + N  +G I         L  L+
Sbjct: 452 EIGNCSRLQMIDFYGNAFSGRIPITIGGLKELNFIDFRQNDLSGEIPASVGNCHQLKILD 511

Query: 757 VENNHFTGWIPPQLQGINSLQ 819
           + +N  +G +P     + +L+
Sbjct: 512 LADNRLSGSVPATFGYLRALE 532



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 3/147 (2%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQK-LNLAGNGFTGGLPYSIS 519
            QL+G +   +  L  +    +S N+L   +P +L    N+Q  L+L+ N  +G +P S+ 
Sbjct: 731  QLSGPIPSTIGNLSKLYILRLSGNSLTGEIPSELGQLKNLQSILDLSFNNISGQIPPSVG 790

Query: 520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
             +  LE L++SHN L GEV      +++L  L+ S+N+L G + + ++        +   
Sbjct: 791  TLTKLETLDLSHNHLTGEVPPQVGEMSSLGKLNLSYNNLQGKLDKQYA--------HWPA 842

Query: 700  NVFTGTIDVLANLPLDNLNVENNHFTG 780
            + FTG    L   PL N  V  ++  G
Sbjct: 843  DAFTGN-PRLCGSPLQNCEVSKSNNRG 868



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 4/154 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG---NGFTGGLPYSIS 519
           Q +G +  ++     +   D   N     +P  +   +++LN      N  +G +P S+ 
Sbjct: 444 QFSGEIPMEIGNCSRLQMIDFYGNAFSGRIPITIG-GLKELNFIDFRQNDLSGEIPASVG 502

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
               L+ L+++ N+L G V   F  L  L  L    NSL GN+P    +L+N+  +   +
Sbjct: 503 NCHQLKILDLADNRLSGSVPATFGYLRALEQLMLYNNSLEGNLPDELINLSNLTRINFSH 562

Query: 700 NVFTGTI-DVLANLPLDNLNVENNHFTGWIPPQL 798
           N   G+I  + ++    + +V NN F   +PP L
Sbjct: 563 NKLNGSIASLCSSTSFLSFDVTNNAFDHEVPPHL 596



>gb:AY268139_1593942 Hordeum vulgare BAC 184G9, complete sequece.
          Length = 1023

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 65/247 (26%), Positives = 117/247 (47%), Gaps = 14/247 (5%)
 Frame = +1

Query: 121 PWAVALLIGF-----LLNAPPSAVADTDPTDASVLRGLFSSLNSPP--QLTKWTANGGDP 279
           PW + L+        LL  P ++ + +   D   L    S +   P   L+ WT NG   
Sbjct: 5   PWLLRLIAILTTTTALLLHPSTSSSVSTAHDLPALLSFKSLITKDPLGALSSWTTNGSTH 64

Query: 280 CGESWKGVSCSG---NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL 450
              SW GV CS      V  +++ GL L+G++   L  L  +   D+S N L   +P  +
Sbjct: 65  GFCSWTGVECSSAHPGHVKALRLQGLGLSGTISPFLGNLSRLRALDLSGNKLQGQIPSSI 124

Query: 451 PP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFS 624
                ++ LNL+ N  +G +P ++  ++ L  L+VS N + G +   F  L  ++    +
Sbjct: 125 GNCFALRTLNLSVNSLSGAIPPAMGNLSKLLVLSVSKNDISGTIPTSFAGLATVAVFSVA 184

Query: 625 FNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQL 798
            N + G +P    +LT ++++ + +N+ +G +    +  + L +L V  N+  G IPP L
Sbjct: 185 RNHVHGQVPPWLGNLTALEDLNMADNIMSGHVPPALSKLINLRSLTVAINNLQGLIPPVL 244

Query: 799 QGINSLQ 819
             ++SL+
Sbjct: 245 FNMSSLE 251



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 51/187 (27%), Positives = 88/187 (47%), Gaps = 29/187 (15%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--KLNLAGNG 489
           + + E+ +   +  G +   +  L  +    +STNNL  S+P       +   L+LA N 
Sbjct: 424 SNLKELSLFQNRYYGEIPSSIGNLSQLNLLALSTNNLEGSIPATFGNLTELISLDLASNL 483

Query: 490 FTGGLPYSISQMAPLE-YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
            +G +P  + +++ L  +LN+S+N L G ++     L NL+ +DFS N L+G IP    S
Sbjct: 484 LSGKIPEEVMRISSLALFLNLSNNLLDGPISPHIGQLANLAIIDFSSNKLSGPIPNALGS 543

Query: 667 LTNMKNMYLQNNVFTGTI--DVLA------------NLP------------LDNLNVENN 768
              ++ ++LQ N+  G I  +++A            NL             L NLN+  N
Sbjct: 544 CIALQFLHLQGNLLQGQIPKELMALRGLEELDLSNNNLSGPVPEFLESFQLLKNLNLSFN 603

Query: 769 HFTGWIP 789
           H +G +P
Sbjct: 604 HLSGPVP 610



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 51/183 (27%), Positives = 92/183 (50%), Gaps = 12/183 (6%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQ--LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK--- 468
           +CS   +  +Q++ L   L  S+G    +L+ +          GN +   +P  + +   
Sbjct: 349 NCSSLLLVNLQLNNLSGILPNSIGNLSQKLEGLRVG-------GNQIAGLIPTGIGRYLK 401

Query: 469 ---LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
              L  A N FTG +P  I +++ L+ L++  N+  GE+     +L+ L+ L  S N+L 
Sbjct: 402 LAILEFADNRFTGTIPSDIGKLSNLKELSLFQNRYYGEIPSSIGNLSQLNLLALSTNNLE 461

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGI 807
           G+IP TF +LT + ++ L +N+ +G I      +++L L  LN+ NN   G I P +  +
Sbjct: 462 GSIPATFGNLTELISLDLASNLLSGKIPEEVMRISSLAL-FLNLSNNLLDGPISPHIGQL 520

Query: 808 NSL 816
            +L
Sbjct: 521 ANL 523



>gb:AB010073_1510938 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFB13.>gb:AY128350_1580649 Arabidopsis thaliana
           Cf-5 disease resistance protein-like (At5g61240) mRNA,
           complete cds.>gb:BT000004_1634282 Arabidopsis thaliana
           Cf-5 disease resistance protein-like (At5g61240) mRNA,
           complete cds.
          Length = 326

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 62/206 (30%), Positives = 97/206 (47%), Gaps = 15/206 (7%)
 Frame = +1

Query: 268 GGDPCGES----WKGVSCSGNR----VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNN 423
           G DPCG+     W GV+CS       VTE+++  + + G     +  L  +T  D+  N 
Sbjct: 49  GDDPCGDGDLPPWSGVTCSTQGDYRVVTELEVYAVSIVGPFPIAVTNLLDLTRLDLHNNK 108

Query: 424 LGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
           L   +P Q+     ++ LNL  N     +P  I ++  L +L +S N  +GE+     +L
Sbjct: 109 LTGPIPPQIGRLKRLKVLNLRWNKLQDVIPPEIGELKRLTHLYLSFNSFKGEIPKELAAL 168

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP-----LDNLNVE 762
             L  L    N L G IP    +L N++++ + NN   GTI  L         L NL + 
Sbjct: 169 PELRYLYLQENRLIGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRFDGSFPALRNLYLN 228

Query: 763 NNHFTGWIPPQLQGINSLQTGGNSWN 840
           NN+ +G IP QL  + +L+    S+N
Sbjct: 229 NNYLSGGIPAQLSNLTNLEIVYLSYN 254



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 5/130 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-----PNVQKLNLAGNGFTGGLPYS 513
           +L G +  +L  L+++   D+  N+L  ++   +      P ++ L L  N  +GG+P  
Sbjct: 180 RLIGRIPAELGTLQNLRHLDVGNNHLVGTIRELIRFDGSFPALRNLYLNNNYLSGGIPAQ 239

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           +S +  LE + +S+N+  G +      +  L+ L    N   G IP  F     +K MY+
Sbjct: 240 LSNLTNLEIVYLSYNKFIGNIPFAIAHIPKLTYLYLDHNQFTGRIPDAFYKHPFLKEMYI 299

Query: 694 QNNVFTGTID 723
           + N+F   ++
Sbjct: 300 EGNMFKSGVN 309



>gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1364A02.
          Length = 1109

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 63/202 (31%), Positives = 101/202 (50%), Gaps = 9/202 (4%)
 Frame = +1

Query: 244 QLTKWTA----NGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFD 408
           +L+ W A     GGDPCG  W G++CS    VT + + GL L G +   +  L  +   +
Sbjct: 48  RLSSWDAAGGSGGGDPCG--WPGIACSAAMEVTAVTLHGLNLHGELSAAVCALPRLAVLN 105

Query: 409 ISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
           +S N L  +LP  L     ++ L+L+ N   GG+P S+  +  L  L +S N L GE+  
Sbjct: 106 VSKNALAGALPPGLAACRALEVLDLSTNSLHGGIPPSLCSLPSLRQLFLSENFLSGEIPA 165

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLN 756
              +LT L  L+   N+L G IP T ++L  ++ +    N  +G I  ++ A   L  L 
Sbjct: 166 AIGNLTALEELEIYSNNLTGGIPTTIAALQRLRIIRAGLNDLSGPIPVEISACASLAVLG 225

Query: 757 VENNHFTGWIPPQLQGINSLQT 822
           +  N+  G +P +L  + +L T
Sbjct: 226 LAQNNLAGELPGELSRLKNLTT 247



 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 54/174 (31%), Positives = 91/174 (52%), Gaps = 4/174 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           +T++Q+ G  LTGS+  +L  L+++++ D++ N     +P ++    ++++L L+ N F 
Sbjct: 461 LTQLQLGGNMLTGSLPVELSLLRNLSSLDMNRNRFSGPIPPEIGKFRSIERLILSENYFV 520

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  I  +  L   N+S NQL G +       T L  LD S NSL G IPQ   +L N
Sbjct: 521 GQIPPGIGNLTKLVAFNISSNQLTGPIPRELARCTKLQRLDLSKNSLTGVIPQELGTLVN 580

Query: 676 MKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
           ++ + L +N   GT+      L  L  L +  N  +G +P +L  + +LQ   N
Sbjct: 581 LEQLKLSDNSLNGTVPSSFGGLSRLTELQMGGNRLSGQLPVELGQLTALQIALN 634



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 52/192 (27%), Positives = 91/192 (47%), Gaps = 28/192 (14%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGG 501
           EI +S  +LTG +  +L ++ ++    +  N L  S+P +L     +++++L+ N  TG 
Sbjct: 319 EIDLSENKLTGVIPGELGRIPTLRLLYLFENRLQGSIPPELGELTVIRRIDLSINNLTGT 378

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFS------------------- 624
           +P     +  LEYL +  NQ+ G +  M  + +NLS LD S                   
Sbjct: 379 IPMEFQNLTDLEYLQLFDNQIHGVIPPMLGAGSNLSVLDLSDNRLTGSIPPHLCKFQKLI 438

Query: 625 -----FNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGW 783
                 N L GNIP    +   +  + L  N+ TG++ V  +L   L +L++  N F+G 
Sbjct: 439 FLSLGSNRLIGNIPPGVKACRTLTQLQLGGNMLTGSLPVELSLLRNLSSLDMNRNRFSGP 498

Query: 784 IPPQLQGINSLQ 819
           IPP++    S++
Sbjct: 499 IPPEIGKFRSIE 510



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 48/160 (30%), Positives = 79/160 (49%), Gaps = 4/160 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G +  +L +LK++TT  +  N L   +P +L   P+++ L L  N FTGG+P  +  +
Sbjct: 231 LAGELPGELSRLKNLTTLILWQNALSGEIPPELGDIPSLEMLALNDNAFTGGVPRELGAL 290

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L  L +  NQL G +      L +   +D S N L G IP     +  ++ +YL  N 
Sbjct: 291 PSLAKLYIYRNQLDGTIPRELGDLQSAVEIDLSENKLTGVIPGELGRIPTLRLLYLFENR 350

Query: 706 FTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
             G+I   L  L  +  +++  N+ TG IP + Q +  L+
Sbjct: 351 LQGSIPPELGELTVIRRIDLSINNLTGTIPMEFQNLTDLE 390



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 42/137 (30%), Positives = 71/137 (51%), Gaps = 3/137 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++    IS  QLTG +  +L +   +   D+S N+L   +P +L    N+++L L+ N  
Sbjct: 532 KLVAFNISSNQLTGPIPRELARCTKLQRLDLSKNSLTGVIPQELGTLVNLEQLKLSDNSL 591

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS-TLDFSFNSLAGNIPQTFSSL 669
            G +P S   ++ L  L +  N+L G++ V    LT L   L+ S+N L+G IP    +L
Sbjct: 592 NGTVPSSFGGLSRLTELQMGGNRLSGQLPVELGQLTALQIALNVSYNMLSGEIPTQLGNL 651

Query: 670 TNMKNMYLQNNVFTGTI 720
             ++ +YL NN   G +
Sbjct: 652 HMLEFLYLNNNELEGEV 668



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 54/176 (30%), Positives = 79/176 (44%), Gaps = 5/176 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL---NLAGNGFTGG 501
           +Q+   Q+ G +   L    +++  D+S N L  S+P  L    QKL   +L  N   G 
Sbjct: 392 LQLFDNQIHGVIPPMLGAGSNLSVLDLSDNRLTGSIPPHLC-KFQKLIFLSLGSNRLIGN 450

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P  +     L  L +  N L G + V    L NLS+LD + N  +G IP       +++
Sbjct: 451 IPPGVKACRTLTQLQLGGNMLTGSLPVELSLLRNLSSLDMNRNRFSGPIPPEIGKFRSIE 510

Query: 682 NMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            + L  N F G I   + NL  L   N+ +N  TG IP +L     LQ    S NS
Sbjct: 511 RLILSENYFVGQIPPGIGNLTKLVAFNISSNQLTGPIPRELARCTKLQRLDLSKNS 566



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 38/137 (27%), Positives = 67/137 (48%), Gaps = 3/137 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           ++  + +S   LTG +  +L  L ++    +S N+L  ++P        + +L + GN  
Sbjct: 556 KLQRLDLSKNSLTGVIPQELGTLVNLEQLKLSDNSLNGTVPSSFGGLSRLTELQMGGNRL 615

Query: 493 TGGLPYSISQMAPLEY-LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           +G LP  + Q+  L+  LNVS+N L GE+     +L  L  L  + N L G +P +F  L
Sbjct: 616 SGQLPVELGQLTALQIALNVSYNMLSGEIPTQLGNLHMLEFLYLNNNELEGEVPSSFGEL 675

Query: 670 TNMKNMYLQNNVFTGTI 720
           +++    L  N   G +
Sbjct: 676 SSLLECNLSYNNLAGPL 692



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 3/132 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ---KLNLAGNGFTG 498
           ++++S   L G++      L  +T   +  N L   LP +L         LN++ N  +G
Sbjct: 583 QLKLSDNSLNGTVPSSFGGLSRLTELQMGGNRLSGQLPVELGQLTALQIALNVSYNMLSG 642

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
            +P  +  +  LE+L +++N+L+GEV   F  L++L   + S+N+LAG +P T       
Sbjct: 643 EIPTQLGNLHMLEFLYLNNNELEGEVPSSFGELSSLLECNLSYNNLAGPLPSTTLFQHMD 702

Query: 679 KNMYLQNNVFTG 714
            + +L NN   G
Sbjct: 703 SSNFLGNNGLCG 714



>gb:AF136588_1771155 Arabidopsis thaliana leucine-rich repeat
           protein FLR1 (FLR1) mRNA, complete cds.
          Length = 324

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 65/243 (26%), Positives = 111/243 (45%), Gaps = 7/243 (2%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           +++    L    PS+   T+  D + L  +  +L +PP L+ W  N    C   W GV C
Sbjct: 7   LSIFFSILFITLPSSYNCTE-NDKNALLQIKKALGNPPLLSSW--NPRTDCCTGWTGVEC 63

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
           +  RVT + ++  +++G + +Q+  L  + T D S       LP+               
Sbjct: 64  TNRRVTGLSVTSGEVSGQISYQIGDLVDLRTLDFSY------LPH--------------- 102

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +P +I+++  L  L + H  L G +      L +L+ LD SFN   G IP + S +
Sbjct: 103 LTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLDLSFNQFTGPIPGSLSQM 162

Query: 670 TNMKNMYLQNNVFTGTI-----DVLANLPLDNLNVENNHFTGWIPPQLQ--GINSLQTGG 828
             ++ + + +N  TG+I       + N+P  NL + NN  +G IP  L     N++   G
Sbjct: 163 PKLEAIQINDNKLTGSIPNSFGSFVGNVP--NLYLSNNKLSGKIPESLSKYDFNAVDLSG 220

Query: 829 NSW 837
           N +
Sbjct: 221 NGF 223



>gb:U42445_1726335 Lycopersicon pimpinellifolium leucine rich repeat
           protein Cf-2.2 gene, complete cds.
          Length = 1112

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 62/218 (28%), Positives = 103/218 (47%), Gaps = 19/218 (8%)
 Frame = +1

Query: 220 FSSLNSPPQLTKWTAN--------------GGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           F+S      L KW A                 + C + W GV C   RV  + I+   + 
Sbjct: 25  FASTEEATALLKWKATFKNQNNSFLASWIPSSNAC-KDWYGVVCFNGRVNTLNITNASVI 83

Query: 358 GSM-GFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMA 528
           G++  F    L S+   D+S NN+  ++P ++    N+  L+L  N  +G +P  I  +A
Sbjct: 84  GTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLA 143

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+ + + HNQL G +      L +L+ L    N L+G+IP +  +L N+  +YL NN  
Sbjct: 144 KLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQL 203

Query: 709 TGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +G+I  ++     L  L++ +N   G IP  L  +N+L
Sbjct: 204 SGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNL 241



 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 4/171 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           N ++ + + G QL+GS+  ++  L+S+    +S N L  S+P  L    N+ +LNL  N 
Sbjct: 287 NNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQ 346

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P S+  +  L  L + +NQL G +     +L NLS L    N L+G+IP +  +L
Sbjct: 347 LSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNL 406

Query: 670 TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            N+  +YL NN  +G+I  ++     L  L++ NN   G+IP     +++L
Sbjct: 407 NNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNL 457



 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 57/171 (33%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           QL  S+  ++  L+S+   D+S N L  S+P       N+ +LNL  N  +G +P  I  
Sbjct: 466 QLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGY 525

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L  L++S N L G +   F +L NLS L+   N L+G+IP+    L ++ ++ L  N
Sbjct: 526 LRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSEN 585

Query: 703 VFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNSWN 840
              G+I   L NL  L  L + NN  +G IP +   L  +  L  G NS N
Sbjct: 586 ALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLN 636



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 61/195 (31%), Positives = 93/195 (47%), Gaps = 28/195 (14%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N ++ + +   QL+GS+  ++  L+S+T  D+S N L  S+P  L    N+  L L GN 
Sbjct: 191 NNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQ 250

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS-------------------- 609
            +G +P  I  +  L YL++S N L G +     +L NLS                    
Sbjct: 251 LSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYL 310

Query: 610 ----TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNH 771
                L  S N+L G+IP +  +L N+  + L NN  +G+I   L NL  L  L + NN 
Sbjct: 311 RSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQ 370

Query: 772 FTGWIPPQLQGINSL 816
            +G IP  L  +N+L
Sbjct: 371 LSGSIPASLGNLNNL 385



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 52/172 (30%), Positives = 86/172 (50%), Gaps = 4/172 (2%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
            N ++ + +   QL+GS+  ++  L+S+   D+S N L  S+P       N+ +LNL  N 
Sbjct: 503  NNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQ 562

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             +G +P  I  +  L  L +S N L G +     +L NLS L    N L+G+IP+    L
Sbjct: 563  LSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYL 622

Query: 670  TNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +++  + L NN   G I     N+  L  L + +N+  G IP  +  + SL+
Sbjct: 623  SSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLE 674



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 4/171 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           N ++ + +   QL+GS+   L  L +++   +  N L  S+P ++    ++  L+L+ N 
Sbjct: 383 NNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNS 442

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G +P S   M+ L +L +  NQL   V      L +L+ LD S N+L G+IP +F +L
Sbjct: 443 INGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNL 502

Query: 670 TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            N+  + L NN  +G+I  ++     L+ L++  N   G IP     +N+L
Sbjct: 503 NNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNL 553



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 56/206 (27%), Positives = 91/206 (44%), Gaps = 31/206 (15%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
            N ++ + +   QL+GS+  ++  L S+T   +  N+L   +P       N+Q L L  N 
Sbjct: 599  NNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNN 658

Query: 490  FTGGLPYSISQMAPLEYL------------------------NVSHNQLQGEVTVMFVSL 597
              G +P S+  +  LE L                        ++S N   GE+     +L
Sbjct: 659  LIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNL 718

Query: 598  TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNH 771
            T+L  LDF  N+L G IPQ F ++++++   +QNN  +GT+    ++   L +LN+  N 
Sbjct: 719  TSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNE 778

Query: 772  FTGWIPPQLQGINSLQT---GGNSWN 840
                IP  L     LQ    G N  N
Sbjct: 779  LEDEIPRSLDNCKKLQVLDLGDNQLN 804



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 52/193 (26%), Positives = 91/193 (47%), Gaps = 28/193 (14%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   +  L +++   +  N L  S+P ++    ++ +L+L+ N   
Sbjct: 169 LTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALN 228

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  M  L +L +  NQL G +      L +L+ LD S N+L G+IP +  +L N
Sbjct: 229 GSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNN 288

Query: 676 MKNMYLQNNVFTGTID-------------------------VLANLP-LDNLNVENNHFT 777
           +  ++L  N  +G+I                           L NL  L  LN+ NN  +
Sbjct: 289 LSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLS 348

Query: 778 GWIPPQLQGINSL 816
           G IP  L  +N+L
Sbjct: 349 GSIPASLGNLNNL 361



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 34/84 (40%), Positives = 50/84 (59%)
 Frame = +1

Query: 469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
            ++L+ N F G +P  +  +  +  LNVSHN LQG +     SL+ L +LD SFN L+G I
Sbjct: 909  IDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEI 968

Query: 649  PQTFSSLTNMKNMYLQNNVFTGTI 720
            PQ  +SLT ++ + L +N   G I
Sbjct: 969  PQQLASLTFLEFLNLSHNYLQGCI 992



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 39/112 (34%), Positives = 55/112 (49%), Gaps = 2/112 (1%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            L   T  D+S+N     +P  L     ++ LN++ N   G +P S+  ++ LE L++S N
Sbjct: 903  LSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFN 962

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
            QL GE+     SLT L  L+ S N L G IPQ     T   N Y  N+   G
Sbjct: 963  QLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRG 1014



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 34/139 (24%), Positives = 63/139 (45%), Gaps = 7/139 (5%)
 Frame = +1

Query: 316  NRVTEIQISGL---QLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLA 480
            + +T +QI       L G++      + S+  FD+  N L  +LP  + +  ++  LNL 
Sbjct: 716  SNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLH 775

Query: 481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
            GN     +P S+     L+ L++  NQL     +   +L  L  L  + N L G I  + 
Sbjct: 776  GNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSR 835

Query: 661  SSL--TNMKNMYLQNNVFT 711
            + +   +++ + L  N F+
Sbjct: 836  AEIMFPDLRIIDLSRNAFS 854



 Score = 40.0 bits (92), Expect = 0.056
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 21/197 (10%)
 Frame = +1

Query: 313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGN 486
            G  +  + + G +L   +   LD  K +   D+  N L ++ P  L   P ++ L L  N
Sbjct: 766  GCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSN 825

Query: 487  GFTGGLPYSISQMA--PLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQT 657
               G +  S +++    L  +++S N    ++ T +F  L  + T+D +    +      
Sbjct: 826  KLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYD 885

Query: 658  FSSLTNMKNMYLQ--------------NNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
             S +   K + L+              +N F G I  VL +L  +  LNV +N   G+IP
Sbjct: 886  DSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIP 945

Query: 790  PQLQGINSLQTGGNSWN 840
              L  ++ L++   S+N
Sbjct: 946  SSLGSLSILESLDLSFN 962



 Score = 37.7 bits (86), Expect = 0.28
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +1

Query: 541 LNVSHNQLQGEVTVM-FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
           LN+++  + G +    F SL +L  LD S N++ G IP    +LTN+  +YL  N     
Sbjct: 75  LNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNL--VYLDLN----- 127

Query: 718 IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
                          NN  +G IPPQ+  +  LQ
Sbjct: 128 ---------------NNQISGTIPPQIGLLAKLQ 146



>gb:ATAC011620_1543299 Arabidopsis thaliana chromosome III BAC F18C1
           genomic sequence, complete sequence.
          Length = 883

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 61/212 (28%), Positives = 103/212 (48%), Gaps = 11/212 (5%)
 Frame = +1

Query: 241 PQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS-------GLQLTGSMGFQLDQLKSVT 399
           P  TK   NG D C   W G++C       I+I        G   + S    L     +T
Sbjct: 57  PLKTKSWENGSDCC--HWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLT 114

Query: 400 TFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGE 573
           T D+S N+L   +   +    ++  L+L+GN F+G +P S+  +  L  L++  N   GE
Sbjct: 115 TLDLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGE 174

Query: 574 VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLD 747
           +     +L+ L+ LD S N+  G IP +F SL  +  + L NN  +G +  +V+    L 
Sbjct: 175 IPSSLGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLS 234

Query: 748 NLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            +++ +N FTG +PP +  ++ L++   S N+
Sbjct: 235 EISLSHNQFTGTLPPNITSLSILESFSASGNN 266



 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 47/174 (27%), Positives = 84/174 (48%), Gaps = 7/174 (4%)
 Frame = +1

Query: 340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLPY 510
            S    +G +   +  L+S+   D+S NN   ++P    +    +  LNL  N  +G LP 
Sbjct: 487  SNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPK 546

Query: 511  SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            +I  +  L  L+VSHN+L+G++    +  + L  L+   N +    P   SSL  ++ + 
Sbjct: 547  TI--IKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLV 604

Query: 691  LQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPP----QLQGINSLQTGGNSWN 840
            L++N F G I       L  +++  NHF G +P     +  G++SL+   + +N
Sbjct: 605  LRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFN 658



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 50/192 (26%), Positives = 88/192 (45%), Gaps = 9/192 (4%)
 Frame = +1

Query: 274 DPCGESWKG--VSCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP 441
           D  G ++ G   S  GN   +T + +      G +   L  L  +T  D+STNN    +P
Sbjct: 141 DLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIP 200

Query: 442 YQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTL 615
                   +  L L  N  +G LP  +  +  L  +++SHNQ  G +     SL+ L + 
Sbjct: 201 SSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESF 260

Query: 616 DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID---VLANLPLDNLNVENNHFTGWI 786
             S N+  G IP +  ++ ++  ++L NN  +GT++   + +   L  L +  N+  G I
Sbjct: 261 SASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPI 320

Query: 787 PPQLQGINSLQT 822
           P  +  + +L+T
Sbjct: 321 PTSISRLVNLRT 332



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 2/107 (1%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            LK  T  D S N     +P    L   +  LNL+ NGFTG +P S+  +  LE L+VS N
Sbjct: 686  LKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRN 745

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
            +L GE+     +L+ L+ ++FS N L G +P      T   + + +N
Sbjct: 746  KLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQSASSFEEN 792



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 45/151 (29%), Positives = 69/151 (45%), Gaps = 7/151 (4%)
 Frame = +1

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLPY 510
           SG    G++   L  + S+T   +  N L  +L +     P N+  L L GN   G +P 
Sbjct: 263 SGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPIPT 322

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
           SIS++  L  L++SH  +QG+V             DF+           FS L  + N+Y
Sbjct: 323 SISRLVNLRTLDLSHFNIQGQV-------------DFNI----------FSHLKLLGNLY 359

Query: 691 LQNNVFTGTIDVLANLP----LDNLNVENNH 771
           L ++  T TID+ A L     L +L++  NH
Sbjct: 360 LSHSNTTTTIDLNAVLSCFKMLISLDLSGNH 390



 Score = 41.2 bits (95), Expect = 0.025
 Identities = 38/151 (25%), Positives = 65/151 (43%), Gaps = 23/151 (15%)
 Frame = +1

Query: 406  DISTNNLGNSLP----------YQLPPNVQKLN--LAGNGF--------TGGLPYSISQM 525
            DIS N+   +LP          + L  N  + N    G+G+          GL   + ++
Sbjct: 626  DISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYMGSGYYHDSMVLMNKGLEMELVRI 685

Query: 526  APL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              +   L+ S N+ +GE+      L  L  L+ S N   G+IP +  +L  ++++ +  N
Sbjct: 686  LKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRN 745

Query: 703  VFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
              +G I   L NL  L  +N  +N   G +P
Sbjct: 746  KLSGEIPQELGNLSYLAYMNFSHNQLVGQVP 776



>pir|T10504|T10504 disease resistance protein Cf-2.1 - currant
           tomato>gb:A57130_1449791 Sequence 1 from Patent
           WO9531564.>gb:U42444_1726334 Lycopersicon
           pimpinellifolium leucine rich repeat protein Cf-2.1
           gene, complete cds.
          Length = 1112

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 62/218 (28%), Positives = 103/218 (47%), Gaps = 19/218 (8%)
 Frame = +1

Query: 220 FSSLNSPPQLTKWTAN--------------GGDPCGESWKGVSCSGNRVTEIQISGLQLT 357
           F+S      L KW A                 + C + W GV C   RV  + I+   + 
Sbjct: 25  FASTEEATALLKWKATFKNQNNSFLASWIPSSNAC-KDWYGVVCFNGRVNTLNITNASVI 83

Query: 358 GSM-GFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMA 528
           G++  F    L S+   D+S NN+  ++P ++    N+  L+L  N  +G +P  I  +A
Sbjct: 84  GTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLA 143

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+ + + HNQL G +      L +L+ L    N L+G+IP +  +L N+  +YL NN  
Sbjct: 144 KLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQL 203

Query: 709 TGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +G+I  ++     L  L++ +N   G IP  L  +N+L
Sbjct: 204 SGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNL 241



 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/171 (31%), Positives = 92/171 (53%), Gaps = 4/171 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           N ++ + + G QL+GS+  ++  L+S+    +S N L  S+P  L    N+ +LNL  N 
Sbjct: 287 NNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQ 346

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P S+  +  L  L + +NQL G +     +L NLS L    N L+G+IP +  +L
Sbjct: 347 LSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNL 406

Query: 670 TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            N+  +YL NN  +G+I  ++     L  L++ NN   G+IP     +++L
Sbjct: 407 NNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNL 457



 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 57/171 (33%), Positives = 86/171 (50%), Gaps = 7/171 (4%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           QL  S+  ++  L+S+   D+S N L  S+P       N+ +LNL  N  +G +P  I  
Sbjct: 466 QLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGY 525

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L  L++S N L G +   F +L NLS L+   N L+G+IP+    L ++ ++ L  N
Sbjct: 526 LRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSEN 585

Query: 703 VFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNSWN 840
              G+I   L NL  L  L + NN  +G IP +   L  +  L  G NS N
Sbjct: 586 ALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLN 636



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 61/195 (31%), Positives = 93/195 (47%), Gaps = 28/195 (14%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N ++ + +   QL+GS+  ++  L+S+T  D+S N L  S+P  L    N+  L L GN 
Sbjct: 191 NNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQ 250

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS-------------------- 609
            +G +P  I  +  L YL++S N L G +     +L NLS                    
Sbjct: 251 LSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYL 310

Query: 610 ----TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNH 771
                L  S N+L G+IP +  +L N+  + L NN  +G+I   L NL  L  L + NN 
Sbjct: 311 RSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQ 370

Query: 772 FTGWIPPQLQGINSL 816
            +G IP  L  +N+L
Sbjct: 371 LSGSIPASLGNLNNL 385



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 52/172 (30%), Positives = 86/172 (50%), Gaps = 4/172 (2%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
            N ++ + +   QL+GS+  ++  L+S+   D+S N L  S+P       N+ +LNL  N 
Sbjct: 503  NNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQ 562

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             +G +P  I  +  L  L +S N L G +     +L NLS L    N L+G+IP+    L
Sbjct: 563  LSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYL 622

Query: 670  TNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +++  + L NN   G I     N+  L  L + +N+  G IP  +  + SL+
Sbjct: 623  SSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNNLIGEIPSSVCNLTSLE 674



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 50/171 (29%), Positives = 88/171 (51%), Gaps = 4/171 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           N ++ + +   QL+GS+   L  L +++   +  N L  S+P ++    ++  L+L+ N 
Sbjct: 383 NNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNS 442

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G +P S   M+ L +L +  NQL   V      L +L+ LD S N+L G+IP +F +L
Sbjct: 443 INGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNL 502

Query: 670 TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            N+  + L NN  +G+I  ++     L+ L++  N   G IP     +N+L
Sbjct: 503 NNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNL 553



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 56/206 (27%), Positives = 91/206 (44%), Gaps = 31/206 (15%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
            N ++ + +   QL+GS+  ++  L S+T   +  N+L   +P       N+Q L L  N 
Sbjct: 599  NNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDNN 658

Query: 490  FTGGLPYSISQMAPLEYL------------------------NVSHNQLQGEVTVMFVSL 597
              G +P S+  +  LE L                        ++S N   GE+     +L
Sbjct: 659  LIGEIPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFSGELPSSISNL 718

Query: 598  TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNH 771
            T+L  LDF  N+L G IPQ F ++++++   +QNN  +GT+    ++   L +LN+  N 
Sbjct: 719  TSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNE 778

Query: 772  FTGWIPPQLQGINSLQT---GGNSWN 840
                IP  L     LQ    G N  N
Sbjct: 779  LEDEIPRSLDNCKKLQVLDLGDNQLN 804



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 52/193 (26%), Positives = 91/193 (47%), Gaps = 28/193 (14%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   +  L +++   +  N L  S+P ++    ++ +L+L+ N   
Sbjct: 169 LTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALN 228

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  M  L +L +  NQL G +      L +L+ LD S N+L G+IP +  +L N
Sbjct: 229 GSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNN 288

Query: 676 MKNMYLQNNVFTGTID-------------------------VLANLP-LDNLNVENNHFT 777
           +  ++L  N  +G+I                           L NL  L  LN+ NN  +
Sbjct: 289 LSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLS 348

Query: 778 GWIPPQLQGINSL 816
           G IP  L  +N+L
Sbjct: 349 GSIPASLGNLNNL 361



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 34/84 (40%), Positives = 50/84 (59%)
 Frame = +1

Query: 469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
            ++L+ N F G +P  +  +  +  LNVSHN LQG +     SL+ L +LD SFN L+G I
Sbjct: 909  IDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEI 968

Query: 649  PQTFSSLTNMKNMYLQNNVFTGTI 720
            PQ  +SLT ++ + L +N   G I
Sbjct: 969  PQQLASLTFLEFLNLSHNYLQGCI 992



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 39/112 (34%), Positives = 55/112 (49%), Gaps = 2/112 (1%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            L   T  D+S+N     +P  L     ++ LN++ N   G +P S+  ++ LE L++S N
Sbjct: 903  LSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIPSSLGSLSILESLDLSFN 962

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
            QL GE+     SLT L  L+ S N L G IPQ     T   N Y  N+   G
Sbjct: 963  QLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRG 1014



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 34/139 (24%), Positives = 63/139 (45%), Gaps = 7/139 (5%)
 Frame = +1

Query: 316  NRVTEIQISGL---QLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLA 480
            + +T +QI       L G++      + S+  FD+  N L  +LP  + +  ++  LNL 
Sbjct: 716  SNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLH 775

Query: 481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
            GN     +P S+     L+ L++  NQL     +   +L  L  L  + N L G I  + 
Sbjct: 776  GNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSR 835

Query: 661  SSL--TNMKNMYLQNNVFT 711
            + +   +++ + L  N F+
Sbjct: 836  AEIMFPDLRIIDLSRNAFS 854



 Score = 40.0 bits (92), Expect = 0.056
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 21/197 (10%)
 Frame = +1

Query: 313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGN 486
            G  +  + + G +L   +   LD  K +   D+  N L ++ P  L   P ++ L L  N
Sbjct: 766  GCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSN 825

Query: 487  GFTGGLPYSISQMA--PLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQT 657
               G +  S +++    L  +++S N    ++ T +F  L  + T+D +    +      
Sbjct: 826  KLHGPIRSSRAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYD 885

Query: 658  FSSLTNMKNMYLQ--------------NNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
             S +   K + L+              +N F G I  VL +L  +  LNV +N   G+IP
Sbjct: 886  DSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRILNVSHNALQGYIP 945

Query: 790  PQLQGINSLQTGGNSWN 840
              L  ++ L++   S+N
Sbjct: 946  SSLGSLSILESLDLSFN 962



 Score = 37.7 bits (86), Expect = 0.28
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +1

Query: 541 LNVSHNQLQGEVTVM-FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
           LN+++  + G +    F SL +L  LD S N++ G IP    +LTN+  +YL  N     
Sbjct: 75  LNITNASVIGTLYAFPFSSLPSLENLDLSKNNIYGTIPPEIGNLTNL--VYLDLN----- 127

Query: 718 IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
                          NN  +G IPPQ+  +  LQ
Sbjct: 128 ---------------NNQISGTIPPQIGLLAKLQ 146



>sp|Q00874|D100_ARATH DNA-damage-repair/toleration protein DRT100
           precursor.>gb:AC069474_1540912 Arabidopsis thaliana
           chromosome 3 BAC T2E22 genomic sequence, complete
           sequence.>gb:AY057652_1564065 Arabidopsis thaliana
           AT3g12610/T2E22_107 mRNA, complete
           cds.>gb:AY086931_1571969 Arabidopsis thaliana clone
           29675 mRNA, complete sequence.>gb:BT000814_1635069
           Arabidopsis thaliana DNA-damage repair/toleration
           protein (At3g12610/T2E22_107) mRNA, complete
           cds.>gb:AP002044_1821614 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone: MMF12.
          Length = 372

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 72/252 (28%), Positives = 115/252 (45%), Gaps = 22/252 (8%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGG 273
           MR+L+  P++  L + F+  +  S V    P D + L    SSL+ P       W+ N  
Sbjct: 1   MRKLLASPFSSLLAVVFI--SVISVVRCCSPKDQTALNAFKSSLSEPNLGIFNTWSEN-- 56

Query: 274 DPCGESWKGVSCS--GNRVTEIQISG------LQLTGSMGFQLDQLKSVTTFDISTNNL- 426
             C + W G+SC     RVT+I + G       Q  G  G+    +        +  +L 
Sbjct: 57  TDCCKEWYGISCDPDSGRVTDISLRGESEDAIFQKAGRSGYMSGSIDPAVCDLTALTSLV 116

Query: 427 ---GNSLPYQLPP------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
                 +  ++PP      +++ L+LAGN  TG +P  I +++ L  LN++ NQ+ GE+ 
Sbjct: 117 LADWKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIP 176

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNL 753
               SL  L  L+ + N + G IP  F SL  +  + L  N  TG+I   +     L +L
Sbjct: 177 ASLTSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADL 236

Query: 754 NVENNHFTGWIP 789
           ++  NH  G IP
Sbjct: 237 DLSKNHIEGPIP 248



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 43/137 (31%), Positives = 72/137 (52%), Gaps = 2/137 (1%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGLPYSISQ 522
           +LTGS+   +  ++ +   D+S N++   +P  +     +  LNL  N  TG +P S+  
Sbjct: 218 ELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLS 277

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
            + L+  N+S N L+G +  +F S T L +LD S NSL+G IP + SS   + ++ + +N
Sbjct: 278 NSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSSAKFVGHLDISHN 337

Query: 703 VFTGTIDVLANLPLDNL 753
              G I      P D+L
Sbjct: 338 KLCGRIP--TGFPFDHL 352



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 49/204 (24%), Positives = 89/204 (43%), Gaps = 35/204 (17%)
 Frame = +1

Query: 292 WKGVS-------CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL 450
           WKG++        S   +  + ++G ++TG +  ++ +L  +   +++ N +   +P  L
Sbjct: 120 WKGITGEIPPCITSLASLRILDLAGNKITGEIPAEIGKLSKLAVLNLAENQMSGEIPASL 179

Query: 451 PPNVQ--------------------------KLNLAGNGFTGGLPYSISQMAPLEYLNVS 552
              ++                          ++ L  N  TG +P SIS M  L  L++S
Sbjct: 180 TSLIELKHLELTENGITGVIPADFGSLKMLSRVLLGRNELTGSIPESISGMERLADLDLS 239

Query: 553 HNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVL 729
            N ++G +     ++  LS L+   NSL G IP +  S + +    L  N   GTI DV 
Sbjct: 240 KNHIEGPIPEWMGNMKVLSLLNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVF 299

Query: 730 ANLP-LDNLNVENNHFTGWIPPQL 798
            +   L +L++ +N  +G IP  L
Sbjct: 300 GSKTYLVSLDLSHNSLSGRIPDSL 323



>gb:AC137619_1743655 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0095J22, complete sequence.
          Length = 952

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 67/220 (30%), Positives = 110/220 (50%), Gaps = 8/220 (3%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCSGN-----RVTEIQISG 345
           TDP++ S L  +  SL  P   L  W  N GDPC ++W GV C         VTE+Q+  
Sbjct: 28  TDPSEVSALMAIKGSLVDPMNNLKNW--NRGDPCTKNWTGVFCHDLGDTYLHVTELQLFR 85

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM 525
             L+G++  ++  L  +   D   NNL                      TG +P  I  +
Sbjct: 86  RNLSGNLVPEVSLLSQLKILDFMWNNL----------------------TGNIPKEIGNI 123

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+ + ++ NQL G +     +L +L+ L    N L+G IP++F++L ++K++++ NN 
Sbjct: 124 TTLKLILLNGNQLSGLLPDEIGNLQSLTRLQVDQNHLSGAIPKSFANLRSVKHLHMNNNS 183

Query: 706 FTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +G I   L+ L  L +L V+NN+ +G +PP+L    SL+
Sbjct: 184 LSGQIPSELSRLNTLLHLLVDNNNLSGPLPPELAAAKSLK 223



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 3/138 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLP--YQLPPNVQKLNLAGN 486
           N +  + +    L+G +  +L   KS+       NN  G+S+P  Y     + KL+L   
Sbjct: 196 NTLLHLLVDNNNLSGPLPPELAAAKSLKILQADNNNFSGSSIPTLYYNMSGLFKLSLRNC 255

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
              G +P  +S +  L+YL++S NQL G +    ++ +N++T+D S N L G IP  FS 
Sbjct: 256 SLQGAIP-DLSAIPQLDYLDLSWNQLTGSIPTNKLA-SNITTIDLSHNMLNGTIPSNFSG 313

Query: 667 LTNMKNMYLQNNVFTGTI 720
           L  ++ + L+NN+  G++
Sbjct: 314 LPYLQLLSLKNNLLDGSV 331



>gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.
          Length = 626

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 58/183 (31%), Positives = 96/183 (52%), Gaps = 3/183 (1%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV 303
           WAV L +  LL  P   VA+T+      LR      N+   L  W     +PC  +W  V
Sbjct: 11  WAVVLAVAVLLG-PGQVVANTEGDALYSLRQSLKDANNV--LQSWDPTLVNPC--TWFHV 65

Query: 304 SCSG-NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLN 474
           +C+  N V  + +   QL+G +  QL QLK++   ++ +NN+  ++P +L    N+  L+
Sbjct: 66  TCNNDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNNISGTIPPELGNLTNLVSLD 125

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           L  N F+G +P S+  +  L +L +++N L G + V   +++ L  LD S N+L+G +P 
Sbjct: 126 LYMNNFSGNIPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVPS 185

Query: 655 TFS 663
           T S
Sbjct: 186 TGS 188



>gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K23L20.
          Length = 1236

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 61/214 (28%), Positives = 99/214 (46%), Gaps = 29/214 (13%)
 Frame = +1

Query: 265 NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP- 441
           N G P   +W GV+C G  +  + +SGL LTGS+   + +  ++   D+S+N L   +P 
Sbjct: 54  NSGSPSYCNWTGVTCGGREIIGLNLSGLGLTGSISPSIGRFNNLIHIDLSSNRLVGPIPT 113

Query: 442 --YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTL 615
               L  +++ L+L  N  +G +P  +  +  L+ L +  N+L G +   F +L NL  L
Sbjct: 114 TLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKSLKLGDNELNGTIPETFGNLVNLQML 173

Query: 616 DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID------------------VLANLP 741
             +   L G IP  F  L  ++ + LQ+N   G I                   +  +LP
Sbjct: 174 ALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLP 233

Query: 742 --------LDNLNVENNHFTGWIPPQLQGINSLQ 819
                   L  LN+ +N F+G IP QL  + S+Q
Sbjct: 234 AELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQ 267



 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 54/175 (30%), Positives = 86/175 (49%), Gaps = 8/175 (4%)
 Frame = +1

Query: 319 RVTEIQISGLQ---LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAG 483
           R+ ++Q   LQ   L G +  ++    S+  F  + N L  SLP +L    N+Q LNL  
Sbjct: 190 RLVQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGD 249

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N F+G +P  +  +  ++YLN+  NQLQG +      L NL TLD S N+L G I + F 
Sbjct: 250 NSFSGEIPSQLGDLVSIQYLNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFW 309

Query: 664 SLTNMKNMYLQNNVFTGTIDVLA---NLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +  ++ + L  N  +G++       N  L  L +     +G IP ++    SL+
Sbjct: 310 RMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLK 364



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 52/168 (30%), Positives = 87/168 (51%), Gaps = 5/168 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + + G QL G +  +L +L ++ T D+S+NNL   +  +      ++ L LA N  +G L
Sbjct: 269 LNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSL 328

Query: 505 PYSI-SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P +I S    L+ L +S  QL GE+     +  +L  LD S N+L G IP +   L  + 
Sbjct: 329 PKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELT 388

Query: 682 NMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           N+YL NN   GT+   ++NL  L    + +N+  G +P ++  +  L+
Sbjct: 389 NLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLE 436



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 51/169 (30%), Positives = 82/169 (48%), Gaps = 6/169 (3%)
 Frame = +1

Query: 352  LTGSMGFQLDQLKSVTTFDISTNNLGNSL-PYQLPPNVQKLNLAGNGFTGGLPYSISQMA 528
            L G++   L  LK++T  + S+N    S+ P     +    ++  NGF G +P  + +  
Sbjct: 541  LQGNLPDSLINLKNLTRINFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKST 600

Query: 529  PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
             L+ L +  NQ  G +   F  ++ LS LD S NSL+G IP        + ++ L NN  
Sbjct: 601  NLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYL 660

Query: 709  TGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQT---GGNSWN 840
            +G I   L  LP L  L + +N F G +P ++  + ++ T    GNS N
Sbjct: 661  SGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLN 709



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 6/162 (3%)
 Frame = +1

Query: 328  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---LAGNGFTG 498
            E+++S  +  GS+  ++  L ++ T  +  N+L  S+P ++  N+Q LN   L  N  +G
Sbjct: 676  ELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIG-NLQALNALNLEENQLSG 734

Query: 499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL-STLDFSFNSLAGNIPQTFSSLTN 675
             LP +I +++ L  L +S N L GE+ V    L +L S LD S+N+  G IP T S+L  
Sbjct: 735  PLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPK 794

Query: 676  MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQ 795
            ++++ L +N   G +   +     L  LN+  N+  G +  Q
Sbjct: 795  LESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKLKKQ 836



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 48/164 (29%), Positives = 80/164 (48%), Gaps = 6/164 (3%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
            Q TG +     ++  ++  DIS N+L   +P +L     +  ++L  N  +G +P  + +
Sbjct: 611  QFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGK 670

Query: 523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
            +  L  L +S N+  G +     SLTN+ TL    NSL G+IPQ   +L  +  + L+ N
Sbjct: 671  LPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEEN 730

Query: 703  VFTG----TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
              +G    TI  L+   L  L +  N  TG IP ++  +  LQ+
Sbjct: 731  QLSGPLPSTIGKLSK--LFELRLSRNALTGEIPVEIGQLQDLQS 772



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/167 (26%), Positives = 80/167 (47%), Gaps = 4/167 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S   LTG +   L QL  +T   ++ N+L  +L   +    N+Q+  L  N   G +
Sbjct: 366 LDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKV 425

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  I  +  LE + +  N+  GE+ V   + T L  +D+  N L+G IP +   L ++  
Sbjct: 426 PKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTR 485

Query: 685 MYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           ++L+ N   G I   L N   +  +++ +N  +G IP     + +L+
Sbjct: 486 LHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALE 532



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 38/108 (35%), Positives = 59/108 (54%), Gaps = 3/108 (2%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLPYSIS 519
            QL+G +   + +L  +    +S N L   +P    QL      L+L+ N FTG +P +IS
Sbjct: 731  QLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTIS 790

Query: 520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
             +  LE L++SHNQL GEV      + +L  L+ S+N+L G + + FS
Sbjct: 791  TLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKLKKQFS 838



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 39/140 (27%), Positives = 71/140 (50%), Gaps = 4/140 (2%)
 Frame = +1

Query: 409 ISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
           +S   L   +P ++    +++ L+L+ N  TG +P S+ Q+  L  L +++N L+G ++ 
Sbjct: 344 LSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSS 403

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLN 756
              +LTNL       N+L G +P+    L  ++ MYL  N F+G + V + N   L  ++
Sbjct: 404 SISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQEID 463

Query: 757 VENNHFTGWIPPQLQGINSL 816
              N  +G IP  +  +  L
Sbjct: 464 WYGNRLSGEIPSSIGRLKDL 483



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 43/169 (25%), Positives = 77/169 (45%), Gaps = 6/169 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           + +G M  ++     +   D   N L   +P  +    ++ +L+L  N   G +P S+  
Sbjct: 444 RFSGEMPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGN 503

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              +  ++++ NQL G +   F  LT L       NSL GN+P +  +L N+  +   +N
Sbjct: 504 CHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSN 563

Query: 703 VFTGTIDVL-ANLPLDNLNVENNHFTGWIPPQL---QGINSLQTGGNSW 837
            F G+I  L  +    + +V  N F G IP +L     ++ L+ G N +
Sbjct: 564 KFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQF 612



>pir|T05322|T05322 hypothetical protein F18F4.240 - Arabidopsis
           thaliana>gb:ATCHRIV52_1545852 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 52.>gb:ATF1C12_1549334
           Arabidopsis thaliana DNA chromosome 4, BAC clone F1C12
           (ESSA project).
          Length = 1232

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 58/180 (32%), Positives = 93/180 (51%), Gaps = 5/180 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           RV  + +    L G +  +L     +T F  + N L  ++P +L    N++ LNLA N  
Sbjct: 192 RVQSLILQDNYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSL 251

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  + +M+ L+YL++  NQLQG +      L NL TLD S N+L G IP+ F +++
Sbjct: 252 TGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMS 311

Query: 673 NMKNMYLQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            + ++ L NN  +G++       N  L+ L +     +G IP +L    SL+    S NS
Sbjct: 312 QLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNS 371



 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 58/162 (35%), Positives = 85/162 (52%), Gaps = 5/162 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL--AGNGFTGGLPYSI-S 519
           QL G +   L  L ++ T D+S NNL   +P +     Q L+L  A N  +G LP SI S
Sbjct: 274 QLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICS 333

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
               LE L +S  QL GE+ V      +L  LD S NSLAG+IP+    L  + ++YL N
Sbjct: 334 NNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHN 393

Query: 700 NVFTGTID-VLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           N   GT+   ++NL  L  L + +N+  G +P ++  +  L+
Sbjct: 394 NTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLE 435



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 59/222 (26%), Positives = 102/222 (45%), Gaps = 5/222 (2%)
 Frame = +1

Query: 166 PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN---RVTEIQ 336
           P  + +   T   V + L ++      L +W ++  + C  SW GV+C      RV  + 
Sbjct: 20  PGIINNDLQTLLEVKKSLVTNPQEDDPLRQWNSDNINYC--SWTGVTCDNTGLFRVIALN 77

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSI 516
           ++GL LTGS+     +  ++   D+S+NNL                       G +P ++
Sbjct: 78  LTGLGLTGSISPWFGRFDNLIHLDLSSNNL----------------------VGPIPTAL 115

Query: 517 SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ 696
           S +  LE L +  NQL GE+     SL N+ +L    N L G+IP+T  +L N++ + L 
Sbjct: 116 SNLTSLESLFLFSNQLTGEIPSQLGSLVNIRSLRIGDNELVGDIPETLGNLVNLQMLALA 175

Query: 697 NNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL 816
           +   TG I       + + +L +++N+  G IP +L   + L
Sbjct: 176 SCRLTGPIPSQLGRLVRVQSLILQDNYLEGPIPAELGNCSDL 217



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 53/175 (30%), Positives = 87/175 (49%), Gaps = 5/175 (2%)
 Frame = +1

Query: 307 CSGN-RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--KLNL 477
           CS N  + ++ +SG QL+G +  +L + +S+   D+S N+L  S+P  L   V+   L L
Sbjct: 332 CSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYL 391

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N   G L  SIS +  L++L + HN L+G++     +L  L  L    N  +G IPQ 
Sbjct: 392 HNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQE 451

Query: 658 FSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
             + T++K + +  N F G I   +     L+ L++  N   G +P  L   + L
Sbjct: 452 IGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQL 506



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 49/165 (29%), Positives = 85/165 (51%), Gaps = 5/165 (3%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
            +++ E+++S  Q   S+  +L     +    +  N+L  S+P ++     +  LNL  N 
Sbjct: 671  SQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQ 730

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL-STLDFSFNSLAGNIPQTFSS 666
            F+G LP ++ +++ L  L +S N L GE+ V    L +L S LD S+N+  G+IP T  +
Sbjct: 731  FSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGT 790

Query: 667  LTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQ 795
            L+ ++ + L +N  TG +   V     L  LNV  N+  G +  Q
Sbjct: 791  LSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKLKKQ 835



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 46/175 (26%), Positives = 87/175 (49%), Gaps = 4/175 (2%)
 Frame = +1

Query: 310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAG 483
            +   +  +++   QLTG + + L +++ ++  D+S+N L  ++P QL     +  ++L  
Sbjct: 597  NSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNN 656

Query: 484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
            N  +G +P  + +++ L  L +S NQ    +     + T L  L    NSL G+IPQ   
Sbjct: 657  NFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIG 716

Query: 664  SLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQT 822
            +L  +  + L  N F+G++   +  L  L  L +  N  TG IP ++  +  LQ+
Sbjct: 717  NLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQS 771



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 48/145 (33%), Positives = 71/145 (48%), Gaps = 10/145 (6%)
 Frame = +1

Query: 427 GNSLPYQLPPNVQKL------NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
           GN    ++PP++ +L      +L  N   GGLP S+     L  L+++ NQL G +   F
Sbjct: 465 GNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSF 524

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVL-ANLPLDNLNVEN 765
             L  L  L    NSL GN+P +  SL N+  + L +N   GTI  L  +    + +V N
Sbjct: 525 GFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCGSSSYLSFDVTN 584

Query: 766 NHFTGWIPPQL---QGINSLQTGGN 831
           N F   IP +L   Q ++ L+ G N
Sbjct: 585 NGFEDEIPLELGNSQNLDRLRLGKN 609



 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 40/151 (26%), Positives = 76/151 (50%), Gaps = 4/151 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G +  ++  L+ +    +  N     +P ++    +++ +++ GN F G +P SI ++
Sbjct: 420 LEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRL 479

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L  L++  N+L G +     +   L+ LD + N L+G+IP +F  L  ++ + L NN 
Sbjct: 480 KELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNS 539

Query: 706 FTGTI-DVLANL-PLDNLNVENNHFTGWIPP 792
             G + D L +L  L  +N+ +N   G I P
Sbjct: 540 LQGNLPDSLISLRNLTRINLSHNRLNGTIHP 570



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 38/108 (35%), Positives = 60/108 (55%), Gaps = 3/108 (2%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLPYSIS 519
            Q +GS+   + +L  +    +S N+L   +P    QL      L+L+ N FTG +P +I 
Sbjct: 730  QFSGSLPQAMGKLSKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIG 789

Query: 520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
             ++ LE L++SHNQL GEV      + +L  L+ SFN+L G + + FS
Sbjct: 790  TLSKLETLDLSHNQLTGEVPGSVGDMKSLGYLNVSFNNLGGKLKKQFS 837



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 47/177 (26%), Positives = 78/177 (44%), Gaps = 6/177 (3%)
 Frame = +1

Query: 328  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL-PYQLPPNVQKLNLAGNGFTGGL 504
            ++ +    L G++   L  L+++T  ++S N L  ++ P     +    ++  NGF   +
Sbjct: 532  QLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIHPLCGSSSYLSFDVTNNGFEDEI 591

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
            P  +     L+ L +  NQL G++      +  LS LD S N+L G IP        + +
Sbjct: 592  PLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTH 651

Query: 685  MYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINS---LQTGGNSWN 840
            + L NN  +G I   L  L  L  L + +N F   +P +L        L   GNS N
Sbjct: 652  IDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLN 708



>gb:AP003630_1831761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0566A10.>gb:AP003724_1832438 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0498C03.
          Length = 1139

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 77/249 (30%), Positives = 116/249 (46%), Gaps = 32/249 (12%)
 Frame = +1

Query: 169 SAVADTDPTDASVLRGLFSSL-NSPPQLTKWTANGGDPCGESWKGVSCSG---NRVTEIQ 336
           +A+ D    D   L  L S L N+   L  W  +    C  +W G++C     +RVT + 
Sbjct: 32  TALDDESNKDLQALLCLKSRLSNNARSLASWNESL-QFC--TWPGITCGKRHESRVTALH 88

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPY 510
           +  L L G +   +  L  +T   +S N L   +P ++     +  +NL+ N  TG +P 
Sbjct: 89  LESLDLNGHLPPCIGNLTFLTRIHLSNNRLNGEIPIEVGHLRRLVYINLSSNNLTGVIPN 148

Query: 511 SISQMAPLEYLNVSHNQLQGEVTV------------------------MFVSLTNLSTLD 618
           S+S  + LE LN+ +N LQGE+ +                         F +L  LS L 
Sbjct: 149 SLSSCSSLEILNLGNNFLQGEIPLGLSNCSNLKRIVLHENMLHGGIPDGFTALDKLSVLF 208

Query: 619 FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPP 792
              N+L+GNIP +  S++++  + L NN  TG I  VLAN   L  L++  NH  G IPP
Sbjct: 209 AHSNNLSGNIPHSLGSVSSLTYVVLANNSLTGGIPPVLANCSSLQWLDLRKNHIGGEIPP 268

Query: 793 QLQGINSLQ 819
            L   +SLQ
Sbjct: 269 ALFNSSSLQ 277



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 50/144 (34%), Positives = 71/144 (49%), Gaps = 5/144 (3%)
 Frame = +1

Query: 409 ISTNNLGNSLPYQ---LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           +  NNL  SLP     LP +++ L L  N  +G +P  I Q+  L  L + HN L G + 
Sbjct: 474 LDANNLQGSLPSSTGDLPQSMKILVLTSNFISGTIPQEIEQLRNLVLLQIDHNLLTGNLP 533

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNL 753
               +L+NL  L  + NS  G IP +   L  +  +YLQ+N F+G I         LD L
Sbjct: 534 DSLGNLSNLLILSLAQNSFYGKIPLSIGKLNQLTELYLQDNSFSGLIPKALGQCQKLDIL 593

Query: 754 NVENNHFTGWIPPQLQGINSLQTG 825
           N+  N   G IP +L  I++L  G
Sbjct: 594 NLSCNSLEGTIPKELFTISTLSEG 617



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 46/178 (25%), Positives = 84/178 (47%), Gaps = 26/178 (14%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTT-FDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
            + +S   L G++  +L  + +++   D+S N L   +P ++    N+  LN++ N  +G 
Sbjct: 593  LNLSCNSLEGTIPKELFTISTLSEGLDLSHNRLSGPIPVEVGSLINLGPLNISNNKLSGE 652

Query: 502  LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM- 678
            +P ++     LEYLN+  N L G++   F +L  +  +D S N+L+G IP+ F +L++M 
Sbjct: 653  IPSALGDCVRLEYLNMEGNVLNGQIPKSFSALRGIIQMDLSRNNLSGQIPEFFETLSSMV 712

Query: 679  ----------------------KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWI 786
                                    ++LQ N     I  L  LPL  ++   N+ T +I
Sbjct: 713  LLNLSFNNLEGPIPSNGIFQNASKVFLQGNKELCAISPLLKLPLCQISASKNNHTSYI 770



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/154 (31%), Positives = 76/154 (49%), Gaps = 5/154 (3%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           ++G++  +++QL+++    I  N L  +LP  L    N+  L+LA N F G +P SI ++
Sbjct: 504 ISGTIPQEIEQLRNLVLLQIDHNLLTGNLPDSLGNLSNLLILSLAQNSFYGKIPLSIGKL 563

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP-QTFSSLTNMKNMYLQNN 702
             L  L +  N   G +         L  L+ S NSL G IP + F+  T  + + L +N
Sbjct: 564 NQLTELYLQDNSFSGLIPKALGQCQKLDILNLSCNSLEGTIPKELFTISTLSEGLDLSHN 623

Query: 703 VFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQL 798
             +G I V     + L  LN+ NN  +G IP  L
Sbjct: 624 RLSGPIPVEVGSLINLGPLNISNNKLSGEIPSAL 657



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 39/140 (27%), Positives = 69/140 (49%), Gaps = 3/140 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S   L+GS+   L    S+ +  ++ N L  S+P  L   P +++L   GN  TG +
Sbjct: 302 LYLSYNNLSGSIPSSLGNSTSLYSLLLAWNELQGSIPSSLSRIPYLEELEFTGNNLTGTV 361

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMF-VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P  +  M+ L +L ++ N L GE+      +L ++       N   G IP++ +  TN++
Sbjct: 362 PLPLYNMSTLTFLGMAENNLIGELPQNIGYTLKSIEMFILQGNKFHGQIPKSLAKATNLQ 421

Query: 682 NMYLQNNVFTGTIDVLANLP 741
            + L+ N F G I    +LP
Sbjct: 422 LINLRENAFKGIIPYFGSLP 441



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 45/199 (22%), Positives = 87/199 (43%), Gaps = 29/199 (14%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAG 483
           S + +T + ++   LTG +   L    S+   D+  N++G  +P  L    ++Q +NLA 
Sbjct: 224 SVSSLTYVVLANNSLTGGIPPVLANCSSLQWLDLRKNHIGGEIPPALFNSSSLQAINLAE 283

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHN------------------------QLQGEVTVMFV 591
           N F G +P  +S ++ +++L +S+N                        +LQG +     
Sbjct: 284 NNFFGSIP-PLSDLSSIQFLYLSYNNLSGSIPSSLGNSTSLYSLLLAWNELQGSIPSSLS 342

Query: 592 SLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN---VE 762
            +  L  L+F+ N+L G +P    +++ +  + +  N   G +       L ++    ++
Sbjct: 343 RIPYLEELEFTGNNLTGTVPLPLYNMSTLTFLGMAENNLIGELPQNIGYTLKSIEMFILQ 402

Query: 763 NNHFTGWIPPQLQGINSLQ 819
            N F G IP  L    +LQ
Sbjct: 403 GNKFHGQIPKSLAKATNLQ 421



>gb:AP003489_1829914 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0568D10.
          Length = 1026

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 76/249 (30%), Positives = 127/249 (51%), Gaps = 16/249 (6%)
 Frame = +1

Query: 100 MRELMGLPWAVALL--IGFLLNAPP-----SAVADTDPTDASVLRGLFSSLNSPPQLTKW 258
           M  L+ +P  +  L  I   ++APP     +AVAD    D S L    S++++       
Sbjct: 1   MANLLLIPIIICYLVPIAVAVDAPPPVMAAAAVAD----DWSALLAFLSNVSADSGGVAL 56

Query: 259 TANGGDPCGESWKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG 429
              G  P   +W GV C G    RVT++ ++G  L G +   L +L+ VT  D+S N   
Sbjct: 57  ADWGRSPEFCNWTGVVCGGGERRRVTQLVLAGRGLRGVVSPALGRLEFVTVLDLSNNGFS 116

Query: 430 NSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV-TVMFVSLT 600
             +P +L     + +L+L GN   G +P  I  +  L +L++S N+L G +   +F + T
Sbjct: 117 GEIPAELASLSRLTQLSLTGNRLEGAIPAGIGLLRRLYFLDLSGNRLSGGIPATLFCNCT 176

Query: 601 NLSTLDFSFNSLAGNIPQTFSS-LTNMKNMYLQNNVFTGTID-VLANLPL-DNLNVENNH 771
            L  +D + NSLAG+IP +    L +++ + L +N  +G I   L+N  L + ++ E+N+
Sbjct: 177 ALQYVDLANNSLAGDIPYSGECRLPSLRYLLLWSNDLSGLIPPALSNSSLLEWVDFESNY 236

Query: 772 FTGWIPPQL 798
             G +PPQ+
Sbjct: 237 LAGELPPQV 245



 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 50/172 (29%), Positives = 91/172 (52%), Gaps = 5/172 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQL-KSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           R+ E++++G  L G +   + +L +      +  N +  ++P  +    N+  LNL+ N 
Sbjct: 283 RLQELELAGNDLGGELPAFVGELSREFRQIHLEDNAITGAIPPSIAGLVNLTYLNLSNNM 342

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G +P  +S++  LE L +S+N L GE+      + +L  +D S N LAG IP TFS+L
Sbjct: 343 LNGSIPPEMSRLRRLERLYLSNNLLAGEIPRSIGEMPHLGLVDLSGNRLAGTIPDTFSNL 402

Query: 670 TNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           T ++ + L +N  +G +       L L+ L++  N   G IPP++  ++ L+
Sbjct: 403 TQLRRLMLHHNHLSGDVPASLGDCLNLEILDLSYNGLQGRIPPRVAAMSGLK 454



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 57/203 (28%), Positives = 97/203 (47%), Gaps = 6/203 (2%)
 Frame = +1

Query: 208 LRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQL 387
           L   F SL +  +L +    G D  GE    V        +I +    +TG++   +  L
Sbjct: 271 LAPFFRSLTNCTRLQELELAGNDLGGELPAFVGELSREFRQIHLEDNAITGAIPPSIAGL 330

Query: 388 KSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ 561
            ++T  ++S N L  S+P ++     +++L L+ N   G +P SI +M  L  +++S N+
Sbjct: 331 VNLTYLNLSNNMLNGSIPPEMSRLRRLERLYLSNNLLAGEIPRSIGEMPHLGLVDLSGNR 390

Query: 562 LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID----VL 729
           L G +   F +LT L  L    N L+G++P +     N++ + L  N   G I      +
Sbjct: 391 LAGTIPDTFSNLTQLRRLMLHHNHLSGDVPASLGDCLNLEILDLSYNGLQGRIPPRVAAM 450

Query: 730 ANLPLDNLNVENNHFTGWIPPQL 798
           + L L  LN+ NNH  G +P +L
Sbjct: 451 SGLKL-YLNLSNNHLEGPLPLEL 472



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 51/177 (28%), Positives = 88/177 (49%), Gaps = 6/177 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           + +SG +L G++      L  +    +  N+L   +P  L    N++ L+L+ NG  G +
Sbjct: 384 VDLSGNRLAGTIPDTFSNLTQLRRLMLHHNHLSGDVPASLGDCLNLEILDLSYNGLQGRI 443

Query: 505 PYSISQMAPLE-YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P  ++ M+ L+ YLN+S+N L+G + +    +  +  LD S N+LAG +P        ++
Sbjct: 444 PPRVAAMSGLKLYLNLSNNHLEGPLPLELGKMDMVLALDLSENALAGAVPAQLGGCVALE 503

Query: 682 NMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIP-PQLQGINSLQTGGNSWNS 843
            + L  N   G +   +A LP L  L+V  N  +G +P   LQ   SL+    S N+
Sbjct: 504 YLNLSGNALRGALPAPVAALPFLQVLDVSRNRLSGELPVSSLQASTSLRDANFSCNN 560



>gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenesis
           receptor-like kinase 2, exons 1-11.
          Length = 626

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 58/183 (31%), Positives = 96/183 (52%), Gaps = 3/183 (1%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV 303
           WAV L +  LL  P   VA+T+      LR      N+   L  W     +PC  +W  V
Sbjct: 11  WAVVLAVAVLLG-PGRVVANTEGDALYSLRQSLKDANNV--LQSWDPTLVNPC--TWFHV 65

Query: 304 SCSG-NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLN 474
           +C+  N V  + +   QL+G +  QL QLK++   ++ +NN+  ++P +L    N+  L+
Sbjct: 66  TCNNDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNNISGTIPPELGNLTNLVSLD 125

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           L  N F+G +P S+  +  L +L +++N L G + V   +++ L  LD S N+L+G +P 
Sbjct: 126 LYMNNFSGNIPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLSGQVPS 185

Query: 655 TFS 663
           T S
Sbjct: 186 TGS 188



>pir|E86312|E86312 F11A6.9 protein - Arabidopsis
           thaliana>gb:AE005172_890741 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC034257_1539927 Arabidopsis thaliana
           chromosome I BAC F11A6 genomic sequence, complete
           sequence.
          Length = 1088

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 62/193 (32%), Positives = 97/193 (50%), Gaps = 6/193 (3%)
 Frame = +1

Query: 256 WTANGGD--PCGESWKGVSC--SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNN 423
           W  N  +  PC  +W GV C  SGN V  + +S   L+G +G ++ +LKS+ T D+S N+
Sbjct: 52  WKENTSETTPCNNNWFGVICDLSGNVVETLNLSASGLSGQLGSEIGELKSLVTLDLSLNS 111

Query: 424 LGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTN 603
                                 F+G LP ++     LEYL++S+N   GEV  +F SL N
Sbjct: 112 ----------------------FSGLLPSTLGNCTSLEYLDLSNNDFSGEVPDIFGSLQN 149

Query: 604 LSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFT 777
           L+ L    N+L+G IP +   L  + ++ +  N  +GTI ++L N   L+ L + NN   
Sbjct: 150 LTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIPELLGNCSKLEYLALNNNKLN 209

Query: 778 GWIPPQLQGINSL 816
           G +P  L  + +L
Sbjct: 210 GSLPASLYLLENL 222



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 55/169 (32%), Positives = 80/169 (47%), Gaps = 6/169 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL---NLAGNGFTGG 501
           + +      GS+   L   K++ T D+S N L   +P +L  N+Q L   NL+ N   G 
Sbjct: 488 VNLGSNSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELG-NLQSLGLLNLSHNYLEGP 546

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           LP  +S  A L Y +V  N L G +   F S  +LSTL  S N+  G IPQ  + L  + 
Sbjct: 547 LPSQLSGCARLLYFDVGSNSLNGSIPSSFRSWKSLSTLVLSDNNFLGAIPQFLAELDRLS 606

Query: 682 NMYLQNNVFTGTIDVLANLPLD---NLNVENNHFTGWIPPQLQGINSLQ 819
           ++ +  N F G I     L       L++  N FTG IP  L  + +L+
Sbjct: 607 DLRIARNAFGGKIPSSVGLLKSLRYGLDLSANVFTGEIPTTLGALINLE 655



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 50/189 (26%), Positives = 81/189 (42%), Gaps = 28/189 (14%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP----------------- 456
           E+ +S   L G + F     K + + D+S N+    +P ++                   
Sbjct: 224 ELFVSNNSLGGRLHFGSSNCKKLVSLDLSFNDFQGGVPPEIGNCSSLHSLVMVKCNLTGT 283

Query: 457 ---------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
                     V  ++L+ N  +G +P  +   + LE L ++ NQLQGE+      L  L 
Sbjct: 284 IPSSMGMLRKVSVIDLSDNRLSGNIPQELGNCSSLETLKLNDNQLQGEIPPALSKLKKLQ 343

Query: 610 TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG--TIDVLANLPLDNLNVENNHFTGW 783
           +L+  FN L+G IP     + ++  M + NN  TG   ++V     L  L + NN F G 
Sbjct: 344 SLELFFNKLSGEIPIGIWKIQSLTQMLVYNNTLTGELPVEVTQLKHLKKLTLFNNGFYGD 403

Query: 784 IPPQLQGIN 810
           IP  L G+N
Sbjct: 404 IPMSL-GLN 411



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 42/161 (26%), Positives = 77/161 (47%), Gaps = 3/161 (1%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           +L+G +   + +++S+T   +  N L   LP ++    +++KL L  NGF G +P S+  
Sbjct: 351 KLSGEIPIGIWKIQSLTQMLVYNNTLTGELPVEVTQLKHLKKLTLFNNGFYGDIPMSLGL 410

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              LE +++  N+  GE+         L       N L G IP +      ++ + L++N
Sbjct: 411 NRSLEEVDLLGNRFTGEIPPHLCHGQKLRLFILGSNQLHGKIPASIRQCKTLERVRLEDN 470

Query: 703 VFTGTI-DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
             +G + +   +L L  +N+ +N F G IP  L    +L T
Sbjct: 471 KLSGVLPEFPESLSLSYVNLGSNSFEGSIPRSLGSCKNLLT 511



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 46/172 (26%), Positives = 81/172 (47%), Gaps = 5/172 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---LAGNGF 492
           +T + +    L+G +   +  L  +    +S NNL  ++P +L  N  KL    L  N  
Sbjct: 150 LTFLYLDRNNLSGLIPASVGGLIELVDLRMSYNNLSGTIP-ELLGNCSKLEYLALNNNKL 208

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            G LP S+  +  L  L VS+N L G +     +   L +LD SFN   G +P    + +
Sbjct: 209 NGSLPASLYLLENLGELFVSNNSLGGRLHFGSSNCKKLVSLDLSFNDFQGGVPPEIGNCS 268

Query: 673 NMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT 822
           ++ ++ +     TGTI     +   +  +++ +N  +G IP +L   +SL+T
Sbjct: 269 SLHSLVMVKCNLTGTIPSSMGMLRKVSVIDLSDNRLSGNIPQELGNCSSLET 320



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 43/169 (25%), Positives = 74/169 (43%), Gaps = 4/169 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           E+ + G + TG +   L   + +  F + +N L   +P  +     ++++ L  N  +G 
Sbjct: 416 EVDLLGNRFTGEIPPHLCHGQKLRLFILGSNQLHGKIPASIRQCKTLERVRLEDNKLSGV 475

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           LP    +   L Y+N+  N  +G +     S  NL T+D S N L G IP    +L ++ 
Sbjct: 476 LP-EFPESLSLSYVNLGSNSFEGSIPRSLGSCKNLLTIDLSQNKLTGLIPPELGNLQSLG 534

Query: 682 NMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
            + L +N   G +   +     L   +V +N   G IP   +   SL T
Sbjct: 535 LLNLSHNYLEGPLPSQLSGCARLLYFDVGSNSLNGSIPSSFRSWKSLST 583



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 4/171 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           +V+ I +S  +L+G++  +L    S+ T  ++ N L   +P  L     +Q L L  N  
Sbjct: 293 KVSVIDLSDNRLSGNIPQELGNCSSLETLKLNDNQLQGEIPPALSKLKKLQSLELFFNKL 352

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +G +P  I ++  L  + V +N L GE+ V    L +L  L    N   G+IP +     
Sbjct: 353 SGEIPIGIWKIQSLTQMLVYNNTLTGELPVEVTQLKHLKKLTLFNNGFYGDIPMSLGLNR 412

Query: 673 NMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++ + L  N FTG I   +     L    + +N   G IP  ++   +L+
Sbjct: 413 SLEEVDLLGNRFTGEIPPHLCHGQKLRLFILGSNQLHGKIPASIRQCKTLE 463



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 4/133 (3%)
 Frame = +1

Query: 265 NGGDPCG-ESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP 441
           NG  P    SWK +S        + +S     G++   L +L  ++   I+ N  G  +P
Sbjct: 568 NGSIPSSFRSWKSLST-------LVLSDNNFLGAIPQFLAELDRLSDLRIARNAFGGKIP 620

Query: 442 YQ---LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLST 612
                L      L+L+ N FTG +P ++  +  LE LN+S+N+L G ++V+  SL +L+ 
Sbjct: 621 SSVGLLKSLRYGLDLSANVFTGEIPTTLGALINLERLNISNNKLTGPLSVL-QSLKSLNQ 679

Query: 613 LDFSFNSLAGNIP 651
           +D S+N   G IP
Sbjct: 680 VDVSYNQFTGPIP 692



>gb:AB018110_1513754 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19M13.>gb:AY093083_1575037 Arabidopsis
           thaliana unknown protein (At5g23400) mRNA, complete
           cds.>gb:BT003360_1636783 Arabidopsis thaliana unknown
           protein (At5g23400) mRNA, complete cds.
          Length = 589

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 77/285 (27%), Positives = 127/285 (44%), Gaps = 42/285 (14%)
 Frame = +1

Query: 109 LMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSL--NSPPQLTKWTANGGDPC 282
           LM L +  AL+  F+L++    +  +   D + L G  SS+  ++   L  W   G D C
Sbjct: 8   LMNLLFVSALVRNFVLSSSQQVICSSQ--DRATLLGFKSSIIEDTTGVLDSWV--GKDCC 63

Query: 283 GESWKGVSC--SGNRVTEIQISG------LQLTGSMGFQLDQLKSVTTFDISTNN-LGNS 435
              W+GV C  +  +VT + +        L + G++   L  L+S+    I+ N  +  S
Sbjct: 64  NGDWEGVQCNPATGKVTGLVLQSAVNEPTLYMKGTLSPSLGNLRSLELLLITGNKFITGS 123

Query: 436 LPYQLP--------------------------PNVQKLNLAGNGFTGGLPYSISQMAPLE 537
           +P                              P ++ L+LAGN F+G +P S   +  L 
Sbjct: 124 IPNSFSNLTSLRQLILDDNSLQGNVLSSLGHLPLLEILSLAGNRFSGLVPASFGSLRRLT 183

Query: 538 YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
            +N++ N   G + V F +L  L  LD S N L+G IP       N+ N+YL +N F+G 
Sbjct: 184 TMNLARNSFSGPIPVTFKNLLKLENLDLSSNLLSGPIPDFIGQFQNLTNLYLSSNRFSGV 243

Query: 718 --IDVLANLPLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNSW 837
             + V +   L  +++E N  TG +  +   L+ + SLQ  GN +
Sbjct: 244 LPVSVYSLRKLQTMSLERNGLTGPLSDRFSYLKSLTSLQLSGNKF 288



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 46/175 (26%), Positives = 83/175 (47%), Gaps = 11/175 (6%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           R+T + ++    +G +      L  +   D+S+N L   +P  +    N+  L L+ N F
Sbjct: 181 RLTTMNLARNSFSGPIPVTFKNLLKLENLDLSSNLLSGPIPDFIGQFQNLTNLYLSSNRF 240

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +G LP S+  +  L+ +++  N L G ++  F  L +L++L  S N   G+IP + + L 
Sbjct: 241 SGVLPVSVYSLRKLQTMSLERNGLTGPLSDRFSYLKSLTSLQLSGNKFIGHIPASITGLQ 300

Query: 673 NMKNMYLQNNVFTGTIDV--------LANLPLDNLNVENNHFTGWI-PPQLQGIN 810
           N+ ++ L  N+F+  + V        L ++ L   N+       WI   QL  IN
Sbjct: 301 NLWSLNLSRNLFSDPLPVVGARGFPSLLSIDLSYNNLNLGAIPSWIRDKQLSDIN 355



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 57/220 (25%), Positives = 92/220 (41%), Gaps = 31/220 (14%)
 Frame = +1

Query: 154 LNAPPSAVADTDPTDASV----LRGLFSSLNSPPQLTKWTANGGDPCGE---------SW 294
           L A PS + D   +D ++    LRG F  L  P  LT    +     G+         + 
Sbjct: 339 LGAIPSWIRDKQLSDINLAGCKLRGTFPKLTRPTTLTSLDLSDNFLTGDVSAFLTSLTNV 398

Query: 295 KGVSCSGNR-------------VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS 435
           + V  S N+             V  I +S   +TGS+   ++   S    +I   N  N 
Sbjct: 399 QKVKLSKNQLRFDLSKLKLPEGVASIDLSSNLVTGSLSSLINNKTSSFLEEIHLTN--NQ 456

Query: 436 LPYQLPP-----NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
           +  ++P      N++ LN+  N  +G +P SIS +  L  L++S N + G +      L 
Sbjct: 457 ISGRIPDFGESLNLKVLNIGSNKISGQIPSSISNLVELVRLDISRNHITGGIPQAIGQLA 516

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
            L  LD S N+L G IP +  ++  +K+   + N   G I
Sbjct: 517 QLKWLDLSINALTGRIPDSLLNIKTIKHASFRANRLCGQI 556



>pir|C84524|C84524 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC005957_1533254 Arabidopsis
           thaliana chromosome 2 clone T15J14 map mi398, complete
           sequence.
          Length = 1011

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/169 (30%), Positives = 91/169 (53%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T + +S    +G +   L  L  +T+ D++ NN    +P  L    ++  L L  N   
Sbjct: 58  LTTLDLSENHFSGQIPSSLGNLLHLTSLDLTDNNFVGDIPTSLGNLSHLTLLLLGANNLV 117

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P+S+  ++ L  L +  N L GE+   F +L++L+ LD S N+L G IP  F S   
Sbjct: 118 GEIPFSLGNLSHLTDLTLCENDLAGEIPSSFENLSHLTNLDLSQNNLVGEIPSFFGSFNQ 177

Query: 676 MKNMYLQNNVFTGT-IDVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           + ++ ++ N FTG  + +L NL  L +L++  N FTG +PP +  +++L
Sbjct: 178 LVSLAVEENEFTGNFLLILLNLTNLSDLSLSRNQFTGTLPPNMSSLSNL 226



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 47/159 (29%), Positives = 75/159 (47%), Gaps = 4/159 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNG 489
           + +T + +    L G + F L  L  +T   +  N+L   +P  ++   ++  L+L+ N 
Sbjct: 104 SHLTLLLLGANNLVGEIPFSLGNLSHLTDLTLCENDLAGEIPSSFENLSHLTNLDLSQNN 163

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G +P        L  L V  N+  G   ++ ++LTNLS L  S N   G +P   SSL
Sbjct: 164 LVGEIPSFFGSFNQLVSLAVEENEFTGNFLLILLNLTNLSDLSLSRNQFTGTLPPNMSSL 223

Query: 670 TNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTG 780
           +N+   Y   N FTGTI   L N+P L   ++ +N   G
Sbjct: 224 SNLVLFYADANAFTGTIPSSLLNIPSLSCFDLSDNQLNG 262



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 39/136 (28%), Positives = 69/136 (50%), Gaps = 3/136 (2%)
 Frame = +1

Query: 391  SVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ 561
            ++++ D+  N    S+P         +Q L+L  N  +G  P +IS+   L+ L+V HNQ
Sbjct: 640  ALSSNDLCDNKFNGSIPRCMGNFSSTLQALHLRKNHLSGVFPENISES--LKSLDVGHNQ 697

Query: 562  LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP 741
            L G++    V +++L  L+   N +    P   SSL  ++ + L++N F G +       
Sbjct: 698  LVGKLPRSLVRISSLEVLNVENNKINDTFPFWLSSLEELQVLVLRSNAFHGPMQQTRFPN 757

Query: 742  LDNLNVENNHFTGWIP 789
            L  ++V +NHF G +P
Sbjct: 758  LRIIDVSHNHFNGTLP 773



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 2/107 (1%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            LK  T+ D S N     +P    L   +  LNL+ N FTG +P S+ ++  LE L+V+ N
Sbjct: 822  LKIFTSVDFSRNKFEGEIPKSIGLLKELHVLNLSSNTFTGHIPSSMGKLRELESLDVAQN 881

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
            +L G++      L+ L+ ++FS N L G +P     LT   + + +N
Sbjct: 882  KLSGDIPQDLGDLSYLAYMNFSHNQLVGPLPGGTQFLTQNCSSFEEN 928



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 49/188 (26%), Positives = 85/188 (45%), Gaps = 14/188 (7%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL-NLA-- 480
           S N++  + +   + TG+    L  L +++   +S N    +LP    PN+  L NL   
Sbjct: 174 SFNQLVSLAVEENEFTGNFLLILLNLTNLSDLSLSRNQFTGTLP----PNMSSLSNLVLF 229

Query: 481 ---GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
               N FTG +P S+  +  L   ++S NQL G +    +S ++LS L    N+  G+I 
Sbjct: 230 YADANAFTGTIPSSLLNIPSLSCFDLSDNQLNGNIEFGNIS-SSLSDLLLGNNNFRGSIH 288

Query: 652 QTFSSLTNMKNMYLQNNVFTGTID--------VLANLPLDNLNVENNHFTGWIPPQLQGI 807
           ++ S L N+  + L +    G+I+        +L NL L +LN              + +
Sbjct: 289 KSISKLVNLYTLDLSHFNTQGSINFSIFSDLKLLVNLHLSHLNTTTTIDLNTFLSSFKSL 348

Query: 808 NSLQTGGN 831
           ++L   GN
Sbjct: 349 DTLDLSGN 356



 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 39/124 (31%), Positives = 66/124 (53%), Gaps = 4/124 (3%)
 Frame = +1

Query: 457 NVQKLNLAGNGFTGGL--PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
           NV +LNL+ +   G L    +I  +  L +L++S+N   G++     + ++L+TLD S N
Sbjct: 7   NVIELNLSSSCLHGLLNSKSNIFSLQNLRFLDLSNNHFSGQILSSLGNFSSLTTLDLSEN 66

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQG 804
             +G IP +  +L ++ ++ L +N F G I   L NL  L  L +  N+  G IP  L  
Sbjct: 67  HFSGQIPSSLGNLLHLTSLDLTDNNFVGDIPTSLGNLSHLTLLLLGANNLVGEIPFSLGN 126

Query: 805 INSL 816
           ++ L
Sbjct: 127 LSHL 130



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 5/146 (3%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPY-QLPPNVQKLNLAGNGFTGGLPYSISQMAP 531
           TG++   L  + S++ FD+S N L  ++ +  +  ++  L L  N F G +  SIS++  
Sbjct: 237 TGTIPSSLLNIPSLSCFDLSDNQLNGNIEFGNISSSLSDLLLGNNNFRGSIHKSISKLVN 296

Query: 532 LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT 711
           L  L++SH   QG             +++FS           FS L  + N++L +   T
Sbjct: 297 LYTLDLSHFNTQG-------------SINFSI----------FSDLKLLVNLHLSHLNTT 333

Query: 712 GTIDVLANL----PLDNLNVENNHFT 777
            TID+   L     LD L++  NH +
Sbjct: 334 TTIDLNTFLSSFKSLDTLDLSGNHIS 359



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 46/201 (22%), Positives = 81/201 (40%), Gaps = 45/201 (22%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP------------------------P 456
            QL G +   L ++ S+   ++  N + ++ P+ L                         P
Sbjct: 697  QLVGKLPRSLVRISSLEVLNVENNKINDTFPFWLSSLEELQVLVLRSNAFHGPMQQTRFP 756

Query: 457  NVQKLNLAGNGFTGGLPYS-ISQMAPLEYLNVSHNQLQGE----------VTVMFVSLTN 603
            N++ ++++ N F G LP         +  L  + +Q  GE          + VM   L  
Sbjct: 757  NLRIIDVSHNHFNGTLPSDFFVNWTVMFLLGENEDQFNGEYMGTSYYSDSIVVMNKGLEM 816

Query: 604  --------LSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNL 753
                     +++DFS N   G IP++   L  +  + L +N FTG I   +  L  L++L
Sbjct: 817  EMVRILKIFTSVDFSRNKFEGEIPKSIGLLKELHVLNLSSNTFTGHIPSSMGKLRELESL 876

Query: 754  NVENNHFTGWIPPQLQGINSL 816
            +V  N  +G IP  L  ++ L
Sbjct: 877  DVAQNKLSGDIPQDLGDLSYL 897



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 44/178 (24%), Positives = 75/178 (42%), Gaps = 24/178 (13%)
 Frame = +1

Query: 328  EIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG------N 486
            E+Q+  L+     G  Q  +  ++   D+S N+   +LP     N   + L G      N
Sbjct: 735  ELQVLVLRSNAFHGPMQQTRFPNLRIIDVSHNHFNGTLPSDFFVNWTVMFLLGENEDQFN 794

Query: 487  G-FTGGLPYSIS--------QMAPLEYLNV------SHNQLQGEVTVMFVSLTNLSTLDF 621
            G + G   YS S        +M  +  L +      S N+ +GE+      L  L  L+ 
Sbjct: 795  GEYMGTSYYSDSIVVMNKGLEMEMVRILKIFTSVDFSRNKFEGEIPKSIGLLKELHVLNL 854

Query: 622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
            S N+  G+IP +   L  ++++ +  N  +G I   L +L  L  +N  +N   G +P
Sbjct: 855  SSNTFTGHIPSSMGKLRELESLDVAQNKLSGDIPQDLGDLSYLAYMNFSHNQLVGPLP 912



 Score = 32.7 bits (73), Expect = 8.9
 Identities = 30/132 (22%), Positives = 50/132 (37%), Gaps = 1/132 (0%)
 Frame = +1

Query: 427 GNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP-LEYLNVSHNQLQGEVTVMFVSLTN 603
           G S  + +   +   +L  N F G +P  +   +  L+ L++  N L G          +
Sbjct: 630 GKSSSFHMCIALSSNDLCDNKFNGSIPRCMGNFSSTLQALHLRKNHLSGVFPENISE--S 687

Query: 604 LSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGW 783
           L +LD   N L G +P++   +++                      L+ LNVENN     
Sbjct: 688 LKSLDVGHNQLVGKLPRSLVRISS----------------------LEVLNVENNKINDT 725

Query: 784 IPPQLQGINSLQ 819
            P  L  +  LQ
Sbjct: 726 FPFWLSSLEELQ 737



>gb:AP003214_1825331 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0083M16.
          Length = 791

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 61/186 (32%), Positives = 92/186 (49%)
 Frame = +1

Query: 277 PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP 456
           PCG +W+GVSC+G RVT + + G  L+G        L ++   D                
Sbjct: 163 PCG-TWRGVSCAGGRVTRLVLEGFGLSGDAA-----LPALARLD---------------- 200

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
            ++ L+L GNG TG +P  +S +A L+ L ++ N L G +     +L  L  LD SFN+L
Sbjct: 201 GLRVLSLKGNGLTGAIP-DLSPLAGLKLLFLAGNSLSGPIPPSIGALYRLYRLDLSFNNL 259

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +G +P   + L  +  + L +N  +G ID +A   L + NV NN  TG IP  +      
Sbjct: 260 SGVVPPELNRLDRLLTLRLDSNRLSGGIDGIALPVLQDFNVSNNLLTGRIPVAMAKFPVG 319

Query: 817 QTGGNS 834
             GGN+
Sbjct: 320 AFGGNA 325



>gb:AF053995_1764489 Lycopersicon esculentum Hcr2-0B (Hcr2-0B) gene,
           complete cds.
          Length = 944

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 59/182 (32%), Positives = 95/182 (52%), Gaps = 7/182 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N ++ + +   +L+GS+  ++  L+S+T  D+  N L  S+P  L    N+ +L+L  N 
Sbjct: 287 NNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLSRLDLYNNK 346

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P  I  +  L YL++  N L G +     +L NLS LD   N L+G+IP+    L
Sbjct: 347 LSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYL 406

Query: 670 TNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNS 834
            ++  + L NN  +G+I   L NL  L  L + NN  +G IP +   L  + +L  G NS
Sbjct: 407 RSLTKLSLGNNFLSGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNS 466

Query: 835 WN 840
            N
Sbjct: 467 LN 468



 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 5/195 (2%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNN 423
           L  WT +  + C + W GV C   RV  + I+   + G++  F    L  +   D+S NN
Sbjct: 49  LASWTTSS-NAC-KDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNN 106

Query: 424 LGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
           +  ++P ++    N+  L+L  N  +G +P  I  +A L+ + + +N L G +      L
Sbjct: 107 ISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYL 166

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNH 771
            +L+ L    N L+G+IP +  ++TN+  ++L  N  +G I  ++     L  L+++ N 
Sbjct: 167 RSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINF 226

Query: 772 FTGWIPPQLQGINSL 816
            +G IP  L  +N+L
Sbjct: 227 LSGSIPASLGNLNNL 241



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 51/172 (29%), Positives = 89/172 (51%), Gaps = 4/172 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N ++ + +   +L+GS+  ++  L+S+T  D+  N L  S+P  L    N+ +L+L  N 
Sbjct: 335 NNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLSRLDLYNNK 394

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P  I  +  L  L++ +N L G +     +L NL  L    N L+G+IP+    L
Sbjct: 395 LSGSIPEEIGYLRSLTKLSLGNNFLSGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYL 454

Query: 670 TNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++ N+YL NN   G I     N+  L  L + +N+  G IP  +  + SL+
Sbjct: 455 SSLTNLYLGNNSLNGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLE 506



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 47/180 (26%), Positives = 86/180 (47%), Gaps = 7/180 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T + +    L G +      ++++    ++ NNL   +P  +    +++ L +  N   
Sbjct: 457 LTNLYLGNNSLNGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLK 516

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  +  ++ L  L++S N   GE+     +LT+L  LDF  N+L G IPQ F ++++
Sbjct: 517 GKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISS 576

Query: 676 MKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT---GGNSWN 840
           ++   +QNN  +GT+    ++   L +LN+  N     IP  L     LQ    G N  N
Sbjct: 577 LQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLN 636



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 46/169 (27%), Positives = 87/169 (51%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   L  + +++   +  N L   +P ++    ++ KL+L  N  +
Sbjct: 169 LTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLS 228

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  +  L +L + +NQL G +      L +L+ LD   N+L G+IP +  +L N
Sbjct: 229 GSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN 288

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +  + L NN  +G+I  ++     L  L++  N   G IP  L  +N+L
Sbjct: 289 LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNL 337



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 47/170 (27%), Positives = 85/170 (50%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   L  L ++    +  N L  S+P ++    ++  L L  N   
Sbjct: 409 LTKLSLGNNFLSGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLN 468

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S   M  L+ L ++ N L GE+     +LT+L  L    N+L G +PQ   ++++
Sbjct: 469 GLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISD 528

Query: 676 MKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +  + + +N F+G +   ++NL  L  L+   N+  G IP     I+SLQ
Sbjct: 529 LLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISSLQ 578



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 33/84 (39%), Positives = 50/84 (59%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           ++L+ N F G +P  +  +  +  LNVSHN LQG +     SL+ + +LD SFN L+G I
Sbjct: 741 IDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSRVESLDLSFNQLSGEI 800

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
           PQ  +SLT ++ + L +N   G I
Sbjct: 801 PQQLASLTFLEFLNLSHNYLQGCI 824



 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 2/112 (1%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            L   T  D+S+N     +P  L     ++ LN++ N   G +P S+  ++ +E L++S N
Sbjct: 735  LSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSRVESLDLSFN 794

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
            QL GE+     SLT L  L+ S N L G IPQ     T   N Y  N+   G
Sbjct: 795  QLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRG 846



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 4/124 (3%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQM 525
           L G++      + S+  FD+  N L  +LP  + +  ++  LNL GN     +P+S+   
Sbjct: 563 LEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNC 622

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL--TNMKNMYLQN 699
             L+ L++  NQL     +   +L  L  L  + N L G I  + + +   +++ + L  
Sbjct: 623 KKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSR 682

Query: 700 NVFT 711
           N F+
Sbjct: 683 NAFS 686



 Score = 40.0 bits (92), Expect = 0.056
 Identities = 45/197 (22%), Positives = 87/197 (44%), Gaps = 21/197 (10%)
 Frame = +1

Query: 313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGN 486
            G  +  + + G +L   + + LD  K +   D+  N L ++ P  L   P ++ L L  N
Sbjct: 598  GCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSN 657

Query: 487  GFTGGLPYSISQMA--PLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSF---------- 627
               G +  S +++    L  +++S N    ++ T +F  L  + T+D +           
Sbjct: 658  KLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEVPSYERYYD 717

Query: 628  NSLAGNIPQTFSSLTNMKNMY----LQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
            +S+          +  + ++Y    L +N F G I  VL +L  +  LNV +N   G+IP
Sbjct: 718  DSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIP 777

Query: 790  PQLQGINSLQTGGNSWN 840
              L  ++ +++   S+N
Sbjct: 778  SSLGSLSRVESLDLSFN 794



>gb:AY182166_1587874 Elaeis guineensis clone Rlk-OPmf receptor-like
           protein kinase mRNA, partial cds.
          Length = 719

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 54/160 (33%), Positives = 89/160 (55%), Gaps = 4/160 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           + +  + G +L GS+  Q  +L+S+T  + S+NN    +P++L    N+  L+L+ N F+
Sbjct: 131 LNKFNVHGNRLNGSIPLQFQKLESLTYLNFSSNNFKGKVPWELGRIINLDTLDLSNNHFS 190

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P SI  +  L  LN+S N L G +   F +L +  T+D S+N L+G IP+    +  
Sbjct: 191 GPIPDSIGDLEHLLELNLSRNNLNGPLPTEFGNLRSGQTIDISYNKLSGPIPEELGQVQT 250

Query: 676 MKNMYLQNNVFTGTIDV-LAN-LPLDNLNVENNHFTGWIP 789
           +  + L NN   G I V L N   L +LN+  N+F+G +P
Sbjct: 251 IDTLILNNNDLYGEIPVQLTNCFSLSSLNLSFNNFSGDVP 290



 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 53/175 (30%), Positives = 91/175 (52%), Gaps = 4/175 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           ++ + G +LTG +  +L  +  ++   ++ N L  ++P +L     + +LNLA N   G 
Sbjct: 61  KLYLHGNKLTGPIPPELGNMTKLSYLQLNDNKLVGTIPAELGKLEELFELNLANNNLEGP 120

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P +IS    L   NV  N+L G + + F  L +L+ L+FS N+  G +P     + N+ 
Sbjct: 121 IPQNISLCTALNKFNVHGNRLNGSIPLQFQKLESLTYLNFSSNNFKGKVPWELGRIINLD 180

Query: 682 NMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            + L NN F+G I D + +L  L  LN+  N+  G +P +   + S QT   S+N
Sbjct: 181 TLDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLNGPLPTEFGNLRSGQTIDISYN 235



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 51/172 (29%), Positives = 82/172 (47%), Gaps = 4/172 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +V  + + G +LTG +   +  ++++   D+S N L  ++P  L       KL L GN  
Sbjct: 10  QVATLSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGTIPPILGNLSYTGKLYLHGNKL 69

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  +  M  L YL ++ N+L G +      L  L  L+ + N+L G IPQ  S  T
Sbjct: 70  TGPIPPELGNMTKLSYLQLNDNKLVGTIPAELGKLEELFELNLANNNLEGPIPQNISLCT 129

Query: 673 NMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT 822
            +    +  N   G+I +       L  LN  +N+F G +P +L  I +L T
Sbjct: 130 ALNKFNVHGNRLNGSIPLQFQKLESLTYLNFSSNNFKGKVPWELGRIINLDT 181



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 31/130 (23%), Positives = 69/130 (53%), Gaps = 2/130 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           + +S    +G +   +  L+ +   ++S NNL   LP +     + Q ++++ N  +G +
Sbjct: 182 LDLSNNHFSGPIPDSIGDLEHLLELNLSRNNLNGPLPTEFGNLRSGQTIDISYNKLSGPI 241

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  + Q+  ++ L +++N L GE+ V   +  +LS+L+ SFN+ +G++P + +     + 
Sbjct: 242 PEELGQVQTIDTLILNNNDLYGEIPVQLTNCFSLSSLNLSFNNFSGDVPLSKNFSRFPQE 301

Query: 685 MYLQNNVFTG 714
            +L N +  G
Sbjct: 302 SFLGNPMLCG 311



 Score = 37.7 bits (86), Expect = 0.28
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 2/78 (2%)
 Frame = +1

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVE 762
           +    ++TL    N L G IP+    +  +  + L  N   GTI  +L NL     L + 
Sbjct: 6   IGFLQVATLSLQGNRLTGKIPEVIGLMQALAVLDLSENELVGTIPPILGNLSYTGKLYLH 65

Query: 763 NNHFTGWIPPQLQGINSL 816
            N  TG IPP+L  +  L
Sbjct: 66  GNKLTGPIPPELGNMTKL 83



>gb:AY099851_1576876 Arabidopsis thaliana receptor protein
           kinase-like protein (At4g39270) mRNA, complete cds.
          Length = 864

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 64/198 (32%), Positives = 109/198 (55%), Gaps = 14/198 (7%)
 Frame = +1

Query: 271 GDPCGESWKGVSCSGN-RVTEIQISGLQLTG--------SMGFQLDQLKSVTTFDISTNN 423
           G+PC  +W G+ C  N RVT+I ISG + T         S+G  L  L  + +F+ S   
Sbjct: 55  GNPC-LNWNGIKCDQNGRVTKINISGFRRTRIGNQNPEFSVG-SLVNLTRLASFNASRFY 112

Query: 424 LGNSLPYQLPPNV---QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVS 594
           L   +P     ++   + L+L+    TG +P S+++++ L+ L++S N + G++ +   S
Sbjct: 113 LPGPIPALFGSSLLTLEVLDLSSCSITGTIPESLTRLSHLKVLDLSKNAINGDIPLSLTS 172

Query: 595 LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENN 768
           L NLS LD S NS+ G+IP    +L+ ++ + L  N  T +I   L +L  L +L++  N
Sbjct: 173 LQNLSILDLSSNSVFGSIPANIGALSKLQRLNLSRNTLTSSIPPSLGDLSVLIDLDLSFN 232

Query: 769 HFTGWIPPQLQGINSLQT 822
             +G +P  L+G+ +LQT
Sbjct: 233 GMSGSVPSDLKGLRNLQT 250



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 46/164 (28%), Positives = 78/164 (47%), Gaps = 6/164 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           +++  + +S   LT S+   L  L  +   D+S N +  S+P  L    N+Q L +AGN 
Sbjct: 198 SKLQRLNLSRNTLTSSIPPSLGDLSVLIDLDLSFNGMSGSVPSDLKGLRNLQTLVIAGNR 257

Query: 490 FTGGLPYSI-SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT--- 657
            +G LP  + S ++ L+ ++   +   G +     SL  L  LD S N  +  +P T   
Sbjct: 258 LSGSLPPDLFSLLSKLQIIDFRGSGFIGALPSRLWSLPELKFLDISGNHFSDMLPNTTVS 317

Query: 658 FSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
           F S  +M N  +  N+F G + +L       +++  N+F G IP
Sbjct: 318 FDSTVSMLN--ISGNMFYGNLTLLLT-RFQVVDLSENYFEGKIP 358



>pir|T08575|T08575 protein kinase homolog T22F8.170 - Arabidopsis
           thaliana>gb:ATCHRIV90_1547911 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 90.>gb:ATT22F8_1555280
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22F8
           (ESSA project).
          Length = 864

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 64/198 (32%), Positives = 109/198 (55%), Gaps = 14/198 (7%)
 Frame = +1

Query: 271 GDPCGESWKGVSCSGN-RVTEIQISGLQLTG--------SMGFQLDQLKSVTTFDISTNN 423
           G+PC  +W G+ C  N RVT+I ISG + T         S+G  L  L  + +F+ S   
Sbjct: 55  GNPC-LNWNGIKCDQNGRVTKINISGFRRTRIGNQNPEFSVG-SLVNLTRLASFNASRFY 112

Query: 424 LGNSLPYQLPPNV---QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVS 594
           L   +P     ++   + L+L+    TG +P S+++++ L+ L++S N + G++ +   S
Sbjct: 113 LPGPIPALFGSSLLTLEVLDLSSCSITGTIPESLTRLSHLKVLDLSKNAINGDIPLSLTS 172

Query: 595 LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENN 768
           L NLS LD S NS+ G+IP    +L+ ++ + L  N  T +I   L +L  L +L++  N
Sbjct: 173 LQNLSILDLSSNSVFGSIPANIGALSKLQRLNLSRNTLTSSIPPSLGDLSVLIDLDLSFN 232

Query: 769 HFTGWIPPQLQGINSLQT 822
             +G +P  L+G+ +LQT
Sbjct: 233 GMSGSVPSDLKGLRNLQT 250



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 46/164 (28%), Positives = 78/164 (47%), Gaps = 6/164 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           +++  + +S   LT S+   L  L  +   D+S N +  S+P  L    N+Q L +AGN 
Sbjct: 198 SKLQRLNLSRNTLTSSIPPSLGDLSVLIDLDLSFNGMSGSVPSDLKGLRNLQTLVIAGNR 257

Query: 490 FTGGLPYSI-SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT--- 657
            +G LP  + S ++ L+ ++   +   G +     SL  L  LD S N  +  +P T   
Sbjct: 258 LSGSLPPDLFSLLSKLQIIDFRGSGFIGALPSRLWSLPELKFLDISGNHFSDMLPNTTVS 317

Query: 658 FSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
           F S  +M N  +  N+F G + +L       +++  N+F G IP
Sbjct: 318 FDSTVSMLN--ISGNMFYGNLTLLLT-RFQVVDLSENYFEGKIP 358



>gb:AP005966_1860358 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863466 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 1102

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 64/216 (29%), Positives = 108/216 (50%), Gaps = 8/216 (3%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCSGN---RVTEIQISGLQLTGS 363
           D   L    S L+ P + L+ W+    + C  +W GV+CS     RV  I +S   +TG+
Sbjct: 33  DRQALLCFKSQLSGPSRVLSSWSNTSLNFC--NWDGVTCSSRSPPRVIAIDLSSEGITGT 90

Query: 364 MGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLE 537
           +   +  L S+ T  +S N+L  S+P +L     ++ LNL+ N   G +P  +S  + +E
Sbjct: 91  ISPCIANLTSLMTLQLSNNSLHGSIPPKLGLLRKLRNLNLSMNSLEGNIPSQLSSYSQIE 150

Query: 538 YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
            L++S N  QG +        +L  ++ S N+L G I   F +L+ ++ + L +N  T  
Sbjct: 151 ILDLSSNSFQGAIPASLGKCIHLQDINLSRNNLQGRISSAFGNLSKLQALVLTSNRLTDE 210

Query: 718 I--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           I   + ++  L  +++ NN  TG IP  L   +SLQ
Sbjct: 211 IPPSLGSSFSLRYVDLGNNDITGSIPESLANSSSLQ 246



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 5/160 (3%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--KLNLAGNGFTGGLPYSISQMA 528
           TG++   +  L ++T    + N L   +P      VQ   + L GN F+G +P SI Q  
Sbjct: 500 TGTIPQTIGNLNNLTVLSFAQNKLSGHIPDVFGNLVQLTDIKLDGNNFSGRIPSSIGQCT 559

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLS-TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
            L+ LN++HN L G +  +   +T+LS  ++ S N L G +P    +L N+  + + NN+
Sbjct: 560 QLQILNLAHNSLDGNIPSIIFKITSLSQEMNLSHNYLTGGMPDEVGNLINLNKLGISNNM 619

Query: 706 FTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +G I       + L+ L +++N F G IP     + S++
Sbjct: 620 LSGEIPSSLGQCVTLEYLEIQSNFFVGGIPQSFMKLVSIK 659



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 51/178 (28%), Positives = 94/178 (52%), Gaps = 9/178 (5%)
 Frame = +1

Query: 283  GESWKG-VSCSGNRVTEIQISGL---QLTGSMGFQLDQLKSVTT-FDISTNNLGNSLPYQ 447
            G ++ G +  S  + T++QI  L    L G++   + ++ S++   ++S N L   +P +
Sbjct: 544  GNNFSGRIPSSIGQCTQLQILNLAHNSLDGNIPSIIFKITSLSQEMNLSHNYLTGGMPDE 603

Query: 448  LPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF 621
            +    N+ KL ++ N  +G +P S+ Q   LEYL +  N   G +   F+ L ++  +D 
Sbjct: 604  VGNLINLNKLGISNNMLSGEIPSSLGQCVTLEYLEIQSNFFVGGIPQSFMKLVSIKEMDI 663

Query: 622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDN-LNVE-NNHFTGWIP 789
            S N+L+G IPQ  + L+++ ++ L  N F G I       +DN +++E NNH    +P
Sbjct: 664  SRNNLSGKIPQFLNLLSSLHDLNLSFNNFDGVIPTGGVFDIDNAVSIEGNNHLCTSVP 721



 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 44/152 (28%), Positives = 68/152 (44%), Gaps = 5/152 (3%)
 Frame = +1

Query: 376 LDQLKSVTTFDISTNNLGNSLPYQ---LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLN 546
           L     +T   +  N+    LP     L  N++ L L  N   G +P  I  +  L  L 
Sbjct: 434 LSNCSKLTQLMLDGNSFQGILPSSIGNLSSNLEGLWLRNNKIYGPIPPEIGNLKSLSILF 493

Query: 547 VSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-- 720
           + +N   G +     +L NL+ L F+ N L+G+IP  F +L  + ++ L  N F+G I  
Sbjct: 494 MDYNLFTGTIPQTIGNLNNLTVLSFAQNKLSGHIPDVFGNLVQLTDIKLDGNNFSGRIPS 553

Query: 721 DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            +     L  LN+ +N   G IP  +  I SL
Sbjct: 554 SIGQCTQLQILNLAHNSLDGNIPSIIFKITSL 585



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 48/164 (29%), Positives = 83/164 (50%), Gaps = 8/164 (4%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQ 522
           +L   +G+ L +++ +    +  N     +P  L    +++ L L  N FTG +P+    
Sbjct: 354 RLPSDIGYTLTKIQGLI---LPANKFVGPIPASLLNAYHLEMLYLGNNSFTGLVPF-FGS 409

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTN---LSTLDFSFNSLAGNIPQTFSSL-TNMKNMY 690
           +  LE L+VS+N L+        SL+N   L+ L    NS  G +P +  +L +N++ ++
Sbjct: 410 LPNLEELDVSYNMLEPGDWSFMTSLSNCSKLTQLMLDGNSFQGILPSSIGNLSSNLEGLW 469

Query: 691 LQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
           L+NN   G I   + NL  L  L ++ N FTG IP  +  +N+L
Sbjct: 470 LRNNKIYGPIPPEIGNLKSLSILFMDYNLFTGTIPQTIGNLNNL 513



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 28/174 (16%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY--QLPPNVQKLNLAGNGFTGGL 504
           +++    L+G +   L    S+T   +  N+   S+P    +   ++ ++L  N  +G +
Sbjct: 248 LRLMSNNLSGEVPKSLFNTSSLTAIFLQQNSFVGSIPAIAAMSSPIKYISLRDNCISGTI 307

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF-------- 660
           P S+  +  LE L +S N L G V     ++++L+ L    NSL G +P           
Sbjct: 308 PESLGHIRTLEILTMSVNNLSGLVPPSLFNISSLTFLAMGNNSLVGRLPSDIGYTLTKIQ 367

Query: 661 --------------SSLTN---MKNMYLQNNVFTGTIDVLANLP-LDNLNVENN 768
                         +SL N   ++ +YL NN FTG +    +LP L+ L+V  N
Sbjct: 368 GLILPANKFVGPIPASLLNAYHLEMLYLGNNSFTGLVPFFGSLPNLEELDVSYN 421



>gb:AP004326_1840210 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1294_F06.
          Length = 1013

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 72/243 (29%), Positives = 120/243 (49%), Gaps = 12/243 (4%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGL--FSSLNSPPQ--LTKWTANGGDPCGESWK 297
           +ALL+  L+ A  +      P +  VL GL  F S  S P   L  WT +   PCG  W 
Sbjct: 5   IALLLFVLVVAAAADSTMPMPVNEEVL-GLVVFKSALSDPSGALATWTESDATPCG--WA 61

Query: 298 GVSC--SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQ 465
            V C  + +RV  + + GL L+G M   LD+L ++ +  ++ NNL   LP    L  +++
Sbjct: 62  HVECDPATSRVLRLALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLR 121

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
            ++L+ N F+G LP  +  +A L YL+++ N   G +   F +      L  S N  +G 
Sbjct: 122 SIDLSYNAFSGPLPGDVPLLASLRYLDLTGNAFSGPLPATFPATVRF--LMLSGNQFSGP 179

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTIDVLANL-PLDN---LNVENNHFTGWIPPQLQGINS 813
           +PQ  S  + + ++ L  N  +G+ D    L PL     L++  N F+G +   +  +++
Sbjct: 180 LPQGLSKSSFLLHLNLSGNQLSGSPDFAGALWPLSRLRALDLSRNQFSGTVTTGIANLHN 239

Query: 814 LQT 822
           L+T
Sbjct: 240 LKT 242



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 50/179 (27%), Positives = 91/179 (50%), Gaps = 6/179 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNG 489
           +R+  + +S  Q +G++   +  L ++ T D+S N    ++P    L P++  ++++ N 
Sbjct: 214 SRLRALDLSRNQFSGTVTTGIANLHNLKTIDLSGNRFFGAVPSDIGLCPHLSTVDISSNA 273

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           F G LP SI+ +  L Y   S N+  G+V      L  L  LDFS N+L G +P +   L
Sbjct: 274 FDGQLPDSIAHLGSLVYFAASGNRFSGDVPAWLGDLAALQHLDFSDNALTGRLPDSLGKL 333

Query: 670 TNMKNMYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPPQL--QGINSLQTGGNS 834
            +++ + +  N  +G I D ++    L  L++  N+ +G IP  L   G+ +L    N+
Sbjct: 334 KDLRYLSMSENQLSGAIPDAMSGCTKLAELHLRANNLSGSIPDALFDVGLETLDMSSNA 392



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 60/195 (30%), Positives = 94/195 (48%), Gaps = 29/195 (14%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNG 489
           ++ E+ +    L+GS+   L  +  + T D+S+N L   LP    +L   +Q L+L+ N 
Sbjct: 359 KLAELHLRANNLSGSIPDALFDV-GLETLDMSSNALSGVLPSGSTKLAETLQWLDLSVNQ 417

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD----------------- 618
            TGG+P  ++    L YLN+S N L+ ++      L NL+ LD                 
Sbjct: 418 ITGGIPAEMALFMNLRYLNLSRNDLRTQLPPELGLLRNLTVLDLRSSGLYGTMPSDLCEA 477

Query: 619 -------FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNH 771
                     NSLAG IP    + +++  + L +N  TG I V ++ L  L+ L +E N+
Sbjct: 478 GSLAVLQLDGNSLAGPIPDNIGNCSSLYLLSLGHNSLTGPIPVGMSELKKLEILRLEYNN 537

Query: 772 FTGWIPPQLQGINSL 816
            +G IP QL GI SL
Sbjct: 538 LSGEIPQQLGGIESL 552



 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 2/118 (1%)
 Frame = +1

Query: 373 QLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLN 546
           +L  L+++T  D+ ++ L  ++P  L    ++  L L GN   G +P +I   + L  L+
Sbjct: 449 ELGLLRNLTVLDLRSSGLYGTMPSDLCEAGSLAVLQLDGNSLAGPIPDNIGNCSSLYLLS 508

Query: 547 VSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           + HN L G + V    L  L  L   +N+L+G IPQ    + ++  + + +N   G +
Sbjct: 509 LGHNSLTGPIPVGMSELKKLEILRLEYNNLSGEIPQQLGGIESLLAVNVSHNRLVGRL 566



>gb:AP004256_1839206 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1224_G08.>gb:AP004695_1843583 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0474F07.
          Length = 1013

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 78/247 (31%), Positives = 117/247 (47%), Gaps = 12/247 (4%)
 Frame = +1

Query: 139 LIGFLLNAPPSAVADTDP--TDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGES-WKGV 303
           L  F ++   +A + + P  TD   L  L   L++ P   L  W  N  D  G   W GV
Sbjct: 29  LSSFAVHPAAAAASSSSPSNTDFQTLLCLKLHLSNDPGGFLGSWKQN--DSIGFCRWPGV 86

Query: 304 SCSG---NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQK 468
           +CS    +RV  + +    L G +   +  L  +       N L   +P +L     +  
Sbjct: 87  TCSKTNTSRVVALDLGSSGLNGQIPPCITNLTLLARIHFPDNQLSGQIPPELGQLSRLGY 146

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           LNL+ N  +G +P ++S    LE +++  N+L G +      L NLS L+ + NSL GNI
Sbjct: 147 LNLSSNSLSGSIPNTLSSTY-LEVIDLESNKLTGGIPGELGMLRNLSVLNLAGNSLTGNI 205

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQT 822
           P +  S T++ ++ L NN  TG I  VLAN   L  LN+ +N+  G IPP L    SL+ 
Sbjct: 206 PISLGSSTSLVSVVLANNTLTGPIPSVLANCSSLQVLNLVSNNLGGGIPPALFNSTSLRR 265

Query: 823 GGNSWNS 843
               WN+
Sbjct: 266 LNLGWNN 272



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 50/179 (27%), Positives = 90/179 (50%), Gaps = 5/179 (2%)
 Frame = +1

Query: 322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
            +  + +S  +L+G +   + +L  +    +  NN    +P  L     +  LNL+ N   
Sbjct: 531  LNSLDLSRNKLSGQIPHSIGKLGQLNELFLQDNNFSGPIPSALGDCKKLVNLNLSCNTLN 590

Query: 496  GGLPYSISQMAPLEY-LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            G +P  +  +  L   L++SHNQL  ++     SL N+  L+FS N ++G IP T  +  
Sbjct: 591  GSIPKELFSLYSLTTGLDLSHNQLSAQIPQEVGSLINIGLLNFSNNHISGKIPTTLGACV 650

Query: 673  NMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
             +++++L+ N   GTI D   NL  +  +++  N+ +G IP   Q  NSL+    S+N+
Sbjct: 651  RLESLHLEGNFLDGTIPDSFVNLKGISEIDLSRNNLSGEIPNFFQSFNSLKLLNLSFNN 709



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 56/209 (26%), Positives = 94/209 (44%), Gaps = 32/209 (15%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAG 483
           S   +  + ++   LTG +   L    S+   ++ +NNLG  +P  L    ++++LNL  
Sbjct: 211 SSTSLVSVVLANNTLTGPIPSVLANCSSLQVLNLVSNNLGGGIPPALFNSTSLRRLNLGW 270

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQL------------------------QGEVTVMFV 591
           N FTG +P   +  +PL+YL +S N L                        QG + V   
Sbjct: 271 NNFTGSIPDVSNVDSPLQYLTLSVNGLTGTIPSSLGNFSSLRLLYLAANHFQGSIPVSIS 330

Query: 592 SLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN---VE 762
            L NL  LD S+N L G +P +  +++++  + L  N FT T+       L N+    ++
Sbjct: 331 KLPNLQELDISYNYLPGTVPPSIFNISSLTYLSLAVNDFTNTLPFGIGYTLPNIQTLILQ 390

Query: 763 NNHFTGWIPPQL---QGINSLQTGGNSWN 840
             +F G IP  L     + S+  G N++N
Sbjct: 391 QGNFQGKIPASLANATNLESINLGANAFN 419



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 47/144 (32%), Positives = 69/144 (47%), Gaps = 5/144 (3%)
 Frame = +1

Query: 409 ISTNNLGNSLPYQLPPNVQKLN---LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           ++TN L  SLP  +      L    L  N  +G +P     +  L +L +  N + G V 
Sbjct: 463 LATNKLQGSLPSSIGSLANTLGALWLHANEISGPIPPETGSLTNLVWLRMEQNYIVGNVP 522

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNL 753
               +L NL++LD S N L+G IP +   L  +  ++LQ+N F+G I         L NL
Sbjct: 523 GTIGNLANLNSLDLSRNKLSGQIPHSIGKLGQLNELFLQDNNFSGPIPSALGDCKKLVNL 582

Query: 754 NVENNHFTGWIPPQLQGINSLQTG 825
           N+  N   G IP +L  + SL TG
Sbjct: 583 NLSCNTLNGSIPKELFSLYSLTTG 606



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 39/151 (25%), Positives = 73/151 (48%), Gaps = 2/151 (1%)
 Frame = +1

Query: 325  TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGFTG 498
            T + +S  QL+  +  ++  L ++   + S N++   +P  L   V  + L+L GN   G
Sbjct: 605  TGLDLSHNQLSAQIPQEVGSLINIGLLNFSNNHISGKIPTTLGACVRLESLHLEGNFLDG 664

Query: 499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
             +P S   +  +  +++S N L GE+   F S  +L  L+ SFN+L G +P+      N 
Sbjct: 665  TIPDSFVNLKGISEIDLSRNNLSGEIPNFFQSFNSLKLLNLSFNNLEGQMPEG-GIFQNS 723

Query: 679  KNMYLQNNVFTGTIDVLANLPLDNLNVENNH 771
              +++Q N+   +   +  LPL   +  + H
Sbjct: 724  SEVFVQGNIMLCSSSPMLQLPLCLASSRHRH 754



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 36/132 (27%), Positives = 68/132 (51%), Gaps = 3/132 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           LTG++   L    S+    ++ N+   S+P  +   PN+Q+L+++ N   G +P SI  +
Sbjct: 297 LTGTIPSSLGNFSSLRLLYLAANHFQGSIPVSISKLPNLQELDISYNYLPGTVPPSIFNI 356

Query: 526 APLEYLNVSHNQLQGEVTV-MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           + L YL+++ N     +   +  +L N+ TL     +  G IP + ++ TN++++ L  N
Sbjct: 357 SSLTYLSLAVNDFTNTLPFGIGYTLPNIQTLILQQGNFQGKIPASLANATNLESINLGAN 416

Query: 703 VFTGTIDVLANL 738
            F G I    +L
Sbjct: 417 AFNGIIPSFGSL 428



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 53/200 (26%), Positives = 95/200 (47%), Gaps = 8/200 (4%)
 Frame = +1

Query: 223 SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTT 402
           S+++SP Q    + NG      S  G + S  R+  +  +  Q  GS+   + +L ++  
Sbjct: 281 SNVDSPLQYLTLSVNGLTGTIPSSLG-NFSSLRLLYLAANHFQ--GSIPVSISKLPNLQE 337

Query: 403 FDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAP-LEYLNVSHNQLQGE 573
            DIS N L  ++P  +    ++  L+LA N FT  LP+ I    P ++ L +     QG+
Sbjct: 338 LDISYNYLPGTVPPSIFNISSLTYLSLAVNDFTNTLPFGIGYTLPNIQTLILQQGNFQGK 397

Query: 574 VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL-QNNVFTGTIDVLANLP--- 741
           +     + TNL +++   N+  G IP +F SL  +K + L  N +  G    +++L    
Sbjct: 398 IPASLANATNLESINLGANAFNGIIP-SFGSLYKLKQLILASNQLEAGDWSFMSSLANCT 456

Query: 742 -LDNLNVENNHFTGWIPPQL 798
            L+ L++  N   G +P  +
Sbjct: 457 RLEVLSLATNKLQGSLPSSI 476



 Score = 34.7 bits (78), Expect = 2.3
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGF 492
           R+  + + G  L G++      LK ++  D+S NNL   +P  +Q   +++ LNL+ N  
Sbjct: 651 RLESLHLEGNFLDGTIPDSFVNLKGISEIDLSRNNLSGEIPNFFQSFNSLKLLNLSFNNL 710

Query: 493 TGGLP 507
            G +P
Sbjct: 711 EGQMP 715



>gb:AP003622_1831610 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0633E08.
          Length = 1072

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 53/170 (31%), Positives = 90/170 (52%), Gaps = 4/170 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +++++ + G  L+G +   +    S+    +  N L   +P ++   PN+  L+L  N F
Sbjct: 433 KLSKLLLLGNALSGRLPPSVADCSSLVRLRLGENQLAGEIPREIGKLPNLVFLDLYSNKF 492

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG LP  ++ +  LE L+V +N   G +   F  L NL  LD S N L G IP +F + +
Sbjct: 493 TGALPGELANITVLELLDVHNNSFTGAIPPQFGELMNLEQLDLSMNKLTGEIPASFGNFS 552

Query: 673 NMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
            +  + L  N+ +GT+   + NL  L  L + NN F+G IPP++  ++SL
Sbjct: 553 YLNKLILSGNMLSGTLPKSIRNLQKLTMLELSNNSFSGPIPPEIGALSSL 602



 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/157 (33%), Positives = 84/157 (53%), Gaps = 4/157 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +     TG++  Q  +L ++   D+S N L   +P        + KL L+GN  +G L
Sbjct: 509 LDVHNNSFTGAIPPQFGELMNLEQLDLSMNKLTGEIPASFGNFSYLNKLILSGNMLSGTL 568

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS-TLDFSFNSLAGNIPQTFSSLTNMK 681
           P SI  +  L  L +S+N   G +     +L++LS +LD S N   G +P   SSLT ++
Sbjct: 569 PKSIRNLQKLTMLELSNNSFSGPIPPEIGALSSLSISLDLSSNRFTGELPDEMSSLTQLQ 628

Query: 682 NMYLQNNVFTGTIDVLANLP-LDNLNVENNHFTGWIP 789
           ++ L +N   G+I VL+ L  L +LN+  N+F+G IP
Sbjct: 629 SLDLSSNGLYGSISVLSGLTSLTSLNISYNNFSGAIP 665



 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 56/176 (31%), Positives = 90/176 (51%), Gaps = 4/176 (2%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNL 477
           +CS   +T +Q+    LTG++  QL +L+++    +  N L  ++P  L     +  L+L
Sbjct: 358 NCSS--LTALQLDKNGLTGAIPPQLGELRALQVLFLWGNALSGAIPPSLGNCTELYALDL 415

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           + N   GG+P  +  +  L  L +  N L G +       ++L  L    N LAG IP+ 
Sbjct: 416 SRNRLAGGIPDEVFALQKLSKLLLLGNALSGRLPPSVADCSSLVRLRLGENQLAGEIPRE 475

Query: 658 FSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
              L N+  + L +N FTG +   LAN+  L+ L+V NN FTG IPPQ   + +L+
Sbjct: 476 IGKLPNLVFLDLYSNKFTGALPGELANITVLELLDVHNNSFTGAIPPQFGELMNLE 531



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 65/239 (27%), Positives = 108/239 (45%), Gaps = 6/239 (2%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           V +++G ++  P +A++     D   L  L  +    P L  W      PC  SW+GV+C
Sbjct: 14  VVVVLGVVVR-PAAALS----ADGKALLSLLPAAAPSPVLPSWDPTAATPC--SWQGVTC 66

Query: 310 SG-NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLA 480
           S  +RV  + +    L  S                       SLP QL    ++Q LNL+
Sbjct: 67  SPQSRVVSLSLPNTFLNLS-----------------------SLPPQLASLSSLQLLNLS 103

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
               +G +P + + +A L  L++S N L G++     +L+ L  L  + N L G IP++ 
Sbjct: 104 TCNISGAIPPAYASLAALRVLDLSSNALYGDIPASLGALSGLQYLLLNSNRLTGAIPRSL 163

Query: 661 SSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENN-HFTGWIPPQLQGINSLQTGG 828
           +SL  ++ + +Q+N+  GTI   + A   L    V  N   +G IP  L  +++L   G
Sbjct: 164 ASLAALQVLCVQDNLLNGTIPASLGALTALQQFRVGGNPGLSGPIPASLGALSNLTVFG 222



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 51/173 (29%), Positives = 88/173 (50%), Gaps = 11/173 (6%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK------LNLAGNGFTGGLPY 510
           +LTG +  +L +L+ +T+  +     GN+L  ++PP +        L+L+GN   G +P 
Sbjct: 275 KLTGPIPPELGRLQKLTSLLL----WGNALSGRIPPELSNCSALVVLDLSGNRLAGEVPG 330

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
           ++ ++A LE L++S NQL G +     + ++L+ L    N L G IP     L  ++ ++
Sbjct: 331 ALGRLAALEQLHLSDNQLAGRIPAELSNCSSLTALQLDKNGLTGAIPPQLGELRALQVLF 390

Query: 691 LQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNS 834
           L  N  +G I   L N   L  L++  N   G IP +   LQ ++ L   GN+
Sbjct: 391 LWGNALSGAIPPSLGNCTELYALDLSRNRLAGGIPDEVFALQKLSKLLLLGNA 443



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 4/137 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---LAGNGFTG 498
           ++ +S  +LTG +         +    +S N L  +LP  +  N+QKL    L+ N F+G
Sbjct: 532 QLDLSMNKLTGEIPASFGNFSYLNKLILSGNMLSGTLPKSIR-NLQKLTMLELSNNSFSG 590

Query: 499 GLPYSISQMAPLEY-LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
            +P  I  ++ L   L++S N+  GE+     SLT L +LD S N L G+I    S LT+
Sbjct: 591 PIPPEIGALSSLSISLDLSSNRFTGELPDEMSSLTQLQSLDLSSNGLYGSI-SVLSGLTS 649

Query: 676 MKNMYLQNNVFTGTIDV 726
           + ++ +  N F+G I V
Sbjct: 650 LTSLNISYNNFSGAIPV 666



>gb:AX093382_1461111 Sequence 1 from Patent WO0118061.
          Length = 330

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 69/232 (29%), Positives = 106/232 (45%), Gaps = 15/232 (6%)
 Frame = +1

Query: 169 SAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES----WKGVSCSGNR----V 324
           SA   T   D   L  + SSL     +  W   G DPCG      W GV+CS       V
Sbjct: 23  SARCKTVKRDVKALNEIKSSLGWRV-VYSWV--GDDPCGHGDLPPWSGVTCSQQGDYRVV 79

Query: 325 TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTG 498
           TE+++  + + G     +  L  +   D+  N L   +P Q+    +++ LNL  N    
Sbjct: 80  TELEVYAVSIVGPFPTAVTNLLDLRRLDLHNNKLTGPIPPQIGRLKHLRILNLRWNKLQD 139

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
            LP  I ++  L +L +S N  +GE+ V   +L  L  L    N   G IP    +L N+
Sbjct: 140 VLPPEIGELKKLTHLYLSFNNFKGEIPVELANLPELRYLYLHENRFTGRIPPELGTLKNL 199

Query: 679 KNMYLQNNVFTGTI-DVLAN----LPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++ + NN  TGT+ D + N      L NL + NN  TG +P Q+  + +L+
Sbjct: 200 RHLDVGNNHLTGTLRDFIGNGNGFPSLRNLYLNNNELTGVLPDQIANLTNLE 251



>gb:AE005173_894080 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007764_1536165 Genomic sequence
           for Arabidopsis thaliana BAC F22C12 from chromosome I,
           complete sequence.
          Length = 587

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 66/216 (30%), Positives = 97/216 (44%), Gaps = 3/216 (1%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS--GNRVTEIQISGLQLTGSMG 369
           D   L    SS NS      W  +  D C  SW GV+C+  G+R+  +++  +   G + 
Sbjct: 25  DKKALLHFLSSFNS--SRLHWNQSS-DVC-HSWTGVTCNENGDRIVSVRLPAVGFNGLIP 80

Query: 370 -FQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLN 546
            F + +L S+                      + L+L  N FTG  P   + +  L +L 
Sbjct: 81  PFTISRLSSL----------------------KFLSLRKNHFTGDFPSDFTNLKSLTHLY 118

Query: 547 VSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV 726
           + HN L G +  +F  L NL  LD S N   G+IP + S LT+++ + L NN F+G I  
Sbjct: 119 LQHNHLSGPLLAIFSELKNLKVLDLSNNGFNGSIPTSLSGLTSLQVLNLANNSFSGEIPN 178

Query: 727 LANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS 834
           L    L  +N+ NN   G IP  LQ   S    GN+
Sbjct: 179 LHLPKLSQINLSNNKLIGTIPKSLQRFQSSAFSGNN 214



>gb:AP005386_1850809 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0019I19.
          Length = 558

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 44/85 (51%), Positives = 61/85 (71%)
 Frame = +1

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVE 762
           MF +LT LS LD SFN+L GN+P +  SL+N+  +YLQNN  +GT++VL+NL L  LN+ 
Sbjct: 1   MFGNLTALSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTVNVLSNLSLTTLNIA 60

Query: 763 NNHFTGWIPPQLQGINSLQTGGNSW 837
           NN+F+G IP +   I+ L  GGNS+
Sbjct: 61  NNNFSGSIPQEFSSISHLILGGNSF 85



 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 24/73 (32%), Positives = 48/73 (65%)
 Frame = +1

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           + +L+++ N   G LP S+  ++ +  + + +NQL G V V+  S  +L+TL+ + N+ +
Sbjct: 8   LSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTVNVL--SNLSLTTLNIANNNFS 65

Query: 640 GNIPQTFSSLTNM 678
           G+IPQ FSS++++
Sbjct: 66  GSIPQEFSSISHL 78



 Score = 39.3 bits (90), Expect = 0.095
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L +++  D+S NNL  +LP  L    N+  + L  N  +G +  ++     L  LN+++N
Sbjct: 5   LTALSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTV--NVLSNLSLTTLNIANN 62

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
              G +   F S+++L     SF ++  + P T +S
Sbjct: 63  NFSGSIPQEFSSISHLILGGNSFLNVPSSPPSTITS 98



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 5/81 (6%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG 501
           ++E+ +S   L G++   L  L +++   +  N L  ++      ++  LN+A N F+G 
Sbjct: 8   LSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTVNVLSNLSLTTLNIANNNFSGS 67

Query: 502 LPYSISQMAPL-----EYLNV 549
           +P   S ++ L      +LNV
Sbjct: 68  IPQEFSSISHLILGGNSFLNV 88



>gb:AP005064_1847429 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBa0049G15.>gb:AP005495_1852849 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0003H03.
          Length = 1011

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 69/225 (30%), Positives = 106/225 (47%), Gaps = 17/225 (7%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSPPQ--LTKW-TANGGD----PCGESWKGVSCSGNR----VTEIQIS 342
           D S L    S +   P+  ++ W TA  G     P    W GVSC+  R    VT +++S
Sbjct: 26  DLSALLSFKSLIRDDPREVMSSWDTAGNGTNMPAPVICQWTGVSCNNRRHPGRVTTLRLS 85

Query: 343 GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSI 516
           G  L G++  QL  L  +   D+S N+L   +P  L     ++ LNL+ N  +G +P  +
Sbjct: 86  GAGLVGTISPQLGNLTHLRVLDLSANSLDGDIPASLGGCRKLRTLNLSTNHLSGSIPDDL 145

Query: 517 SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ 696
            Q + L   +V HN L G V   F +LT L       N + G       +LT++ +  L+
Sbjct: 146 GQSSKLAIFDVGHNNLTGNVPKSFSNLTTLVKFIIETNFIDGKDLSWMGNLTSLTHFVLE 205

Query: 697 NNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            N FTG I      +ANL     NV++N   G +P  +  I+S++
Sbjct: 206 GNRFTGNIPESFGKMANLIY--FNVKDNQLEGHVPLPIFNISSIR 248



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 52/160 (32%), Positives = 85/160 (53%), Gaps = 5/160 (3%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQL-PPNVQKLNLAGNGFTGGLPYSISQM 525
           L G+M   +  L   ++  D+S N L  ++P  L    +  LNL+ N FTG LP+ I  +
Sbjct: 360 LVGAMPINIANLSGELSWIDLSGNQLIGTIPADLWKLKLTSLNLSYNLFTGTLPHDIGWL 419

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             +  + VSHN++ G++     + + LS+L  S N L G+IP +  +LT ++ + L  N 
Sbjct: 420 TRINSIYVSHNRITGQIPQSLGNASQLSSLTLSNNFLDGSIPSSLGNLTKLQYLDLSGNA 479

Query: 706 FTGTI--DVLANLPLDN-LNVENNHFTGWIPPQLQGINSL 816
             G I  ++L    L   L++ NN  +G IP Q+  +NSL
Sbjct: 480 LMGQIPQEILTIPSLTKLLSLSNNALSGSIPRQIGLLNSL 519



 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 53/180 (29%), Positives = 88/180 (48%), Gaps = 5/180 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           R+  I +S  ++TG +   L     +++  +S N L  S+P  L     +Q L+L+GN  
Sbjct: 421 RINSIYVSHNRITGQIPQSLGNASQLSSLTLSNNFLDGSIPSSLGNLTKLQYLDLSGNAL 480

Query: 493 TGGLPYSISQMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            G +P  I  +  L + L++S+N L G +      L +L  +D S N L+G IP+   S 
Sbjct: 481 MGQIPQEILTIPSLTKLLSLSNNALSGSIPRQIGLLNSLVKMDLSMNKLSGEIPKAIGSC 540

Query: 670 TNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
             +  +  + N+  G I + L NL  L+ L++ NN+  G IP  L     L     S+N+
Sbjct: 541 VQLSFLNFKGNLLQGQIPENLNNLRSLEILDLSNNNLAGPIPEFLANFTLLTNLNLSFNA 600



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 51/171 (29%), Positives = 87/171 (50%), Gaps = 6/171 (3%)
 Frame = +1

Query: 226 SLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQ---ISGLQLTGSMGFQLDQLKSV 396
           SL +  QL+  T +     G     +  S   +T++Q   +SG  L G +  ++  + S+
Sbjct: 439 SLGNASQLSSLTLSNNFLDGS----IPSSLGNLTKLQYLDLSGNALMGQIPQEILTIPSL 494

Query: 397 TTF-DISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ 567
           T    +S N L  S+P Q  L  ++ K++L+ N  +G +P +I     L +LN   N LQ
Sbjct: 495 TKLLSLSNNALSGSIPRQIGLLNSLVKMDLSMNKLSGEIPKAIGSCVQLSFLNFKGNLLQ 554

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           G++     +L +L  LD S N+LAG IP+  ++ T + N+ L  N  +G +
Sbjct: 555 GQIPENLNNLRSLEILDLSNNNLAGPIPEFLANFTLLTNLNLSFNALSGPV 605



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 2/111 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK--LNLAGNGFTGGL 504
           + +S   L+GS+  Q+  L S+   D+S N L   +P  +   VQ   LN  GN   G +
Sbjct: 498 LSLSNNALSGSIPRQIGLLNSLVKMDLSMNKLSGEIPKAIGSCVQLSFLNFKGNLLQGQI 557

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           P +++ +  LE L++S+N L G +     + T L+ L+ SFN+L+G +P T
Sbjct: 558 PENLNNLRSLEILDLSNNNLAGPIPEFLANFTLLTNLNLSFNALSGPVPNT 608



>gb:AY084350_1569441 Arabidopsis thaliana clone 105146 mRNA,
           complete sequence.
          Length = 477

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 50/155 (32%), Positives = 91/155 (58%), Gaps = 3/155 (1%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGF 492
           R+T++++    LTG++   +  LK ++  ++  N L  ++P  ++  P ++ L L+ NGF
Sbjct: 175 RLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGF 234

Query: 493 TGGLPYSISQMAP-LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           +G LP SI+ +AP L +L + HN+L G +     +   L TLD S N  +G IP++F++L
Sbjct: 235 SGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANL 294

Query: 670 TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHF 774
           T + N+ L +N+ T    VL    +++L++  N F
Sbjct: 295 TKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNKF 329



 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 71/264 (26%), Positives = 112/264 (42%), Gaps = 39/264 (14%)
 Frame = +1

Query: 148 FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSC-SGN 318
           FL    P+  A   P D + L    + +   P   L+ W    G  C  SW GV+C + +
Sbjct: 15  FLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKK--GTACC-SWNGVTCLTTD 71

Query: 319 RVTEIQISGL-------------------------------QLTGSMGFQLDQLKSVTTF 405
           RV+ + ++G                                 +TGS    L QL ++   
Sbjct: 72  RVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYV 131

Query: 406 DISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
            I  N L   LP  +     ++  +L GN FTG +P SIS +  L  L + +N L G + 
Sbjct: 132 YIENNRLSGPLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTRLTQLKLGNNLLTGTIP 191

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP--LDN 750
           +   +L  +S L+   N L G IP  F S+  ++++ L  N F+G +   +A+L   L  
Sbjct: 192 LGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRF 251

Query: 751 LNVENNHFTGWIPPQLQGINSLQT 822
           L + +N  +G IP  L    +L T
Sbjct: 252 LELGHNKLSGTIPNFLSNFKALDT 275



>sp|P93194|RPK1_PHANI Receptor-like protein kinase precursor (EC
           2.7.1.37).>gb:INU77888_1683175 Ipomoea nil receptor-like
           protein kinase INRPK1 (inrpk1) gene, complete cds,
           alternatively spliced.
          Length = 1109

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 65/237 (27%), Positives = 115/237 (48%), Gaps = 7/237 (2%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNS-PPQLTK-WTANGGDPCGESWKG 300
           AV   + FL +      A    +D + L  L     S P  +T+ W A+   PC  SW G
Sbjct: 4   AVNTFLLFLCSTSSIYAAFALNSDGAALLSLTRHWTSIPSDITQSWNASDSTPC--SWLG 61

Query: 301 VSCSGNR-VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKL 471
           V C   + V  + +S   ++G  G ++  LK +    +S N    S+P QL     ++ +
Sbjct: 62  VECDRRQFVDTLNLSSYGISGEFGPEISHLKHLKKVVLSGNGFFGSIPSQLGNCSLLEHI 121

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L+ N FTG +P ++  +  L  L++  N L G      +S+ +L T+ F+ N L G+IP
Sbjct: 122 DLSSNSFTGNIPDTLGALQNLRNLSLFFNSLIGPFPESLLSIPHLETVYFTGNGLNGSIP 181

Query: 652 QTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
               +++ +  ++L +N F+G +   L N+  L  L + +N+  G +P  L  + +L
Sbjct: 182 SNIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTLPVTLNNLENL 238



 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 55/152 (36%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = +1

Query: 403 FDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
           FD+S NN    +P  L    NV  + L+ N  +G +P  +  +  LE+LN+SHN L+G +
Sbjct: 504 FDLSGNNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGIL 563

Query: 577 TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDN 750
                +   LS LD S N L G+IP T  SLT +  + L  N F+G I   +  +  L N
Sbjct: 564 PSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLN 623

Query: 751 LNVENNHFTGWIPP--QLQGINSLQTGGNSWN 840
           L +  N   G IPP   LQ + SL    N  N
Sbjct: 624 LQLGGNLLAGDIPPVGALQALRSLNLSSNKLN 655



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 47/153 (30%), Positives = 79/153 (51%), Gaps = 4/153 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
           L+G +     QL  + T  ++ N+    +P +L    ++  L L  N   G +P  +  +
Sbjct: 296 LSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGML 355

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L+YL++  N L GEV +    + +L +L    N+L+G +P   + L  + ++ L  N 
Sbjct: 356 SQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENH 415

Query: 706 FTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
           FTG I  D+ AN  L+ L++  N FTG IPP L
Sbjct: 416 FTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNL 448



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 46/166 (27%), Positives = 77/166 (46%), Gaps = 4/166 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           +  +G  L GS+   +  +  +TT  +  N     +P  L     +Q+L L  N   G L
Sbjct: 169 VYFTGNGLNGSIPSNIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTL 228

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P +++ +  L YL+V +N L G + + FVS   + T+  S N   G +P    + T+++ 
Sbjct: 229 PVTLNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNCTSLRE 288

Query: 685 MYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL 816
               +   +G I         LD L +  NHF+G IPP+L    S+
Sbjct: 289 FGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSM 334



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 54/178 (30%), Positives = 92/178 (51%), Gaps = 6/178 (3%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
            ++  + +S   L G +  +L     ++  D S N L  S+P  L     + KL+L  N F
Sbjct: 548  KLEHLNLSHNILKGILPSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSF 607

Query: 493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            +GG+P S+ Q   L  L +  N L G++  +  +L  L +L+ S N L G +P     L 
Sbjct: 608  SGGIPTSLFQSNKLLNLQLGGNLLAGDIPPVG-ALQALRSLNLSSNKLNGQLPIDLGKLK 666

Query: 673  NMKNMYLQNNVFTGTIDVLANLP-LDNLNVENNHFTGWIPPQL-QGINSLQT--GGNS 834
             ++ + + +N  +GT+ VL+ +  L  +N+ +N F+G +PP L + +NS  T   GNS
Sbjct: 667  MLEELDVSHNNLSGTLRVLSTIQSLTFINISHNLFSGPVPPSLTKFLNSSPTSFSGNS 724



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 6/179 (3%)
 Frame = +1

Query: 304 SCSGNRVT--EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKL 471
           S  GN  T  E+ ++   L G++   L+ L+++   D+  N+L  ++P        +  +
Sbjct: 206 SSLGNITTLQELYLNDNNLVGTLPVTLNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTI 265

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L+ N FTGGLP  +     L         L G +   F  LT L TL  + N  +G IP
Sbjct: 266 SLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIP 325

Query: 652 QTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT 822
                  +M ++ LQ N   G I     +   L  L++  N+ +G +P  +  I SLQ+
Sbjct: 326 PELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPLSIWKIQSLQS 384



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 50/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 301 VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLN 474
           VSC   ++  I +S  Q TG +   L    S+  F   +  L   +P  +     +  L 
Sbjct: 257 VSCK--QIDTISLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGPIPSCFGQLTKLDTLY 314

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           LAGN F+G +P  + +   +  L +  NQL+GE+      L+ L  L    N+L+G +P 
Sbjct: 315 LAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPL 374

Query: 655 TFSSLTNMKNMYLQNNVFTGT--IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +   + +++++ L  N  +G   +D+     L +L +  NHFTG IP  L   +SL+
Sbjct: 375 SIWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIPQDLGANSSLE 431



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 27/189 (14%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGL 504
           +Q+    L+G +   + +LK + +  +  N+    +P  L  N  ++ L+L  N FTG +
Sbjct: 385 LQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIPQDLGANSSLEVLDLTRNMFTGHI 444

Query: 505 PYSISQMAPLEYLNVSHNQLQGEV-----------------------TVMFVSLTNLSTL 615
           P ++     L+ L + +N L+G V                          FV   NL   
Sbjct: 445 PPNLCSQKKLKRLLLGYNYLEGSVPSDLGGCSTLERLILEENNLRGGLPDFVEKQNLLFF 504

Query: 616 DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIP 789
           D S N+  G IP +  +L N+  +YL +N  +G+I  ++ + + L++LN+ +N   G +P
Sbjct: 505 DLSGNNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILP 564

Query: 790 PQLQGINSL 816
            +L   + L
Sbjct: 565 SELSNCHKL 573



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 44/171 (25%), Positives = 75/171 (43%), Gaps = 25/171 (14%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--------------------GNS 435
            ++++E+  S   L GS+   L  L  +T   +  N+                     GN 
Sbjct: 571  HKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNL 630

Query: 436  LPYQLPP-----NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
            L   +PP      ++ LNL+ N   G LP  + ++  LE L+VSHN L G + V+  ++ 
Sbjct: 631  LAGDIPPVGALQALRSLNLSSNKLNGQLPIDLGKLKMLEELDVSHNNLSGTLRVL-STIQ 689

Query: 601  NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL 753
            +L+ ++ S N  +G +P + +   N          F+G  D+  N P D L
Sbjct: 690  SLTFINISHNLFSGPVPPSLTKFLNS-----SPTSFSGNSDLCINCPADGL 735



>gb:AC099732_1737183 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1203D03, complete sequence.
          Length = 1001

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 81/268 (30%), Positives = 121/268 (45%), Gaps = 39/268 (14%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDAS----VLRGLFSSLNSPPQL--TKWTANGGDPCGESWK 297
           LL+  L  A   A ADT  + AS     L  L ++L  P     T WT    D    SW 
Sbjct: 14  LLLLLLATATHGAAADTVSSPASPEAAALLNLSAALGDPSGYLSTHWTH---DTAFCSWP 70

Query: 298 GVSCS--GNRVTEIQISGLQLTGSMGFQ--------------------------LDQLKS 393
            +SC   G+RV  + +SGL L+G +                             +  LK+
Sbjct: 71  RLSCDADGSRVLSLDLSGLNLSGPIPAAALSSLSHLQSLNLSNNILNSTFPEGLIASLKN 130

Query: 394 VTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ 567
           +   D   NNL  +LP  LP   N+  L+L GN F G +P S  Q + ++YL +S N+L 
Sbjct: 131 LRVLDFYNNNLTGALPAALPNLTNLVHLHLGGNFFFGSIPRSYGQWSRIKYLALSGNELT 190

Query: 568 GEVTVMFVSLTNLSTLDFS-FNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL- 738
           GE+     +LT L  L    FNS  G IP     L  +  + + N   +G +   +ANL 
Sbjct: 191 GEIPPELGNLTTLRELYLGYFNSFTGGIPPELGRLKELVRLDMANCGISGVVPPEVANLT 250

Query: 739 PLDNLNVENNHFTGWIPPQLQGINSLQT 822
            LD L ++ N  +G +PP++  + +L++
Sbjct: 251 SLDTLFLQINALSGRLPPEIGAMGALKS 278



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 5/161 (3%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMA 528
           TG +  +L +LK +   D++   +   +P ++    ++  L L  N  +G LP  I  M 
Sbjct: 215 TGGIPPELGRLKELVRLDMANCGISGVVPPEVANLTSLDTLFLQINALSGRLPPEIGAMG 274

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+ L++S+N   GE+   F SL NL+ L+   N LAG IP+    L N++ + L  N F
Sbjct: 275 ALKSLDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFVGDLPNLEVLQLWENNF 334

Query: 709 TGTIDV---LANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           TG +     +A   L  ++V  N  TG +P +L     L+T
Sbjct: 335 TGGVPAQLGVAATRLRIVDVSTNRLTGVLPTELCAGKRLET 375



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 35/116 (30%), Positives = 70/116 (60%), Gaps = 6/116 (5%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK------LNLAGNG 489
           ++ ++G +L+G +  ++ +L+ ++  D+S    GN +  ++PP +        L+L+GN 
Sbjct: 472 KLLVAGNRLSGELPREIGKLQQLSKADLS----GNLISGEIPPAIAGCRLLTFLDLSGNR 527

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
            +G +P +++ +  L YLN+SHN L GE+      + +L+ +DFS N+L+G +P T
Sbjct: 528 LSGRIPPALAGLRILNYLNLSHNALDGEIPPAIAGMQSLTAVDFSDNNLSGEVPAT 583



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 46/177 (25%), Positives = 79/177 (44%), Gaps = 7/177 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLK-SVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGF 492
           +T+I++    L+G +      +  S+    +  N L   +P  +   V  QKL +AGN  
Sbjct: 421 LTQIELHDNLLSGELRLDAGVVSPSIGELSLYNNRLSGPVPVGIGGLVGLQKLLVAGNRL 480

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +G LP  I ++  L   ++S N + GE+         L+ LD S N L+G IP   + L 
Sbjct: 481 SGELPREIGKLQQLSKADLSGNLISGEIPPAIAGCRLLTFLDLSGNRLSGRIPPALAGLR 540

Query: 673 NMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPP--QLQGINSLQTGGN 831
            +  + L +N   G I   +     L  ++  +N+ +G +P   Q    N+    GN
Sbjct: 541 ILNYLNLSHNALDGEIPPAIAGMQSLTAVDFSDNNLSGEVPATGQFAYFNATSFAGN 597



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 49/193 (25%), Positives = 79/193 (40%), Gaps = 30/193 (15%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S     G +      LK++T  ++  N L   +P  +   PN++ L L  N FTGG+
Sbjct: 279 LDLSNNLFVGEIPASFASLKNLTLLNLFRNRLAGEIPEFVGDLPNLEVLQLWENNFTGGV 338

Query: 505 PYSISQMAP-LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P  +   A  L  ++VS N+L G +     +   L T     NSL G+IP   +   ++ 
Sbjct: 339 PAQLGVAATRLRIVDVSTNRLTGVLPTELCAGKRLETFIALGNSLFGSIPDGLAGCPSLT 398

Query: 682 NMYLQNNVFTGTID----VLANL-----------------------PLDNLNVENNHFTG 780
            + L  N   GTI      L NL                        +  L++ NN  +G
Sbjct: 399 RLRLGENYLNGTIPAKMFTLQNLTQIELHDNLLSGELRLDAGVVSPSIGELSLYNNRLSG 458

Query: 781 WIPPQLQGINSLQ 819
            +P  + G+  LQ
Sbjct: 459 PVPVGIGGLVGLQ 471



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 29/198 (14%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAG 483
           +  R+  + +S  +LTG +  +L   K + TF    N+L  S+P  L   P++ +L L  
Sbjct: 345 AATRLRIVDVSTNRLTGVLPTELCAGKRLETFIALGNSLFGSIPDGLAGCPSLTRLRLGE 404

Query: 484 NGFTGGLP---YSISQMAPLEY----------------------LNVSHNQLQGEVTVMF 588
           N   G +P   +++  +  +E                       L++ +N+L G V V  
Sbjct: 405 NYLNGTIPAKMFTLQNLTQIELHDNLLSGELRLDAGVVSPSIGELSLYNNRLSGPVPVGI 464

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVE 762
             L  L  L  + N L+G +P+    L  +    L  N+ +G I   +     L  L++ 
Sbjct: 465 GGLVGLQKLLVAGNRLSGELPREIGKLQQLSKADLSGNLISGEIPPAIAGCRLLTFLDLS 524

Query: 763 NNHFTGWIPPQLQGINSL 816
            N  +G IPP L G+  L
Sbjct: 525 GNRLSGRIPPALAGLRIL 542



>gb:AY368673_1602931 Triticum turgidum HMW-glutenin locus, complete
           sequence.
          Length = 753

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 64/245 (26%), Positives = 119/245 (48%), Gaps = 15/245 (6%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPT--DASVLRGLFSSLNSPP--QLTKWT----ANGGDPCG 285
           +ALL   +L +P ++ + +  T  D   L    S +   P   L+ WT    +NG     
Sbjct: 11  LALLTTTILLSPSTSTSSSISTVDDLQALLSFKSLITKDPLGALSSWTINSSSNGSTHGF 70

Query: 286 ESWKGVSCSG---NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP 456
            SW GV CS      V  + + GL L+G++   L  L  +   D+  N L   +P  L  
Sbjct: 71  CSWTGVKCSSAHPGHVKVLCLQGLSLSGTVSPFLGNLSRLRVLDLFNNKLEGQIPPSLGN 130

Query: 457 --NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
              +++LNL+ N  +G +P ++  ++ L  +++S+N + G + ++F  L  ++      N
Sbjct: 131 CFALRRLNLSFNSLSGAIPPAMGNLSKLLVMSISNNNISGTIPLLFADLATVTMFSIKSN 190

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQG 804
           ++ G IP    +LT +K++ +  N+ +G +    +  + L  LN+  N+  G IPP L  
Sbjct: 191 NVHGEIPPWLGNLTALKHLNMGGNMMSGHVPPALSKLIHLQFLNLAVNNLQGLIPPVLFN 250

Query: 805 INSLQ 819
           ++S +
Sbjct: 251 MSSFE 255



 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 51/166 (30%), Positives = 94/166 (56%), Gaps = 5/166 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +++  + IS   ++G++      L +VT F I +NN+   +P  L     ++ LN+ GN 
Sbjct: 156 SKLLVMSISNNNISGTIPLLFADLATVTMFSIKSNNVHGEIPPWLGNLTALKHLNMGGNM 215

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS- 666
            +G +P ++S++  L++LN++ N LQG +  +  ++++   L+F  N L+G++PQ   S 
Sbjct: 216 MSGHVPPALSKLIHLQFLNLAVNNLQGLIPPVLFNMSSFELLNFGSNQLSGSLPQDIGSI 275

Query: 667 LTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQL 798
           LTN+K+  L  N F G I   L+N+  L+ + +  N F G IP  +
Sbjct: 276 LTNLKSFSLFYNKFEGQIPASLSNISSLEFIVLHGNRFRGRIPSNI 321



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 41/132 (31%), Positives = 72/132 (54%), Gaps = 5/132 (3%)
 Frame = +1

Query: 451 PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
           P +V+ L L G   +G +   +  ++ L  L++ +N+L+G++     +   L  L+ SFN
Sbjct: 83  PGHVKVLCLQGLSLSGTVSPFLGNLSRLRVLDLFNNKLEGQIPPSLGNCFALRRLNLSFN 142

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVL-ANL-PLDNLNVENNHFTGWIPP---Q 795
           SL+G IP    +L+ +  M + NN  +GTI +L A+L  +   ++++N+  G IPP    
Sbjct: 143 SLSGAIPPAMGNLSKLLVMSISNNNISGTIPLLFADLATVTMFSIKSNNVHGEIPPWLGN 202

Query: 796 LQGINSLQTGGN 831
           L  +  L  GGN
Sbjct: 203 LTALKHLNMGGN 214



>pir|T00971|T00971 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC002505_1530747 Arabidopsis
           thaliana chromosome 2 clone T9J22 map B68, complete
           sequence.
          Length = 480

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 81/264 (30%), Positives = 120/264 (45%), Gaps = 39/264 (14%)
 Frame = +1

Query: 148 FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSC-SGN 318
           FL    P+A A   P D + L    S +   P   L+ W   G D C  SW GVSC +GN
Sbjct: 17  FLRCLNPTAAATCHPDDEAGLLAFKSGITKDPSGILSTWK-KGTDCC--SWNGVSCPNGN 73

Query: 319 RVTEIQI------SGLQLTGSMGFQLDQLKSVT-TFDISTNNLGNSLPY----------- 444
           RV  + I      +G+ L+G++   L +L+ +     I+  N+    P            
Sbjct: 74  RVVVLTIRIESDDAGIFLSGTISPSLAKLQHLEGVVFINLKNITGPFPPFLFRLPHLKYV 133

Query: 445 ---------QLPPNVQKLN------LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
                     LP N+  LN      + GN F G +P SIS +  L YLN+  N L G + 
Sbjct: 134 YLENTRLSGPLPANIGALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIP 193

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP--LDN 750
           +   +L  +S L+   N L+G IP  F S+TN++ + L  N F+G +   +A+L   L  
Sbjct: 194 LGIANLKLISNLNLDGNRLSGTIPDIFKSMTNLRILTLSRNRFSGKLPPSIASLAPVLAF 253

Query: 751 LNVENNHFTGWIPPQLQGINSLQT 822
           L +  N+ +G IP  L    +L T
Sbjct: 254 LELGQNNLSGSIPSYLSRFVALDT 277



 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 4/125 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTF-DISTNNLGNSLPYQLPPNV--QKLNLAGNGFTGG 501
           + +S  + +G +   +  L  V  F ++  NNL  S+P  L   V    L+L+ N F+G 
Sbjct: 229 LTLSRNRFSGKLPPSIASLAPVLAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGA 288

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL-AGNIPQTFSSLTNM 678
           +P S++++  +  +N+SHN L     V+ V    + TLD S+N      IP+  +S + +
Sbjct: 289 VPKSLAKLTKIANINLSHNLLTNPFPVLNVK-NYILTLDLSYNKFHMETIPEWVTSASIL 347

Query: 679 KNMYL 693
            ++ L
Sbjct: 348 GSLKL 352



>pir|T02361|T02361 hypothetical protein T8F5.16 - Arabidopsis
           thaliana>gb:AE005173_894191 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AY065442_1566548 Arabidopsis thaliana
           unknown protein (At1g65380) mRNA, complete
           cds.>gb:AY096537_1576079 Arabidopsis thaliana unknown
           protein (At1g65380) mRNA, complete cds.>gb:T8F5_1724151
           Arabidopsis thaliana chromosome 1 BAC T8F5 sequence,
           complete sequence.>gb:AF177672_1774648 Arabidopsis
           thaliana cultivar Columbia receptor-like protein
           CLAVATA2 (CLV2) gene, complete cds.
          Length = 720

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 68/214 (31%), Positives = 112/214 (52%), Gaps = 7/214 (3%)
 Frame = +1

Query: 169 SAVADTDPTD-ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG--NRVTEIQI 339
           S + D DP D AS+L    S  +    L+ W    G  C  +W G++C     +V  + +
Sbjct: 25  SQLPDLDPQDKASLLIFRVSIHDLNRSLSTWY---GSSCS-NWTGLACQNPTGKVLSLTL 80

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYS 513
           SGL L+  +   L +L S+ + D+S NN   ++P  +    N++ LNL+ N F G +P +
Sbjct: 81  SGLNLSSQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGSIPAT 140

Query: 514 ISQMAPLEYLNVSHNQ-LQGEVTVMFVSLT-NLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
              +  L  + +S N+ L G V   F + + NL  +DFSF S  G +P++   L ++K +
Sbjct: 141 FVSLKELREVVLSENRDLGGVVPHWFGNFSMNLERVDFSFCSFVGELPESLLYLKSLKYL 200

Query: 688 YLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
            L++N  TGT+      PL  LN+ +N F+G +P
Sbjct: 201 NLESNNMTGTLRDFQQ-PLVVLNLASNQFSGTLP 233



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/153 (31%), Positives = 80/153 (52%), Gaps = 9/153 (5%)
 Frame = +1

Query: 388 KSVTTFDISTNNLGNSLPYQLPPNVQKL-----NLAGNGFTGGLPYSISQMAPLEYLNVS 552
           + +   D+S N     LP ++    +KL     +L+ N F+G +P  I+++  L+ L +S
Sbjct: 288 EKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLDLSHNSFSGDIPLRITELKSLQALRLS 347

Query: 553 HNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI---- 720
           HN L G++     +LT L  +D S N+L G+IP        +  + + NN  +G I    
Sbjct: 348 HNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQLLALMISNNNLSGEIQPEL 407

Query: 721 DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           D L +L +  L++ NNH +G IP  L G+ SL+
Sbjct: 408 DALDSLKI--LDISNNHISGEIPLTLAGLKSLE 438



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 50/185 (27%), Positives = 93/185 (50%), Gaps = 15/185 (8%)
 Frame = +1

Query: 319 RVTEIQ------ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL- 477
           R+TE++      +S   LTG +  ++  L  +   D+S N L  S+P  +    Q L L 
Sbjct: 334 RITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQLLALM 393

Query: 478 -AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            + N  +G +   +  +  L+ L++S+N + GE+ +    L +L  +D S N+L+GN+ +
Sbjct: 394 ISNNNLSGEIQPELDALDSLKILDISNNHISGEIPLTLAGLKSLEIVDISSNNLSGNLNE 453

Query: 655 TFSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINS----- 813
             +  +N+K + L  N F+GT+   +     +  ++  +N F+ +IP     +NS     
Sbjct: 454 AITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSNRFSWFIPD--DNLNSTRFKD 511

Query: 814 LQTGG 828
            QTGG
Sbjct: 512 FQTGG 516



 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 47/173 (27%), Positives = 77/173 (44%), Gaps = 7/173 (4%)
 Frame = +1

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSIS 519
           L+     G   D  + +   ++++N    +LP  Y   P++  LN+A N   GGLP  + 
Sbjct: 202 LESNNMTGTLRDFQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLPSCLG 261

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY--- 690
            +  L +LN+S N    E++   +    L  LD S N  +G +P   S  T    +    
Sbjct: 262 SLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLD 321

Query: 691 LQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           L +N F+G I   +     L  L + +N  TG IP ++  +  LQ    S N+
Sbjct: 322 LSHNSFSGDIPLRITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNA 374



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 44/152 (28%), Positives = 75/152 (49%), Gaps = 5/152 (3%)
 Frame = +1

Query: 379 DQLKSVTTFDISTNNLGNSLPYQLPPN-VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH 555
           D  +S++T+  S+ +    L  Q P   V  L L+G   +  +  S+ +++ L+ L++SH
Sbjct: 47  DLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTLSGLNLSSQIHPSLCKLSSLQSLDLSH 106

Query: 556 NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV--- 726
           N   G +   F SL NL TL+ S N   G+IP TF SL  ++ + L  N   G +     
Sbjct: 107 NNFSGNIPSCFGSLRNLRTLNLSRNRFVGSIPATFVSLKELREVVLSENRDLGGVVPHWF 166

Query: 727 -LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
              ++ L+ ++     F G +P  L  + SL+
Sbjct: 167 GNFSMNLERVDFSFCSFVGELPESLLYLKSLK 198



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 47/84 (55%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           ++L+ N   G +P ++ +   +EYLN+S+N L+G++      L  L  LD S NSL+G +
Sbjct: 553 IDLSDNLLHGEIPEALFRQKNIEYLNLSYNFLEGQLP-RLEKLPRLKALDLSHNSLSGQV 611

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
               S+   +  + L +N F+G I
Sbjct: 612 IGNISAPPGLTLLNLSHNCFSGII 635



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L S+   D+S N L   +P  L    N++ LNL+ N   G LP  + ++  L+ L++SHN
Sbjct: 547 LLSMVGIDLSDNLLHGEIPEALFRQKNIEYLNLSYNFLEGQLP-RLEKLPRLKALDLSHN 605

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            L G+V     +   L+ L+ S N  +G I +
Sbjct: 606 SLSGQVIGNISAPPGLTLLNLSHNCFSGIITE 637



>pir|C84538|C84538 probable LRR receptor protein kinase [imported] -
           Arabidopsis thaliana>gb:AC007047_1535085 Arabidopsis
           thaliana chromosome 2 clone F16F14 map mi398, complete
           sequence.
          Length = 925

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 69/211 (32%), Positives = 104/211 (49%), Gaps = 13/211 (6%)
 Frame = +1

Query: 250 TKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT--GSMG--FQLDQLKSVTTFDIST 417
           T W   G DPC + W+G+ C    +  I ISG + T  G +   F +D L+++T      
Sbjct: 52  TDWPIKG-DPCVD-WRGIQCENGSIIGINISGFRRTRIGKLNPQFSVDPLRNLTRLSYF- 108

Query: 418 NNLGNSLPYQLPP-------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
           N  G +LP  +P         ++ L+L+     G +P+++  +  L  LN+S N L   V
Sbjct: 109 NASGLALPGTIPEWFGVSLLALEVLDLSSCSVNGVVPFTLGNLTSLRTLNLSQNSLTSLV 168

Query: 577 TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDN 750
                 L NLS LD S NS  G +PQ+FSSL N+  + + +N  TG I   + A   L +
Sbjct: 169 PSSLGQLLNLSQLDLSRNSFTGVLPQSFSSLKNLLTLDVSSNYLTGPIPPGLGALSKLIH 228

Query: 751 LNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           LN  +N F+  IP +L  + +L     S NS
Sbjct: 229 LNFSSNSFSSPIPSELGDLVNLVDFDLSINS 259



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 61/195 (31%), Positives = 93/195 (47%), Gaps = 29/195 (14%)
 Frame = +1

Query: 292 WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQ 465
           W GVS     V  + +S   + G + F L  L S+ T ++S N+L + +P  L    N+ 
Sbjct: 122 WFGVSLLALEV--LDLSSCSVNGVVPFTLGNLTSLRTLNLSQNSLTSLVPSSLGQLLNLS 179

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT-----------VMFVS------ 594
           +L+L+ N FTG LP S S +  L  L+VS N L G +            + F S      
Sbjct: 180 QLDLSRNSFTGVLPQSFSSLKNLLTLDVSSNYLTGPIPPGLGALSKLIHLNFSSNSFSSP 239

Query: 595 -------LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV---LANLPL 744
                  L NL   D S NSL+G++PQ    L+ ++ M + +N+ +GT+ V    A   L
Sbjct: 240 IPSELGDLVNLVDFDLSINSLSGSVPQELRKLSKLQLMAIGDNLLSGTLPVDLFSAESQL 299

Query: 745 DNLNVENNHFTGWIP 789
             L +  N F+G +P
Sbjct: 300 QTLVLRENGFSGSLP 314



 Score = 39.7 bits (91), Expect = 0.073
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 5/105 (4%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKS-VTTFDISTNNLGNSLP---YQLPPNVQKLNLAGNGFTGGLPYSIS 519
           L+G++   L   +S + T  +  N    SLP   + LP  ++ L++A N FTG LPYS  
Sbjct: 284 LSGTLPVDLFSAESQLQTLVLRENGFSGSLPDVCWSLP-KLRILDIAKNNFTGLLPYSSY 342

Query: 520 QMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
               + E +++S N   GE+T +   L     +D S N   G +P
Sbjct: 343 DSDQIAEMVDISSNTFYGELTPI---LRRFRIMDLSGNYFEGKLP 384



>pir|T02565|T02565 disease resistance protein homolog At2g32660
           [imported] - Arabidopsis thaliana>gb:AC003974_1531263
           Arabidopsis thaliana chromosome 2 clone F24L7 map TEn5,
           complete sequence.>gb:AC004681_1532039 Arabidopsis
           thaliana chromosome 2 clone T26B15 map TEn5, complete
           sequence.
          Length = 771

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 60/182 (32%), Positives = 99/182 (54%), Gaps = 9/182 (4%)
 Frame = +1

Query: 292 WKGVSCSGNR--VTEIQISGLQLTGSM--GFQLDQLKSVTTFDISTNNLGNS---LPYQL 450
           + GV C      VT +++ G  L G++     L +L  +   ++S NN  +S     +  
Sbjct: 51  FSGVVCDNTTGAVTVLELPGGCLRGTLRPNSSLFELSHLRYLNLSFNNFDSSPLSSAFGQ 110

Query: 451 PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
             N++ L L+ NGFTG +P SI  +  L  LN+ HN+L G++  +  +LT L  LD S+N
Sbjct: 111 LNNLEVLLLSSNGFTGQVPSSIRNLTKLTQLNLPHNKLTGDLPSLVQNLTKLLALDLSYN 170

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVL-ANLPLDNLNVENNHF-TGWIPPQLQG 804
             +G IP +F ++  +  + L  N  TG+ ++  ++  L+NLN+ NNHF T  I P L+ 
Sbjct: 171 QFSGTIPSSFFTMPFLSYLDLSENHLTGSFEISNSSSKLENLNLGNNHFETEIIDPVLRL 230

Query: 805 IN 810
           +N
Sbjct: 231 VN 232



 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 6/122 (4%)
 Frame = +1

Query: 367 GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ------KLNLAGNGFTGGLPYSISQMA 528
           G  ++Q K V TF  + +  GN L  ++P ++        LNL+ N FTG +P S + + 
Sbjct: 579 GLYMEQGK-VLTFYSAIDFSGNKLEGEIPESIGLLKTLIALNLSNNSFTGHIPMSFANVT 637

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            LE L++S N+L GE+      L+ L+ +D S N L G IPQ    +   K+ +  N+  
Sbjct: 638 ELESLDLSGNKLSGEIPQELGRLSYLAYIDVSDNQLTGKIPQGTQIIGQPKSSFEGNSGL 697

Query: 709 TG 714
            G
Sbjct: 698 CG 699



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 6/151 (3%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL 534
           TG +   +    S+   D+S NN   S+P  +  N   +NL  N   G +P      A  
Sbjct: 388 TGDIPLSVCNRTSLDVLDLSYNNFTGSIPPCMG-NFTIVNLRKNKLEGNIPDEFYSGALT 446

Query: 535 EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
           + L+V +NQL GE+    ++ + +  L    N +  + P    +L N+K + L++N F G
Sbjct: 447 QTLDVGYNQLTGELPRSLLNCSFIRFLSVDHNRINDSFPLWLKALPNLKVLTLRSNSFHG 506

Query: 715 TI------DVLANLPLDNLNVENNHFTGWIP 789
            +        LA   L  L + +N FTG +P
Sbjct: 507 PMSPPDDQSSLAFPKLQILEISHNRFTGSLP 537



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 56/222 (25%), Positives = 88/222 (39%), Gaps = 53/222 (23%)
 Frame = +1

Query: 310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAG 483
            SG     + +   QLTG +   L     +    +  N + +S P  L   PN++ L L  
Sbjct: 442  SGALTQTLDVGYNQLTGELPRSLLNCSFIRFLSVDHNRINDSFPLWLKALPNLKVLTLRS 501

Query: 484  NGFTGGL--PYSISQMA--PLEYLNVSHNQLQGEVTVMFVS------------------- 594
            N F G +  P   S +A   L+ L +SHN+  G +   + +                   
Sbjct: 502  NSFHGPMSPPDDQSSLAFPKLQILEISHNRFTGSLPTNYFANWSVKSLKMYDEERLYMGD 561

Query: 595  --------------------------LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ 696
                                      LT  S +DFS N L G IP++   L  +  + L 
Sbjct: 562  YSSDRFVYEDTLDLQYKGLYMEQGKVLTFYSAIDFSGNKLEGEIPESIGLLKTLIALNLS 621

Query: 697  NNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
            NN FTG I +  AN+  L++L++  N  +G IP +L  ++ L
Sbjct: 622  NNSFTGHIPMSFANVTELESLDLSGNKLSGEIPQELGRLSYL 663



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 5/171 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQL---KSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF 492
           +  + +S    TG  G  LD +    SV   DI+ N+   S P   P ++  L+   N F
Sbjct: 330 LVSLDLSNNSFTGFNG-SLDHVLANSSVQVLDIALNSFKGSFPNP-PVSIINLSAWNNSF 387

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P S+     L+ L++S+N   G +      + N + ++   N L GNIP  F S  
Sbjct: 388 TGDIPLSVCNRTSLDVLDLSYNNFTGSIP---PCMGNFTIVNLRKNKLEGNIPDEFYSGA 444

Query: 673 NMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
             + + +  N  TG +   +L    +  L+V++N      P  L+ + +L+
Sbjct: 445 LTQTLDVGYNQLTGELPRSLLNCSFIRFLSVDHNRINDSFPLWLKALPNLK 495



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 4/102 (3%)
 Frame = +1

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           ++ S N+L+GE+      L  L  L+ S NS  G+IP +F+++T ++++ L  N  +G I
Sbjct: 594 IDFSGNKLEGEIPESIGLLKTLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLSGEI 653

Query: 721 -DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTG--GNS 834
              L  L  L  ++V +N  TG IP   Q I   ++   GNS
Sbjct: 654 PQELGRLSYLAYIDVSDNQLTGKIPQGTQIIGQPKSSFEGNS 695



 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 51/161 (31%), Positives = 72/161 (44%), Gaps = 10/161 (6%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQLP-----PNVQKLNLAGNGFTGGLPYS-ISQMAPLEYLN 546
           L+ V    +S + L  S P  L       ++  L+L GN  T    YS I     +E L 
Sbjct: 228 LRLVNLRYLSLSFLNTSHPIDLSIFSPLQSLTHLDLHGNSLTLTSVYSDIDFPKNMEILL 287

Query: 547 VSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT---GT 717
           +S   +  E      SL  L  LD S N + GN+P    SL  + ++ L NN FT   G+
Sbjct: 288 LSGCNIS-EFPRFLKSLKKLWYLDLSSNRIKGNVPDWIWSLPLLVSLDLSNNSFTGFNGS 346

Query: 718 ID-VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW 837
           +D VLAN  +  L++  N F G  P     I +L    NS+
Sbjct: 347 LDHVLANSSVQVLDIALNSFKGSFPNPPVSIINLSAWNNSF 387



>pir|T18536|T18536 receptor-like protein kinase - Ipomoea nil
           (Japanese morning glory)
          Length = 1109

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 56/199 (28%), Positives = 102/199 (51%), Gaps = 6/199 (3%)
 Frame = +1

Query: 238 PPQLTK-WTANGGDPCGESWKGVSCSGNR-VTEIQISGLQLTGSMGFQLDQLKSVTTFDI 411
           P  +T+ W A+   PC  SW GV C   + V  + +S   ++G  G ++  LK +    +
Sbjct: 42  PSDITQSWNASDSTPC--SWLGVECDRRQFVDTLNLSSYGISGEFGPEISHLKHLKKVVL 99

Query: 412 STNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM 585
           S N    S+P QL     ++ ++L+ N FTG +P ++  +  L  L++  N L G     
Sbjct: 100 SGNGFFGSIPSQLGNCSLLEHIDLSSNSFTGNIPDTLGALQNLRNLSLFFNSLIGPFPES 159

Query: 586 FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNV 759
            +S+ +L T+ F+ N L G+IP    +++ +  ++L +N F+G +   L N+  L  L +
Sbjct: 160 LLSIPHLETVYFTGNGLNGSIPSNIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYL 219

Query: 760 ENNHFTGWIPPQLQGINSL 816
            +N+  G +P  L  + +L
Sbjct: 220 NDNNLVGTLPVTLNNLENL 238



 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 55/152 (36%), Positives = 76/152 (50%), Gaps = 6/152 (3%)
 Frame = +1

Query: 403 FDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
           FD+S NN    +P  L    NV  + L+ N  +G +P  +  +  LE+LN+SHN L+G +
Sbjct: 504 FDLSGNNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGIL 563

Query: 577 TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDN 750
                +   LS LD S N L G+IP T  SLT +  + L  N F+G I   +  +  L N
Sbjct: 564 PSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLN 623

Query: 751 LNVENNHFTGWIPP--QLQGINSLQTGGNSWN 840
           L +  N   G IPP   LQ + SL    N  N
Sbjct: 624 LQLGGNLLAGDIPPVGALQALRSLNLSSNKLN 655



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 47/153 (30%), Positives = 79/153 (51%), Gaps = 4/153 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
           L+G +     QL  + T  ++ N+    +P +L    ++  L L  N   G +P  +  +
Sbjct: 296 LSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGML 355

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L+YL++  N L GEV +    + +L +L    N+L+G +P   + L  + ++ L  N 
Sbjct: 356 SQLQYLHLYTNNLSGEVPLSIWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENH 415

Query: 706 FTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
           FTG I  D+ AN  L+ L++  N FTG IPP L
Sbjct: 416 FTGVIPQDLGANSSLEVLDLTRNMFTGHIPPNL 448



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 46/166 (27%), Positives = 77/166 (46%), Gaps = 4/166 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           +  +G  L GS+   +  +  +TT  +  N     +P  L     +Q+L L  N   G L
Sbjct: 169 VYFTGNGLNGSIPSNIGNMSELTTLWLDDNQFSGPVPSSLGNITTLQELYLNDNNLVGTL 228

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P +++ +  L YL+V +N L G + + FVS   + T+  S N   G +P    + T+++ 
Sbjct: 229 PVTLNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTISLSNNQFTGGLPPGLGNCTSLRE 288

Query: 685 MYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL 816
               +   +G I         LD L +  NHF+G IPP+L    S+
Sbjct: 289 FGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIPPELGKCKSM 334



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 54/178 (30%), Positives = 92/178 (51%), Gaps = 6/178 (3%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
            ++  + +S   L G +  +L     ++  D S N L  S+P  L     + KL+L  N F
Sbjct: 548  KLEHLNLSHNILKGILPSELSNCHKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSF 607

Query: 493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            +GG+P S+ Q   L  L +  N L G++  +  +L  L +L+ S N L G +P     L 
Sbjct: 608  SGGIPTSLFQSNKLLNLQLGGNLLAGDIPPVG-ALQALRSLNLSSNKLNGQLPIDLGKLK 666

Query: 673  NMKNMYLQNNVFTGTIDVLANLP-LDNLNVENNHFTGWIPPQL-QGINSLQT--GGNS 834
             ++ + + +N  +GT+ VL+ +  L  +N+ +N F+G +PP L + +NS  T   GNS
Sbjct: 667  MLEELDVSHNNLSGTLRVLSTIQSLTFINISHNLFSGPVPPSLTKFLNSSPTSFSGNS 724



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 6/179 (3%)
 Frame = +1

Query: 304 SCSGNRVT--EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKL 471
           S  GN  T  E+ ++   L G++   L+ L+++   D+  N+L  ++P        +  +
Sbjct: 206 SSLGNITTLQELYLNDNNLVGTLPVTLNNLENLVYLDVRNNSLVGAIPLDFVSCKQIDTI 265

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L+ N FTGGLP  +     L         L G +   F  LT L TL  + N  +G IP
Sbjct: 266 SLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGPIPSCFGQLTKLDTLYLAGNHFSGRIP 325

Query: 652 QTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT 822
                  +M ++ LQ N   G I     +   L  L++  N+ +G +P  +  I SLQ+
Sbjct: 326 PELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPLSIWKIQSLQS 384



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 50/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 301 VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLN 474
           VSC   ++  I +S  Q TG +   L    S+  F   +  L   +P  +     +  L 
Sbjct: 257 VSCK--QIDTISLSNNQFTGGLPPGLGNCTSLREFGAFSCALSGPIPSCFGQLTKLDTLY 314

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           LAGN F+G +P  + +   +  L +  NQL+GE+      L+ L  L    N+L+G +P 
Sbjct: 315 LAGNHFSGRIPPELGKCKSMIDLQLQQNQLEGEIPGELGMLSQLQYLHLYTNNLSGEVPL 374

Query: 655 TFSSLTNMKNMYLQNNVFTGT--IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +   + +++++ L  N  +G   +D+     L +L +  NHFTG IP  L   +SL+
Sbjct: 375 SIWKIQSLQSLQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIPQDLGANSSLE 431



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 27/189 (14%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGL 504
           +Q+    L+G +   + +LK + +  +  N+    +P  L  N  ++ L+L  N FTG +
Sbjct: 385 LQLYQNNLSGELPVDMTELKQLVSLALYENHFTGVIPQDLGANSSLEVLDLTRNMFTGHI 444

Query: 505 PYSISQMAPLEYLNVSHNQLQGEV-----------------------TVMFVSLTNLSTL 615
           P ++     L+ L + +N L+G V                          FV   NL   
Sbjct: 445 PPNLCSQKKLKRLLLGYNYLEGSVPSDLGGCSTLERLILEENNLRGGLPDFVEKQNLLFF 504

Query: 616 DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIP 789
           D S N+  G IP +  +L N+  +YL +N  +G+I  ++ + + L++LN+ +N   G +P
Sbjct: 505 DLSGNNFTGPIPPSLGNLKNVTAIYLSSNQLSGSIPPELGSLVKLEHLNLSHNILKGILP 564

Query: 790 PQLQGINSL 816
            +L   + L
Sbjct: 565 SELSNCHKL 573



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 44/171 (25%), Positives = 75/171 (43%), Gaps = 25/171 (14%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--------------------GNS 435
            ++++E+  S   L GS+   L  L  +T   +  N+                     GN 
Sbjct: 571  HKLSELDASHNLLNGSIPSTLGSLTELTKLSLGENSFSGGIPTSLFQSNKLLNLQLGGNL 630

Query: 436  LPYQLPP-----NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
            L   +PP      ++ LNL+ N   G LP  + ++  LE L+VSHN L G + V+  ++ 
Sbjct: 631  LAGDIPPVGALQALRSLNLSSNKLNGQLPIDLGKLKMLEELDVSHNNLSGTLRVL-STIQ 689

Query: 601  NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL 753
            +L+ ++ S N  +G +P + +   N          F+G  D+  N P D L
Sbjct: 690  SLTFINISHNLFSGPVPPSLTKFLNS-----SPTSFSGNSDLCINCPADGL 735



>pir|B84659|B84659 probable receptor-like protein kinase, ERECTA
           [imported] - Arabidopsis thaliana>gb:AC004484_1531781
           Arabidopsis thaliana chromosome 2 clone T1D16 map B68,
           complete sequence.>gb:ATHER_1553162 Arabidopsis thaliana
           DNA for receptor protein kinase, complete
           cds.>gb:ATU47029_1557030 Arabidopisis thaliana ERECTA
           mRNA, complete cds.>gb:AY035110_1559881 Arabidopsis
           thaliana putative receptor protein kinase, ERECTA
           (At2g26330) mRNA, complete cds.
          Length = 976

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 72/243 (29%), Positives = 114/243 (46%), Gaps = 8/243 (3%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ-LTKWTAN-GGDPCGESWKGVSC 309
           +L+GFL     S VA     + + L  +  S       L  WT +   D C   W+GVSC
Sbjct: 8   VLLGFLFCL--SLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYC--VWRGVSC 63

Query: 310 SGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNL 477
                 V  + +S L L G +   +  LKS+ + D+  N L   +P ++    ++Q L+L
Sbjct: 64  ENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDL 123

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           + N  +G +P+SIS++  LE L + +NQL G +      + NL  LD + N L+G IP+ 
Sbjct: 124 SFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRL 183

Query: 658 FSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
                 ++ + L+ N   G I  D+     L   +V NN  TG IP  +    + Q    
Sbjct: 184 IYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDL 243

Query: 832 SWN 840
           S+N
Sbjct: 244 SYN 246



 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 51/163 (31%), Positives = 90/163 (55%), Gaps = 3/163 (1%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAG 483
           S   +  + + G + +G++     +L+S+T  ++S+NN+   +P +L    N+  L+L+ 
Sbjct: 377 SCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSN 436

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N   G +P S+  +  L  +N+S N + G V   F +L ++  +D S N ++G IP+  +
Sbjct: 437 NKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELN 496

Query: 664 SLTNMKNMYLQNNVFTGTIDVLAN-LPLDNLNVENNHFTGWIP 789
            L N+  + L+NN  TG +  LAN L L  LNV +N+  G IP
Sbjct: 497 QLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIP 539



 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 54/172 (31%), Positives = 87/172 (50%), Gaps = 4/172 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +V  + + G QL+G +   +  ++++   D+S N L  S+P  L      +KL L  N  
Sbjct: 260 QVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKL 319

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  +  M+ L YL ++ N L G +      LT+L  L+ + N L G IP   SS T
Sbjct: 320 TGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCT 379

Query: 673 NMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT 822
           N+ ++ +  N F+GTI         +  LN+ +N+  G IP +L  I +L T
Sbjct: 380 NLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDT 431



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/166 (28%), Positives = 88/166 (53%), Gaps = 4/166 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           ++++   LTG +  +L +L  +   +++ N+L   +P  L    N+  LN+ GN F+G +
Sbjct: 336 LELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTI 395

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P +  ++  + YLN+S N ++G + V    + NL TLD S N + G IP +   L ++  
Sbjct: 396 PRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLK 455

Query: 685 MYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
           M L  N  TG +     NL  +  +++ NN  +G IP +L  + ++
Sbjct: 456 MNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNI 501



>gb:AP000607_1820463 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:T25O11.
          Length = 943

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 70/242 (28%), Positives = 115/242 (47%), Gaps = 12/242 (4%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSP-PQLTKWTANGGD 276
           M+E+MG+   + L++     +   A   T PTD S L+ +   L  P   L  W     D
Sbjct: 1   MKEMMGVV-GIILVVSSCCLSLLDAQEITHPTDVSALQYVHRKLKDPLNHLQDWKKT--D 57

Query: 277 PCGESWKGVSCSGN------RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
           PC  +W GV C  +       V E+ +SG QLTGS+  +L  L ++    I  N +   L
Sbjct: 58  PCASNWTGVICIPDPSDGFLHVKELLLSGNQLTGSLPQELGSLSNLLILQIDYNEISGKL 117

Query: 439 PYQLPPNVQKL---NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
           P  L  N++KL   ++  N  TG +P   S +  + +  + +N+L G +      + +L 
Sbjct: 118 PTSL-ANLKKLKHFHMNNNSITGQIPPEYSTLTNVLHFLMDNNKLTGNLPPELAQMPSLR 176

Query: 610 TLDFSFNSLAG-NIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLPLDNLNVENNHFTGW 783
            L    ++  G  IP ++ S+ N+  + L+N    G I D+  +L L  L++ +N  TG 
Sbjct: 177 ILQLDGSNFDGTEIPSSYGSIPNLVKLSLRNCNLEGPIPDLSKSLVLYYLDISSNKLTGE 236

Query: 784 IP 789
           IP
Sbjct: 237 IP 238



 Score = 41.2 bits (95), Expect = 0.025
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 3/73 (4%)
 Frame = +1

Query: 379 DQLKSVTTF--DISTNNLGNSLPY-QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNV 549
           D  KS+  +  DIS+N L   +P  +   N+  +NL  N  +G +P + S +  L+ L V
Sbjct: 216 DLSKSLVLYYLDISSNKLTGEIPKNKFSANITTINLYNNLLSGSIPSNFSGLPRLQRLQV 275

Query: 550 SHNQLQGEVTVMF 588
            +N L GE+ V++
Sbjct: 276 QNNNLSGEIPVIW 288



>gb:AC093952_1736170 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1004_E02, complete sequence.
          Length = 909

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 56/182 (30%), Positives = 99/182 (54%), Gaps = 11/182 (6%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTN-NLGNSLPYQLPP--NVQKLNL 477
           C+  RVT +++S + L G++   + QL  +T  D+S N NLG  LP ++     +  L L
Sbjct: 2   CTNGRVTTLRLSSVSLQGTLSSSIGQLGQLTYLDLSFNINLGGPLPAEIGNLGELTTLIL 61

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           AG  FTG +P +I  +  L +L ++ N+  G +      LTNL  LD + N L G++P +
Sbjct: 62  AGCSFTGNIPIAIGNLRKLGFLALNSNKFSGGIPSSIGVLTNLLWLDLADNQLTGSVPIS 121

Query: 658 FSS------LTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWIPPQLQGINS 813
            S+      L   ++ +   N  TGT+  L  +N+ L ++  ++N F+G IP ++  +++
Sbjct: 122 TSTSPGLDQLVKTQHFHFNKNQLTGTLTGLFNSNMTLIHILFDSNKFSGSIPAEVGTVST 181

Query: 814 LQ 819
           L+
Sbjct: 182 LE 183



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 47/185 (25%), Positives = 90/185 (48%), Gaps = 12/185 (6%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T + ++G   TG++   +  L+ +    +++N     +P  +    N+  L+LA N  T
Sbjct: 56  LTTLILAGCSFTGNIPIAIGNLRKLGFLALNSNKFSGGIPSSIGVLTNLLWLDLADNQLT 115

Query: 496 GGLPYSIS------QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           G +P S S      Q+   ++ + + NQL G +T +F S   L  + F  N  +G+IP  
Sbjct: 116 GSVPISTSTSPGLDQLVKTQHFHFNKNQLTGTLTGLFNSNMTLIHILFDSNKFSGSIPAE 175

Query: 658 FSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIP--PQLQGINSLQTG 825
             +++ ++ + L  N FTG I       + L+ LN+ NN  TG +P    +  +N +   
Sbjct: 176 VGTVSTLEVLRLDRNGFTGAIPATIGSLVKLNELNLANNKLTGSVPDLSNMTNLNVVDLS 235

Query: 826 GNSWN 840
            N+++
Sbjct: 236 NNTFD 240



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 43/168 (25%), Positives = 80/168 (47%), Gaps = 28/168 (16%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           QLTG++    +   ++      +N    S+P ++     ++ L L  NGFTG +P +I  
Sbjct: 143 QLTGTLTGLFNSNMTLIHILFDSNKFSGSIPAEVGTVSTLEVLRLDRNGFTGAIPATIGS 202

Query: 523 MAPLEYLNVSHNQLQGEVTVM------------------------FVSLTNLSTLDFSFN 630
           +  L  LN+++N+L G V  +                        F SLT+L+++     
Sbjct: 203 LVKLNELNLANNKLTGSVPDLSNMTNLNVVDLSNNTFDPSVAPSWFTSLTSLASVSIVSG 262

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENN 768
           SL+G +P+   +L  ++ + L NN F GT+++  N+   L  +N+ +N
Sbjct: 263 SLSGQVPKGLFTLPTLQQVVLSNNQFNGTLEITGNISSSLQTVNLMDN 310



>gb:AY065068_1566222 Arabidopsis thaliana AT4g37250/C7A10_110 mRNA,
           complete cds.>gb:BT002237_1635840 Arabidopsis thaliana
           At4g37250/C7A10_110 mRNA, complete cds.
          Length = 768

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 72/231 (31%), Positives = 107/231 (46%), Gaps = 25/231 (10%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGS 363
           +D  VL    SS+   P   L  W      PC  SW+G+SC+ + +V  + +   QL GS
Sbjct: 24  SDGLVLMKFKSSVLVDPLSLLQTWNYKHESPC--SWRGISCNNDSKVLTLSLPNSQLLGS 81

Query: 364 MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL 543
           +                 ++LG+ L       +Q L+L+ N F G LP S      L +L
Sbjct: 82  I----------------PSDLGSLL------TLQSLDLSNNSFNGPLPVSFFNARELRFL 119

Query: 544 NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI- 720
           ++S N + GE+      L NL TL+ S N+LAG +P   +SL N+  + L+NN F+G I 
Sbjct: 120 DLSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNYFSGEIP 179

Query: 721 ---------DVLANL------------PLDNLNVENNHFTGWIPPQLQGIN 810
                    D+ +NL             L  LNV  N  +G IPP++ G+N
Sbjct: 180 GGWRVVEFLDLSSNLINGSLPPDFGGYSLQYLNVSFNQISGEIPPEI-GVN 229



>gb:AX093392_1461116 Sequence 11 from Patent WO0118061.
          Length = 1059

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 74/260 (28%), Positives = 117/260 (45%), Gaps = 20/260 (7%)
 Frame = +1

Query: 121 PWAVALLIGFLLNAPPSAVADTDP----------TDASVLRGLFSSLNSP-PQLTKWTAN 267
           P  + LL+ ++L   P++ A              TD   L    +SL+   P L  W   
Sbjct: 3   PSILLLLLPYVLQLMPTSFAQVSTLPLPFGNETATDRDALLQFKASLSQQSPTLVSWNKT 62

Query: 268 GGDPCGESWKGVSCS---GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
             D C   W GV+CS     RV+ + +S   L GS+   +  L  +   D+S+NNL   +
Sbjct: 63  S-DFC--HWTGVTCSLRHKGRVSALNLSSAGLVGSLSPAIGNLTFLKILDLSSNNLQGGI 119

Query: 439 PYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLST 612
           P  +     +Q L   GN   GG+   +S    L  + + +N L GE+         L+ 
Sbjct: 120 PSTIGRLRRLQYLVFTGNSLHGGITDGLSNCTGLVIIFLGNNHLTGEIPSWLGGFPKLAA 179

Query: 613 LDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTG 780
           LD S N+L G+IP +  +LT+++ +YLQ N   G+I      L N+    L V  NH +G
Sbjct: 180 LDLSKNNLTGSIPPSLGNLTSLQELYLQINQLEGSIPKELGRLKNVQWFALFV--NHLSG 237

Query: 781 WIPPQLQGINSLQTGGNSWN 840
            +P  +  ++S+   G   N
Sbjct: 238 EVPEAVFNLSSVVAFGVDQN 257



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/166 (29%), Positives = 81/166 (48%), Gaps = 1/166 (0%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-YQLPPNVQKLNLAGNGFTGGLP 507
           + +S     GS+  ++ +L  +   +IS NNL  SLP      ++ +L+L GN F+G LP
Sbjct: 501 LDLSDNLFNGSLPPEVGRLTKLVYLNISRNNLSGSLPDLSNCQSLLQLHLDGNSFSGSLP 560

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
            SI++M  L  LN++ N L G +   F  +  L  L  + N+L+G IP T  ++T+    
Sbjct: 561 ASITEMYGLVVLNLTENSLSGAIPQEFGRMKGLEELYLAHNNLSGQIPTTLQNMTS---- 616

Query: 688 YLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTG 825
                             L  L++  NH +G +P  +QG+ +  TG
Sbjct: 617 ------------------LSQLDISFNHLSGQVP--MQGVFAKSTG 642



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 2/139 (1%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++  + IS   L+GS+   L   +S+    +  N+   SLP  +     +  LNL  N  
Sbjct: 521 KLVYLNISRNNLSGSLP-DLSNCQSLLQLHLDGNSFSGSLPASITEMYGLVVLNLTENSL 579

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +G +P    +M  LE L ++HN L G++     ++T+LS LD SFN L+G +P       
Sbjct: 580 SGAIPQEFGRMKGLEELYLAHNNLSGQIPTTLQNMTSLSQLDISFNHLSGQVPMQGVFAK 639

Query: 673 NMKNMYLQNNVFTGTIDVL 729
           +   +++ N+   G +  L
Sbjct: 640 STGFLFVGNDRLCGGVQEL 658



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 52/188 (27%), Positives = 86/188 (45%), Gaps = 11/188 (5%)
 Frame = +1

Query: 286 ESWKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP- 456
           E W+ V+   N  R+  +      L G +   +  L S     + T    N +   +PP 
Sbjct: 337 EGWEFVTLLTNCTRLRVLSFRNNMLAGELPPSVGNLSSTHLQVLYTG--WNEIYGNIPPG 394

Query: 457 -----NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF 621
                N+QKL L+ N FTG LP +I ++  +  L +  N L G +     +LT L  +  
Sbjct: 395 ISNLVNLQKLFLSQNHFTGALPNTIGRLKMMRALGIDGNLLSGTIPPSIGNLTLLQIITM 454

Query: 622 SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLPLDN--LNVENNHFTGWIPP 792
             N+L G++P + S+L  +    L  N F G I   + NL   +  L++ +N F G +PP
Sbjct: 455 DNNNLEGSLPSSISNLQMLSIATLSRNAFAGPIPKQIFNLSSLSYILDLSDNLFNGSLPP 514

Query: 793 QLQGINSL 816
           ++  +  L
Sbjct: 515 EVGRLTKL 522



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 50/203 (24%), Positives = 86/203 (42%), Gaps = 40/203 (19%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL---PPNVQKLNLAGNGFTGGLPYSISQ 522
           L+G +   +  L SV  F +  N+L  +LP       P+++ + LA N FTG +P S++ 
Sbjct: 235 LSGEVPEAVFNLSSVVAFGVDQNDLHGTLPSNWGNNQPDLEFIYLAINHFTGNVPASLAN 294

Query: 523 MAPLEYLNVSHNQLQG-----------------------------EVTVMFVSLTNLSTL 615
              ++ +++S N   G                             E   +  + T L  L
Sbjct: 295 ATMMDTIDLSVNNFTGRMPPEIGTLCPRIFSFDSNQIEASATEGWEFVTLLTNCTRLRVL 354

Query: 616 DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP--------LDNLNVENNH 771
            F  N LAG +P    S+ N+ + +LQ  ++TG  ++  N+P        L  L +  NH
Sbjct: 355 SFRNNMLAGELPP---SVGNLSSTHLQV-LYTGWNEIYGNIPPGISNLVNLQKLFLSQNH 410

Query: 772 FTGWIPPQLQGINSLQTGGNSWN 840
           FTG +P  +  +  ++  G   N
Sbjct: 411 FTGALPNTIGRLKMMRALGIDGN 433



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 47/183 (25%), Positives = 79/183 (43%), Gaps = 12/183 (6%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGG 501
           E+ +   QL GS+  +L +LK+V  F +  N+L   +P  +    +V    +  N   G 
Sbjct: 203 ELYLQINQLEGSIPKELGRLKNVQWFALFVNHLSGEVPEAVFNLSSVVAFGVDQNDLHGT 262

Query: 502 LPYSISQMAP-LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
           LP +     P LE++ ++ N   G V     + T + T+D S N+  G +P    +L   
Sbjct: 263 LPSNWGNNQPDLEFIYLAINHFTGNVPASLANATMMDTIDLSVNNFTGRMPPEIGTLCPR 322

Query: 679 KNMYLQNNVFTGT------IDVLANLP-LDNLNVENNHFTGWIPPQLQGINS--LQTGGN 831
              +  N +          + +L N   L  L+  NN   G +PP +  ++S  LQ    
Sbjct: 323 IFSFDSNQIEASATEGWEFVTLLTNCTRLRVLSFRNNMLAGELPPSVGNLSSTHLQVLYT 382

Query: 832 SWN 840
            WN
Sbjct: 383 GWN 385



>pir|T46070|T46070 hypothetical protein T18N14.120 - Arabidopsis
           thaliana>gb:ATT18N14_1554791 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T18N14.>gb:AY054515_1563169
           Arabidopsis thaliana putative protein (At3g51740;
           T18N14.120) mRNA, complete cds.>gb:BT006350_1639237
           Arabidopsis thaliana At3g51740/T18N14_120 gene, complete
           cds.>gb:AF372978_1792690 Arabidopsis thaliana
           AT3g51740/T18N14_120 mRNA, complete cds.
          Length = 836

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 55/172 (31%), Positives = 97/172 (56%), Gaps = 5/172 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN---VQKLNLAGNG 489
           R+  + +S   L+G +   + +  ++T  D+  NNL  S+P         ++ LNL  N 
Sbjct: 191 RLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNR 250

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           F+G +P S+ + + LE +++SHNQL G +      L +L +LDFS+NS+ G IP +FS+L
Sbjct: 251 FSGAVPVSLCKHSLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSINGTIPDSFSNL 310

Query: 670 TNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++ ++ L++N   G I D +  L  L  LN++ N   G IP  +  I+ ++
Sbjct: 311 SSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKINGPIPETIGNISGIK 362



 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 54/189 (28%), Positives = 93/189 (49%), Gaps = 5/189 (2%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +        W G+ C   +V  IQ+    L G++  ++ QL S+    +  N +
Sbjct: 71  LKSWNNSASSQVCSGWAGIKCLRGQVVAIQLPWKGLGGTISEKIGQLGSLRKLSLHNNVI 130

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
             S+P  L    +++ + L  N  +G +P S+     L+ L++S NQL G +       T
Sbjct: 131 AGSVPRSLGYLKSLRGVYLFNNRLSGSIPVSLGNCPLLQNLDLSSNQLTGAIPPSLTEST 190

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID---VLANLPLDNLNVENNH 771
            L  L+ SFNSL+G +P + +    +  + LQ+N  +G+I    V  + PL  LN+++N 
Sbjct: 191 RLYRLNLSFNSLSGPLPVSVARSYTLTFLDLQHNNLSGSIPDFFVNGSHPLKTLNLDHNR 250

Query: 772 FTGWIPPQL 798
           F+G +P  L
Sbjct: 251 FSGAVPVSL 259



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 52/166 (31%), Positives = 85/166 (51%), Gaps = 5/166 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           + +G++   L +   +    IS N L  S+P +    P++Q L+ + N   G +P S S 
Sbjct: 250 RFSGAVPVSLCKHSLLEEVSISHNQLSGSIPRECGGLPHLQSLDFSYNSINGTIPDSFSN 309

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           ++ L  LN+  N L+G +      L NL+ L+   N + G IP+T  +++ +K + L  N
Sbjct: 310 LSSLVSLNLESNHLKGPIPDAIDRLHNLTELNLKRNKINGPIPETIGNISGIKKLDLSEN 369

Query: 703 VFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQL-QGINSLQTGGN 831
            FTG I + L +L  L + NV  N  +G +PP L +  NS    GN
Sbjct: 370 NFTGPIPLSLVHLAKLSSFNVSYNTLSGPVPPVLSKKFNSSSFLGN 415



>pir|T45718|T45718 receptor-kinase like protein - Arabidopsis
           thaliana>gb:ATF1P2_1549428 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F1P2.>gb:AY059729_1564587
           Arabidopsis thaliana putative receptor kinase
           (At3g47580) mRNA, complete cds.>gb:BT001976_1635579
           Arabidopsis thaliana clone U10482 putative receptor
           kinase (At3g47580) mRNA, complete cds.
          Length = 1011

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 69/236 (29%), Positives = 116/236 (49%), Gaps = 8/236 (3%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSC 309
           LL+ F  +    A   TD TD   L    S ++   +  L+ W  N    C  +WK V+C
Sbjct: 5   LLLSFSAHLLLGADGFTDETDRQALLEFKSQVSEGKRDVLSSWN-NSFPLC--NWKWVTC 61

Query: 310 SGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNL 477
                RVT + + GLQL G +   +  +  + + D+S N  G  +P ++     ++ L +
Sbjct: 62  GRKHKRVTHLNLGGLQLGGIVSPSIGNVSFLISLDLSDNAFGGIIPREVGNLFRLEHLYM 121

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           A N   GG+P ++S  + L  L++  N L+  V     SLT L  LD   N+L G +P++
Sbjct: 122 AFNSLEGGIPATLSNCSRLLNLDLYSNPLRQGVPSELGSLTKLVILDLGRNNLKGKLPRS 181

Query: 658 FSSLTNMKNM-YLQNNVFTGTIDVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
             +LT++K++ +  NN+     D LA L  +  L +  N F G  PP +  +++L+
Sbjct: 182 LGNLTSLKSLGFTDNNIEGEVPDELARLSQMVGLGLSMNKFFGVFPPAIYNLSALE 237



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 46/173 (26%), Positives = 84/173 (48%), Gaps = 6/173 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           +Q+    LTG +   L +L  +    + +N +   +P  +     ++ L L+ N F G +
Sbjct: 391 LQLGKNMLTGPLPTSLGKLLRLGLLSLYSNRMSGEIPSFIGNLTQLEILYLSNNSFEGIV 450

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P S+ + + +  L + +N+L G +    + +  L  L    NSL+G++P    SL N+  
Sbjct: 451 PPSLGKCSHMLDLRIGYNKLNGTIPKEIMQIPTLVNLSMEGNSLSGSLPNDIGSLQNLVK 510

Query: 685 MYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIP--PQLQGINSLQTGGN 831
           + L+NN F+G +   L N L ++ L ++ N F G IP    L G+  +    N
Sbjct: 511 LSLENNKFSGHLPQTLGNCLAMEQLFLQGNSFDGAIPNIRGLMGVRRVDLSNN 563



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 43/155 (27%), Positives = 67/155 (43%), Gaps = 8/155 (5%)
 Frame = +1

Query: 376 LDQLKSVT---TFDISTNNLGNSLPYQLP---PNVQKLNLAGNGFTGGLPYSISQMAPLE 537
           +D L + T      +    LG +LP  +      +  LNL GN F G +P  I  +  L+
Sbjct: 330 IDSLTNCTHLQLLSVGYTRLGGALPTSIANMSTELISLNLIGNHFFGSIPQDIGNLIGLQ 389

Query: 538 YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
            L +  N L G +      L  L  L    N ++G IP    +LT ++ +YL NN F G 
Sbjct: 390 RLQLGKNMLTGPLPTSLGKLLRLGLLSLYSNRMSGEIPSFIGNLTQLEILYLSNNSFEGI 449

Query: 718 IDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL 816
           +         + +L +  N   G IP ++  I +L
Sbjct: 450 VPPSLGKCSHMLDLRIGYNKLNGTIPKEIMQIPTL 484



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 37/142 (26%), Positives = 74/142 (52%), Gaps = 2/142 (1%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           + + +++I   +L G++  ++ Q+ ++    +  N+L  SLP  +    N+ KL+L  N 
Sbjct: 458 SHMLDLRIGYNKLNGTIPKEIMQIPTLVNLSMEGNSLSGSLPNDIGSLQNLVKLSLENNK 517

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           F+G LP ++     +E L +  N   G +  +   L  +  +D S N L+G+IP+ F++ 
Sbjct: 518 FSGHLPQTLGNCLAMEQLFLQGNSFDGAIPNIR-GLMGVRRVDLSNNDLSGSIPEYFANF 576

Query: 670 TNMKNMYLQNNVFTGTIDVLAN 735
           + ++ + L  N FTG +    N
Sbjct: 577 SKLEYLNLSINNFTGKVPSKGN 598



 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 45/141 (31%), Positives = 73/141 (51%), Gaps = 13/141 (9%)
 Frame = +1

Query: 448 LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSF 627
           L PN+++LNL  N   G +P ++S ++ L+   ++ N + G +   F  + +L  LD S 
Sbjct: 257 LLPNIRELNLGENDLVGAIPTTLSNISTLQKFGINKNMMTGGIYPNFGKVPSLQYLDLSE 316

Query: 628 NSLA----GNIPQTFSSLTNMKNMYLQNNVFT---GTIDV-LANL--PLDNLNVENNHFT 777
           N L     G++ +   SLTN  ++ L +  +T   G +   +AN+   L +LN+  NHF 
Sbjct: 317 NPLGSYTFGDL-EFIDSLTNCTHLQLLSVGYTRLGGALPTSIANMSTELISLNLIGNHFF 375

Query: 778 GWIPP---QLQGINSLQTGGN 831
           G IP     L G+  LQ G N
Sbjct: 376 GSIPQDIGNLIGLQRLQLGKN 396



>pir|B85440|B85440 receptor kinase-like protein [imported] -
           Arabidopsis thaliana>gb:ATAP21_1543972 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV87_1547680 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 87.
          Length = 766

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 72/231 (31%), Positives = 107/231 (46%), Gaps = 25/231 (10%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGS 363
           +D  VL    SS+   P   L  W      PC  SW+G+SC+ + +V  + +   QL GS
Sbjct: 22  SDGLVLMKFKSSVLVDPLSLLQTWNYKHESPC--SWRGISCNNDSKVLTLSLPNSQLLGS 79

Query: 364 MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL 543
           +                 ++LG+ L       +Q L+L+ N F G LP S      L +L
Sbjct: 80  I----------------PSDLGSLL------TLQSLDLSNNSFNGPLPVSFFNARELRFL 117

Query: 544 NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI- 720
           ++S N + GE+      L NL TL+ S N+LAG +P   +SL N+  + L+NN F+G I 
Sbjct: 118 DLSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNYFSGEIP 177

Query: 721 ---------DVLANL------------PLDNLNVENNHFTGWIPPQLQGIN 810
                    D+ +NL             L  LNV  N  +G IPP++ G+N
Sbjct: 178 GGWRVVEFLDLSSNLINGSLPPDFGGYSLQYLNVSFNQISGEIPPEI-GVN 227



>gb:AP005966_1860355 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863463 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 1087

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 66/249 (26%), Positives = 117/249 (46%), Gaps = 32/249 (12%)
 Frame = +1

Query: 166 PSAVADTDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCS---GNRVTEI 333
           P  +++    D   L    S +    + L  W+    + C  SW G++CS     RV  +
Sbjct: 25  PLVISNETENDRQALLCFKSQITGSAEVLASWSNASMEFC--SWHGITCSIQSPRRVIVL 82

Query: 334 QISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLP 507
            +S   +TG +   +  L  +T   +S N+   S+P ++     +  L+++ N   G +P
Sbjct: 83  DLSSEGITGCISPCIANLTDLTRLQLSNNSFRGSIPSEIGFLSKLSILDISMNSLEGNIP 142

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTL------------------------ 615
             ++  + L+ +++S+N+LQG +   F  LT L TL                        
Sbjct: 143 SELTSCSKLQEIDLSNNKLQGRIPSAFGDLTELQTLELASNKLSGYIPPSLGSNLSLTYV 202

Query: 616 DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIP 789
           D   N+L G IP++ +S  +++ + L NN  +G + V L N   L +L++E+NHFTG IP
Sbjct: 203 DLGRNALTGEIPESLASSKSLQVLVLMNNALSGQLPVALFNCSSLIDLDLEDNHFTGTIP 262

Query: 790 PQLQGINSL 816
             L  ++SL
Sbjct: 263 SSLGNLSSL 271



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 52/170 (30%), Positives = 87/170 (51%), Gaps = 5/170 (2%)
 Frame = +1

Query: 349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
            +L+G +   +  L  +   ++  NNL  S+P  +     ++ LNLA N   G +P  I +
Sbjct: 500  RLSGQIPGTIGNLVQLNELNLDGNNLSGSIPESIHHCAQLKTLNLAHNSLHGTIPVHIFK 559

Query: 523  MAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
            +  L E+L++SHN L G +     +L NL+ L  S N L+GNIP        ++++ LQ+
Sbjct: 560  IFSLSEHLDLSHNYLSGGIPQEVGNLINLNKLSISNNRLSGNIPSALGQCVILESLELQS 619

Query: 700  NVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            N   G I +  A L  ++ L++ +N  +G IP  L    SL     S+N+
Sbjct: 620  NFLEGIIPESFAKLQSINKLDISHNKLSGKIPEFLASFKSLINLNLSFNN 669



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 49/171 (28%), Positives = 84/171 (49%), Gaps = 5/171 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFT 495
           +T + +    LTG +   L   KS+    +  N L   LP  L    ++  L+L  N FT
Sbjct: 199 LTYVDLGRNALTGEIPESLASSKSLQVLVLMNNALSGQLPVALFNCSSLIDLDLEDNHFT 258

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  ++ L YL++  N L G +  +F  +  L TL  + N+L+G +P +  ++++
Sbjct: 259 GTIPSSLGNLSSLIYLSLIANNLVGTIPDIFDHVPTLQTLAVNLNNLSGPVPPSIFNISS 318

Query: 676 MKNMYLQNNVFTGTIDVLANLPLDNLN---VENNHFTGWIPPQLQGINSLQ 819
           +  + + NN  TG +       L N+    + NN F+G IP  L   + LQ
Sbjct: 319 LAYLGMANNSLTGRLPSKIGHMLPNIQELILLNNKFSGSIPVSLLNASHLQ 369



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 15/195 (7%)
 Frame = +1

Query: 292 WKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--- 456
           W  VS   N  R+TE+ + G  L G++   +  L S   +    NN    + + +PP   
Sbjct: 406 WSFVSSLSNCSRLTELMLDGNNLQGNLPSSIGNLSSSLEYLWLRNN---QISWLIPPGIG 462

Query: 457 NVQKLNLAG---NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSF 627
           N++ LN+     N  TG +P +I  +  L +L+ + N+L G++     +L  L+ L+   
Sbjct: 463 NLKSLNMLYMDYNYLTGNIPPTIGYLHNLVFLSFAQNRLSGQIPGTIGNLVQLNELNLDG 522

Query: 628 NSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQ 795
           N+L+G+IP++      +K + L +N   GTI V    + +L  ++L++ +N+ +G IP +
Sbjct: 523 NNLSGSIPESIHHCAQLKTLNLAHNSLHGTIPVHIFKIFSLS-EHLDLSHNYLSGGIPQE 581

Query: 796 ---LQGINSLQTGGN 831
              L  +N L    N
Sbjct: 582 VGNLINLNKLSISNN 596



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 50/164 (30%), Positives = 86/164 (52%), Gaps = 9/164 (5%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNGFTGGLPYSISQ 522
           L+G +   +  + S+    ++ N+L   LP ++    PN+Q+L L  N F+G +P S+  
Sbjct: 305 LSGPVPPSIFNISSLAYLGMANNSLTGRLPSKIGHMLPNIQELILLNNKFSGSIPVSLLN 364

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN---MKNMYL 693
            + L+ L++++N L G +  +F SL NL+ LD ++N L  N     SSL+N   +  + L
Sbjct: 365 ASHLQKLSLANNSLCGPIP-LFGSLQNLTKLDMAYNMLEANDWSFVSSLSNCSRLTELML 423

Query: 694 QNNVFTGTI-DVLANL--PLDNLNVENNHFTGWIPPQLQGINSL 816
             N   G +   + NL   L+ L + NN  +  IPP +  + SL
Sbjct: 424 DGNNLQGNLPSSIGNLSSSLEYLWLRNNQISWLIPPGIGNLKSL 467



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 2/107 (1%)
 Frame = +1

Query: 406 DISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           D+S N L   +P ++    N+ KL+++ N  +G +P ++ Q   LE L +  N L+G + 
Sbjct: 568 DLSHNYLSGGIPQEVGNLINLNKLSISNNRLSGNIPSALGQCVILESLELQSNFLEGIIP 627

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
             F  L +++ LD S N L+G IP+  +S  ++ N+ L  N F G +
Sbjct: 628 ESFAKLQSINKLDISHNKLSGKIPEFLASFKSLINLNLSFNNFYGPL 674



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 2/109 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGFTGGL 504
           + +S   L+G +  ++  L ++    IS N L  ++P  L   V  + L L  N   G +
Sbjct: 567 LDLSHNYLSGGIPQEVGNLINLNKLSISNNRLSGNIPSALGQCVILESLELQSNFLEGII 626

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           P S +++  +  L++SHN+L G++     S  +L  L+ SFN+  G +P
Sbjct: 627 PESFAKLQSINKLDISHNKLSGKIPEFLASFKSLINLNLSFNNFYGPLP 675



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 38/132 (28%), Positives = 55/132 (41%)
 Frame = +1

Query: 427 GNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL 606
           G +   Q P  V  L+L+  G TG +   I+ +  L  L +S+N  +G +      L+ L
Sbjct: 68  GITCSIQSPRRVIVLDLSSEGITGCISPCIANLTDLTRLQLSNNSFRGSIPSEIGFLSKL 127

Query: 607 STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWI 786
           S LD S NSL GNIP   +S +                       L  +++ NN   G I
Sbjct: 128 SILDISMNSLEGNIPSELTSCSK----------------------LQEIDLSNNKLQGRI 165

Query: 787 PPQLQGINSLQT 822
           P     +  LQT
Sbjct: 166 PSAFGDLTELQT 177



>gb:AB025639_1516701 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MWL2.
          Length = 630

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 49/166 (29%), Positives = 90/166 (54%), Gaps = 4/166 (2%)
 Frame = +1

Query: 193 TDASV-LRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM 366
           TD  V   G+ SSL  P   L  W     DPC  SW  ++CS   V  ++     L+G++
Sbjct: 35  TDKGVNFEGIKSSLTDPHGVLMNWDDTAVDPC--SWNMITCSDGFVIRLEAPSQNLSGTL 92

Query: 367 GFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEY 540
              +  L ++ T  +  N +  ++P+++     ++ L+L+ N FTG +P+++S    L+Y
Sbjct: 93  SSSIGNLTNLQTVLLQNNYITGNIPHEIGKLMKLKTLDLSTNNFTGQIPFTLSYSKNLQY 152

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
           L V++N L G +     ++T L+ LD S+N+L+G +P++ +   N+
Sbjct: 153 LRVNNNSLTGTIPSSLANMTQLTFLDLSYNNLSGPVPRSLAKTFNV 198



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 34/103 (33%), Positives = 45/103 (43%), Gaps = 2/103 (1%)
 Frame = +1

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           L      L G ++    +LTNL T+    N + GNIP     L  +K + L  N FTG I
Sbjct: 81  LEAPSQNLSGTLSSSIGNLTNLQTVLLQNNYITGNIPHEIGKLMKLKTLDLSTNNFTGQI 140

Query: 721 DVLANLP--LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
               +    L  L V NN  TG IP  L  +  L     S+N+
Sbjct: 141 PFTLSYSKNLQYLRVNNNSLTGTIPSSLANMTQLTFLDLSYNN 183



>pir|G86459|G86459 Hypothetical 55.6 kDa protein - Arabidopsis
           thaliana>gb:AE005172_892171 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069299_1540789 Arabidopsis thaliana
           chromosome 1 BAC T1E4 genomic sequence, complete
           sequence.
          Length = 512

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 49/154 (31%), Positives = 90/154 (58%), Gaps = 3/154 (1%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFT 495
           +T++++    LTG++   +  LK ++  ++  N L  ++P  ++  P ++ L L+ NGF+
Sbjct: 211 LTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFS 270

Query: 496 GGLPYSISQMAP-LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           G LP SI+ +AP L +L + HN+L G +     +   L TLD S N  +G IP++F++LT
Sbjct: 271 GNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLT 330

Query: 673 NMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHF 774
            + N+ L +N+ T    VL    +++L++  N F
Sbjct: 331 KIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQF 364



 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 71/264 (26%), Positives = 113/264 (42%), Gaps = 39/264 (14%)
 Frame = +1

Query: 148 FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSC-SGN 318
           FL    P+  A   P D + L    + +   P   L+ W    G  C  SW GV+C + +
Sbjct: 50  FLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKK--GTACC-SWNGVTCLTTD 106

Query: 319 RVTEIQISGL-------------------------------QLTGSMGFQLDQLKSVTTF 405
           RV+ + ++G                                 +TGS    L QL ++   
Sbjct: 107 RVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYV 166

Query: 406 DISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
            I  N L  +LP  +     ++  +L GN FTG +P SIS +  L  L + +N L G + 
Sbjct: 167 YIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIP 226

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP--LDN 750
           +   +L  +S L+   N L G IP  F S+  ++++ L  N F+G +   +A+L   L  
Sbjct: 227 LGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRF 286

Query: 751 LNVENNHFTGWIPPQLQGINSLQT 822
           L + +N  +G IP  L    +L T
Sbjct: 287 LELGHNKLSGTIPNFLSNFKALDT 310



>pir|T48216|T48216 hypothetical protein T20L15.220 - Arabidopsis
           thaliana>gb:ATT20L15_1555048 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T20L15 (ESSA project).
          Length = 984

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 66/231 (28%), Positives = 110/231 (47%), Gaps = 12/231 (5%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCSGN-------RVTEIQI 339
           T P++ + LR +  SL  P   L  W  N GDPC  +W GV C           V E+ +
Sbjct: 109 THPSEVTALRSVKRSLLDPKDYLRNW--NRGDPCRSNWTGVICFNEIGTDDYLHVRELLL 166

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS 519
           +G +L+G++  +L  L ++  F I  NN+                      TG +P S S
Sbjct: 167 NGNKLSGTLPSELGYLSNLNRFQIDENNI----------------------TGPIPKSFS 204

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
            +  +++L+ ++N L G++ V   +LTN+  +    N L+GN+P   S+L N++ + L N
Sbjct: 205 NLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDN 264

Query: 700 NVFTGTIDVLANL----PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           N F+G+ D+ A+      +  L++ N    G + P    I  L+    SWN
Sbjct: 265 NNFSGS-DIPASYGNFSNILKLSLRNCSLKGAL-PDFSKIRHLKYLDLSWN 313



>pir|B84431|B84431 probable receptor protein kinase [imported] -
           Arabidopsis thaliana>gb:AC006532_1534365 Arabidopsis
           thaliana chromosome 2 clone F14H20 map CIC11A04,
           complete sequence.>gb:AY074313_1567471 Arabidopsis
           thaliana putative receptor protein kinase (At2g01950)
           mRNA, complete cds.
          Length = 1143

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 76/254 (29%), Positives = 123/254 (48%), Gaps = 37/254 (14%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM 366
           TD+  L    + +   P   L+ W+     PC   + GV+C G RVTEI +SG  L+G +
Sbjct: 38  TDSLSLLSFKTMIQDDPNNILSNWSPRKS-PC--QFSGVTCLGGRVTEINLSGSGLSGIV 94

Query: 367 GF----QLDQLK---------------------SVTTFDISTNNLGNSLP---YQLPPNV 462
            F     LD L                      ++T  ++S++ L  +LP   +    N+
Sbjct: 95  SFNAFTSLDSLSVLKLSENFFVLNSTSLLLLPLTLTHLELSSSGLIGTLPENFFSKYSNL 154

Query: 463 QKLNLAGNGFTGGLPYSI-SQMAPLEYLNVSHNQLQGEV---TVMFVSLTNLSTLDFSFN 630
             + L+ N FTG LP  +      L+ L++S+N + G +   T+   S  +++ LDFS N
Sbjct: 155 ISITLSYNNFTGKLPNDLFLSSKKLQTLDLSYNNITGPISGLTIPLSSCVSMTYLDFSGN 214

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQL-Q 801
           S++G I  +  + TN+K++ L  N F G I      L  L +L++ +N  TGWIPP++  
Sbjct: 215 SISGYISDSLINCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRLTGWIPPEIGD 274

Query: 802 GINSLQTGGNSWNS 843
              SLQ    S+N+
Sbjct: 275 TCRSLQNLRLSYNN 288



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 5/162 (3%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA---GNGFTG 498
           E+++    +TG +   + Q   + T D+S N L  ++P ++  N+QKL       N   G
Sbjct: 379 ELRLPDNLVTGEIPPAISQCSELRTIDLSLNYLNGTIPPEIG-NLQKLEQFIAWYNNIAG 437

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
            +P  I ++  L+ L +++NQL GE+   F + +N+  + F+ N L G +P+ F  L+ +
Sbjct: 438 EIPPEIGKLQNLKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRL 497

Query: 679 KNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
             + L NN FTG I  ++     L  L++  NH TG IPP+L
Sbjct: 498 AVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNHLTGEIPPRL 539



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 52/183 (28%), Positives = 82/183 (44%), Gaps = 29/183 (15%)
 Frame = +1

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP---NVQKLNLAGNGFTGGLP 507
           +S   ++G     +   KS+   D S+N     +P  L P   ++++L L  N  TG +P
Sbjct: 333 LSNNLISGDFPTSISACKSLRIADFSSNRFSGVIPPDLCPGAASLEELRLPDNLVTGEIP 392

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
            +ISQ + L  +++S N L G +     +L  L      +N++AG IP     L N+K++
Sbjct: 393 PAISQCSELRTIDLSLNYLNGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDL 452

Query: 688 YLQNNVFTGTID------------------VLANLPLD--------NLNVENNHFTGWIP 789
            L NN  TG I                   +   +P D         L + NN+FTG IP
Sbjct: 453 ILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIP 512

Query: 790 PQL 798
           P+L
Sbjct: 513 PEL 515



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 48/143 (33%), Positives = 72/143 (50%), Gaps = 2/143 (1%)
 Frame = +1

Query: 298 GVSCSGNRVTEIQISGL-QLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-YQLPPNVQKL 471
           G SC G       + GL + +G    +L Q+ S+ + D +    G  L  +     ++ L
Sbjct: 564 GNSCKG-------VGGLVEFSGIRPERLLQIPSLKSCDFTRMYSGPILSLFTRYQTIEYL 616

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L+ N   G +P  I +M  L+ L +SHNQL GE+      L NL   D S N L G IP
Sbjct: 617 DLSYNQLRGKIPDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIP 676

Query: 652 QTFSSLTNMKNMYLQNNVFTGTI 720
           ++FS+L+ +  + L NN  TG I
Sbjct: 677 ESFSNLSFLVQIDLSNNELTGPI 699



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 51/186 (27%), Positives = 90/186 (48%), Gaps = 9/186 (4%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMG---FQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLN 474
           S  ++  + +S   +TG +      L    S+T  D S N++   +   L    N++ LN
Sbjct: 175 SSKKLQTLDLSYNNITGPISGLTIPLSSCVSMTYLDFSGNSISGYISDSLINCTNLKSLN 234

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFV-SLTNLSTLDFSFNSLAGNIP 651
           L+ N F G +P S  ++  L+ L++SHN+L G +      +  +L  L  S+N+  G IP
Sbjct: 235 LSYNNFDGQIPKSFGELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQNLRLSYNNFTGVIP 294

Query: 652 QTFSSLTNMKNMYLQNNVFTGTI--DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQT 822
           ++ SS + ++++ L NN  +G     +L +   L  L + NN  +G  P  +    SL+ 
Sbjct: 295 ESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFPTSISACKSLRI 354

Query: 823 GGNSWN 840
              S N
Sbjct: 355 ADFSSN 360



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 2/106 (1%)
 Frame = +1

Query: 388 KSVTTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ 561
           +++   D+S N L   +P ++   +  Q L L+ N  +G +P++I Q+  L   + S N+
Sbjct: 611 QTIEYLDLSYNQLRGKIPDEIGEMIALQVLELSHNQLSGEIPFTIGQLKNLGVFDASDNR 670

Query: 562 LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
           LQG++   F +L+ L  +D S N L G IPQ     T     Y  N
Sbjct: 671 LQGQIPESFSNLSFLVQIDLSNNELTGPIPQRGQLSTLPATQYANN 716



>gb:AP003768_1833268 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439E07.
          Length = 936

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 74/278 (26%), Positives = 122/278 (43%), Gaps = 38/278 (13%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFLLNAPPSAV------ADTDPTDASVLRGLFSSLNSPPQLTKWT 261
           M  +   P  V LL  FLL A P  +      A     +A +L  +  +   P  L  W 
Sbjct: 1   METMAKAPGPVYLL--FLLLALPCCLIPHRGAAQPAANEARLLLQIKRAWGDPAVLAGWN 58

Query: 262 ANGGDPCGESWKGVSC-SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
                    SW  V+C +  RVT + ++   ++G +   +  L S+   D+  NN+  + 
Sbjct: 59  DTAAPAAHCSWPYVTCDTAGRVTNLSLANTNVSGPVSDAVGGLSSLVHLDLYNNNINGTF 118

Query: 439 PYQ----------------------------LPPNVQKLNLAGNGFTGGLPYSISQMAPL 534
           P                              L  N+  L L+GN FTG +P S+S++  L
Sbjct: 119 PTSVYRCVSLRYLNLSQNYLGGELPADIGVGLGENLTTLVLSGNYFTGTIPKSLSRLQKL 178

Query: 535 EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA-GNIPQTFSSLTNMKNMYLQNNVFT 711
           E+L + +N L G +      LT+L+TL  S N L  G +P++F +LT +  ++ +     
Sbjct: 179 EWLMLDNNNLTGTIPGELGDLTSLTTLTISTNKLGPGQLPESFKNLTKLTTLWARKCQLV 238

Query: 712 GTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           G +   +A++P L  L++  N+ TG IPP +  +  LQ
Sbjct: 239 GDMPAYVADMPDLVTLDLAVNNLTGSIPPGIWSLKKLQ 276



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 46/165 (27%), Positives = 77/165 (46%), Gaps = 3/165 (1%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL---PPNVQKLNLAGNGFTGGLPYSISQM 525
           +G +   + +L ++    +  N+L   LP +L    P++  L +  N FTG +P  +   
Sbjct: 337 SGEIPASIGRLPALKEIHLFNNSLTGVLPPELGQKSPDLWDLEVDFNKFTGPIPEGLCDG 396

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L     ++N L G +       T L TL    N L+G++P+   + T ++ + LQNN 
Sbjct: 397 GKLNIFTAANNLLNGSIPERLAGCTTLQTLFLPNNKLSGDVPEALWTATKLQFVQLQNNG 456

Query: 706 FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            TGT+       L +L VENN F G IP     +     G N+++
Sbjct: 457 LTGTLPSTMYSNLSSLTVENNQFRGSIPAAAAALQKFIAGNNNFS 501



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 44/138 (31%), Positives = 74/138 (53%), Gaps = 3/138 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGN 486
           + ++ + +   Q  GS+      L+    F    NN    +P  L    P +Q LNL+GN
Sbjct: 467 SNLSSLTVENNQFRGSIPAAAAALQK---FIAGNNNFSGEIPESLGNGMPVLQTLNLSGN 523

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +GG+P S+S++  L  L++S NQL GE+     ++  L+ LD S N L+G IP + +S
Sbjct: 524 QLSGGIPKSVSKLKVLTQLDLSKNQLSGEIPAELGAMPVLNALDLSSNRLSGGIPSSLAS 583

Query: 667 LTNMKNMYLQNNVFTGTI 720
           L N+ ++ L +N  +G +
Sbjct: 584 L-NLNSLNLSSNQLSGQV 600



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 2/116 (1%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L K+ A   +  GE  + +      +  + +SG QL+G +   + +LK +T  D+S N L
Sbjct: 490 LQKFIAGNNNFSGEIPESLGNGMPVLQTLNLSGNQLSGGIPKSVSKLKVLTQLDLSKNQL 549

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
              +P +L   P +  L+L+ N  +GG+P S++ +  L  LN+S NQL G+V   F
Sbjct: 550 SGEIPAELGAMPVLNALDLSSNRLSGGIPSSLASLN-LNSLNLSSNQLSGQVPAKF 604



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 49/211 (23%), Positives = 84/211 (39%), Gaps = 32/211 (15%)
 Frame = +1

Query: 286 ESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL----- 450
           ES+K ++    ++T +     QL G M   +  +  + T D++ NNL  S+P  +     
Sbjct: 219 ESFKNLT----KLTTLWARKCQLVGDMPAYVADMPDLVTLDLAVNNLTGSIPPGIWSLKK 274

Query: 451 -----------------------PPNVQKLNLAGNGFTGG-LPYSISQMAPLEYLNVSHN 558
                                    N+  ++L+ N   GG +P     +  LE +++  N
Sbjct: 275 LQCLFLFANKLTGDIVVADGAFAAVNLVFIDLSANPKLGGPIPQDFGLLQKLEVIHLYFN 334

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT-NMKNMYLQNNVFTGTI--DVL 729
              GE+      L  L  +    NSL G +P      + ++ ++ +  N FTG I   + 
Sbjct: 335 NFSGEIPASIGRLPALKEIHLFNNSLTGVLPPELGQKSPDLWDLEVDFNKFTGPIPEGLC 394

Query: 730 ANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
               L+     NN   G IP +L G  +LQT
Sbjct: 395 DGGKLNIFTAANNLLNGSIPERLAGCTTLQT 425



>gb:AP003768_1833267 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439E07.
          Length = 1066

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 74/278 (26%), Positives = 122/278 (43%), Gaps = 38/278 (13%)
 Frame = +1

Query: 100 MRELMGLPWAVALLIGFLLNAPPSAV------ADTDPTDASVLRGLFSSLNSPPQLTKWT 261
           M  +   P  V LL  FLL A P  +      A     +A +L  +  +   P  L  W 
Sbjct: 1   METMAKAPGPVYLL--FLLLALPCCLIPHRGAAQPAANEARLLLQIKRAWGDPAVLAGWN 58

Query: 262 ANGGDPCGESWKGVSC-SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
                    SW  V+C +  RVT + ++   ++G +   +  L S+   D+  NN+  + 
Sbjct: 59  DTAAPAAHCSWPYVTCDTAGRVTNLSLANTNVSGPVSDAVGGLSSLVHLDLYNNNINGTF 118

Query: 439 PYQ----------------------------LPPNVQKLNLAGNGFTGGLPYSISQMAPL 534
           P                              L  N+  L L+GN FTG +P S+S++  L
Sbjct: 119 PTSVYRCVSLRYLNLSQNYLGGELPADIGVGLGENLTTLVLSGNYFTGTIPKSLSRLQKL 178

Query: 535 EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA-GNIPQTFSSLTNMKNMYLQNNVFT 711
           E+L + +N L G +      LT+L+TL  S N L  G +P++F +LT +  ++ +     
Sbjct: 179 EWLMLDNNNLTGTIPGELGDLTSLTTLTISTNKLGPGQLPESFKNLTKLTTLWARKCQLV 238

Query: 712 GTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           G +   +A++P L  L++  N+ TG IPP +  +  LQ
Sbjct: 239 GDMPAYVADMPDLVTLDLAVNNLTGSIPPGIWSLKKLQ 276



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 46/165 (27%), Positives = 77/165 (46%), Gaps = 3/165 (1%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL---PPNVQKLNLAGNGFTGGLPYSISQM 525
           +G +   + +L ++    +  N+L   LP +L    P++  L +  N FTG +P  +   
Sbjct: 337 SGEIPASIGRLPALKEIHLFNNSLTGVLPPELGQKSPDLWDLEVDFNKFTGPIPEGLCDG 396

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L     ++N L G +       T L TL    N L+G++P+   + T ++ + LQNN 
Sbjct: 397 GKLNIFTAANNLLNGSIPERLAGCTTLQTLFLPNNKLSGDVPEALWTATKLQFVQLQNNG 456

Query: 706 FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            TGT+       L +L VENN F G IP     +     G N+++
Sbjct: 457 LTGTLPSTMYSNLSSLTVENNQFRGSIPAAAAALQKFIAGNNNFS 501



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 44/138 (31%), Positives = 74/138 (53%), Gaps = 3/138 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGN 486
           + ++ + +   Q  GS+      L+    F    NN    +P  L    P +Q LNL+GN
Sbjct: 467 SNLSSLTVENNQFRGSIPAAAAALQK---FIAGNNNFSGEIPESLGNGMPVLQTLNLSGN 523

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +GG+P S+S++  L  L++S NQL GE+     ++  L+ LD S N L+G IP + +S
Sbjct: 524 QLSGGIPKSVSKLKVLTQLDLSKNQLSGEIPAELGAMPVLNALDLSSNRLSGGIPSSLAS 583

Query: 667 LTNMKNMYLQNNVFTGTI 720
           L N+ ++ L +N  +G +
Sbjct: 584 L-NLNSLNLSSNQLSGQV 600



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 2/116 (1%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L K+ A   +  GE  + +      +  + +SG QL+G +   + +LK +T  D+S N L
Sbjct: 490 LQKFIAGNNNFSGEIPESLGNGMPVLQTLNLSGNQLSGGIPKSVSKLKVLTQLDLSKNQL 549

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
              +P +L   P +  L+L+ N  +GG+P S++ +  L  LN+S NQL G+V   F
Sbjct: 550 SGEIPAELGAMPVLNALDLSSNRLSGGIPSSLASLN-LNSLNLSSNQLSGQVPAKF 604



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 49/211 (23%), Positives = 84/211 (39%), Gaps = 32/211 (15%)
 Frame = +1

Query: 286 ESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL----- 450
           ES+K ++    ++T +     QL G M   +  +  + T D++ NNL  S+P  +     
Sbjct: 219 ESFKNLT----KLTTLWARKCQLVGDMPAYVADMPDLVTLDLAVNNLTGSIPPGIWSLKK 274

Query: 451 -----------------------PPNVQKLNLAGNGFTGG-LPYSISQMAPLEYLNVSHN 558
                                    N+  ++L+ N   GG +P     +  LE +++  N
Sbjct: 275 LQCLFLFANKLTGDIVVADGAFAAVNLVFIDLSANPKLGGPIPQDFGLLQKLEVIHLYFN 334

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT-NMKNMYLQNNVFTGTI--DVL 729
              GE+      L  L  +    NSL G +P      + ++ ++ +  N FTG I   + 
Sbjct: 335 NFSGEIPASIGRLPALKEIHLFNNSLTGVLPPELGQKSPDLWDLEVDFNKFTGPIPEGLC 394

Query: 730 ANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
               L+     NN   G IP +L G  +LQT
Sbjct: 395 DGGKLNIFTAANNLLNGSIPERLAGCTTLQT 425



>gb:AJ786411_1814069 Phaseolus vulgaris bpgip4 gene for
           polygalacturonase inhibiting
           protein.>gb:AJ864509_1814989 Phaseolus vulgaris ppgip4
           gene for polygalacturonase inhibiting protein precursor.
          Length = 335

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 62/218 (28%), Positives = 96/218 (44%), Gaps = 14/218 (6%)
 Frame = +1

Query: 187 DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN----RVTEIQISGLQL 354
           +P D   L  +   L +P  L+ W  N  D C   W+GVSC  +    RV  + ++GL L
Sbjct: 25  NPQDKQALLQIKKDLGNPTTLSSWLPNT-DCCKPEWEGVSCDTDTKSYRVNILDLNGLSL 83

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG-------NGFTGGLPYS 513
           T                           PY +P +V  L   G       N   G +P S
Sbjct: 84  TK--------------------------PYPIPSSVGNLPYLGSLYISRMNNLVGSIPPS 117

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           I+++  L ++ +SH  + G++      + +L T+DFS+N+L+G +P + SSL N+  + L
Sbjct: 118 IAKLTKLGFIRISHTNVSGQIPNFLSQMKSLITIDFSYNALSGTLPPSLSSLPNLVGISL 177

Query: 694 QNNVFTGTI-DVLANLP--LDNLNVENNHFTGWIPPQL 798
             N  +GTI     + P     L +  N  TG IP  L
Sbjct: 178 DGNRISGTIPGSFGSFPKHFTVLTLSRNRLTGNIPTTL 215



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 45/166 (27%), Positives = 75/166 (45%), Gaps = 2/166 (1%)
 Frame = +1

Query: 226 SLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTF 405
           SL+S P L   + +G    G             T + +S  +LTG++   L +L  ++  
Sbjct: 165 SLSSLPNLVGISLDGNRISGTIPGSFGSFPKHFTVLTLSRNRLTGNIPTTLAKL-GLSFV 223

Query: 406 DISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           D+S N L    S+ +    N++K++LA N     L     +   LE L++  N++ G + 
Sbjct: 224 DLSENMLEGDASVLFGANKNLRKIDLAKNLLAFDLGKISLRSKNLEGLDLRKNRIYGTLP 283

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
            +  SL  L TL+ S+N+L G IPQ        +  Y  N    G+
Sbjct: 284 KVLTSLKYLRTLNVSYNNLCGQIPQGGKLQRFSEYCYAHNKCLCGS 329



>gb:AY632359_1618694 Gossypium hirsutum BAC 155C17, complete
           sequence.
          Length = 435

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 59/175 (33%), Positives = 89/175 (50%), Gaps = 5/175 (2%)
 Frame = +1

Query: 325 TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGL 504
           T +  SGL +       L  +  + T  IS  NL  SLP  L  N+  ++L+ N   G +
Sbjct: 176 TPVNTSGLYVI------LGNMHKLKTITISHANLTGSLPRHLHLNLTHVDLSDNKLKGNI 229

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P S++ +  LEYLN+S N L GE+   F  L +L  L  + NS +G+IP++ S++  + +
Sbjct: 230 PTSLTLLEDLEYLNLSSNGLNGEIPTEFGDLISLRNLSLASNSFSGSIPESISAIPGLVH 289

Query: 685 MYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL---QTGGNS 834
           + L NN   GT+    +    L  LN+ENN   G +P     I  L   + GGNS
Sbjct: 290 VDLSNNQLNGTVPRFFSQLKGLKVLNLENNELHGVLPFNASFIKKLAVFKVGGNS 344



>gb:AY075617_1567762 Arabidopsis thaliana AT3g25560/MWL2_18 mRNA,
           complete cds.>gb:BT002619_1636222 Arabidopsis thaliana
           At3g25560/MWL2_18 mRNA, complete cds.
          Length = 635

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 47/160 (29%), Positives = 88/160 (55%), Gaps = 3/160 (1%)
 Frame = +1

Query: 208 LRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQ 384
           L G+ SSL  P   L  W     DPC  SW  ++CS   V  ++     L+G++   +  
Sbjct: 46  LIGIKSSLTDPHGVLMNWDDTAVDPC--SWNMITCSDGFVIRLEAPSQNLSGTLSSSIGN 103

Query: 385 LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L ++ T  +  N +  ++P+++     ++ L+L+ N FTG +P+++S    L+YL V++N
Sbjct: 104 LTNLQTVLLQNNYITGNIPHEIGKLMKLKTLDLSTNNFTGQIPFTLSYSKNLQYLRVNNN 163

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
            L G +     ++T L+ LD S+N+L+G +P++ +   N+
Sbjct: 164 SLTGTIPSSLANMTQLTFLDLSYNNLSGPVPRSLAKTFNV 203



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 34/103 (33%), Positives = 45/103 (43%), Gaps = 2/103 (1%)
 Frame = +1

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           L      L G ++    +LTNL T+    N + GNIP     L  +K + L  N FTG I
Sbjct: 86  LEAPSQNLSGTLSSSIGNLTNLQTVLLQNNYITGNIPHEIGKLMKLKTLDLSTNNFTGQI 145

Query: 721 DVLANLP--LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
               +    L  L V NN  TG IP  L  +  L     S+N+
Sbjct: 146 PFTLSYSKNLQYLRVNNNSLTGTIPSSLANMTQLTFLDLSYNN 188



>gb:AY072083_1566979 Arabidopsis thaliana putative receptor protein
           kinase (At5g56040) mRNA, complete cds.
          Length = 953

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 54/169 (31%), Positives = 100/169 (59%), Gaps = 5/169 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           ++++G +L G++  ++  LK++   DIS N L  ++P ++    +++ ++L  NG TGGL
Sbjct: 462 LRLNGNRLAGNIPAEIGNLKNLNFIDISENRLIGNIPPEISGCTSLEFVDLHSNGLTGGL 521

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P ++ +   L+++++S N L G +     SLT L+ L+ + N  +G IP+  SS  +++ 
Sbjct: 522 PGTLPKS--LQFIDLSDNSLTGSLPTGIGSLTELTKLNLAKNRFSGEIPREISSCRSLQL 579

Query: 685 MYLQNNVFTGTI-DVLANLP--LDNLNVENNHFTGWIPPQLQGINSLQT 822
           + L +N FTG I + L  +P    +LN+  NHFTG IP +   + +L T
Sbjct: 580 LNLGDNGFTGEIPNELGRIPSLAISLNLSCNHFTGEIPSRFSSLTNLGT 628



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 53/179 (29%), Positives = 93/179 (51%), Gaps = 4/179 (2%)
 Frame = +1

Query: 292 WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQ 465
           W+  +C    +  + ++   L+G +   +  LK V T  + T+ L   +P ++     +Q
Sbjct: 211 WEIGNCES--LVTLGLAETSLSGRLPASIGNLKKVQTIALYTSLLSGPIPDEIGNCTELQ 268

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
            L L  N  +G +P S+ ++  L+ L +  N L G++     +   L  +D S N L GN
Sbjct: 269 NLYLYQNSISGSIPVSMGRLKKLQSLLLWQNNLVGKIPTELGTCPELFLVDLSENLLTGN 328

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPPQLQGINSL 816
           IP++F +L N++ + L  N  +GTI + LAN   L +L ++NN  +G IPP +  + SL
Sbjct: 329 IPRSFGNLPNLQELQLSVNQLSGTIPEELANCTKLTHLEIDNNQISGEIPPLIGKLTSL 387



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 62/215 (28%), Positives = 105/215 (48%), Gaps = 15/215 (6%)
 Frame = +1

Query: 223 SSLN-SPPQLTKWTANGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGSM-GFQLDQLKS 393
           S LN S   L+ W A+  +PC   W G+ C+   +V+EIQ+  +   G +    L Q+KS
Sbjct: 40  SQLNISGDALSSWKASESNPC--QWVGIKCNERGQVSEIQLQVMDFQGPLPATNLRQIKS 97

Query: 394 VTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ 567
           +T   +++ NL  S+P +L     ++ L+LA N  +G +P  I ++  L+ L+++ N L+
Sbjct: 98  LTLLSLTSVNLTGSIPKELGDLSELEVLDLADNSLSGEIPVDIFKLKKLKILSLNTNNLE 157

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT--GTIDVLANLP 741
           G +     +L NL  L    N LAG IP+T   L N++       +F   G  ++   LP
Sbjct: 158 GVIPSELGNLVNLIELTLFDNKLAGEIPRTIGELKNLE-------IFRAGGNKNLRGELP 210

Query: 742 --------LDNLNVENNHFTGWIPPQLQGINSLQT 822
                   L  L +     +G +P  +  +  +QT
Sbjct: 211 WEIGNCESLVTLGLAETSLSGRLPASIGNLKKVQT 245



 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 56/170 (32%), Positives = 83/170 (48%), Gaps = 6/170 (3%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
            I +S   LTGS+   +  L  +T  +++ N     +P ++    ++Q LNL  NGFTG +
Sbjct: 532  IDLSDNSLTGSLPTGIGSLTELTKLNLAKNRFSGEIPREISSCRSLQLLNLGDNGFTGEI 591

Query: 505  PYSISQMAPLEY-LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
            P  + ++  L   LN+S N   GE+   F SLTNL TLD S N LAGN+    + L N+ 
Sbjct: 592  PNELGRIPSLAISLNLSCNHFTGEIPSRFSSLTNLGTLDVSHNKLAGNL-NVLADLQNLV 650

Query: 682  NMYLQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
            ++ +  N F+G +        LPL  L      F    P      N +QT
Sbjct: 651  SLNISFNEFSGELPNTLFFRKLPLSVLESNKGLFISTRPE-----NGIQT 695



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 43/159 (27%), Positives = 79/159 (49%), Gaps = 4/159 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G +  +L     +   D+S N L  ++P      PN+Q+L L+ N  +G +P  ++  
Sbjct: 301 LVGKIPTELGTCPELFLVDLSENLLTGNIPRSFGNLPNLQELQLSVNQLSGTIPEELANC 360

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L +L + +NQ+ GE+  +   LT+L+      N L G IP++ S    ++ + L  N 
Sbjct: 361 TKLTHLEIDNNQISGEIPPLIGKLTSLTMFFAWQNQLTGIIPESLSQCQELQAIDLSYNN 420

Query: 706 FTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            +G+I   +     L  L + +N+ +G+IPP +    +L
Sbjct: 421 LSGSIPNGIFEIRNLTKLLLLSNYLSGFIPPDIGNCTNL 459



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 45/164 (27%), Positives = 80/164 (48%), Gaps = 4/164 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           ++T ++I   Q++G +   + +L S+T F    N L   +P  L     +Q ++L+ N  
Sbjct: 362 KLTHLEIDNNQISGEIPPLIGKLTSLTMFFAWQNQLTGIIPESLSQCQELQAIDLSYNNL 421

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +G +P  I ++  L  L +  N L G +     + TNL  L  + N LAGNIP    +L 
Sbjct: 422 SGSIPNGIFEIRNLTKLLLLSNYLSGFIPPDIGNCTNLYRLRLNGNRLAGNIPAEIGNLK 481

Query: 673 NMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
           N+  + +  N   G I  ++     L+ +++ +N  TG +P  L
Sbjct: 482 NLNFIDISENRLIGNIPPEISGCTSLEFVDLHSNGLTGGLPGTL 525



>pir|B84742|B84742 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC002334_1530378 Arabidopsis
           thaliana chromosome 2 clone F25I18 map TEn5, complete
           sequence.
          Length = 1124

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 57/172 (33%), Positives = 91/172 (52%), Gaps = 4/172 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           ++++ G +LTG    +L +L +++  ++  N     LP ++     +Q+L+LA N F+  
Sbjct: 473 QLRVVGNRLTGQFPTELCKLVNLSAIELDQNRFSGPLPPEIGTCQKLQRLHLAANQFSSN 532

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           LP  IS+++ L   NVS N L G +     +   L  LD S NS  G++P    SL  ++
Sbjct: 533 LPNEISKLSNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLE 592

Query: 682 NMYLQNNVFTGTID-VLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
            + L  N F+G I   + NL  L  L +  N F+G IPPQL  ++SLQ   N
Sbjct: 593 ILRLSENRFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMN 644



 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 51/180 (28%), Positives = 99/180 (55%), Gaps = 5/180 (2%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
            ++  + ++  Q + ++  ++ +L ++ TF++S+N+L   +P ++     +Q+L+L+ N F
Sbjct: 518  KLQRLHLAANQFSSNLPNEISKLSNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSF 577

Query: 493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
             G LP  +  +  LE L +S N+  G +     +LT+L+ L    N  +G+IP     L+
Sbjct: 578  IGSLPPELGSLHQLEILRLSENRFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLS 637

Query: 673  NMK-NMYLQNNVFTGTIDV-LANLPL-DNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            +++  M L  N F+G I   + NL L   L++ NNH +G IP   + ++SL     S+N+
Sbjct: 638  SLQIAMNLSYNDFSGEIPPEIGNLHLLMYLSLNNNHLSGEIPTTFENLSSLLGCNFSYNN 697



 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 60/214 (28%), Positives = 94/214 (43%), Gaps = 4/214 (1%)
 Frame = +1

Query: 211 RGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLK 390
           RG   SLN   +L  W      PC  +W GV+CS    +    S +              
Sbjct: 46  RGFQDSLN---RLHNWNGIDETPC--NWIGVNCSSQGSSSSSNSLV-------------- 86

Query: 391 SVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQL 564
            VT+ D+S+ NL   +   +    N+  LNLA N  TG +P  I   + LE + +++NQ 
Sbjct: 87  -VTSLDLSSMNLSGIVSPSIGGLVNLVYLNLAYNALTGDIPREIGNCSKLEVMFLNNNQF 145

Query: 565 QGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID-VLANL- 738
            G + V    L+ L + +   N L+G +P+    L N++ +    N  TG +   L NL 
Sbjct: 146 GGSIPVEINKLSQLRSFNICNNKLSGPLPEEIGDLYNLEELVAYTNNLTGPLPRSLGNLN 205

Query: 739 PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            L       N F+G IP ++    +L+  G + N
Sbjct: 206 KLTTFRAGQNDFSGNIPTEIGKCLNLKLLGLAQN 239



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 54/183 (29%), Positives = 88/183 (48%), Gaps = 13/183 (7%)
 Frame = +1

Query: 310 SGNRVTEI------QISGLQ---LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--P 456
           SGN  TEI      ++ GL    ++G +  ++  L  +    +  N     +P  +    
Sbjct: 218 SGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGMLVKLQEVILWQNKFSGFIPKDIGNLT 277

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           +++ L L GN   G +P  I  M  L+ L +  NQL G +      L+ +  +DFS N L
Sbjct: 278 SLETLALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSENLL 337

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGIN 810
           +G IP   S ++ ++ +YL  N  TG I + L+ L  L  L++  N  TG IPP  Q + 
Sbjct: 338 SGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINSLTGPIPPGFQNLT 397

Query: 811 SLQ 819
           S++
Sbjct: 398 SMR 400



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/165 (29%), Positives = 75/165 (45%), Gaps = 4/165 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           ++V EI  S   L+G +  +L ++  +    +  N L   +P +L    N+ KL+L+ N 
Sbjct: 325 SKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINS 384

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +P     +  +  L + HN L G +       + L  +DFS N L+G IP      
Sbjct: 385 LTGPIPPGFQNLTSMRQLQLFHNSLSGVIPQGLGLYSPLWVVDFSENQLSGKIPPFICQQ 444

Query: 670 TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
           +N+  + L +N   G I   VL    L  L V  N  TG  P +L
Sbjct: 445 SNLILLNLGSNRIFGNIPPGVLRCKSLLQLRVVGNRLTGQFPTEL 489



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 37/119 (31%), Positives = 69/119 (57%), Gaps = 5/119 (4%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQ-KLNLAGNGFTGG 501
           +++S  + +G++ F +  L  +T   +  N    S+P QL    ++Q  +NL+ N F+G 
Sbjct: 594 LRLSENRFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMNLSYNDFSGE 653

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT--FSSLT 672
           +P  I  +  L YL++++N L GE+   F +L++L   +FS+N+L G +P T  F ++T
Sbjct: 654 IPPEIGNLHLLMYLSLNNNHLSGEIPTTFENLSSLLGCNFSYNNLTGQLPHTQIFQNMT 712



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 48/168 (28%), Positives = 79/168 (47%), Gaps = 5/168 (2%)
 Frame = +1

Query: 301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLN 474
            +S   N VT   +S   LTG +  ++   K +   D+S N+   SLP +L     ++ L 
Sbjct: 537  ISKLSNLVT-FNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLEILR 595

Query: 475  LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS-TLDFSFNSLAGNIP 651
            L+ N F+G +P++I  +  L  L +  N   G +      L++L   ++ S+N  +G IP
Sbjct: 596  LSENRFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMNLSYNDFSGEIP 655

Query: 652  QTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
                +L  +  + L NN  +G I     NL  L   N   N+ TG +P
Sbjct: 656  PEIGNLHLLMYLSLNNNHLSGEIPTTFENLSSLLGCNFSYNNLTGQLP 703



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 55/197 (27%), Positives = 88/197 (44%), Gaps = 29/197 (14%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL--AG-N 486
           +++    I   +L+G +  ++  L ++      TNNL   LP  L  N+ KL    AG N
Sbjct: 157 SQLRSFNICNNKLSGPLPEEIGDLYNLEELVAYTNNLTGPLPRSLG-NLNKLTTFRAGQN 215

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV---MFV---------------------S 594
            F+G +P  I +   L+ L ++ N + GE+     M V                     +
Sbjct: 216 DFSGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGMLVKLQEVILWQNKFSGFIPKDIGN 275

Query: 595 LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENN 768
           LT+L TL    NSL G IP    ++ ++K +YL  N   GTI   L  L  +  ++   N
Sbjct: 276 LTSLETLALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSEN 335

Query: 769 HFTGWIPPQLQGINSLQ 819
             +G IP +L  I+ L+
Sbjct: 336 LLSGEIPVELSKISELR 352



>pir|E84846|E84846 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC002339_1530506 Arabidopsis
           thaliana chromosome 2 clone T11A7 map CIC11C08, complete
           sequence.
          Length = 890

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 57/179 (31%), Positives = 91/179 (50%), Gaps = 4/179 (2%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLA 480
           CSG  ++ I+I   +L G +   +  +  +T F+   NNL   +  +     N+  LNLA
Sbjct: 253 CSG--LSSIRIGNNELVGVIPRTIGNISGLTYFEADKNNLSGEIVAEFSKCSNLTLLNLA 310

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
            NGF G +P  + Q+  L+ L +S N L GE+   F+   NL+ LD S N L G IP+  
Sbjct: 311 ANGFAGTIPTELGQLINLQELILSGNSLFGEIPKSFLGSGNLNKLDLSNNRLNGTIPKEL 370

Query: 661 SSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
            S+  ++ + L  N   G I  ++   + L  L +  N+ TG IPP++  + +LQ   N
Sbjct: 371 CSMPRLQYLLLDQNSIRGDIPHEIGNCVKLLQLQLGRNYLTGTIPPEIGRMRNLQIALN 429



 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 64/249 (25%), Positives = 106/249 (42%), Gaps = 28/249 (11%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           ++ L++GFL     S + +   +D + L  +   L  P     W++NG D C  +W G+ 
Sbjct: 7   SILLIVGFLSK---SELCEAQLSDEATLVAINRELGVPG----WSSNGTDYC--TWVGLK 57

Query: 307 CSGNR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA 480
           C  N   V  + +SGLQL G++   +  L+S+                      + L+L+
Sbjct: 58  CGVNNSFVEMLDLSGLQLRGNVTL-ISDLRSL----------------------KHLDLS 94

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
           GN F G +P S   ++ LE+L++S N+  G + V F  L  L   + S N L G IP   
Sbjct: 95  GNNFNGRIPTSFGNLSELEFLDLSLNRFVGAIPVEFGKLRGLRAFNISNNLLVGEIPDEL 154

Query: 661 SSLTNMKNMYLQNNVFTGTI------------------DVLANLP--------LDNLNVE 762
             L  ++   +  N   G+I                  D++  +P        L+ LN+ 
Sbjct: 155 KVLERLEEFQVSGNGLNGSIPHWVGNLSSLRVFTAYENDLVGEIPNGLGLVSELELLNLH 214

Query: 763 NNHFTGWIP 789
           +N   G IP
Sbjct: 215 SNQLEGKIP 223



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 55/181 (30%), Positives = 85/181 (46%), Gaps = 9/181 (4%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGF 492
           R+ E Q+SG  L GS+   +  L S+  F    N+L   +P    L   ++ LNL  N  
Sbjct: 159 RLEEFQVSGNGLNGSIPHWVGNLSSLRVFTAYENDLVGEIPNGLGLVSELELLNLHSNQL 218

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            G +P  I +   L+ L ++ N+L GE+       + LS++    N L G IP+T  +++
Sbjct: 219 EGKIPKGIFEKGKLKVLVLTQNRLTGELPEAVGICSGLSSIRIGNNELVGVIPRTIGNIS 278

Query: 673 NMKNMYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ---TGGN 831
            +       N  +G I       +NL L  LN+  N F G IP +L  + +LQ     GN
Sbjct: 279 GLTYFEADKNNLSGEIVAEFSKCSNLTL--LNLAANGFAGTIPTELGQLINLQELILSGN 336

Query: 832 S 834
           S
Sbjct: 337 S 337



 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 46/159 (28%), Positives = 73/159 (45%), Gaps = 5/159 (3%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGG 501
           E+ +SG  L G +        ++   D+S N L  ++P +L   P +Q L L  N   G 
Sbjct: 330 ELILSGNSLFGEIPKSFLGSGNLNKLDLSNNRLNGTIPKELCSMPRLQYLLLDQNSIRGD 389

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS-TLDFSFNSLAGNIPQTFSSLTNM 678
           +P+ I     L  L +  N L G +      + NL   L+ SFN L G++P     L  +
Sbjct: 390 IPHEIGNCVKLLQLQLGRNYLTGTIPPEIGRMRNLQIALNLSFNHLHGSLPPELGKLDKL 449

Query: 679 KNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIP 789
            ++ + NN+ TG+I  L    + L  +N  NN   G +P
Sbjct: 450 VSLDVSNNLLTGSIPPLLKGMMSLIEVNFSNNLLNGPVP 488



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 53/195 (27%), Positives = 88/195 (45%), Gaps = 3/195 (1%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTE 330
           LLN   +  A T PT+   L  L   + S          G    GE  K    SGN + +
Sbjct: 306 LLNLAANGFAGTIPTELGQLINLQELILS----------GNSLFGEIPKSFLGSGN-LNK 354

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--KLNLAGNGFTGGL 504
           + +S  +L G++  +L  +  +    +  N++   +P+++   V+  +L L  N  TG +
Sbjct: 355 LDLSNNRLNGTIPKELCSMPRLQYLLLDQNSIRGDIPHEIGNCVKLLQLQLGRNYLTGTI 414

Query: 505 PYSISQMAPLEY-LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P  I +M  L+  LN+S N L G +      L  L +LD S N L G+IP     + ++ 
Sbjct: 415 PPEIGRMRNLQIALNLSFNHLHGSLPPELGKLDKLVSLDVSNNLLTGSIPPLLKGMMSLI 474

Query: 682 NMYLQNNVFTGTIDV 726
            +   NN+  G + V
Sbjct: 475 EVNFSNNLLNGPVPV 489



>gb:AP005064_1847421 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBa0049G15.>gb:AP005495_1852841 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0003H03.
          Length = 1069

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 67/255 (26%), Positives = 116/255 (45%), Gaps = 19/255 (7%)
 Frame = +1

Query: 112 MGLPWAVALLI----GFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGG 273
           M + W +++L       LL    S   + D  D S L    S + + P+  L+ W A G 
Sbjct: 1   MAIKWQLSMLSLLTHALLLLTASSQTINGD--DLSALMSFKSLIRNDPRGVLSSWDAIGN 58

Query: 274 D-----PCGESWKGVSCSG----NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
                 P    W GV+C+     +RVT + +    LTG++  QL  L  +   D+S N+L
Sbjct: 59  GTNMTAPVFCQWTGVTCNDRQYPSRVTTLNLRDAGLTGTISQQLGNLTHLHVLDLSANSL 118

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
              +P  L   P ++ LN + N  +G +P  + +++ L   ++ HN L  ++     +LT
Sbjct: 119 DGDIPTSLGGCPKLRSLNFSRNHLSGTIPADLGKLSKLAVFDIGHNNLTCDIPKSLSNLT 178

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHF 774
            L+      N + G       +LT + +  L+ N FTG I       + L   +V++NH 
Sbjct: 179 TLTKFIVERNFIHGQDLSWMGNLTTLTHFVLEGNSFTGNIPETFGKMVKLIYFSVQDNHL 238

Query: 775 TGWIPPQLQGINSLQ 819
            G +P  +  I+S++
Sbjct: 239 EGHVPLSIFNISSIR 253



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 57/177 (32%), Positives = 90/177 (50%), Gaps = 6/177 (3%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPP--NVQKLN 474
           +CS  R  +I  + L   G+M   +  L + ++  D+  N +  ++P  L     +  +N
Sbjct: 351 NCSSLRFLDIGKNNL--VGAMPINIANLSNELSWIDLGGNQIIGTIPEDLWKFNKLTSVN 408

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           L+ N FTG LP  I  +  L    +SHN++ G++     ++T LS L  S N L G+IP 
Sbjct: 409 LSYNLFTGTLPPDIGGLPRLNSFYISHNRIDGKIPQSLGNITQLSYLSLSNNFLDGSIPT 468

Query: 655 TFSSLTNMKNMYLQNNVFTGTI--DVLANLPLD-NLNVENNHFTGWIPPQLQGINSL 816
           +  + T ++ M L  N  TG I  ++LA   L   LN+ NN   G IP Q+  +NSL
Sbjct: 469 SLGNFTKLEVMDLSCNSLTGQIPQEILAITSLTRRLNLSNNALIGSIPTQIGLLNSL 525



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 2/111 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--KLNLAGNGFTGGL 504
           + +S   L GS+  Q+  L S+   D+S N L   +P  +   VQ   LN  GN   G +
Sbjct: 504 LNLSNNALIGSIPTQIGLLNSLVKMDMSMNKLSGGIPEAIGSCVQLSSLNFQGNLLQGQI 563

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           P S++ +  L+ L++S N L+G +     + T L+ L+ SFN L+G +P T
Sbjct: 564 PKSLNNLRSLQILDLSKNSLEGRIPEFLANFTFLTNLNLSFNKLSGPVPNT 614



 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 49/195 (25%), Positives = 80/195 (41%), Gaps = 27/195 (13%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-------------- 456
           ++  +  S   L+G++   L +L  +  FDI  NNL   +P  L                
Sbjct: 131 KLRSLNFSRNHLSGTIPADLGKLSKLAVFDIGHNNLTCDIPKSLSNLTTLTKFIVERNFI 190

Query: 457 ---------NVQKLN---LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
                    N+  L    L GN FTG +P +  +M  L Y +V  N L+G V +   +++
Sbjct: 191 HGQDLSWMGNLTTLTHFVLEGNSFTGNIPETFGKMVKLIYFSVQDNHLEGHVPLSIFNIS 250

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP-LDNLNVENNHFT 777
           ++   D  FN L+G++P                      +DV   LP ++  N   NHF 
Sbjct: 251 SIRFFDLGFNRLSGSLP----------------------LDVGVKLPRINRFNTLANHFE 288

Query: 778 GWIPPQLQGINSLQT 822
           G IPP     ++L++
Sbjct: 289 GIIPPTFSNASALES 303



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/133 (31%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTT-FDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFTGG 501
           + +S   LTG +  ++  + S+T   ++S N L  S+P Q  L  ++ K++++ N  +GG
Sbjct: 479 MDLSCNSLTGQIPQEILAITSLTRRLNLSNNALIGSIPTQIGLLNSLVKMDMSMNKLSGG 538

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P +I     L  LN   N LQG++     +L +L  LD S NSL G IP+  ++ T + 
Sbjct: 539 IPEAIGSCVQLSSLNFQGNLLQGQIPKSLNNLRSLQILDLSKNSLEGRIPEFLANFTFLT 598

Query: 682 NMYLQNNVFTGTI 720
           N+ L  N  +G +
Sbjct: 599 NLNLSFNKLSGPV 611



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 53/193 (27%), Positives = 84/193 (43%), Gaps = 36/193 (18%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNGFTGGLPYSISQ 522
           L G +   +  + S+  FD+  N L  SLP  +    P + + N   N F G +P + S 
Sbjct: 238 LEGHVPLSIFNISSIRFFDLGFNRLSGSLPLDVGVKLPRINRFNTLANHFEGIIPPTFSN 297

Query: 523 MAPLEYLNVSHNQLQG----EVTV-----------------------MFVSLTNLSTL-- 615
            + LE L +  N   G    E+ +                        F+SLTN S+L  
Sbjct: 298 ASALESLLLRGNNYHGIIPREIGIHGNLKVFSLGDNALQATRPSDWEFFISLTNCSSLRF 357

Query: 616 -DFSFNSLAGNIPQTFSSLTN-MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGW 783
            D   N+L G +P   ++L+N +  + L  N   GTI  D+     L ++N+  N FTG 
Sbjct: 358 LDIGKNNLVGAMPINIANLSNELSWIDLGGNQIIGTIPEDLWKFNKLTSVNLSYNLFTGT 417

Query: 784 IPPQLQGINSLQT 822
           +PP + G+  L +
Sbjct: 418 LPPDIGGLPRLNS 430



>gb:AP003210_1825238 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0010K01.
          Length = 1002

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 70/224 (31%), Positives = 103/224 (45%), Gaps = 34/224 (15%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCS----GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDIS 414
           L  W A    PC  SW GVSC     G  VT I ++GL LTGS    L +L  V + D+S
Sbjct: 44  LADWNARDATPC--SWTGVSCDAGVGGGAVTGISLAGLNLTGSFPAALCRLPRVASIDLS 101

Query: 415 TNNLG---------------------NSLPYQLP------PNVQKLNLAGNGFTGGLPYS 513
            N +G                     N+L   LP      P +  L L  N F+G +P S
Sbjct: 102 YNYIGPNLSSDAVAPCKALRRLDLSMNALVGPLPDALAALPELVYLKLDSNNFSGPIPES 161

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS-LAGNIPQTFSSLTNMKNMY 690
             +   LE L++ +N L GEV      ++ L  L+ S+N  +AG +P    +L+ ++ ++
Sbjct: 162 FGRFKKLESLSLVYNLLGGEVPPFLGGVSTLRELNLSYNPFVAGPVPAELGNLSALRVLW 221

Query: 691 LQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
           L      G I   L  L  L +L++  N  TG IPP++  + S+
Sbjct: 222 LAGCNLIGAIPASLGRLGNLTDLDLSTNALTGSIPPEITRLTSV 265



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 44/158 (27%), Positives = 85/158 (53%), Gaps = 4/158 (2%)
 Frame = +1

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPY 510
           ++G  L G++   L +L ++T  D+STN L  S+P ++    +V ++ L  N  TG +P 
Sbjct: 222 LAGCNLIGAIPASLGRLGNLTDLDLSTNALTGSIPPEITRLTSVVQIELYNNSLTGPIPV 281

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
              ++A L+ ++++ N+L G +   F     L ++    NSL G +P++ +   ++  + 
Sbjct: 282 GFGKLAELQGVDLAMNRLNGAIPDDFFEAPKLESVHLYANSLTGPVPESVAKAASLVELR 341

Query: 691 LQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
           L  N   GT+  D+  N PL  +++ +N  +G IPP +
Sbjct: 342 LFANRLNGTLPADLGKNSPLVCVDMSDNSISGEIPPAI 379



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 46/158 (29%), Positives = 78/158 (49%), Gaps = 3/158 (1%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           ++++  QLTG +   +    +++   +S N L  S+P ++     + +L+  GN  +G L
Sbjct: 436 LELNDNQLTGVISPVIGGAANLSKLVLSNNRLTGSIPPEIGSASKLYELSADGNMLSGPL 495

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P S+  +  L  L + +N L G++     S   LS L+ + N   G IP     L  +  
Sbjct: 496 PGSLGGLEELGRLVLRNNSLSGQLLRGINSWKKLSELNLADNGFTGAIPAELGDLPVLNY 555

Query: 685 MYLQNNVFTGTIDV-LANLPLDNLNVENNHFTGWIPPQ 795
           + L  N  TG + + L NL L+  NV NN  +G +PPQ
Sbjct: 556 LDLSGNRLTGEVPMQLENLKLNQFNVSNNQLSGALPPQ 593



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 40/169 (23%), Positives = 82/169 (48%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFT 495
           + E+++   +L G++   L +   +   D+S N++   +P  +     +++L +  N  +
Sbjct: 337 LVELRLFANRLNGTLPADLGKNSPLVCVDMSDNSISGEIPPAICDRGELEELLMLDNKLS 396

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  + +   L  + +S+N+L G+V      L ++S L+ + N L G I        N
Sbjct: 397 GRIPDGLGRCRRLRRVRLSNNRLDGDVPAAVWGLPHMSLLELNDNQLTGVISPVIGGAAN 456

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +  + L NN  TG+I  ++ +   L  L+ + N  +G +P  L G+  L
Sbjct: 457 LSKLVLSNNRLTGSIPPEIGSASKLYELSADGNMLSGPLPGSLGGLEEL 505



 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 46/167 (27%), Positives = 80/167 (47%), Gaps = 4/167 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGF 492
           R+  +++S  +L G +   +  L  ++  +++ N L   +   +    N+ KL L+ N  
Sbjct: 408 RLRRVRLSNNRLDGDVPAAVWGLPHMSLLELNDNQLTGVISPVIGGAANLSKLVLSNNRL 467

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  I   + L  L+   N L G +      L  L  L    NSL+G + +  +S  
Sbjct: 468 TGSIPPEIGSASKLYELSADGNMLSGPLPGSLGGLEELGRLVLRNNSLSGQLLRGINSWK 527

Query: 673 NMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGI 807
            +  + L +N FTG I   L +LP L+ L++  N  TG +P QL+ +
Sbjct: 528 KLSELNLADNGFTGAIPAELGDLPVLNYLDLSGNRLTGEVPMQLENL 574



 Score = 38.1 bits (87), Expect = 0.21
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)
 Frame = +1

Query: 196 DASVLRG-LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGF 372
           D ++L G L  SL    +L +         G+  +G++ S  +++E+ ++    TG++  
Sbjct: 487 DGNMLSGPLPGSLGGLEELGRLVLRNNSLSGQLLRGIN-SWKKLSELNLADNGFTGAIPA 545

Query: 373 QLDQLKSVTTFDISTNNLGNSLPYQLPP-NVQKLNLAGNGFTGGLP 507
           +L  L  +   D+S N L   +P QL    + + N++ N  +G LP
Sbjct: 546 ELGDLPVLNYLDLSGNRLTGEVPMQLENLKLNQFNVSNNQLSGALP 591



>gb:AY632360_1618708 Gossypium hirsutum BAC 106I22, complete
           sequence.
          Length = 435

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 63/176 (35%), Positives = 93/176 (52%), Gaps = 6/176 (3%)
 Frame = +1

Query: 325 TEIQISGLQ-LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG 501
           T +  SGL  + G+M     +LK+VT   IS  NL  SLP  L  N+ +++L+ N   G 
Sbjct: 176 TPVNTSGLYVILGNM----HKLKTVT---ISHANLTGSLPRHLHLNLTQVDLSDNKLKGN 228

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P S++ +  LEYLN+S N L GE+   F  L +L  L  + NS +G+IP + S++    
Sbjct: 229 IPTSLTLLEDLEYLNLSSNGLNGEIPTEFGDLISLKNLSLASNSFSGSIPDSISAIPGFV 288

Query: 682 NMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL---QTGGNS 834
           ++ L NN   GT+    +    L  LN+ENN   G +P     I  L   + GGNS
Sbjct: 289 HVDLSNNQLNGTVPRFFSQLKGLKVLNLENNELHGVLPFNASFIKKLAVFKVGGNS 344



>gb:AY064013_1565953 Arabidopsis thaliana putative receptor kinase
           (At3g47570) mRNA, complete cds.
          Length = 1010

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 63/225 (28%), Positives = 110/225 (48%), Gaps = 6/225 (2%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS--GNRVTEIQISGLQLT 357
           TD TD   L    S ++   ++   + N   P   +WKGV+C     RVT +++  LQL 
Sbjct: 21  TDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLC-NWKGVTCGRKNKRVTHLELGRLQLG 79

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAP 531
           G +   +  L  + + D+  N  G ++P ++     ++ L++  N   G +P  +   + 
Sbjct: 80  GVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSR 139

Query: 532 LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT 711
           L  L +  N+L G V     SLTNL  L+   N++ G +P +  +LT ++ + L +N   
Sbjct: 140 LLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLE 199

Query: 712 GTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           G I  DV     + +L +  N+F+G  PP L  ++SL+  G  +N
Sbjct: 200 GEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYN 244



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 49/180 (27%), Positives = 91/180 (50%), Gaps = 11/180 (6%)
 Frame = +1

Query: 325 TEIQISGL---QLTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPP--NVQKLNLAGN 486
           T+++  G+   +L G +   +  L + + T D+    +  S+PY +    N+QKL L  N
Sbjct: 336 TQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQN 395

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +G LP S+ ++  L YL++  N+L G +     ++T L TLD S N   G +P +  +
Sbjct: 396 MLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGN 455

Query: 667 LTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQ---LQGINSLQTGGN 831
            +++  +++ +N   GTI  +++    L  L++  N   G +P     LQ + +L  G N
Sbjct: 456 CSHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDN 515



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 47/156 (30%), Positives = 83/156 (53%), Gaps = 4/156 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L+G +   L +L ++    + +N L   +P  +     ++ L+L+ NGF G +P S+   
Sbjct: 397 LSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNC 456

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L  L +  N+L G + +  + +  L  LD S NSL G++PQ   +L N+  + L +N 
Sbjct: 457 SHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNK 516

Query: 706 FTGTI-DVLAN-LPLDNLNVENNHFTGWIPPQLQGI 807
            +G +   L N L +++L +E N F G I P L+G+
Sbjct: 517 LSGKLPQTLGNCLTMESLFLEGNLFYGDI-PDLKGL 551



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 12/179 (6%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNG 489
           ++  +Q+     +G     L  L S+    I  N+    L   L    PN+   N+ GN 
Sbjct: 211 QIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNY 270

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P ++S ++ LE L ++ N L G +   F ++ NL  L    NSL  +  +    L
Sbjct: 271 FTGSIPTTLSNISTLERLGMNENNLTGSIPT-FGNVPNLKLLFLHTNSLGSDSSRDLEFL 329

Query: 670 TNMKN------MYLQNNVFTGTIDV-LANL--PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           T++ N      + +  N   G + + +ANL   L  L++     +G IP  +  + +LQ
Sbjct: 330 TSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQ 388



 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 27/137 (19%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-------------- 456
           ++  + +SG  L GS+   +  L+++ T  +  N L   LP  L                
Sbjct: 482 QLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLF 541

Query: 457 -----------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV--MFVSL 597
                       V++++L+ N  +G +P   +  + LEYLN+S N L+G+V V  +F + 
Sbjct: 542 YGDIPDLKGLVGVKEVDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFENA 601

Query: 598 TNLSTLDFSFNSLAGNI 648
           T +S +    N L G I
Sbjct: 602 TTVSIV--GNNDLCGGI 616



>pir|H86459|H86459 hypothetical protein T1E4.2 - Arabidopsis
           thaliana>gb:AE005172_892172 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069299_1540788 Arabidopsis thaliana
           chromosome 1 BAC T1E4 genomic sequence, complete
           sequence.
          Length = 478

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 78/272 (28%), Positives = 117/272 (43%), Gaps = 38/272 (13%)
 Frame = +1

Query: 121 PWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESW 294
           P  +   + FL    P   A   P D + L    S +   P   L+ W   G D C  SW
Sbjct: 7   PLFIFAFVIFLRCLSPIEAATCHPDDEAGLLAFKSGITQDPTGILSSWK-KGTDCC--SW 63

Query: 295 KGVSCSGNRVTEIQISGLQ-------------------------------LTGSMGFQLD 381
           KGV C  NRVT + I+G                                 +TGS    L 
Sbjct: 64  KGVGCLTNRVTGLTINGQSDVTGSFLSGTISPSLAKLQHLVGIYFTNLRNITGSFPQFLF 123

Query: 382 QLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH 555
           QL +V     + + L   LP  +     + +L+L GN FTG +P SIS +  L  LN+  
Sbjct: 124 QLPNVKQVYFTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLNLGD 183

Query: 556 NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLA 732
           N L G + +   +L  L +L+F  N L+  IP  F S+  ++++ L  N F+G +   +A
Sbjct: 184 NLLTGTIPLGLANLKILLSLNFGNNRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPPSIA 243

Query: 733 NLP--LDNLNVENNHFTGWIPPQLQGINSLQT 822
           +L   L+ L++  N+ +G IP  L     L +
Sbjct: 244 SLKPILNYLDLSQNNLSGTIPTFLSNFKVLDS 275



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 52/186 (27%), Positives = 93/186 (50%), Gaps = 4/186 (2%)
 Frame = +1

Query: 148 FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT 327
           +LLN   + +  T P   + L+ L S LN           G +   E+   +  S  ++ 
Sbjct: 177 YLLNLGDNLLTGTIPLGLANLKILLS-LNF----------GNNRLSETIPDIFKSMQKLQ 225

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTF-DISTNNLGNSLPYQLP--PNVQKLNLAGNGFTG 498
            + +S  + +G++   +  LK +  + D+S NNL  ++P  L     +  L+L+ N F+G
Sbjct: 226 SLTLSRNKFSGNLPPSIASLKPILNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSG 285

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL-AGNIPQTFSSLTN 675
            +P S++ M  L +LN+SHN L G +  M  ++  L+TLD S+N      IP+  +S  +
Sbjct: 286 VVPKSLANMPKLFHLNLSHNFLTGPLPAM-KNVDGLATLDLSYNQFHLKTIPKWVTSSPS 344

Query: 676 MKNMYL 693
           M ++ L
Sbjct: 345 MYSLKL 350



>pir|T45717|T45717 receptor-kinase like protein - Arabidopsis
           thaliana>gb:ATF1P2_1549427 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F1P2.
          Length = 988

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 63/225 (28%), Positives = 110/225 (48%), Gaps = 6/225 (2%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS--GNRVTEIQISGLQLT 357
           TD TD   L    S ++   ++   + N   P   +WKGV+C     RVT +++  LQL 
Sbjct: 21  TDETDRQALLQFKSQVSEDKRVVLSSWNHSFPLC-NWKGVTCGRKNKRVTHLELGRLQLG 79

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAP 531
           G +   +  L  + + D+  N  G ++P ++     ++ L++  N   G +P  +   + 
Sbjct: 80  GVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSR 139

Query: 532 LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT 711
           L  L +  N+L G V     SLTNL  L+   N++ G +P +  +LT ++ + L +N   
Sbjct: 140 LLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLE 199

Query: 712 GTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           G I  DV     + +L +  N+F+G  PP L  ++SL+  G  +N
Sbjct: 200 GEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYN 244



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 49/180 (27%), Positives = 91/180 (50%), Gaps = 11/180 (6%)
 Frame = +1

Query: 325 TEIQISGL---QLTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPP--NVQKLNLAGN 486
           T+++  G+   +L G +   +  L + + T D+    +  S+PY +    N+QKL L  N
Sbjct: 336 TQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQN 395

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +G LP S+ ++  L YL++  N+L G +     ++T L TLD S N   G +P +  +
Sbjct: 396 MLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGN 455

Query: 667 LTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQ---LQGINSLQTGGN 831
            +++  +++ +N   GTI  +++    L  L++  N   G +P     LQ + +L  G N
Sbjct: 456 CSHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDN 515



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 47/156 (30%), Positives = 83/156 (53%), Gaps = 4/156 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L+G +   L +L ++    + +N L   +P  +     ++ L+L+ NGF G +P S+   
Sbjct: 397 LSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNC 456

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L  L +  N+L G + +  + +  L  LD S NSL G++PQ   +L N+  + L +N 
Sbjct: 457 SHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNK 516

Query: 706 FTGTI-DVLAN-LPLDNLNVENNHFTGWIPPQLQGI 807
            +G +   L N L +++L +E N F G I P L+G+
Sbjct: 517 LSGKLPQTLGNCLTMESLFLEGNLFYGDI-PDLKGL 551



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 12/179 (6%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNG 489
           ++  +Q+     +G     L  L S+    I  N+    L   L    PN+   N+ GN 
Sbjct: 211 QIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNY 270

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +P ++S ++ LE L ++ N L G +   F ++ NL  L    NSL  +  +    L
Sbjct: 271 FTGSIPTTLSNISTLERLGMNENNLTGSIPT-FGNVPNLKLLFLHTNSLGSDSSRDLEFL 329

Query: 670 TNMKN------MYLQNNVFTGTIDV-LANL--PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           T++ N      + +  N   G + + +ANL   L  L++     +G IP  +  + +LQ
Sbjct: 330 TSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQ 388



 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 27/137 (19%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-------------- 456
           ++  + +SG  L GS+   +  L+++ T  +  N L   LP  L                
Sbjct: 482 QLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLF 541

Query: 457 -----------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV--MFVSL 597
                       V++++L+ N  +G +P   +  + LEYLN+S N L+G+V V  +F + 
Sbjct: 542 YGDIPDLKGLVGVKEVDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVPVKGIFENA 601

Query: 598 TNLSTLDFSFNSLAGNI 648
           T +S +    N L G I
Sbjct: 602 TTVSIV--GNNDLCGGI 616



>gb:AP005966_1860351 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:B1047H05.>gb:AP007273_1863459 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0035K09.
          Length = 605

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 67/232 (28%), Positives = 112/232 (48%), Gaps = 32/232 (13%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCSGN---RVTEIQISGLQLTG 360
           +D   L  L S L    + L+ W+    + C  SW GV+CS     RVT + +S   +TG
Sbjct: 35  SDRQALLCLKSQLTGSAEVLSSWSNASMEFC--SWHGVTCSTQYPRRVTALDLSSEGITG 92

Query: 361 SMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPL 534
           S+   +  L  +T   +S N+   S+P +L     +  LN++ N   G +P  ++    L
Sbjct: 93  SISPCIANLTYLTKLQLSNNSFYGSIPSELGFLTQLSILNISMNSLEGNIPSELTSCFKL 152

Query: 535 EYLNVSHNQLQGEVTVMFVSLTNLSTL------------------------DFSFNSLAG 642
           + +++S+N+LQG +   F  LT L TL                        D   N+LAG
Sbjct: 153 QKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNALAG 212

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPP 792
            IPQ+ +S T+++ + L +N  +G +   +L +  L  L+++ N+F G IPP
Sbjct: 213 RIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPP 264



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 52/166 (31%), Positives = 84/166 (50%), Gaps = 9/166 (5%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNGFTGGLPYSISQ 522
           L+G +   +  + S+T   ++ N+L   LP  +    PN+Q+L L  N F+G +P S+  
Sbjct: 330 LSGPVPPSIFNVTSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILPNNKFSGSIPSSLLN 389

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN---MKNMYL 693
            + L+ L +++N   G +   F SL NL  LD ++N L        SSLTN   +  + L
Sbjct: 390 ASHLQRLFLTNNSFTGHIP-FFGSLQNLEILDMAYNMLEAGDWSFVSSLTNCSKLTQLLL 448

Query: 694 QNNVFTGTI-DVLANLP--LDNLNVENNHFTGWIPPQLQGINSLQT 822
             N   G +   + NL   L++L + NN  +G IPP +  + SL T
Sbjct: 449 DGNNLQGNLPSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKSLNT 494



 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 53/203 (26%), Positives = 96/203 (47%), Gaps = 28/203 (13%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK--LNLAGNGF 492
           ++ +I +S  +L GS+      L  + T  +++N L   +P  L  N+    ++L  N  
Sbjct: 151 KLQKIDLSNNKLQGSIPSAFGDLTELRTLILTSNRLSGDIPQSLGSNLSLTYVDLGRNAL 210

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEV--------TVMFVSL----------------T 600
            G +P S++    L++L ++ N L GE+        +++F+ L                 
Sbjct: 211 AGRIPQSLASSTSLQFLILTSNTLSGELPKALLNSSSLIFLDLQQNNFVGSIPPVTAISP 270

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHF 774
            +  LD  FN L G IP +  +L+++  + L  N   G+I D L ++P L+ L V  N+ 
Sbjct: 271 KMYYLDLRFNHLTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNL 330

Query: 775 TGWIPPQLQGINSLQTGGNSWNS 843
           +G +PP +  + SL   G + NS
Sbjct: 331 SGPVPPSIFNVTSLTYLGMANNS 353



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 41/132 (31%), Positives = 71/132 (53%), Gaps = 3/132 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           LTG++   L  L S+T   +  NNL  S+P  L   P ++ L +  N  +G +P SI  +
Sbjct: 282 LTGTIPSSLGNLSSLTYLCLIGNNLVGSIPDTLGHVPTLETLAVNVNNLSGPVPPSIFNV 341

Query: 526 APLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
             L YL +++N L G + + +  +L N+  L    N  +G+IP +  + ++++ ++L NN
Sbjct: 342 TSLTYLGMANNSLTGRLPSNIGYTLPNIQQLILPNNKFSGSIPSSLLNASHLQRLFLTNN 401

Query: 703 VFTGTIDVLANL 738
            FTG I    +L
Sbjct: 402 SFTGHIPFFGSL 413



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 47/170 (27%), Positives = 85/170 (50%), Gaps = 5/170 (2%)
 Frame = +1

Query: 223 SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ---LTGSMGFQLDQLKS 393
           SSL +  +LT+   +G +  G      SC GN  + ++   L+   ++G +   +  LKS
Sbjct: 435 SSLTNCSKLTQLLLDGNNLQGNL---PSCIGNLSSSLEHLWLRNNMISGLIPPGIGNLKS 491

Query: 394 VTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ 567
           + T  +  N L  ++P  +    N+ KL +  N  TG +P +I  +  + +L+ SHN+L 
Sbjct: 492 LNTLYMDDNYLTGNIPPTIGYLHNMNKLYMDYNYLTGNIPPTIGYLHSMVFLSFSHNRLS 551

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
           G++     +L  L+ L    N+L+G+IP +    T +  + L +N   GT
Sbjct: 552 GQIPGTIGNLVQLNELRLDENNLSGSIPASIRHCTQLTKLNLAHNSLHGT 601



>gb:AP004063_1837106 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1476_F05.>gb:AP004881_1846551 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0496E03.
          Length = 552

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 63/186 (33%), Positives = 96/186 (51%), Gaps = 9/186 (4%)
 Frame = +1

Query: 292 WKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN- 459
           W GVSCS     RVT + +  L L+G++   L  L  +   + S+N+    LP   P N 
Sbjct: 62  WTGVSCSRRHPGRVTALNLFKLSLSGTISSSLGNLTFLKALNFSSNHFSGKLP---PLNH 118

Query: 460 ---VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
              ++ L+L  N     +P  ++  + L  L++S N L GE+      LTNLS+L  S N
Sbjct: 119 LHRLKVLDLRHNSLRDTIPEGLANCSRLRVLDLSSNSLVGEIPTKLGLLTNLSSLCLSNN 178

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTID-VLANL-PLDNLNVENNHFTGWIPPQLQG 804
           S  G IP T  ++T +  + LQ N   G+I   L  L  L +LN+  N+ +G +P +L  
Sbjct: 179 SFTGTIPPTLGNITGLNYLSLQINHLEGSIPRELGKLSDLLSLNIFMNNISGRLPHELFN 238

Query: 805 INSLQT 822
           ++SLQT
Sbjct: 239 LSSLQT 244



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 42/145 (28%), Positives = 77/145 (53%), Gaps = 8/145 (5%)
 Frame = +1

Query: 406 DISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           D+S+N+L   +P +L    N+  L L+ N FTG +P ++  +  L YL++  N L+G + 
Sbjct: 150 DLSSNSLVGEIPTKLGLLTNLSSLCLSNNSFTGTIPPTLGNITGLNYLSLQINHLEGSIP 209

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF------TGTIDVLANLP 741
                L++L +L+   N+++G +P    +L++++ ++L +N+           DVL NL 
Sbjct: 210 RELGKLSDLLSLNIFMNNISGRLPHELFNLSSLQTLWLSDNMLGKEALPPNIGDVLPNLQ 269

Query: 742 LDNLNVENNHFTGWIPPQLQGINSL 816
              L++  N F G IP  L   + L
Sbjct: 270 F--LSLARNMFEGHIPTSLINASGL 292



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 39/131 (29%), Positives = 65/131 (49%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG 501
           +T + +S   L G++   + +L+++    +  NN   S+P  +          GN   G 
Sbjct: 393 LTSLWLSKNNLIGTIEEWVGKLRNLELLYLQENNFTGSIPSSI----------GNSLDGQ 442

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P ++  +  L+ LN S+N L G +      L NL  LD S N+L GNIP +F  L  +K
Sbjct: 443 IPANLGNLRQLDRLNFSYNNLHGSIPYNVGKLRNLVQLDLSHNNLDGNIPSSFIKLQKLK 502

Query: 682 NMYLQNNVFTG 714
           ++ L +N F G
Sbjct: 503 HLDLSDNNFQG 513



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 55/175 (31%), Positives = 87/175 (49%), Gaps = 14/175 (8%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGN-SLPYQLP---PNVQKLNLAGNGFTGGLPYSIS 519
           ++G +  +L  L S+ T  +S N LG  +LP  +    PN+Q L+LA N F G +P S+ 
Sbjct: 228 ISGRLPHELFNLSSLQTLWLSDNMLGKEALPPNIGDVLPNLQFLSLARNMFEGHIPTSLI 287

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ----TFSSLTNMKNM 687
             + L  +++++N   G+V      L NLS L  + N L  +  +     F++ T ++ +
Sbjct: 288 NASGLWLIDLTNNNFYGQVPSYLSELANLSDLYLAGNHLEASDNEKWLHAFANCTLLQAL 347

Query: 688 YLQNNVFTGTI-DVLANLP--LDNLNVENNHFTGWIPP---QLQGINSLQTGGNS 834
            L  N   G I   + NL   L  LN+  NHF G +PP    L G+ SL    N+
Sbjct: 348 NLARNQIKGDIPSSIGNLSTNLQYLNLGVNHFVGVVPPSIGNLHGLTSLWLSKNN 402



 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 47/134 (35%), Positives = 67/134 (50%), Gaps = 15/134 (11%)
 Frame = +1

Query: 460 VQKLNLAGNGFTGGLPYSISQMAP-LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           +Q LNLA N   G +P SI  ++  L+YLN+  N   G V     +L  L++L  S N+L
Sbjct: 344 LQALNLARNQIKGDIPSSIGNLSTNLQYLNLGVNHFVGVVPPSIGNLHGLTSLWLSKNNL 403

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI----------DVLANL----PLDNLNVENNHF 774
            G I +    L N++ +YLQ N FTG+I           + ANL     LD LN   N+ 
Sbjct: 404 IGTIEEWVGKLRNLELLYLQENNFTGSIPSSIGNSLDGQIPANLGNLRQLDRLNFSYNNL 463

Query: 775 TGWIPPQLQGINSL 816
            G IP  +  + +L
Sbjct: 464 HGSIPYNVGKLRNL 477



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 7/166 (4%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGF---QLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQK 468
           S  GN  T +Q   L +   +G     +  L  +T+  +S NNL  ++   +    N++ 
Sbjct: 360 SSIGNLSTNLQYLNLGVNHFVGVVPPSIGNLHGLTSLWLSKNNLIGTIEEWVGKLRNLEL 419

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           L L  N FTG +P SI             N L G++     +L  L  L+FS+N+L G+I
Sbjct: 420 LYLQENNFTGSIPSSIG------------NSLDGQIPANLGNLRQLDRLNFSYNNLHGSI 467

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTG 780
           P     L N+  + L +N   G I    +    L +L++ +N+F G
Sbjct: 468 PYNVGKLRNLVQLDLSHNNLDGNIPSSFIKLQKLKHLDLSDNNFQG 513



>gb:AP003238_1825989 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0401G10.
          Length = 952

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 61/221 (27%), Positives = 104/221 (47%), Gaps = 10/221 (4%)
 Frame = +1

Query: 184 TDPTDASVLRGLFSSLNSPP-QLTKWTANGGDPCGESWKGVSCSGN-------RVTEIQI 339
           T P +   L+ +  +L  P  +L  W  N GDPC  +W  V C           V E+Q+
Sbjct: 27  TAPWEVDALKAIKGNLIDPQGRLNNW--NRGDPCMGNWSYVHCYNETASDGYLHVLELQL 84

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS 519
             L L+GS+  +L +L  +   D   NN+                      +G +P  + 
Sbjct: 85  LKLNLSGSLAAELGRLSHMQIMDFMWNNI----------------------SGSIPKEVG 122

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
            +  L+ L ++ NQL G +      L NL  +    N ++G IP++F++L   K+ ++ N
Sbjct: 123 NITSLKLLLLNGNQLTGSLPEEIGFLPNLDRIQIDQNYISGPIPKSFANLNKTKHFHMNN 182

Query: 700 NVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           N  +G I   L+ LP L +L ++NN+ +G++PP+L  +  L
Sbjct: 183 NSLSGQIPPELSRLPSLVHLLLDNNNLSGYLPPELSKLPKL 223



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 49/157 (31%), Positives = 80/157 (50%), Gaps = 10/157 (6%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNL-GNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQ 522
           L+G +  +L +L  +    +  NN  G S+P  Y     + KL+L      G +P  +S 
Sbjct: 209 LSGYLPPELSKLPKLLIIQLDNNNFSGTSIPSSYGNITTLLKLSLRNCSLEGPVP-DVSG 267

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L YL++S NQL+G +     + +N++T+D S N L G+IP +FS L N++ + L NN
Sbjct: 268 IPQLGYLDLSWNQLRGSIPSGRPA-SNITTIDLSHNLLNGSIPGSFSGLPNLQRLSLDNN 326

Query: 703 VFTGTI--DVLANLPLDN-----LNVENNHFTGWIPP 792
              G++  DV  N+         L+ +NN  T    P
Sbjct: 327 NLDGSVPSDVWRNIDFSGNRSLILDFQNNSLTNLSNP 363



>gb:AP002908_1823802 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0013G02.>gb:AP003310_1827792 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0022F12.
          Length = 689

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 71/234 (30%), Positives = 110/234 (47%), Gaps = 10/234 (4%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES----W 294
           A A+++  L+ A   A       +   L  L + L+   +L    A G DPCG      +
Sbjct: 9   AAAIVVVVLVLAGAGAAGAAGAGEVRALLDLAAGLDPTGRLLPSWAPGRDPCGREGGGGF 68

Query: 295 KGVSCSG--NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NV 462
           +GV+C G    V  + + G  L G++   +  L ++T   +  N L  +LP +L     +
Sbjct: 69  EGVACDGATGAVANVSLQGKGLAGTLPPAVAGLTALTGLYLHYNRLTGALPRELAALSRL 128

Query: 463 QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAG 642
             L L  N F+G +P  I+ M  L+ + + +NQL G V      L  L+ L+   N L+G
Sbjct: 129 TDLYLNVNNFSGPIPPEIAAMPSLQVVQLCYNQLTGGVPTQLGLLKRLTVLELQSNHLSG 188

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQL 798
            IP +   L  +  + L  N   G+I V LA LP L  L+V NN  TG +P +L
Sbjct: 189 AIPASLGDLPQLVRLDLSFNNLFGSIPVRLALLPRLLALDVRNNTLTGSVPSEL 242



 Score = 41.6 bits (96), Expect = 0.019
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
 Frame = +1

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGI 807
           LAG +P   + LT +  +YL  N  TG +  ++ A   L +L +  N+F+G IPP++  +
Sbjct: 90  LAGTLPPAVAGLTALTGLYLHYNRLTGALPRELAALSRLTDLYLNVNNFSGPIPPEIAAM 149

Query: 808 NSLQ 819
            SLQ
Sbjct: 150 PSLQ 153



>gb:AP002522_1822349 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0009G03.>gb:AP003045_1824367 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0030H07.
          Length = 1050

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 75/242 (30%), Positives = 115/242 (47%), Gaps = 6/242 (2%)
 Frame = +1

Query: 91  SLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLR---GLFSSLNSPPQLTKWT 261
           ++++   +GLP    LL         +  A +   +AS+L    GL  S +S   L  W 
Sbjct: 2   AIRLMRRLGLPLLPVLL---------TIAAASSSDEASLLAFKAGLTGSNSSA--LASWN 50

Query: 262 ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP 441
           ++G   C  +W+GV+CS  R T +    L  +   G          T   +  NL  + P
Sbjct: 51  SSGASFC--NWEGVTCSRRRPTRVASLSLPSSNLAG----------TLSPAIGNL--TFP 96

Query: 442 YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF 621
                  ++LNL+ NG  G +P SI ++  L++LN+S+N   G   V   S  +L  LD 
Sbjct: 97  -------RRLNLSSNGLYGEIPTSIGRLRRLQWLNLSYNSFSGAFPVNLTSCISLKILDL 149

Query: 622 SFNSLAGNIP-QTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPP 792
            +N L G IP +  ++LT ++ + L NN   G I   LANL  L +L ++ NH  G IPP
Sbjct: 150 DYNQLGGIIPVELGNTLTQLQMLLLTNNSIIGPIPPSLANLSLLQDLYLDYNHLEGLIPP 209

Query: 793 QL 798
            L
Sbjct: 210 CL 211



 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 49/158 (31%), Positives = 86/158 (54%), Gaps = 5/158 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVT-TFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           + +S  +L GS+  ++ +L S+    D+S N+L   LP ++    N+ +L L+GN  +G 
Sbjct: 468 LDLSFNRLNGSIPREILELPSLAWILDLSYNSLSGHLPSEVGTLANLNQLILSGNQLSGQ 527

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P SI     LE+L + +N   G++     +L  L+ L+ + N L+G IP   S++ N++
Sbjct: 528 IPNSIGNCEVLEFLLLDNNSFGGDMPQSLTNLKGLNVLNLTVNKLSGRIPNAISNIGNLQ 587

Query: 682 NMYLQNNVFTGTID-VLANLP-LDNLNVENNHFTGWIP 789
            + L +N F+G I   L N   L  L+V  N+  G +P
Sbjct: 588 YLCLAHNNFSGPIPAALQNFTLLKQLDVSFNNLQGEVP 625



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 51/169 (30%), Positives = 87/169 (51%), Gaps = 5/169 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLNLAGNGFTGGLPYSISQ 522
           L G +   + +LK++   D+S N L  S+P    +LP     L+L+ N  +G LP  +  
Sbjct: 451 LEGPIPATIGRLKNLFNLDLSFNRLNGSIPREILELPSLAWILDLSYNSLSGHLPSEVGT 510

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +A L  L +S NQL G++     +   L  L    NS  G++PQ+ ++L  +  + L  N
Sbjct: 511 LANLNQLILSGNQLSGQIPNSIGNCEVLEFLLLDNNSFGGDMPQSLTNLKGLNVLNLTVN 570

Query: 703 VFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
             +G I + ++N+  L  L + +N+F+G IP  LQ    L+    S+N+
Sbjct: 571 KLSGRIPNAISNIGNLQYLCLAHNNFSGPIPAALQNFTLLKQLDVSFNN 619



 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 45/143 (31%), Positives = 66/143 (46%), Gaps = 7/143 (4%)
 Frame = +1

Query: 409 ISTNNLGNSLP---YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
           +S N  G  LP     L   +Q L+L  N F+G +P+ IS +  L  L++  N + G + 
Sbjct: 349 LSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNLIGLRLLDLGFNPISGVIP 408

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG----TIDVLANLPLD 747
                LTNL  L      L+G IP T  +LT +  +   +    G    TI  L N  L 
Sbjct: 409 ESIGKLTNLVDLALYNTGLSGLIPSTIGNLTKLNRLLAFHTNLEGPIPATIGRLKN--LF 466

Query: 748 NLNVENNHFTGWIPPQLQGINSL 816
           NL++  N   G IP ++  + SL
Sbjct: 467 NLDLSFNRLNGSIPREILELPSL 489



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 53/182 (29%), Positives = 93/182 (51%), Gaps = 13/182 (7%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQL-DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---L 477
           S  RV  + ++ LQ  GS+   + D+  ++  F +  N    ++P  L  N+ +L    L
Sbjct: 239 SALRVIGVGLNMLQ--GSIPANIGDKFPAMRFFGLHENRFHGAIPSSLS-NLSRLTDLYL 295

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQ---GEVTVMFVSLTNLSTLD---FSFNSLA 639
           A N FTG +P ++  +  L+YL +  NQL+   G+ +    SL N S L     S N   
Sbjct: 296 ADNNFTGFVPPTLGMLHSLKYLYIGTNQLEADNGKGSEFVTSLANCSQLQELMLSHNFFG 355

Query: 640 GNIPQTFSSLT-NMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGIN 810
           G +P++  +L+  ++ + L+NN F+GTI  D+   + L  L++  N  +G IP  +  + 
Sbjct: 356 GQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISNLIGLRLLDLGFNPISGVIPESIGKLT 415

Query: 811 SL 816
           +L
Sbjct: 416 NL 417



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 50/185 (27%), Positives = 82/185 (44%), Gaps = 14/185 (7%)
 Frame = +1

Query: 307 CSGNR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKL 471
           C GN   + E+ +    LTG     L  L ++    +  N L  S+P  +    P ++  
Sbjct: 210 CLGNFPVLHELSLEANMLTGEFPHSLWNLSALRVIGVGLNMLQGSIPANIGDKFPAMRFF 269

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA---G 642
            L  N F G +P S+S ++ L  L ++ N   G V      L +L  L    N L    G
Sbjct: 270 GLHENRFHGAIPSSLSNLSRLTDLYLADNNFTGFVPPTLGMLHSLKYLYIGTNQLEADNG 329

Query: 643 NIPQTFSSLTN---MKNMYLQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQG 804
              +  +SL N   ++ + L +N F G +    V  ++ L  L++ENN F+G IP  +  
Sbjct: 330 KGSEFVTSLANCSQLQELMLSHNFFGGQLPRSIVNLSMTLQMLDLENNSFSGTIPHDISN 389

Query: 805 INSLQ 819
           +  L+
Sbjct: 390 LIGLR 394



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 37/103 (35%), Positives = 55/103 (53%), Gaps = 4/103 (3%)
 Frame = +1

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAP 531
           G M   L  LK +   +++ N L   +P  +    N+Q L LA N F+G +P ++     
Sbjct: 550 GDMPQSLTNLKGLNVLNLTVNKLSGRIPNAISNIGNLQYLCLAHNNFSGPIPAALQNFTL 609

Query: 532 LEYLNVSHNQLQGEVTV--MFVSLTNLSTLDFSFNSLAGNIPQ 654
           L+ L+VS N LQGEV V  +F +LT  S +    ++L G IPQ
Sbjct: 610 LKQLDVSFNNLQGEVPVKGVFRNLTFSSVV--GNDNLCGGIPQ 650



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 49/176 (27%), Positives = 81/176 (46%), Gaps = 7/176 (3%)
 Frame = +1

Query: 313 GNRVTEIQ---ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNL 477
           GN +T++Q   ++   + G +   L  L  +    +  N+L   +P  L   P + +L+L
Sbjct: 163 GNTLTQLQMLLLTNNSIIGPIPPSLANLSLLQDLYLDYNHLEGLIPPCLGNFPVLHELSL 222

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N  TG  P+S+  ++ L  + V  N LQG                    S+  NI   
Sbjct: 223 EANMLTGEFPHSLWNLSALRVIGVGLNMLQG--------------------SIPANIGDK 262

Query: 658 FSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           F +   M+   L  N F G I   L+NL  L +L + +N+FTG++PP L  ++SL+
Sbjct: 263 FPA---MRFFGLHENRFHGAIPSSLSNLSRLTDLYLADNNFTGFVPPTLGMLHSLK 315



>gb:AJ609275_1812000 Cicer arietinum mRNA for leucine rich repeat
           protein (lrr gene).
          Length = 368

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 67/242 (27%), Positives = 113/242 (46%), Gaps = 25/242 (10%)
 Frame = +1

Query: 172 AVADTDPTDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSC--SGNRVTEIQI 339
           AV    P+D + L    ++L  P       W+   G+ C  +W G+SC  +  RVT+I +
Sbjct: 19  AVNGCSPSDRAALLSFKAALKEPYHGIFNSWS---GENCCLNWYGISCDSTSGRVTDINL 75

Query: 340 SGLQ-------------LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP------NV 462
            G               +TG +  ++ ++  +T+  I+      ++   +PP      N+
Sbjct: 76  RGESEDPIFEKSGRSGYMTGKISPEICKIDRLTSLIIAD---WKAITGDIPPCVTSLSNL 132

Query: 463 QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAG 642
           + L+L GN   G +P +I  +  L  LN++ N + GE+      L +L  LD S N L G
Sbjct: 133 RILDLIGNQIAGKIPSTIGNLQSLSVLNLADNSISGEIPASIADLGSLKHLDLSNNVLTG 192

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
           +IP  F  L  +    L  N  TG+I V ++N+  L +L++  N  TG +P +L  +  L
Sbjct: 193 SIPANFGKLQMLSRALLNRNKLTGSIPVSISNIYRLADLDLSMNRLTGSVPSELGKMQVL 252

Query: 817 QT 822
            T
Sbjct: 253 ST 254



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 2/141 (1%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGLPYSISQ 522
           +LTGS+   +  +  +   D+S N L  S+P +L     +  LNL  N  +G +P S+  
Sbjct: 213 KLTGSIPVSISNIYRLADLDLSMNRLTGSVPSELGKMQVLSTLNLDSNLLSGQIPSSLLS 272

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
            + L  LN+S N   G +  +F   +    LD SFN+L G +P +  S   + ++ L +N
Sbjct: 273 NSGLGILNLSRNGFSGTIPDVFGPKSYFMALDMSFNNLNGRVPGSLLSAKYIGHLDLSHN 332

Query: 703 VFTGTIDVLANLPLDNLNVEN 765
              G+I +    P D+L   +
Sbjct: 333 HLCGSIPLGLGSPFDHLEASS 353



 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 57/214 (26%), Positives = 92/214 (42%), Gaps = 30/214 (14%)
 Frame = +1

Query: 247 LTKWTANGGD--PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTN 420
           +  W A  GD  PC       S S  R+  + + G Q+ G +   +  L+S++  +++ N
Sbjct: 112 IADWKAITGDIPPCV-----TSLSNLRI--LDLIGNQIAGKIPSTIGNLQSLSVLNLADN 164

Query: 421 NLGNSLPYQL--------------------PPNVQKLNLAG------NGFTGGLPYSISQ 522
           ++   +P  +                    P N  KL +        N  TG +P SIS 
Sbjct: 165 SISGEIPASIADLGSLKHLDLSNNVLTGSIPANFGKLQMLSRALLNRNKLTGSIPVSISN 224

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L  L++S N+L G V      +  LSTL+   N L+G IP +  S + +  + L  N
Sbjct: 225 IYRLADLDLSMNRLTGSVPSELGKMQVLSTLNLDSNLLSGQIPSSLLSNSGLGILNLSRN 284

Query: 703 VFTGTI-DVLA-NLPLDNLNVENNHFTGWIPPQL 798
            F+GTI DV         L++  N+  G +P  L
Sbjct: 285 GFSGTIPDVFGPKSYFMALDMSFNNLNGRVPGSL 318



>gb:AF053993_1764487 Lycopersicon esculentum disease resistance
           protein (Cf-5) gene, complete cds.
          Length = 968

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 58/182 (31%), Positives = 93/182 (51%), Gaps = 7/182 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N ++ + +   +L+GS+  ++  L+S+T  D+  N L  S+P  L    N+ +L+L  N 
Sbjct: 287 NNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNLSRLDLYNNK 346

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P  I  +  L YL++  N L G +     +L NL  L    N L+G+IP+    L
Sbjct: 347 LSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYL 406

Query: 670 TNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNS 834
           +++  +YL NN   G+I   L NL  L  L + NN  +G IP +   L  +  L  G NS
Sbjct: 407 SSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNS 466

Query: 835 WN 840
            N
Sbjct: 467 LN 468



 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 5/195 (2%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNN 423
           L  WT +  + C + W GV C   RV  + I+   + G++  F    L  +   D+S NN
Sbjct: 49  LASWTTSS-NAC-KDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNN 106

Query: 424 LGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
           +  ++P ++    N+  L+L  N  +G +P  I  +A L+ + + +N L G +      L
Sbjct: 107 ISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYL 166

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNH 771
            +L+ L    N L+G+IP +  ++TN+  ++L  N  +G I  ++     L  L+++ N 
Sbjct: 167 RSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINF 226

Query: 772 FTGWIPPQLQGINSL 816
            +G IP  L  +N+L
Sbjct: 227 LSGSIPASLGNLNNL 241



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 50/182 (27%), Positives = 93/182 (51%), Gaps = 7/182 (3%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
            N ++ + +   QL+GS+      ++++ T  +S N+L   +P  +    +++ L ++ N 
Sbjct: 479  NNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNN 538

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
              G +P  +  ++ L  L++S N  +GE+     +LT+L  LDF  N+L G IPQ F ++
Sbjct: 539  LKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNI 598

Query: 670  TNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT---GGNS 834
            ++++   +QNN  +GT+    ++   L +LN+  N     IP  L     LQ    G N 
Sbjct: 599  SSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQ 658

Query: 835  WN 840
             N
Sbjct: 659  LN 660



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 48/170 (28%), Positives = 83/170 (48%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T + +    L GS+   L  L ++    +  N L  S+P ++    ++ +L L  N   
Sbjct: 361 LTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLN 420

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  +  L  L + +NQL G +      L++L+ L    NSL G+IP +  +L N
Sbjct: 421 GSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNN 480

Query: 676 MKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +  +YL NN  +G+I     N+  L  L + +N   G IP  +  + SL+
Sbjct: 481 LSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLE 530



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 45/169 (26%), Positives = 86/169 (50%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   L  + +++   +  N L   +P ++    ++ KL+L  N  +
Sbjct: 169 LTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLS 228

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  +  L +L + +NQL G +      L +L+ L    N L+G+IP +  +L N
Sbjct: 229 GSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNN 288

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +  + L NN  +G+I  ++     L  L++  N   G IP  L  +N+L
Sbjct: 289 LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPSSLGNLNNL 337



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 34/84 (40%), Positives = 50/84 (59%)
 Frame = +1

Query: 469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
            ++L+ N F G +P  +  +  +  LNVSHN LQG +     SL+ L +LD SFN L+G I
Sbjct: 765  IDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEI 824

Query: 649  PQTFSSLTNMKNMYLQNNVFTGTI 720
            PQ  +SLT ++ + L +N   G I
Sbjct: 825  PQQLASLTFLEVLNLSHNYLQGCI 848



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 39/112 (34%), Positives = 55/112 (49%), Gaps = 2/112 (1%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            L   T  D+S+N     +P  L     ++ LN++ N   G +P S+  ++ LE L++S N
Sbjct: 759  LSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFN 818

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
            QL GE+     SLT L  L+ S N L G IPQ     T   N Y  N+   G
Sbjct: 819  QLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRG 870



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 4/124 (3%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQM 525
           L G++      + S+  FD+  N L  +LP  + +  ++  LNL GN     +P S+   
Sbjct: 587 LEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNC 646

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL--TNMKNMYLQN 699
             L+ L++  NQL     +   +L  L  L  + N L G I  + + +   +++ + L  
Sbjct: 647 KKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSR 706

Query: 700 NVFT 711
           N F+
Sbjct: 707 NAFS 710



 Score = 40.0 bits (92), Expect = 0.056
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 21/197 (10%)
 Frame = +1

Query: 313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGN 486
            G  +  + + G +L   +   LD  K +   D+  N L ++ P  L   P ++ L L  N
Sbjct: 622  GCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSN 681

Query: 487  GFTGGLPYSISQMA--PLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQT 657
               G +  S +++    L  +++S N    ++ T +F  L  + T+D +    +      
Sbjct: 682  KLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYD 741

Query: 658  FSSLTNMKNMYLQ--------------NNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
             S +   K + L+              +N F G I  VL +L  +  LNV +N   G+IP
Sbjct: 742  DSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIP 801

Query: 790  PQLQGINSLQTGGNSWN 840
              L  ++ L++   S+N
Sbjct: 802  SSLGSLSILESLDLSFN 818



>gb:AY364476_1602838 Oryza sativa (indica cultivar-group) bacterial
           blight resistance protein (Xa26) gene, complete cds.
          Length = 1103

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 67/230 (29%), Positives = 102/230 (44%), Gaps = 14/230 (6%)
 Frame = +1

Query: 163 PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNR-----VT 327
           P ++ +++  TD + L    + L+ P  +       G P    W GVSCS +R     VT
Sbjct: 31  PIASKSNSSDTDLAALLAFKAQLSDPNNILAGNWTTGTPFCR-WVGVSCSSHRRRRQRVT 89

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLP 507
            +++  + L G +   L  +  +                        LNL   G TG +P
Sbjct: 90  ALELPNVPLQGELSSHLGNISFLFI----------------------LNLTNTGLTGSVP 127

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
             I ++  LE L++ HN + G +     +LT L  L+  FN L G IP     L ++ +M
Sbjct: 128 NKIGRLRRLELLDLGHNAMSGGIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSM 187

Query: 688 YLQNNVFTGTI--DVLANLP-LDNLNVENNHFTGWIP------PQLQGIN 810
            L++N  TG+I  D+  N P L  LNV NN  +G IP      P LQ +N
Sbjct: 188 NLRHNYLTGSIPDDLFNNTPLLTYLNVGNNSLSGLIPGCIGSLPILQHLN 237



 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 57/185 (30%), Positives = 91/185 (49%), Gaps = 31/185 (16%)
 Frame = +1

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ----------------------L 450
           + G  L GS+   +D + S+T  D++ NNL   L +                       L
Sbjct: 408 LKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNFLSTVSNCRKLSTLQMDLNYITGIL 467

Query: 451 PPNVQKLN-------LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
           P  V  L+       L+ N  TG LP +IS +  LE +++SHNQL+  +    +++ NL 
Sbjct: 468 PDYVGNLSSQLKWFTLSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQ 527

Query: 610 TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGW 783
            LD S NSL+G IP   + L N+  ++L++N  +G+I  D+     L++L + +N  T  
Sbjct: 528 WLDLSGNSLSGFIPSNTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTST 587

Query: 784 IPPQL 798
           IPP L
Sbjct: 588 IPPSL 592



 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 49/144 (34%), Positives = 75/144 (52%), Gaps = 5/144 (3%)
 Frame = +1

Query: 337  ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPY 510
            +S  +LT ++   L  L  +   D+S N L  +LP  +     +  ++L+ N F+G +PY
Sbjct: 579  LSDNKLTSTIPPSLFHLDKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPY 638

Query: 511  SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            SI Q+  L +LN+S N     V   F +LT L TLD S NS++G IP   ++ T + ++ 
Sbjct: 639  SIGQLQMLTHLNLSANGFYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLN 698

Query: 691  LQNNVFTGTI---DVLANLPLDNL 753
            L  N   G I    V AN+ L  L
Sbjct: 699  LSFNKLHGQIPEGGVFANITLQYL 722



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 39/131 (29%), Positives = 68/131 (51%), Gaps = 2/131 (1%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +++  + +S   L+G++   +  LK +T  D+S N+    +PY +     +  LNL+ NG
Sbjct: 596 DKIVRLDLSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANG 655

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           F   +P S   +  L+ L++SHN + G +     + T L +L+ SFN L G IP+     
Sbjct: 656 FYDSVPDSFGNLTGLQTLDISHNSISGTIPNYLANFTTLVSLNLSFNKLHGQIPEG-GVF 714

Query: 670 TNMKNMYLQNN 702
            N+   YL+ N
Sbjct: 715 ANITLQYLEGN 725



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/174 (28%), Positives = 87/174 (50%), Gaps = 7/174 (4%)
 Frame = +1

Query: 337  ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPY 510
            +S  +LTG++   +  L ++   D+S N L N++P  +    N+Q L+L+GN  +G +P 
Sbjct: 483  LSNNKLTGTLPATISNLTALEVIDLSHNQLRNAIPESIMTIENLQWLDLSGNSLSGFIPS 542

Query: 511  SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            + + +  +  L +  N++ G +     +LTNL  L  S N L   IP +   L  +  + 
Sbjct: 543  NTALLRNIVKLFLESNEISGSIPKDMRNLTNLEHLLLSDNKLTSTIPPSLFHLDKIVRLD 602

Query: 691  LQNNVFTGT--IDVLANLPLDNLNVENNHFTGWIP---PQLQGINSLQTGGNSW 837
            L  N  +G   +DV     +  +++ +NHF+G IP    QLQ +  L    N +
Sbjct: 603  LSRNFLSGALPVDVGYLKQITIMDLSDNHFSGRIPYSIGQLQMLTHLNLSANGF 656



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 57/194 (29%), Positives = 96/194 (49%), Gaps = 12/194 (6%)
 Frame = +1

Query: 298 GVSCSGNRVTEIQISGLQ---LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL---PPN 459
           G+  +   +T +Q+  LQ   L G +  +L  L S+ + ++  N L  S+P  L    P 
Sbjct: 149 GIPAAIGNLTRLQLLNLQFNQLYGPIPAELQGLHSLGSMNLRHNYLTGSIPDDLFNNTPL 208

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           +  LN+  N  +G +P  I  +  L++LN   N L G V     +++ LST+    N L 
Sbjct: 209 LTYLNVGNNSLSGLIPGCIGSLPILQHLNFQANNLTGAVPPAIFNMSKLSTISLISNGLT 268

Query: 640 GNIP-QTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPP---QLQ 801
           G IP  T  SL  ++   +  N F G I + LA  P L  + +  N F G +PP   +L 
Sbjct: 269 GPIPGNTSFSLPVLRWFAISKNNFFGQIPLGLAACPYLQVIAMPYNLFEGVLPPWLGRLT 328

Query: 802 GINSLQTGGNSWNS 843
            ++++  GGN++++
Sbjct: 329 NLDAISLGGNNFDA 342



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 37/153 (24%), Positives = 74/153 (48%), Gaps = 7/153 (4%)
 Frame = +1

Query: 376 LDQLKSVTTFDISTNNL-GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLN 546
           L +L ++    +  NN     +P +L     +  L+L     TG +P  I  +  L +L+
Sbjct: 324 LGRLTNLDAISLGGNNFDAGPIPTELSNLTMLTVLDLTTCNLTGNIPADIGHLGQLSWLH 383

Query: 547 VSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV 726
           ++ NQL G +     +L++L+ L    N L G++P T  S+ ++  + +  N   G ++ 
Sbjct: 384 LAMNQLTGPIPASLGNLSSLAILLLKGNLLDGSLPSTVDSMNSLTAVDVTENNLHGDLNF 443

Query: 727 LANL----PLDNLNVENNHFTGWIPPQLQGINS 813
           L+ +     L  L ++ N+ TG +P  +  ++S
Sbjct: 444 LSTVSNCRKLSTLQMDLNYITGILPDYVGNLSS 476



>gb:AC069472_1540863 Arabidopsis thaliana chromosome 3 BAC F28J15
           genomic sequence, complete sequence.
          Length = 203

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 59/222 (26%), Positives = 103/222 (46%), Gaps = 5/222 (2%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           +++    L    PS+ + T+  D + L  +  +L +PP L+ W  N    C   W GV C
Sbjct: 7   LSIFFSILFITLPSSYSCTE-NDKNALLQIKKALGNPPLLSSW--NPRTDCCTGWTGVEC 63

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
           +  RVT + ++  +++G + +Q+  L  + T D S       LP+               
Sbjct: 64  TNRRVTGLSVTSGEVSGQISYQIGDLVDLRTLDFSY------LPH--------------- 102

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +P +I+++  L  L + H  L G +      L +L+ LD SFN   G IP + S +
Sbjct: 103 LTGNIPRTITKLKNLNTLYLKHTSLSGPIPDYISELKSLTFLDLSFNQFTGPIPGSLSQM 162

Query: 670 TNMKNMYLQNNVFTGTI-----DVLANLPLDNLNVENNHFTG 780
             ++ + + +N  TG+I       + N+P  NL + NN  +G
Sbjct: 163 PKLEAIQINDNKLTGSIPNSFGSFVGNVP--NLYLSNNKLSG 202



>gb:AB018111_1513765 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2A11.
          Length = 640

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 78/248 (31%), Positives = 111/248 (44%), Gaps = 13/248 (5%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTD-PTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           VA    FLL A  + +   D  +D   L    +S+  PP+L  W  N       SW G++
Sbjct: 9   VAASFFFLLLAATAVLVSADLASDEQALLNFAASVPHPPKLN-WNKNLS--LCSSWIGIT 65

Query: 307 CSGN----RVTEIQISGLQLTGSMG----FQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
           C  +    RV  +++ G+ L GS+      +LD LK                        
Sbjct: 66  CDESNPTSRVVAVRLPGVGLYGSIPPATLGKLDALKV----------------------- 102

Query: 463 QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS----TLDFSFN 630
             L+L  N   G LP  I  +  LEYL + HN   GE+T    SL ++S     LD S+N
Sbjct: 103 --LSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTN--SLPSISKQLVVLDLSYN 158

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGIN 810
           SL+GNIP    +L+ +  +YLQNN F G ID L    +  +N+  N+ +G IP  L+   
Sbjct: 159 SLSGNIPSGLRNLSQITVLYLQNNSFDGPIDSLDLPSVKVVNLSYNNLSGPIPEHLKKSP 218

Query: 811 SLQTGGNS 834
                GNS
Sbjct: 219 EYSFIGNS 226



>gb:AB011476_1511391 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDA7.
          Length = 1015

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 56/161 (34%), Positives = 92/161 (57%), Gaps = 3/161 (1%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMA 528
           QLTG +   L Q + +   D+S NNL  S+P  +   ++ ++L  NG TGGLP ++ +  
Sbjct: 396 QLTGIIPESLSQCQELQAIDLSYNNLSGSIPNGIF-GLEFVDLHSNGLTGGLPGTLPKS- 453

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L+++++S N L G +     SLT L+ L+ + N  +G IP+  SS  +++ + L +N F
Sbjct: 454 -LQFIDLSDNSLTGSLPTGIGSLTELTKLNLAKNRFSGEIPREISSCRSLQLLNLGDNGF 512

Query: 709 TGTI-DVLANLP--LDNLNVENNHFTGWIPPQLQGINSLQT 822
           TG I + L  +P    +LN+  NHFTG IP +   + +L T
Sbjct: 513 TGEIPNELGRIPSLAISLNLSCNHFTGEIPSRFSSLTNLGT 553



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 53/179 (29%), Positives = 93/179 (51%), Gaps = 4/179 (2%)
 Frame = +1

Query: 292 WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQ 465
           W+  +C    +  + ++   L+G +   +  LK V T  + T+ L   +P ++     +Q
Sbjct: 211 WEIGNCES--LVTLGLAETSLSGRLPASIGNLKKVQTIALYTSLLSGPIPDEIGNCTELQ 268

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
            L L  N  +G +P S+ ++  L+ L +  N L G++     +   L  +D S N L GN
Sbjct: 269 NLYLYQNSISGSIPVSMGRLKKLQSLLLWQNNLVGKIPTELGTCPELFLVDLSENLLTGN 328

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTI-DVLAN-LPLDNLNVENNHFTGWIPPQLQGINSL 816
           IP++F +L N++ + L  N  +GTI + LAN   L +L ++NN  +G IPP +  + SL
Sbjct: 329 IPRSFGNLPNLQELQLSVNQLSGTIPEELANCTKLTHLEIDNNQISGEIPPLIGKLTSL 387



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 62/215 (28%), Positives = 105/215 (48%), Gaps = 15/215 (6%)
 Frame = +1

Query: 223 SSLN-SPPQLTKWTANGGDPCGESWKGVSCSGN-RVTEIQISGLQLTGSM-GFQLDQLKS 393
           S LN S   L+ W A+  +PC   W G+ C+   +V+EIQ+  +   G +    L Q+KS
Sbjct: 40  SQLNISGDALSSWKASESNPC--QWVGIKCNERGQVSEIQLQVMDFQGPLPATNLRQIKS 97

Query: 394 VTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ 567
           +T   +++ NL  S+P +L     ++ L+LA N  +G +P  I ++  L+ L+++ N L+
Sbjct: 98  LTLLSLTSVNLTGSIPKELGDLSELEVLDLADNSLSGEIPVDIFKLKKLKILSLNTNNLE 157

Query: 568 GEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT--GTIDVLANLP 741
           G +     +L NL  L    N LAG IP+T   L N++       +F   G  ++   LP
Sbjct: 158 GVIPSELGNLVNLIELTLFDNKLAGEIPRTIGELKNLE-------IFRAGGNKNLRGELP 210

Query: 742 --------LDNLNVENNHFTGWIPPQLQGINSLQT 822
                   L  L +     +G +P  +  +  +QT
Sbjct: 211 WEIGNCESLVTLGLAETSLSGRLPASIGNLKKVQT 245



 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 56/170 (32%), Positives = 83/170 (48%), Gaps = 6/170 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           I +S   LTGS+   +  L  +T  +++ N     +P ++    ++Q LNL  NGFTG +
Sbjct: 457 IDLSDNSLTGSLPTGIGSLTELTKLNLAKNRFSGEIPREISSCRSLQLLNLGDNGFTGEI 516

Query: 505 PYSISQMAPLEY-LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P  + ++  L   LN+S N   GE+   F SLTNL TLD S N LAGN+    + L N+ 
Sbjct: 517 PNELGRIPSLAISLNLSCNHFTGEIPSRFSSLTNLGTLDVSHNKLAGNL-NVLADLQNLV 575

Query: 682 NMYLQNNVFTGTID---VLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           ++ +  N F+G +        LPL  L      F    P      N +QT
Sbjct: 576 SLNISFNEFSGELPNTLFFRKLPLSVLESNKGLFISTRPE-----NGIQT 620



 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 41/151 (27%), Positives = 75/151 (49%), Gaps = 2/151 (1%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G +  +L     +   D+S N L  ++P      PN+Q+L L+ N  +G +P  ++  
Sbjct: 301 LVGKIPTELGTCPELFLVDLSENLLTGNIPRSFGNLPNLQELQLSVNQLSGTIPEELANC 360

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L +L + +NQ+ GE+  +   LT+L+      N L G IP++ S    ++ + L  N 
Sbjct: 361 TKLTHLEIDNNQISGEIPPLIGKLTSLTMFFAWQNQLTGIIPESLSQCQELQAIDLSYNN 420

Query: 706 FTGTIDVLANLPLDNLNVENNHFTGWIPPQL 798
            +G+I       L+ +++ +N  TG +P  L
Sbjct: 421 LSGSIP-NGIFGLEFVDLHSNGLTGGLPGTL 450



>gb:AE016959_1023018 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC022457_1538983
           Oryza sativa chromosome 10 BAC OSJNBa0006L06 genomic
           sequence, complete sequence.>gb:AE017103_1752837 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           57 of 77 of the complete sequence.
          Length = 940

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 57/164 (34%), Positives = 92/164 (56%), Gaps = 5/164 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLP--YQLPPNVQKLNLAGNGF 492
           +T I ++G +LTG +   L +L  V  F++S N L G  LP  +    N++     GN F
Sbjct: 100 LTVIGLAGNKLTGKLPVALARLTRVREFNVSKNMLSGEVLPDYFTAWTNLEVFQADGNRF 159

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P +I+  + LE+L+++ N L G +  +  +L NL  LD + N LAG IP+T  +LT
Sbjct: 160 TGEIPTAITMASRLEFLSLATNNLSGAIPPVIGTLANLKLLDLAENKLAGAIPRTIGNLT 219

Query: 673 NMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQL 798
           +++ + L  N  TG + D L ++  L  L+V +N   G +P  L
Sbjct: 220 SLETLRLYTNKLTGRLPDELGDMAALQRLSVSSNMLEGELPAGL 263



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 39/153 (25%), Positives = 75/153 (49%), Gaps = 4/153 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL---PPNVQKLNLAGNGFTGGLPYSISQ 522
           L+G++  +  +   ++   ++ N     LP  +    P ++ L L  N F+G +P     
Sbjct: 279 LSGAIPPEFGRNGQLSIVSMANNRFSGELPRGVCASAPRLRWLGLDDNQFSGTVPACYRN 338

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L  L ++ N+L G+V+ +  S  +L  LD S NS  G +P+ ++   ++  ++L  N
Sbjct: 339 LTNLVRLRMARNKLAGDVSEILASHPDLYYLDLSGNSFDGELPEHWAQFKSLSFLHLSGN 398

Query: 703 VFTGTIDV-LANLPLDNLNVENNHFTGWIPPQL 798
              G I      + L +L++ +N   G IPP+L
Sbjct: 399 KIAGAIPASYGAMSLQDLDLSSNRLAGEIPPEL 431



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 39/168 (23%), Positives = 78/168 (46%), Gaps = 5/168 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S  Q +G +   L +L  + +  + +N L   +P  +     ++ L L+GN   G +
Sbjct: 7   LNLSSNQFSGEIPASLAKLTKLQSVVLGSNLLHGGVPPVIGNISGLRTLELSGNPLGGAI 66

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P ++ ++  LE++NVS   L+  +        NL+ +  + N L G +P   + LT ++ 
Sbjct: 67  PTTLGKLRSLEHINVSLAGLESTIPDELSLCANLTVIGLAGNKLTGKLPVALARLTRVRE 126

Query: 685 MYLQNNVFTGTI---DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
             +  N+ +G +      A   L+    + N FTG IP  +   + L+
Sbjct: 127 FNVSKNMLSGEVLPDYFTAWTNLEVFQADGNRFTGEIPTAITMASRLE 174



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 4/119 (3%)
 Frame = +1

Query: 454 PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
           PN++ LNL+ N F+G +P S++++  L+ + +  N L G V  +  +++ L TL+ S N 
Sbjct: 2   PNLEHLNLSSNQFSGEIPASLAKLTKLQSVVLGSNLLHGGVPPVIGNISGLRTLELSGNP 61

Query: 634 LAGNIPQTFSSLTNMKNMYLQ----NNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL 798
           L G IP T   L +++++ +      +     + + ANL +  + +  N  TG +P  L
Sbjct: 62  LGGAIPTTLGKLRSLEHINVSLAGLESTIPDELSLCANLTV--IGLAGNKLTGKLPVAL 118



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 2/103 (1%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGG 501
           ++ +S  +L G +  +L  L  +T  ++  N L   +P  L     ++ L+L+GN   GG
Sbjct: 415 DLDLSSNRLAGEIPPELGSLP-LTKLNLRRNALSGRVPATLGNAARMEMLDLSGNALDGG 473

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
           +P  ++++A + YLN+S N L GEV  +   + +L+TLD S N
Sbjct: 474 VPVELTKLAEMWYLNLSSNNLSGEVPPLLGKMRSLTTLDLSGN 516



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 2/108 (1%)
 Frame = +1

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           M  LE+LN+S NQ  GE+      LT L ++    N L G +P    +++ ++ + L  N
Sbjct: 1   MPNLEHLNLSSNQFSGEIPASLAKLTKLQSVVLGSNLLHGGVPPVIGNISGLRTLELSGN 60

Query: 703 VFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
              G I   L  L  L+++NV        IP +L    +L   G + N
Sbjct: 61  PLGGAIPTTLGKLRSLEHINVSLAGLESTIPDELSLCANLTVIGLAGN 108



>gb:AP004069_1837219 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1626_B09.
          Length = 999

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 76/289 (26%), Positives = 116/289 (40%), Gaps = 66/289 (22%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAV-------ADTDPTD--ASVLRGLFSSLNSPPQLTKWTANGGDPC 282
           V LL   LL   P+AV       + T+ TD  A+ L    S ++ P     W      PC
Sbjct: 5   VILLCSTLLLYSPAAVCTVGSSSSSTNATDKQAAALLSFRSMVSDPSGALTWWNASNHPC 64

Query: 283 GESWKGVSCSGNR----VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-------- 426
              W+GV+C   R    V  + +    L+G +   L  L  +   D+  N L        
Sbjct: 65  --RWRGVACGRGRHAGSVVALSLGSSSLSGLISPFLGNLSFLRVLDLGANQLVGQIPPEL 122

Query: 427 ------------GNSLPYQLPP-------------------------------NVQKLNL 477
                       GNSL   +PP                               N+  LNL
Sbjct: 123 GRLGRLRELNLSGNSLEGGIPPALAIGCSKLESLSLDSNHLRGEIPGEIAALRNLAYLNL 182

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N  +G +P S+  ++ L +LN+  N L GE+     +L+ L+ L    N L+G IP +
Sbjct: 183 RANNLSGEIPPSLGNLSSLYFLNLGFNMLFGEIPASLGNLSQLNALGIQHNQLSGGIPSS 242

Query: 658 FSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQL 798
              L N+ ++ LQ N   G+I   + N+  L + +VENN  +G +PP +
Sbjct: 243 LGHLNNLTSLLLQANGLIGSIPPNICNISFLKHFSVENNELSGMLPPNV 291



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 5/168 (2%)
 Frame = +1

Query: 301 VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKL 471
           V C+   +  + +     +GS+   +  + S+++   S NN   ++P   + +      L
Sbjct: 466 VICNLTHMDSLDLGRNNFSGSIPITVGNMVSLSSLRFSFNNFIGTIPTSLFNITTLSIYL 525

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +++ N   G +P  +  +  L YL+  +NQL GE+ + F     L  L    NS  GNIP
Sbjct: 526 DISYNHLDGSIPPEVGNLPNLVYLDARYNQLSGEIPITFEKCQLLQILYLQNNSFIGNIP 585

Query: 652 QTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIP 789
            +FS +  ++ + L +N F+G I       L L +LN+  N+F G +P
Sbjct: 586 SSFSEMKGLEILDLSSNNFSGQIPKFFGHFLTLYDLNLSYNNFDGEVP 633



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 45/177 (25%), Positives = 90/177 (50%), Gaps = 6/177 (3%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLK-SVTTFDISTNNLGNSLPYQLPP--NVQKLN 474
           +CS   V E++ +  + +G++   +  L  S+T   +++N +  ++P ++    N+  L 
Sbjct: 372 NCSQLEVLELEAN--KFSGTLPSVISNLSASLTILTLASNKIVGNMPREIGKLINLGALV 429

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
              N  TG  P S+  +  L  L + +N   G    +  +LT++ +LD   N+ +G+IP 
Sbjct: 430 AHNNFLTGSPPSSLGMLQNLRILWLDNNYFSGPFPRVICNLTHMDSLDLGRNNFSGSIPI 489

Query: 655 TFSSLTNMKNMYLQNNVFTGTIDV-LANLPLDN--LNVENNHFTGWIPPQLQGINSL 816
           T  ++ ++ ++    N F GTI   L N+   +  L++  NH  G IPP++  + +L
Sbjct: 490 TVGNMVSLSSLRFSFNNFIGTIPTSLFNITTLSIYLDISYNHLDGSIPPEVGNLPNL 546



 Score = 41.2 bits (95), Expect = 0.025
 Identities = 29/115 (25%), Positives = 53/115 (46%), Gaps = 4/115 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQ 522
           QL+G +    ++ + +    +  N+   ++P  +     ++ L+L+ N F+G +P     
Sbjct: 555 QLSGEIPITFEKCQLLQILYLQNNSFIGNIPSSFSEMKGLEILDLSSNNFSGQIPKFFGH 614

Query: 523 MAPLEYLNVSHNQLQGEVTV--MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
              L  LN+S+N   GEV V  +F + T +S      N L G IP       ++K
Sbjct: 615 FLTLYDLNLSYNNFDGEVPVFGVFANATGISVQ--GNNKLCGGIPDLHLPTCSLK 667



>gb:AP003276_1827044 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0516D04.
          Length = 1040

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 71/235 (30%), Positives = 110/235 (46%), Gaps = 10/235 (4%)
 Frame = +1

Query: 166 PSAVADTDPTDASVLRGLFSSLNSPPQL---TKWTAN-GGDPCGESWKGVSCSGN---RV 324
           PS+    + +D   L    ++L+   QL   + W  + G D C   W GV+CS     RV
Sbjct: 23  PSSSLPDEYSDREALLQFRAALSVSDQLGSLSSWNGSTGSDFC--RWGGVTCSRRHPGRV 80

Query: 325 TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN-VQKLNLAGNGFTGG 501
           T + +S L L GS+   +  L  + + D+  N L   + +    + +  L LA N F+G 
Sbjct: 81  TSLNLSSLGLAGSISPVIGNLTFLQSLDLFNNTLSGDVYFTSQLHRLHYLELAYNDFSGD 140

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           LP  +   + L +L+V  N+L G +     SL  L  L    N+L G +P +  +LT + 
Sbjct: 141 LPVGLCNCSNLVFLSVEANELHGAIPSCLGSLLQLKVLYLGENNLTGTVPPSLGNLTMLL 200

Query: 682 NMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            + L  N   GTI + L+ L  L  +    N  +G +PP    I+SLQ  G S N
Sbjct: 201 QIALYQNQLEGTIPEGLSGLRYLQYIQASRNSLSGTLPPLFFNISSLQYLGFSSN 255



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 51/182 (28%), Positives = 87/182 (47%), Gaps = 29/182 (15%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---------------------Q 447
           + +S  QL GS+   L  ++ +T  D+S+N L  S+P                       
Sbjct: 451 LDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSDNYLSGA 510

Query: 448 LPPNVQKL------NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLS 609
           LPP V  L      +L+ N  +G +P ++   A L YL +  N   G +     +L  LS
Sbjct: 511 LPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIPPSLGNLRGLS 570

Query: 610 TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGW 783
            L+ + N+L+G+IPQ  S++  ++ +YL +N  +GTI   +  +  L  L++  NH +G 
Sbjct: 571 ILNLTRNALSGSIPQQLSNIHGLQQLYLAHNNLSGTIPQFLEKSSALIELDLSYNHLSGE 630

Query: 784 IP 789
           +P
Sbjct: 631 VP 632



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 51/185 (27%), Positives = 86/185 (46%), Gaps = 29/185 (15%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           Q++G +   +  LK +   +   NNL   +P  +    N++ L L  N  +GG+P+SI  
Sbjct: 385 QISGIIPPGIGSLKGIEDLEFQGNNLFGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGN 444

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM-KNMYLQN 699
           +  L  L++S+NQL G +     S+  L+ LD S N L  +IP    SL ++  ++ L +
Sbjct: 445 LTQLLTLDLSNNQLNGSIPKSLGSMERLTNLDLSSNRLVESIPDVIFSLPSLTDSLLLSD 504

Query: 700 NVFTGTID---------VLANLPLDNLN-----------------VENNHFTGWIPPQLQ 801
           N  +G +             +L  +NL+                 +++NHFTG IPP L 
Sbjct: 505 NYLSGALPPKVGNLRRATTLSLSRNNLSGKIPTTLGDCASLVYLALDSNHFTGSIPPSLG 564

Query: 802 GINSL 816
            +  L
Sbjct: 565 NLRGL 569



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 53/192 (27%), Positives = 95/192 (49%), Gaps = 14/192 (7%)
 Frame = +1

Query: 283 GESWKG-VSCSGNRVTEIQISGL---QLTGSMGFQLDQLKSVT----TFDISTNNLGNSL 438
           G ++ G +  S +  TEIQ+ GL      G +  ++ +L  V+    +  +  N+ G+  
Sbjct: 281 GNNFSGTIPASLSNATEIQVLGLARNSFEGRIPPEIGKLCPVSVQMGSNKLQANDAGDWE 340

Query: 439 PYQLPPN---VQKLNLAGNGFTGGLPYSISQMA-PLEYLNVSHNQLQGEVTVMFVSLTNL 606
             +   N   +Q ++L+ N   G LP  I+ ++  +++L+++ NQ+ G +     SL  +
Sbjct: 341 FLRYFTNCTRLQVIDLSDNTLGGILPSFIANLSRSIQWLSMAKNQISGIIPPGIGSLKGI 400

Query: 607 STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTG 780
             L+F  N+L G+IP     L N+K ++L  N  +G I   + NL  L  L++ NN   G
Sbjct: 401 EDLEFQGNNLFGDIPGDIGRLRNLKVLWLNMNNMSGGIPFSIGNLTQLLTLDLSNNQLNG 460

Query: 781 WIPPQLQGINSL 816
            IP  L  +  L
Sbjct: 461 SIPKSLGSMERL 472



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 51/185 (27%), Positives = 85/185 (45%), Gaps = 17/185 (9%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAG--NGFT 495
           IQ S   L+G++      + S+     S+N L   LP       PN+Q L L G  N F+
Sbjct: 226 IQASRNSLSGTLPPLFFNISSLQYLGFSSNKLHGRLPPDAGTRLPNLQVLRLGGIGNNFS 285

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN------IPQT 657
           G +P S+S    ++ L ++ N  +G +      L  +S +    N L  N        + 
Sbjct: 286 GTIPASLSNATEIQVLGLARNSFEGRIPPEIGKLCPVS-VQMGSNKLQANDAGDWEFLRY 344

Query: 658 FSSLTNMKNMYLQNNVFTGTI-DVLANL--PLDNLNVENNHFTGWIPP---QLQGINSLQ 819
           F++ T ++ + L +N   G +   +ANL   +  L++  N  +G IPP    L+GI  L+
Sbjct: 345 FTNCTRLQVIDLSDNTLGGILPSFIANLSRSIQWLSMAKNQISGIIPPGIGSLKGIEDLE 404

Query: 820 TGGNS 834
             GN+
Sbjct: 405 FQGNN 409



>gb:AF529302_1809045 Glycine max polygalacturonase inhibitor protein
           mRNA, complete cds.
          Length = 333

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 67/239 (28%), Positives = 106/239 (44%), Gaps = 12/239 (5%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           + LLI   L+AP  A++     D  VL  +   L +P +L+ W     D C   W+GV+C
Sbjct: 3   MVLLIVLYLSAP--ALSKLCNQDKQVLLQIKKELGNPTKLSSWLPTT-DYCDTIWEGVAC 59

Query: 310 ---SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN-- 474
              S N+   + I  L                       ++L    PY +PP++  L   
Sbjct: 60  VTDSNNQTCRVDILYL-----------------------SHLNLPKPYPIPPSIGNLPYL 96

Query: 475 ----LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAG 642
               L    F G +P SI+ +  L YLN+++  + G +      +  L ++DFS+N+L+G
Sbjct: 97  NYLYLIDTNFFGAIPSSIANLTNLNYLNITYTNVSGTIPDFLSHIKTLVSIDFSYNNLSG 156

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL--PLDNLNVENNHFTGWIPPQLQGIN 810
           N+P + SSL N+  M    N  +G I D   +    L  + +  N  TG IP  L  +N
Sbjct: 157 NLPASLSSLPNLGEMIFTGNRISGAIPDSFGSFSEELILMRLSRNRLTGKIPATLAKLN 215



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 52/198 (26%), Positives = 93/198 (46%), Gaps = 29/198 (14%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + I+   ++G++   L  +K++ + D S NNL  +LP  L   PN+ ++   GN  +G +
Sbjct: 123 LNITYTNVSGTIPDFLSHIKTLVSIDFSYNNLSGNLPASLSSLPNLGEMIFTGNRISGAI 182

Query: 505 PYSISQMAP------------------------LEYLNVSHNQLQGEVTVMFVSLTNLST 612
           P S    +                         L +L++S N L+G+ +V+F S  +   
Sbjct: 183 PDSFGSFSEELILMRLSRNRLTGKIPATLAKLNLRFLDLSRNMLEGDASVLFGSEKDTVQ 242

Query: 613 LDFSFNSLAGNIPQT-FSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGW 783
           ++   N+LA ++ +  FS +  + +  L++N   GT+   + A   L  LNV NN+  G 
Sbjct: 243 INLGKNNLAFDLGKVEFSEILAILD--LRHNRIYGTLPQGLTALKHLTKLNVSNNNLCGE 300

Query: 784 IPPQLQGINSLQTGGNSW 837
           IP   QG N  +   NS+
Sbjct: 301 IP---QGGNLQRIKVNSY 315



 Score = 40.8 bits (94), Expect = 0.033
 Identities = 41/167 (24%), Positives = 72/167 (43%), Gaps = 2/167 (1%)
 Frame = +1

Query: 223 SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTT 402
           +SL+S P L +    G    G            +  +++S  +LTG +   L +L ++  
Sbjct: 160 ASLSSLPNLGEMIFTGNRISGAIPDSFGSFSEELILMRLSRNRLTGKIPATLAKL-NLRF 218

Query: 403 FDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
            D+S N L    S+ +    +  ++NL  N     L   +     L  L++ HN++ G +
Sbjct: 219 LDLSRNMLEGDASVLFGSEKDTVQINLGKNNLAFDLG-KVEFSEILAILDLRHNRIYGTL 277

Query: 577 TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
                +L +L+ L+ S N+L G IPQ  +      N Y  N    G+
Sbjct: 278 PQGLTALKHLTKLNVSNNNLCGEIPQGGNLQRIKVNSYAHNKCLCGS 324



>gb:AF503433_1806732 Sorghum bicolor BAC 170F8, complete sequence.
          Length = 1053

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 75/268 (27%), Positives = 122/268 (45%), Gaps = 40/268 (14%)
 Frame = +1

Query: 133 ALLIGFLLNAPPSAVADT-----DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK 297
           ALL+  LL A  S  + +     +  D S L  + ++  +   L +W+ + G P   SW 
Sbjct: 13  ALLLLLLLTAAVSVSSSSGLRRGEDQDRSALLQIKNAFPAVELLQQWSPDSGGPNHCSWP 72

Query: 298 GVSC-SGNRVTEIQI--------SGLQLTGSM-------------GFQLD---------- 381
           GV+C S +RV  +++         G +L G +              F L           
Sbjct: 73  GVTCDSSSRVVALEVLSPSRRSGHGRELAGELPAAVGLLAELKEVSFPLHGLRGEIPGEI 132

Query: 382 -QLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            +L+ +   ++  N+L   LP   PP ++ L+LA N   G +P S+S    LE L++S N
Sbjct: 133 WRLEKLEVVNLPGNSLRGVLPSAFPPRLRVLSLASNLLHGEIPSSLSTCEDLERLDLSGN 192

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LAN 735
           +  G V      LT L  LD S N LAG IP +  +   ++++ L +N   G+I   + +
Sbjct: 193 RFTGSVPRALGGLTKLKWLDLSGNLLAGGIPSSLGNCRQLRSLRLFSNSLHGSIPAGIGS 252

Query: 736 L-PLDNLNVENNHFTGWIPPQLQGINSL 816
           L  L  L+V  N  +G +PP+L   + L
Sbjct: 253 LKKLRVLDVSRNRLSGLVPPELGNCSDL 280



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 47/179 (26%), Positives = 86/179 (48%), Gaps = 4/179 (2%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQLTGSMGFQLDQ-LKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNL 477
           CS  +   +     +++G +  +L +   ++   D++ N +   +P    L   + K+++
Sbjct: 365 CSNFKGLVVSFRDNKISGQLTAELSRKCSAIRALDLAGNQISGMMPDNVGLLGALVKMDM 424

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           + N   G +P S   +  L++L+++ N L G +      L +L  LD S NSLAG IP  
Sbjct: 425 SRNFLEGQIPASFEDLKTLKFLSLAGNNLSGRIPSCLGQLRSLRVLDLSSNSLAGEIPNN 484

Query: 658 FSSLTNMKNMYLQNNVFTGTIDVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
             +L ++  + L NN  +G I  LA+ P L   NV  N  +G +P ++  +      GN
Sbjct: 485 LVTLRDITVLLLNNNKLSGNIPDLASSPSLSIFNVSFNDLSGPLPSKVHSLTCDSIRGN 543



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 53/210 (25%), Positives = 91/210 (43%), Gaps = 19/210 (9%)
 Frame = +1

Query: 208 LRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQL 387
           LRG+  S   PP+L   +       GE    +S   + +  + +SG + TGS+   L  L
Sbjct: 148 LRGVLPSA-FPPRLRVLSLASNLLHGEIPSSLSTCED-LERLDLSGNRFTGSVPRALGGL 205

Query: 388 KSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ 561
             +   D+S N L   +P  L     ++ L L  N   G +P  I  +  L  L+VS N+
Sbjct: 206 TKLKWLDLSGNLLAGGIPSSLGNCRQLRSLRLFSNSLHGSIPAGIGSLKKLRVLDVSRNR 265

Query: 562 LQG----------EVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT 711
           L G          +++V+ +S  + S     FN   G IP++ ++L  ++ +++      
Sbjct: 266 LSGLVPPELGNCSDLSVLILSSQSNSVKSHEFNLFKGGIPESVTALPKLRVLWVPRAGLE 325

Query: 712 GTI-------DVLANLPLDNLNVENNHFTG 780
           GT+       D   N       V++N F+G
Sbjct: 326 GTLPSNWGSADRFGNKMTYMFVVDHNKFSG 355



>gb:AF466199_1802194 Sorghum bicolor putative receptor protein
           kinase, aminoalcoholphosphotransferase, putative
           growth-regulating factor 1, putative GAG-POL precursor,
           putative GAG-POL precursor, putative RIRE2 orf3,
           putative anthocyanin regulatory C1, putative protein
           T30F21.6, putative copia polyprotein, putative copia
           polyprotein, putative protein NP_196765.1, and gb
           protein genes, complete cds; and putative zinc finger
           protein gene, partial cds.
          Length = 921

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 79/267 (29%), Positives = 120/267 (44%), Gaps = 29/267 (10%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           A   L+  LL A   AVAD   T   + +   S  N    L  W   G D C  SW+GV 
Sbjct: 5   AARALVALLLVAV--AVADDGATLVEIKK---SFRNVGNVLYDWA--GDDYC--SWRGVL 55

Query: 307 CSGNR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLN 474
           C      V  + +SGL L G +   +  LKS+ + D+ +N L   +P ++    +++ L+
Sbjct: 56  CDNVTFAVAALNLSGLNLEGEISPAVGSLKSLVSIDLKSNGLSGQIPDEIGDCSSLRTLD 115

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN-------- 630
            + N   G +P+SIS++  LE L + +NQL G +      L NL  LD + N        
Sbjct: 116 FSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEIPR 175

Query: 631 ----------------SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLPLDNLNV 759
                           SL G IP T  + T+ + + L  N FTG I   +  L +  L++
Sbjct: 176 LIYWNEVLQYLDVKNNSLTGVIPDTIGNCTSFQVLDLSYNRFTGPIPFNIGFLQVATLSL 235

Query: 760 ENNHFTGWIPPQLQGINSLQTGGNSWN 840
           + N FTG IP  +  + +L     S+N
Sbjct: 236 QGNKFTGPIPSVIGLMQALAVLDLSYN 262



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 51/175 (29%), Positives = 90/175 (51%), Gaps = 4/175 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           ++++  QLTGS+  +L +L  +   +++ N+L   +P  L    N+   N  GN   G +
Sbjct: 305 LELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLNGTI 364

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P S+ ++  + YLN+S N + G + +    + NL TLD S N + G IP +  SL ++  
Sbjct: 365 PRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSIGSLEHLLR 424

Query: 685 MYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           + L  N   G I     NL  +  +++  NH  G IP +L+ + +L     S+N+
Sbjct: 425 LNLSKNGLVGFIPAEFGNLRSVMEIDLSYNHLGGLIPQELEMLQNLMLLNVSYNN 479



 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 56/176 (31%), Positives = 83/176 (47%), Gaps = 6/176 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-PNVQKLNLAGNGFTGGLP 507
           + +    LTG +   +    S    D+S N     +P+ +    V  L+L GN FTG +P
Sbjct: 186 LDVKNNSLTGVIPDTIGNCTSFQVLDLSYNRFTGPIPFNIGFLQVATLSLQGNKFTGPIP 245

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
             I  M  L  L++S+NQL G +  +  +LT    L    N L G+IP    +++ +  +
Sbjct: 246 SVIGLMQALAVLDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSIPPELGNMSTLHYL 305

Query: 688 YLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQ---GINSLQTGGNSWN 840
            L +N  TG+I   L  L  L +LN+ NNH  G IP  L     +NS    GN  N
Sbjct: 306 ELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSFNAYGNKLN 361



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 49/156 (31%), Positives = 79/156 (50%), Gaps = 2/156 (1%)
 Frame = +1

Query: 343 GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSI 516
           G +L G++   L +L+S+T  ++S+N +  S+P +L    N+  L+L+ N  TG +P SI
Sbjct: 357 GNKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNLDTLDLSCNMMTGPIPSSI 416

Query: 517 SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ 696
             +  L  LN+S N L G +   F +L ++  +D S+N L G IPQ    L N+  + + 
Sbjct: 417 GSLEHLLRLNLSKNGLVGFIPAEFGNLRSVMEIDLSYNHLGGLIPQELEMLQNLMLLNVS 476

Query: 697 NNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQG 804
            N   G +      P D      N+FT + P    G
Sbjct: 477 YNNLAGVV------PAD------NNFTRFSPDSFLG 500



>gb:AF177673_1774649 Arabidopsis thaliana cultivar Lansberg erecta
           receptor-like protein CLAVATA2 (CLV2) gene, complete
           cds.
          Length = 720

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 68/214 (31%), Positives = 111/214 (51%), Gaps = 7/214 (3%)
 Frame = +1

Query: 169 SAVADTDPTD-ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG--NRVTEIQI 339
           S + D DP D AS+L    S  +    L+ W    G  C  +W G++C     +V  + +
Sbjct: 25  SQLPDLDPQDKASLLIFRVSIHDLNRSLSTWY---GSSCS-NWTGLACQNPTGKVLSLTL 80

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYS 513
           SGL L+G +   L +L S+ + D+S NN   ++P  +    N++ LNL+ N F G +P +
Sbjct: 81  SGLNLSGQIHPSLCKLSSLQSLDLSHNNFCGNIPSCFGSLRNLRTLNLSRNRFIGSIPPT 140

Query: 514 ISQMAPLEYLNVSHNQ-LQGEVTVMFVSLT-NLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
              +  L  + +S N+ L G V   F   + NL  +D SF S  G +P++   L ++K +
Sbjct: 141 FMSLKELGEVVLSENRNLGGVVPHWFGDFSMNLERVDLSFCSFVGELPESLLYLKSLKYL 200

Query: 688 YLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
            L++N  TGT+      PL  LN+ +N F+G +P
Sbjct: 201 NLESNNMTGTLRDFQQ-PLVVLNLASNRFSGTLP 233



 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 49/153 (32%), Positives = 80/153 (52%), Gaps = 9/153 (5%)
 Frame = +1

Query: 388 KSVTTFDISTNNLGNSLPYQLPPNVQKL-----NLAGNGFTGGLPYSISQMAPLEYLNVS 552
           + +   D+S N     LP ++    +KL     +L+ N F+G +P  I+++  L+ L +S
Sbjct: 288 EKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLDLSHNSFSGDIPLRITELKSLQALRLS 347

Query: 553 HNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI---- 720
           HN L G++     +LT L  +D S NSL G+IP        +  + + NN  +G I    
Sbjct: 348 HNLLTGDIPARIGNLTYLQVIDLSHNSLTGSIPLNIVGCFQLLALMISNNNLSGEIQPEL 407

Query: 721 DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           D L +L +  L++ NNH +G IP  L G+ SL+
Sbjct: 408 DALDSLKI--LDISNNHISGEIPLTLAGLKSLE 438



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 50/185 (27%), Positives = 94/185 (50%), Gaps = 15/185 (8%)
 Frame = +1

Query: 319 RVTEIQ------ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL- 477
           R+TE++      +S   LTG +  ++  L  +   D+S N+L  S+P  +    Q L L 
Sbjct: 334 RITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNSLTGSIPLNIVGCFQLLALM 393

Query: 478 -AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            + N  +G +   +  +  L+ L++S+N + GE+ +    L +L  +D S N+L+GN+ +
Sbjct: 394 ISNNNLSGEIQPELDALDSLKILDISNNHISGEIPLTLAGLKSLEIVDISSNNLSGNLNE 453

Query: 655 TFSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINS----- 813
             +  +N+K + L  N F+GT+   +     +  ++  +N F+ +IP     +NS     
Sbjct: 454 AITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSNRFSWFIPD--DNLNSTRFKD 511

Query: 814 LQTGG 828
            QTGG
Sbjct: 512 FQTGG 516



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 50/173 (28%), Positives = 77/173 (44%), Gaps = 7/173 (4%)
 Frame = +1

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSIS 519
           L+     G   D  + +   ++++N    +LP  Y   P++  LNLA N   GGLP  + 
Sbjct: 202 LESNNMTGTLRDFQQPLVVLNLASNRFSGTLPCFYASRPSLSVLNLAENSLVGGLPSCLG 261

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY--- 690
            +  L +LN+S N    E++   V    L  LD S N  +G +P   S  T    +    
Sbjct: 262 SLKELSHLNLSFNGFNYEISPRLVFSEKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLD 321

Query: 691 LQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           L +N F+G I   +     L  L + +N  TG IP ++  +  LQ    S NS
Sbjct: 322 LSHNSFSGDIPLRITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNS 374



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 47/154 (30%), Positives = 76/154 (49%), Gaps = 7/154 (4%)
 Frame = +1

Query: 379 DQLKSVTTFDISTNNLGNSLPYQLPPN-VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH 555
           D  +S++T+  S+ +    L  Q P   V  L L+G   +G +  S+ +++ L+ L++SH
Sbjct: 47  DLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTLSGLNLSGQIHPSLCKLSSLQSLDLSH 106

Query: 556 NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI----- 720
           N   G +   F SL NL TL+ S N   G+IP TF SL  +  + L  N   G +     
Sbjct: 107 NNFCGNIPSCFGSLRNLRTLNLSRNRFIGSIPPTFMSLKELGEVVLSENRNLGGVVPHWF 166

Query: 721 -DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            D   N  L+ +++    F G +P  L  + SL+
Sbjct: 167 GDFSMN--LERVDLSFCSFVGELPESLLYLKSLK 198



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 47/84 (55%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           ++L+ N   G +P ++ +   +EYLN+S+N L+G++      L  L  LD S NSL+G +
Sbjct: 553 IDLSDNLLHGEIPEALFRQRNIEYLNLSYNFLEGQLP-RLEKLPRLKALDLSHNSLSGQV 611

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
               S+   +  + L +N F+G I
Sbjct: 612 IGNISAPPGLTLLNLSHNCFSGII 635



 Score = 43.1 bits (100), Expect = 0.007
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L S+   D+S N L   +P  L    N++ LNL+ N   G LP  + ++  L+ L++SHN
Sbjct: 547 LLSMVGIDLSDNLLHGEIPEALFRQRNIEYLNLSYNFLEGQLP-RLEKLPRLKALDLSHN 605

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            L G+V     +   L+ L+ S N  +G I +
Sbjct: 606 SLSGQVIGNISAPPGLTLLNLSHNCFSGIITE 637



>gb:AP003858_1834406 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1014_H11.>gb:AP004157_1838353 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1114_D06.>gb:AP005442_1851845 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0073I05.
          Length = 976

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 64/242 (26%), Positives = 105/242 (43%), Gaps = 4/242 (1%)
 Frame = +1

Query: 103 RELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPC 282
           R+L+ L W V +   ++  A       TDP + + L  +     + P  T W   GGDPC
Sbjct: 11  RQLLLLYWLV-IACSWVAAAQAQQAPRTDPVEVAALNAILGRWGTNPPKT-WNITGGDPC 68

Query: 283 GESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-- 456
                G +     + +  +    +     F    +  +T   +   N+  ++P +L    
Sbjct: 69  ----TGTAVDDTNIDDSPVVNPGIKCDCSFNNRTVCHITKLRVYALNVVGTIPAELESLR 124

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
            +  LNL  N  TG +P  I ++  ++YL +  N   GE+     +LT L  L    +  
Sbjct: 125 YLANLNLQQNYLTGPVPSFIGKLTFMQYLGIGSNNFTGELPEELGNLTKLEQLYIDSSGF 184

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGIN 810
           +G  P T S L N++ ++  +N FTG I D L  L  L  L  + N F G IP  L  ++
Sbjct: 185 SGPFPSTLSKLKNLEKLWASDNDFTGKIPDYLGTLTKLVELRFQGNSFQGPIPASLSNLS 244

Query: 811 SL 816
           +L
Sbjct: 245 NL 246



>gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1118_D07.>gb:AP004338_1840410 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0507H12.
          Length = 1023

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 69/232 (29%), Positives = 110/232 (47%), Gaps = 10/232 (4%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPP-QLTKWTANG-GDPCGESWKGVSCSGN-R 321
           LL A  +A       +A  L  + ++L+ P   L  WT N    PC  +W GV+C+    
Sbjct: 12  LLAAVAAAATAAAGGEADALLAVKAALDDPTGALASWTTNTTSSPC--AWSGVACNARGA 69

Query: 322 VTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNG 489
           V  + +SG  LTG + G  L  L+ +   D++ N L   +P    +L P +  LNL+ NG
Sbjct: 70  VVGLDVSGRNLTGGLPGAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNG 129

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G  P  +S++  L  L++ +N L G + +  VS+  L  L    N  +G IP  +   
Sbjct: 130 LNGTFPPQLSRLRALRVLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRW 189

Query: 670 TNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVEN-NHFTGWIPPQLQGINSL 816
             ++ + +  N  +G I   L NL  L  L +   N ++G IPP+L  +  L
Sbjct: 190 GRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDL 241



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 66/234 (28%), Positives = 101/234 (43%), Gaps = 29/234 (12%)
 Frame = +1

Query: 208 LRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQL 387
           L G F S   PP+  +W                    R+  + +SG +L+G +  +L  L
Sbjct: 173 LGGNFFSGGIPPEYGRW-------------------GRLQYLAVSGNELSGKIPPELGNL 213

Query: 388 KSVTTFDISTNN---------LGN------------SLPYQLPP------NVQKLNLAGN 486
            S+    I   N         LGN             L  ++PP      N+  L L  N
Sbjct: 214 TSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVN 273

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
           G  GG+P  + ++A L  L++S+N L GE+   F  L NL+ L+   N L G+IP+    
Sbjct: 274 GLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGD 333

Query: 667 LTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           L +++ + L  N FTG I   +  N     L++ +N  TG +PP L     L+T
Sbjct: 334 LPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLET 387



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 54/180 (30%), Positives = 90/180 (50%), Gaps = 26/180 (14%)
 Frame = +1

Query: 196 DASVLRGLFSSLN-SPPQLTKWTANGGDPC-----GESWKGVSCSGNRVTEI------QI 339
           + S+  GLF   N +  +L     +GG P        +   +S S N++T          
Sbjct: 420 NGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSF 479

Query: 340 SGLQ--------LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK------LNL 477
           SG+Q         TG +  ++ +L+ ++  D+S    GNS    +PP + K      L+L
Sbjct: 480 SGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLS----GNSFDGGVPPEIGKCRLLTYLDL 535

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           + N  +G +P +IS M  L YLN+S NQL GE+     ++ +L+ +DFS+N+L+G +P T
Sbjct: 536 SRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT 595



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 46/178 (25%), Positives = 79/178 (44%), Gaps = 8/178 (4%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGL 504
           +Q+     TG +  +L +       D+S+N L  +LP  L     ++ L   GN   G +
Sbjct: 340 LQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNSLFGAI 399

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS-LTNMK 681
           P S+ +   L  + +  N L G +      L NL+ ++   N ++G  P    +   N+ 
Sbjct: 400 PASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLG 459

Query: 682 NMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNSWN 840
            + L NN  TG +         +  L ++ N FTG IPP+   LQ ++     GNS++
Sbjct: 460 QISLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFD 517



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 44/160 (27%), Positives = 79/160 (49%), Gaps = 4/160 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           ++ + +S   L G +      LK++T  ++  N L   +P  +   P+++ L L  N FT
Sbjct: 289 LSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFT 348

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           GG+P  + +    + L++S N+L G +     +   L TL    NSL G IP +    T+
Sbjct: 349 GGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNSLFGAIPASLGKCTS 408

Query: 676 MKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
           +  + L +N   G+I + L  LP L  + +++N  +G  P
Sbjct: 409 LTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFP 448



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 5/162 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGLPYSISQ 522
           +L G +   +  L S+    +  NN    +P +L  N   Q L+L+ N  TG LP  +  
Sbjct: 322 KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA 381

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              LE L    N L G +       T+L+ +    N L G+IP+    L N+  + LQ+N
Sbjct: 382 GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN 441

Query: 703 VFTGTIDVLANLPLDNL---NVENNHFTGWIPPQLQGINSLQ 819
           + +G    ++     NL   ++ NN  TG +P  +   + +Q
Sbjct: 442 LISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGSFSGVQ 483



 Score = 36.2 bits (82), Expect = 0.80
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 4/73 (5%)
 Frame = +1

Query: 613 LDFSFNSLAGNIP-QTFSSLTNMKNMYLQNNVFTGTIDV-LANLP--LDNLNVENNHFTG 780
           LD S  +L G +P    S L ++  + L  N  +G I   L+ L   L +LN+ NN   G
Sbjct: 73  LDVSGRNLTGGLPGAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNG 132

Query: 781 WIPPQLQGINSLQ 819
             PPQL  + +L+
Sbjct: 133 TFPPQLSRLRALR 145



>gb:AF177674_1774650 Arabidopsis thaliana cultivar Wassilewskia
           receptor-like protein CLAVATA2 (CLV2) gene, complete
           cds.
          Length = 720

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 67/214 (31%), Positives = 110/214 (51%), Gaps = 7/214 (3%)
 Frame = +1

Query: 169 SAVADTDPTD-ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG--NRVTEIQI 339
           S + D DP D AS+L    S  +    L+ W    G  C  +W G++C     +V  +  
Sbjct: 25  SQLPDLDPQDKASLLIFRVSIHDLNRSLSTWY---GSSCS-NWTGLACQNPTGKVLSLTS 80

Query: 340 SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYS 513
           SGL L+G +   L +L S+ + D+S NN   ++P  +    N++ LNL+ N F G +P +
Sbjct: 81  SGLNLSGQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRILNLSRNRFVGSIPAT 140

Query: 514 ISQMAPLEYLNVSHNQ-LQGEVTVMFVSLT-NLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
              +  L  + +S N+ L G +   F   + NL  +D SF S  G +P++   L ++K +
Sbjct: 141 FVSLKELREVVLSENRDLGGVIPHWFGDFSMNLERVDISFCSFVGELPESLLYLKSLKYL 200

Query: 688 YLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
            L++N  TGT+      PL  LN+ +N F+G +P
Sbjct: 201 NLESNNMTGTLRDFQQ-PLVVLNLASNQFSGTLP 233



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/153 (31%), Positives = 80/153 (52%), Gaps = 9/153 (5%)
 Frame = +1

Query: 388 KSVTTFDISTNNLGNSLPYQLPPNVQKL-----NLAGNGFTGGLPYSISQMAPLEYLNVS 552
           + +   D+S N     LP ++    +KL     +L+ N F+G +P  I+++  L+ L +S
Sbjct: 288 EKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLDLSHNSFSGDIPLRITELKSLQALRLS 347

Query: 553 HNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI---- 720
           HN L G++     +LT L  +D S N+L G+IP        +  + + NN  +G I    
Sbjct: 348 HNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQLLALMISNNNLSGEIQPEL 407

Query: 721 DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           D L +L +  L++ NNH +G IP  L G+ SL+
Sbjct: 408 DALDSLKI--LDISNNHISGEIPLTLAGLKSLE 438



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 50/185 (27%), Positives = 93/185 (50%), Gaps = 15/185 (8%)
 Frame = +1

Query: 319 RVTEIQ------ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL- 477
           R+TE++      +S   LTG +  ++  L  +   D+S N L  S+P  +    Q L L 
Sbjct: 334 RITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQLLALM 393

Query: 478 -AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            + N  +G +   +  +  L+ L++S+N + GE+ +    L +L  +D S N+L+GN+ +
Sbjct: 394 ISNNNLSGEIQPELDALDSLKILDISNNHISGEIPLTLAGLKSLEIVDISSNNLSGNLNE 453

Query: 655 TFSSLTNMKNMYLQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINS----- 813
             +  +N+K + L  N F+GT+   +     +  ++  +N F+ +IP     +NS     
Sbjct: 454 AITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSNRFSWFIPD--DNLNSTRFKD 511

Query: 814 LQTGG 828
            QTGG
Sbjct: 512 FQTGG 516



 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 47/173 (27%), Positives = 77/173 (44%), Gaps = 7/173 (4%)
 Frame = +1

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSIS 519
           L+     G   D  + +   ++++N    +LP  Y   P++  LN+A N   GGLP  + 
Sbjct: 202 LESNNMTGTLRDFQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLPSCLG 261

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY--- 690
            +  L +LN+S N    E++   +    L  LD S N  +G +P   S  T    +    
Sbjct: 262 SLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLD 321

Query: 691 LQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           L +N F+G I   +     L  L + +N  TG IP ++  +  LQ    S N+
Sbjct: 322 LSHNSFSGDIPLRITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNA 374



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 45/154 (29%), Positives = 75/154 (48%), Gaps = 7/154 (4%)
 Frame = +1

Query: 379 DQLKSVTTFDISTNNLGNSLPYQLPPN-VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH 555
           D  +S++T+  S+ +    L  Q P   V  L  +G   +G +  S+ +++ L+ L++SH
Sbjct: 47  DLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTSSGLNLSGQIHPSLCKLSSLQSLDLSH 106

Query: 556 NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI----- 720
           N   G +   F SL NL  L+ S N   G+IP TF SL  ++ + L  N   G +     
Sbjct: 107 NNFSGNIPSCFGSLRNLRILNLSRNRFVGSIPATFVSLKELREVVLSENRDLGGVIPHWF 166

Query: 721 -DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            D   N  L+ +++    F G +P  L  + SL+
Sbjct: 167 GDFSMN--LERVDISFCSFVGELPESLLYLKSLK 198



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 47/84 (55%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           ++L+ N   G +P ++ +   +EYLN+S+N L+G++      L  L  LD S NSL+G +
Sbjct: 553 IDLSDNLLHGEIPEALFRQKNIEYLNLSYNFLEGQLP-RLEKLPRLKALDLSHNSLSGQV 611

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
               S+   +  + L +N F+G I
Sbjct: 612 IGNISAPPGLTLLNLSHNCFSGII 635



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L S+   D+S N L   +P  L    N++ LNL+ N   G LP  + ++  L+ L++SHN
Sbjct: 547 LLSMVGIDLSDNLLHGEIPEALFRQKNIEYLNLSYNFLEGQLP-RLEKLPRLKALDLSHN 605

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            L G+V     +   L+ L+ S N  +G I +
Sbjct: 606 SLSGQVIGNISAPPGLTLLNLSHNCFSGIITE 637



>gb:AB025621_1516426 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFG13.
          Length = 895

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 4/165 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + + G  L+G +  +L  L ++T  +I  N+    +P+++     ++ L++AG   +G L
Sbjct: 206 LHLGGNLLSGHIPQELGNLTTLTHMEIGYNSYEGVIPWEIGYMSELKYLDIAGANLSGFL 265

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P   S +  LE L +  N L  E+      +T+L  LD S N ++G IP++FS L N++ 
Sbjct: 266 PKHFSNLTKLESLFLFRNHLSREIPWELGEITSLVNLDLSDNHISGTIPESFSGLKNLRL 325

Query: 685 MYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINS 813
           + L  N  +GT+ +V+A LP LD L + NN+F+G +P  L G+NS
Sbjct: 326 LNLMFNEMSGTLPEVIAQLPSLDTLFIWNNYFSGSLPKSL-GMNS 369



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 48/173 (27%), Positives = 84/173 (48%), Gaps = 28/173 (16%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           LK++   D  +N+    LP  L    N++ LNLAG+ FTG +P        LE+L++  N
Sbjct: 152 LKNLIFLDALSNSFSGPLPIHLSQLENLKVLNLAGSYFTGSIPSQYGSFKNLEFLHLGGN 211

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNS------------------------LAGNIPQTFSS 666
            L G +     +LT L+ ++  +NS                        L+G +P+ FS+
Sbjct: 212 LLSGHIPQELGNLTTLTHMEIGYNSYEGVIPWEIGYMSELKYLDIAGANLSGFLPKHFSN 271

Query: 667 LTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           LT +++++L  N  +  I  ++     L NL++ +NH +G IP    G+ +L+
Sbjct: 272 LTKLESLFLFRNHLSREIPWELGEITSLVNLDLSDNHISGTIPESFSGLKNLR 324



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 46/150 (30%), Positives = 78/150 (52%), Gaps = 4/150 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L+  + ++L ++ S+   D+S N++  ++P       N++ LNL  N  +G LP  I+Q+
Sbjct: 285 LSREIPWELGEITSLVNLDLSDNHISGTIPESFSGLKNLRLLNLMFNEMSGTLPEVIAQL 344

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+ L + +N   G +       + L  +D S NS  G IPQ   S   +  + L +N 
Sbjct: 345 PSLDTLFIWNNYFSGSLPKSLGMNSKLRWVDVSTNSFQGEIPQGICSRGVLFKLILFSNN 404

Query: 706 FTGTID-VLANL-PLDNLNVENNHFTGWIP 789
           FTGT+   L+N   L  + +E+N F+G IP
Sbjct: 405 FTGTLSPSLSNCSTLVRIRLEDNSFSGVIP 434



 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 43/174 (24%), Positives = 85/174 (48%), Gaps = 5/174 (2%)
 Frame = +1

Query: 283 GESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--P 456
           GE  +G+ CS   + ++ +     TG++   L    ++    +  N+    +P+     P
Sbjct: 383 GEIPQGI-CSRGVLFKLILFSNNFTGTLSPSLSNCSTLVRIRLEDNSFSGVIPFSFSEIP 441

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN-QLQGEVTVMFVSLTNLSTLDFSFNS 633
           ++  ++L+ N  TGG+P  IS+   L+Y N+S+N +L G++     S  +L     S  S
Sbjct: 442 DISYIDLSRNKLTGGIPLDISKATKLDYFNISNNPELGGKLPPHIWSAPSLQNFSASSCS 501

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIP 789
           ++G +P  F S  ++  + L NN  +G +    +    L  +++ +N+  G IP
Sbjct: 502 ISGGLP-VFESCKSITVIELSNNNISGMLTPTVSTCGSLKKMDLSHNNLRGAIP 554



 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 57/195 (29%), Positives = 86/195 (44%), Gaps = 12/195 (6%)
 Frame = +1

Query: 289 SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPN 459
           SW GV C+ N                        SV + D+S+ NL  SL    + +   
Sbjct: 65  SWSGVRCNQNST----------------------SVVSVDLSSKNLAGSLSGKEFLVFTE 102

Query: 460 VQKLNLAGNGFTGGLPYSIS-QMAPLEYLNVSHNQLQGEV---TVMFVSLTNLSTLDFSF 627
           + +LN++ N F+G  P  I   M  L  L++S N   G          SL NL  LD   
Sbjct: 103 LLELNISDNSFSGEFPAEIFFNMTNLRSLDISRNNFSGRFPDGNGGDSSLKNLIFLDALS 162

Query: 628 NSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQ 801
           NS +G +P   S L N+K + L  + FTG+I     +   L+ L++  N  +G IP +L 
Sbjct: 163 NSFSGPLPIHLSQLENLKVLNLAGSYFTGSIPSQYGSFKNLEFLHLGGNLLSGHIPQELG 222

Query: 802 GINSL---QTGGNSW 837
            + +L   + G NS+
Sbjct: 223 NLTTLTHMEIGYNSY 237



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 31/128 (24%), Positives = 63/128 (49%), Gaps = 2/128 (1%)
 Frame = +1

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN-SLAG 642
           ++ L  N F+G +P+S S++  + Y+++S N+L G + +     T L   + S N  L G
Sbjct: 421 RIRLEDNSFSGVIPFSFSEIPDISYIDLSRNKLTGGIPLDISKATKLDYFNISNNPELGG 480

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +P    S  +++N    +   +G + V  +   +  + + NN+ +G + P +    SL+
Sbjct: 481 KLPPHIWSAPSLQNFSASSCSISGGLPVFESCKSITVIELSNNNISGMLTPTVSTCGSLK 540

Query: 820 TGGNSWNS 843
               S N+
Sbjct: 541 KMDLSHNN 548



>gb:AB022219_1515120 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MKP6.
          Length = 396

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 67/233 (28%), Positives = 112/233 (48%), Gaps = 5/233 (2%)
 Frame = +1

Query: 151 LLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ---LTKWTANGGDPCGESWKGVSCSGN- 318
           LL+   S  +   PTD + L+ +  SL   P     + W     DPC  S+ G++CS   
Sbjct: 9   LLSLVHSTFSSLAPTDRAALQSIRDSLTDMPGSAFFSSWDFTVPDPCS-SFSGLTCSSRG 67

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG 498
           RVT + + G  L+GS+   +  L  +T                      +L L     TG
Sbjct: 68  RVTGLTL-GPNLSGSLSPSISILTHLT----------------------QLILYPGSVTG 104

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
            LP     +  L  ++++ N+L G + V F SL+NL TLD S+N L+G++P   ++L  +
Sbjct: 105 PLPPRFDSLPLLRVISLTRNRLTGPIPVSFSSLSNLHTLDLSYNQLSGSLPPFLTTLPRL 164

Query: 679 KNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQL-QGINSLQTGGNS 834
           K + L +N F+  +  +++ PL +L+++ N  +G +PP     +  L   GNS
Sbjct: 165 KVLVLASNHFSNNLKPVSS-PLFHLDLKMNQISGQLPPAFPTTLRYLSLSGNS 216



 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 5/132 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL-PPNVQKLNLAGNGFTGGLP 507
           + +SG  + G++   ++ L  +   D+S N    ++P  L  P +  + L  N FT    
Sbjct: 210 LSLSGNSMQGTIN-AMEPLTELIYIDLSMNQFTGAIPSSLFSPTISTMFLQRNNFTSIAT 268

Query: 508 YSISQMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF-SSLTN-- 675
            + + + P    +++SHN + GE+T    +L     L  + N L G+IP+ +  SL N  
Sbjct: 269 SNATSLLPEGSIVDLSHNSISGELT---PALVGAEALFLNNNRLTGDIPEEYVKSLINGT 325

Query: 676 MKNMYLQNNVFT 711
            K ++LQ+N FT
Sbjct: 326 TKQLFLQHNYFT 337



>gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBM17.
          Length = 1102

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 58/174 (33%), Positives = 88/174 (50%), Gaps = 4/174 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           + +++++   L G     L +  +VT  ++  N    S+P ++     +Q+L LA NGFT
Sbjct: 459 LVQLRLARNNLVGRFPSNLCKQVNVTAIELGQNRFRGSIPREVGNCSALQRLQLADNGFT 518

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G LP  I  ++ L  LN+S N+L GEV     +   L  LD   N+ +G +P    SL  
Sbjct: 519 GELPREIGMLSQLGTLNISSNKLTGEVPSEIFNCKMLQRLDMCCNNFSGTLPSEVGSLYQ 578

Query: 676 MKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGN 831
           ++ + L NN  +GTI V L NL  L  L +  N F G IP +L  +  LQ   N
Sbjct: 579 LELLKLSNNNLSGTIPVALGNLSRLTELQMGGNLFNGSIPRELGSLTGLQIALN 632



 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 57/185 (30%), Positives = 97/185 (52%), Gaps = 5/185 (2%)
 Frame = +1

Query: 304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNL 477
            +CS   +  +Q++    TG +  ++  L  + T +IS+N L   +P ++     +Q+L++
Sbjct: 503  NCSA--LQRLQLADNGFTGELPREIGMLSQLGTLNISSNKLTGEVPSEIFNCKMLQRLDM 560

Query: 478  AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
              N F+G LP  +  +  LE L +S+N L G + V   +L+ L+ L    N   G+IP+ 
Sbjct: 561  CCNNFSGTLPSEVGSLYQLELLKLSNNNLSGTIPVALGNLSRLTELQMGGNLFNGSIPRE 620

Query: 658  FSSLTNMK-NMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGG 828
              SLT ++  + L  N  TG I   L+NL  L+ L + NN+ +G IP     ++SL    
Sbjct: 621  LGSLTGLQIALNLSYNKLTGEIPPELSNLVMLEFLLLNNNNLSGEIPSSFANLSSLLGYN 680

Query: 829  NSWNS 843
             S+NS
Sbjct: 681  FSYNS 685



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 49/155 (31%), Positives = 77/155 (49%), Gaps = 5/155 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ---KLNLAGNGFTGGLPYSIS 519
           QL G +  +L  L+S+    +  N L  ++P ++  N+    +++ + N  TG +P  + 
Sbjct: 276 QLVGPIPKELGDLQSLEFLYLYRNGLNGTIPREIG-NLSYAIEIDFSENALTGEIPLELG 334

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
            +  LE L +  NQL G + V   +L NLS LD S N+L G IP  F  L  +  + L  
Sbjct: 335 NIEGLELLYLFENQLTGTIPVELSTLKNLSKLDLSINALTGPIPLGFQYLRGLFMLQLFQ 394

Query: 700 NVFTGTIDVLANLPLD--NLNVENNHFTGWIPPQL 798
           N  +GTI        D   L++ +NH +G IP  L
Sbjct: 395 NSLSGTIPPKLGWYSDLWVLDMSDNHLSGRIPSYL 429



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 44/156 (28%), Positives = 80/156 (51%), Gaps = 3/156 (1%)
 Frame = +1

Query: 355  TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMA 528
            +G++  ++  L  +    +S NNL  ++P  L     + +L + GN F G +P  +  + 
Sbjct: 566  SGTLPSEVGSLYQLELLKLSNNNLSGTIPVALGNLSRLTELQMGGNLFNGSIPRELGSLT 625

Query: 529  PLEY-LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L+  LN+S+N+L GE+     +L  L  L  + N+L+G IP +F++L+++       N 
Sbjct: 626  GLQIALNLSYNKLTGEIPPELSNLVMLEFLLLNNNNLSGEIPSSFANLSSLLGYNFSYNS 685

Query: 706  FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINS 813
             TG I +L N+ + +  + N    G  PP  Q I +
Sbjct: 686  LTGPIPLLRNISMSSF-IGNEGLCG--PPLNQCIQT 718



 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 50/169 (29%), Positives = 83/169 (49%), Gaps = 7/169 (4%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQ 522
           QL+G +  ++  LK ++   +  N     +P ++    +++ L L  N   G +P  +  
Sbjct: 228 QLSGELPKEIGMLKKLSQVILWENEFSGFIPREISNCTSLETLALYKNQLVGPIPKELGD 287

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  LE+L +  N L G +     +L+    +DFS N+L G IP    ++  ++ +YL  N
Sbjct: 288 LQSLEFLYLYRNGLNGTIPREIGNLSYAIEIDFSENALTGEIPLELGNIEGLELLYLFEN 347

Query: 703 VFTGTIDV-LANLP-LDNLNVENNHFTGWIP---PQLQGINSLQTGGNS 834
             TGTI V L+ L  L  L++  N  TG IP     L+G+  LQ   NS
Sbjct: 348 QLTGTIPVELSTLKNLSKLDLSINALTGPIPLGFQYLRGLFMLQLFQNS 396



 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 42/167 (25%), Positives = 78/167 (46%), Gaps = 4/167 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           +Q+    L+G++  +L     +   D+S N+L   +P  L    N+  LNL  N  +G +
Sbjct: 390 LQLFQNSLSGTIPPKLGWYSDLWVLDMSDNHLSGRIPSYLCLHSNMIILNLGTNNLSGNI 449

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  I+    L  L ++ N L G          N++ ++   N   G+IP+   + + ++ 
Sbjct: 450 PTGITTCKTLVQLRLARNNLVGRFPSNLCKQVNVTAIELGQNRFRGSIPREVGNCSALQR 509

Query: 685 MYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           + L +N FTG +  ++     L  LN+ +N  TG +P ++     LQ
Sbjct: 510 LQLADNGFTGELPREIGMLSQLGTLNISSNKLTGEVPSEIFNCKMLQ 556



 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 46/160 (28%), Positives = 75/160 (46%), Gaps = 4/160 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           ++G +   +  LK +T+F    N +  SLP ++    ++  L LA N  +G LP  I  +
Sbjct: 181 ISGQLPRSIGNLKRLTSFRAGQNMISGSLPSEIGGCESLVMLGLAQNQLSGELPKEIGML 240

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L  + +  N+  G +     + T+L TL    N L G IP+    L +++ +YL  N 
Sbjct: 241 KKLSQVILWENEFSGFIPREISNCTSLETLALYKNQLVGPIPKELGDLQSLEFLYLYRNG 300

Query: 706 FTGTID-VLANLPLD-NLNVENNHFTGWIPPQLQGINSLQ 819
             GTI   + NL     ++   N  TG IP +L  I  L+
Sbjct: 301 LNGTIPREIGNLSYAIEIDFSENALTGEIPLELGNIEGLE 340



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 3/110 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ---KLNLAGNGFTGG 501
           +++S   L+G++   L  L  +T   +  N    S+P +L         LNL+ N  TG 
Sbjct: 582 LKLSNNNLSGTIPVALGNLSRLTELQMGGNLFNGSIPRELGSLTGLQIALNLSYNKLTGE 641

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +P  +S +  LE+L +++N L GE+   F +L++L   +FS+NSL G IP
Sbjct: 642 IPPELSNLVMLEFLLLNNNNLSGEIPSSFANLSSLLGYNFSYNSLTGPIP 691



 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 50/206 (24%), Positives = 83/206 (40%), Gaps = 5/206 (2%)
 Frame = +1

Query: 229 LNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFD 408
           +++   L  W +N   PCG  W GV CS                                
Sbjct: 42  VDAKQNLRNWNSNDSVPCG--WTGVMCSN------------------------------- 68

Query: 409 ISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
                      Y   P V  LNL+    +G L  SI  +  L+ L++S+N L G++    
Sbjct: 69  -----------YSSDPEVLSLNLSSMVLSGKLSPSIGGLVHLKQLDLSYNGLSGKIPKEI 117

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LAN-LPLDNLNVE 762
            + ++L  L  + N   G IP     L +++N+ + NN  +G++ V + N L L  L   
Sbjct: 118 GNCSSLEILKLNNNQFDGEIPVEIGKLVSLENLIIYNNRISGSLPVEIGNLLSLSQLVTY 177

Query: 763 NNHFTGWIP---PQLQGINSLQTGGN 831
           +N+ +G +P     L+ + S + G N
Sbjct: 178 SNNISGQLPRSIGNLKRLTSFRAGQN 203



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 43/159 (27%), Positives = 76/159 (47%), Gaps = 5/159 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL---NLAGNGFTGGLPYSIS 519
           +++GS+  ++  L S++     +NN+   LP  +  N+++L       N  +G LP  I 
Sbjct: 156 RISGSLPVEIGNLLSLSQLVTYSNNISGQLPRSI-GNLKRLTSFRAGQNMISGSLPSEIG 214

Query: 520 QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN 699
               L  L ++ NQL GE+      L  LS +    N  +G IP+  S+ T+++ + L  
Sbjct: 215 GCESLVMLGLAQNQLSGELPKEIGMLKKLSQVILWENEFSGFIPREISNCTSLETLALYK 274

Query: 700 NVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGIN 810
           N   G I   L +L  L+ L +  N   G IP ++  ++
Sbjct: 275 NQLVGPIPKELGDLQSLEFLYLYRNGLNGTIPREIGNLS 313



>pir|T30553|T30553 disease resistance protein Hcr2-5D -
           tomato>gb:AF053998_1764492 Lycopersicon esculentum
           Hcr2-5D (Hcr2-5D) gene, complete cds.
          Length = 1016

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 59/182 (32%), Positives = 92/182 (50%), Gaps = 7/182 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N +  + +   QL+GS+  ++  L+S+T  D+  N L  S+P  L    N+ +L+L  N 
Sbjct: 335 NNLFMLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLSRLDLYNNK 394

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P  I  +  L YL++  N L G +     +L NL  L    N L+G+IP+    L
Sbjct: 395 LSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYL 454

Query: 670 TNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQ---LQGINSLQTGGNS 834
           +++  +YL NN   G+I   L NL  L  L + NN  +G IP +   L  +  L  G NS
Sbjct: 455 SSLTELYLGNNSLNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNS 514

Query: 835 WN 840
            N
Sbjct: 515 LN 516



 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 5/195 (2%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNN 423
           L  WT +  + C + W GV C   RV  + I+   + G++  F    L  +   D+S NN
Sbjct: 49  LASWTTSS-NAC-KDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNN 106

Query: 424 LGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
           +  ++P ++    N+  L+L  N  +G +P  I  +A L+ + + +N L G +      L
Sbjct: 107 ISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYL 166

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNH 771
            +L+ L    N L+G+IP +  ++TN+  ++L  N  +G I  ++     L  L+++ N 
Sbjct: 167 RSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINF 226

Query: 772 FTGWIPPQLQGINSL 816
            +G IP  L  +N+L
Sbjct: 227 LSGSIPASLGNLNNL 241



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 50/182 (27%), Positives = 93/182 (51%), Gaps = 7/182 (3%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
            N ++ + +   QL+GS+      ++++ T  +S N+L   +P  +    +++ L ++ N 
Sbjct: 527  NNLSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLEVLYMSRNN 586

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
              G +P  +  ++ L  L++S N  +GE+     +LT+L  LDF  N+L G IPQ F ++
Sbjct: 587  LKGKVPQCLGNISDLHILSMSSNSFRGELPSSISNLTSLKILDFGRNNLEGAIPQFFGNI 646

Query: 670  TNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT---GGNS 834
            ++++   +QNN  +GT+    ++   L +LN+  N     IP  L     LQ    G N 
Sbjct: 647  SSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQ 706

Query: 835  WN 840
             N
Sbjct: 707  LN 708



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/169 (28%), Positives = 86/169 (50%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   L  L +++  D+  N L  S+P ++    ++  L+L  N   
Sbjct: 265 LTKLSLGINFLSGSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALN 324

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  +  L  L + +NQL G +      L +L+ LD   N+L G+IP +  +L N
Sbjct: 325 GSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN 384

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +  + L NN  +G+I  ++     L  L++  N   G IP  L  +N+L
Sbjct: 385 LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNL 433



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 48/169 (28%), Positives = 89/169 (52%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   L  L +++   +  N L  S+P ++    ++ KL+L  N  +
Sbjct: 217 LTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLS 276

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  +  L  L++ +N+L G +      L +L+ LD   N+L G+IP +  +L N
Sbjct: 277 GSIPASLGNLNNLSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNN 336

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +  +YL NN  +G+I  ++     L  L++  N   G IP  L  +N+L
Sbjct: 337 LFMLYLYNNQLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNL 385



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 48/170 (28%), Positives = 83/170 (48%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T + +    L GS+   L  L ++    +  N L  S+P ++    ++ +L L  N   
Sbjct: 409 LTYLDLGENALNGSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELYLGNNSLN 468

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  +  L  L + +NQL G +      L++L+ L    NSL G+IP +  +L N
Sbjct: 469 GSIPASLGNLNNLFMLYLYNNQLSGSIPEEIGYLSSLTELFLGNNSLNGSIPASLGNLNN 528

Query: 676 MKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +  +YL NN  +G+I     N+  L  L + +N   G IP  +  + SL+
Sbjct: 529 LSRLYLYNNQLSGSIPASFGNMRNLQTLFLSDNDLIGEIPSFVCNLTSLE 578



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 45/169 (26%), Positives = 86/169 (50%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ +    L+GS+   L  + +++   +  N L   +P ++    ++ KL+L  N  +
Sbjct: 169 LTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLS 228

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+  +  L +L + +NQL G +      L +L+ L    N L+G+IP +  +L N
Sbjct: 229 GSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTKLSLGINFLSGSIPASLGNLNN 288

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           +  + L NN  +G+I  ++     L  L++  N   G IP  L  +N+L
Sbjct: 289 LSRLDLYNNKLSGSIPEEIGYLRSLTYLDLGENALNGSIPASLGNLNNL 337



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 34/84 (40%), Positives = 50/84 (59%)
 Frame = +1

Query: 469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
            ++L+ N F G +P  +  +  +  LNVSHN LQG +     SL+ L +LD SFN L+G I
Sbjct: 813  IDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEI 872

Query: 649  PQTFSSLTNMKNMYLQNNVFTGTI 720
            PQ  +SLT ++ + L +N   G I
Sbjct: 873  PQQLASLTFLEVLNLSHNYLQGCI 896



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 39/112 (34%), Positives = 55/112 (49%), Gaps = 2/112 (1%)
 Frame = +1

Query: 385  LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
            L   T  D+S+N     +P  L     ++ LN++ N   G +P S+  ++ LE L++S N
Sbjct: 807  LSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFN 866

Query: 559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
            QL GE+     SLT L  L+ S N L G IPQ     T   N Y  N+   G
Sbjct: 867  QLSGEIPQQLASLTFLEVLNLSHNYLQGCIPQGPQFRTFESNSYEGNDGLRG 918



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 4/124 (3%)
 Frame = +1

Query: 352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQM 525
            L G++      + S+  FD+  N L  +LP  + +  ++  LNL GN     +P S+   
Sbjct: 635  LEGAIPQFFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELADEIPRSLDNC 694

Query: 526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL--TNMKNMYLQN 699
              L+ L++  NQL     +   +L  L  L  + N L G I  + + +   +++ + L  
Sbjct: 695  KKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSR 754

Query: 700  NVFT 711
            N F+
Sbjct: 755  NAFS 758



 Score = 40.0 bits (92), Expect = 0.056
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 21/197 (10%)
 Frame = +1

Query: 313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGN 486
            G  +  + + G +L   +   LD  K +   D+  N L ++ P  L   P ++ L L  N
Sbjct: 670  GCSLISLNLHGNELADEIPRSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSN 729

Query: 487  GFTGGLPYSISQMA--PLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQT 657
               G +  S +++    L  +++S N    ++ T +F  L  + T+D +    +      
Sbjct: 730  KLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYESYYD 789

Query: 658  FSSLTNMKNMYLQ--------------NNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
             S +   K + L+              +N F G I  VL +L  +  LNV +N   G+IP
Sbjct: 790  DSVVVVTKGLELEIVRILSLYTIIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIP 849

Query: 790  PQLQGINSLQTGGNSWN 840
              L  ++ L++   S+N
Sbjct: 850  SSLGSLSILESLDLSFN 866



>gb:AP003952_1835675 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1294_G12.
          Length = 1023

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 75/279 (26%), Positives = 112/279 (40%), Gaps = 54/279 (19%)
 Frame = +1

Query: 148 FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-RV 324
           FL+ +  S  AD    D   L GL S + S P     +   G  C  +W GV C+ + RV
Sbjct: 32  FLVVSAQSVPADN--MDQEALLGLKSLVTSDPSGMLLSWGNGSAC--TWSGVRCNRHGRV 87

Query: 325 TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP----------------- 453
             + + GL L G +   +  L ++    +  N     +P Q+                  
Sbjct: 88  LVLDLQGLNLVGKISPSIGNLSALHGLYLQKNQFSGEIPDQIGWLGQLQTLNASANILTG 147

Query: 454 ---------PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL 606
                     N++ ++L+ N F G +P SIS    L  L +  NQL G V     +L+ L
Sbjct: 148 NIPAALINCTNLEIIDLSQNTFFGTIPASISSFQKLRVLKIGGNQLSGSVPRYIGNLSLL 207

Query: 607 STLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI------------------DVLA 732
           STLD S N+L G IP  F  L  +K + L  N   GT+                  D+  
Sbjct: 208 STLDLSTNNLTGTIPYEFGHLRQLKYLQLSINNLKGTVPEPLYNLSSLSFFAIANNDLHG 267

Query: 733 NLPLD---------NLNVENNHFTGWIPPQLQGINSLQT 822
            +P D           ++  N FTG IPP L  + ++Q+
Sbjct: 268 KIPSDVGFRLPRLLVFHICINRFTGPIPPSLHNVTNIQS 306



 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 57/179 (31%), Positives = 98/179 (54%), Gaps = 5/179 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ--LPPNVQKLNLAGNGFT 495
           +T + + G ++TG +   + +L S+T  ++S N L  S+P +  L   +  L+LA N  +
Sbjct: 379 LTRLYVGGNRITGYIPASIGRLSSLTLLNMSYNLLFGSIPPEIGLLKELTMLSLARNKLS 438

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  I  +A L  L ++HN+L GE+ V   +L ++ +LD S NSL G IP +  SL +
Sbjct: 439 GIIPAEIGDLAQLTRLEMNHNELVGEIPVEIGNLQHVLSLDISSNSLKGGIPASIFSLNS 498

Query: 676 MKNMY-LQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           +  +  L +N+ TG+I + +  L  +  +++  N   G IP  +    SLQ+   S NS
Sbjct: 499 LSTLLNLSHNLLTGSIRENIGQLGQITAIDLSYNFLNGSIPVSIGKCQSLQSLSLSRNS 557



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 46/162 (28%), Positives = 85/162 (52%), Gaps = 5/162 (3%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLNLAGNG 489
           ++T ++++  +L G +  ++  L+ V + DIS+N+L   +P   + L      LNL+ N 
Sbjct: 450 QLTRLEMNHNELVGEIPVEIGNLQHVLSLDISSNSLKGGIPASIFSLNSLSTLLNLSHNL 509

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +  +I Q+  +  +++S+N L G + V      +L +L  S NSL+G IP T  +L
Sbjct: 510 LTGSIRENIGQLGQITAIDLSYNFLNGSIPVSIGKCQSLQSLSLSRNSLSGVIPGTIGNL 569

Query: 670 TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIP 789
             ++ + L +N  +G I   ++    L  LN+  N   G +P
Sbjct: 570 KGLQTLDLSSNQLSGIIPATLVKMQALRLLNLSMNDLDGLVP 611



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 8/178 (4%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNGFTGG 501
           +Q+S   L G++   L  L S++ F I+ N+L   +P  +    P +   ++  N FTG 
Sbjct: 234 LQLSINNLKGTVPEPLYNLSSLSFFAIANNDLHGKIPSDVGFRLPRLLVFHICINRFTGP 293

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN--IPQTFSSLTN 675
           +P S+  +  ++ + +SHN   G V      L NL   +  FN + GN  +     + T 
Sbjct: 294 IPPSLHNVTNIQSIRMSHNHFSGSVPPGLSGLHNLVLYNIGFNQIVGNTSVLVDLMNCTK 353

Query: 676 MKNMYLQNNVFTGTI-DVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           ++ +    N+  G + D + NL   L  L V  N  TG+IP  +  ++SL     S+N
Sbjct: 354 LQLIAFDENLIEGILPDSIGNLSSSLTRLYVGGNRITGYIPASIGRLSSLTLLNMSYN 411



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 43/140 (30%), Positives = 72/140 (51%), Gaps = 2/140 (1%)
 Frame = +1

Query: 409 ISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
           I  +++GN     L  ++ +L + GN  TG +P SI +++ L  LN+S+N L G +    
Sbjct: 367 ILPDSIGN-----LSSSLTRLYVGGNRITGYIPASIGRLSSLTLLNMSYNLLFGSIPPEI 421

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVE 762
             L  L+ L  + N L+G IP     L  +  + + +N   G I V + NL  + +L++ 
Sbjct: 422 GLLKELTMLSLARNKLSGIIPAEIGDLAQLTRLEMNHNELVGEIPVEIGNLQHVLSLDIS 481

Query: 763 NNHFTGWIPPQLQGINSLQT 822
           +N   G IP  +  +NSL T
Sbjct: 482 SNSLKGGIPASIFSLNSLST 501



>gb:OSJN00174_1696186 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0058K23, complete sequence.
          Length = 1174

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 58/178 (32%), Positives = 90/178 (50%), Gaps = 7/178 (3%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL---PPNVQK-LNLAGNGFTG 498
            + +S   L G++   L +L  + T D+S N L  ++P  +     NVQ  LNL+ N FTG
Sbjct: 574  LDLSSNMLNGTVPAALGRLDQLLTLDLSHNRLAGAIPGAVIASMSNVQMYLNLSNNAFTG 633

Query: 499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP-QTFSSLTN 675
             +P  I  +  ++ +++S+NQL G V        NL +LD S NSL G +P   F  L  
Sbjct: 634  AIPAEIGGLVMVQTIDLSNNQLSGGVPATLAGCKNLYSLDLSGNSLTGELPANLFPQLDL 693

Query: 676  MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
            +  + +  N   G I  D+ A   +  L+V  N F G IPP L  + +L++   S N+
Sbjct: 694  LTTLNISGNDLDGEIPADIAALKHIQTLDVSRNAFAGAIPPALANLTALRSLNLSSNT 751



 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 63/238 (26%), Positives = 107/238 (44%), Gaps = 6/238 (2%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNS--PPQLTKWTANGGDPCGESWK 297
           WA+AL +  L  A PS + D   ++  +     ++L+   PP + K             K
Sbjct: 164 WALALNVNNLTGAIPSCIGDL--SNLEIFEAYLNNLDGELPPSMAKL------------K 209

Query: 298 GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKL 471
           G+         + +S  QL+GS+  ++  L ++    +  N     +P +L    N+  L
Sbjct: 210 GIMV-------VDLSCNQLSGSIPPEIGDLSNLQILQLYENRFSGHIPRELGRCKNLTLL 262

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           N+  NGFTG +P  + ++  LE + +  N L  E+        +L  LD S N LAG IP
Sbjct: 263 NIFSNGFTGEIPGELGELTNLEVMRLYKNALTSEIPRSLRRCVSLLNLDLSMNQLAGPIP 322

Query: 652 QTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
                L +++ + L  N   GT+   L NL  L  L +  NH +G +P  +  + +L+
Sbjct: 323 PELGELPSLQRLSLHANRLAGTVPASLTNLVNLTILELSENHLSGPLPASIGSLRNLR 380



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 50/147 (34%), Positives = 80/147 (54%), Gaps = 6/147 (4%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
            + +S    TG++  ++  L  V T D+S N L   +P  L    N+  L+L+GN  TG L
Sbjct: 624  LNLSNNAFTGAIPAEIGGLVMVQTIDLSNNQLSGGVPATLAGCKNLYSLDLSGNSLTGEL 683

Query: 505  PYSI-SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
            P ++  Q+  L  LN+S N L GE+     +L ++ TLD S N+ AG IP   ++LT ++
Sbjct: 684  PANLFPQLDLLTTLNISGNDLDGEIPADIAALKHIQTLDVSRNAFAGAIPPALANLTALR 743

Query: 682  NMYLQNNVFTGTI---DVLANLPLDNL 753
            ++ L +N F G +    V  NL + +L
Sbjct: 744  SLNLSSNTFEGPVPDGGVFRNLTMSSL 770



 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 56/199 (28%), Positives = 91/199 (45%), Gaps = 31/199 (15%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL---NLAGNG 489
            ++ ++ +S    TG +   + QL ++T   +  N L   +P ++  N+ KL    L  N 
Sbjct: 450  QLQKLDLSENSFTGGLSRLVGQLGNLTVLQLQGNALSGEIPEEIG-NMTKLISLKLGRNR 508

Query: 490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            F G +P SIS M+ L+ L++ HN+L G        L  L+ L    N  AG IP   ++L
Sbjct: 509  FAGHVPASISNMSSLQLLDLGHNRLDGVFPAEVFELRQLTILGAGSNRFAGPIPDAVANL 568

Query: 670  TNMKNMYLQNNVFTGTI-------DVLANLPLDN---------------------LNVEN 765
             ++  + L +N+  GT+       D L  L L +                     LN+ N
Sbjct: 569  RSLSFLDLSSNMLNGTVPAALGRLDQLLTLDLSHNRLAGAIPGAVIASMSNVQMYLNLSN 628

Query: 766  NHFTGWIPPQLQGINSLQT 822
            N FTG IP ++ G+  +QT
Sbjct: 629  NAFTGAIPAEIGGLVMVQT 647



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 55/168 (32%), Positives = 81/168 (48%), Gaps = 4/168 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           LT  +   L +  S+   D+S N L   +P +L   P++Q+L+L  N   G +P S++ +
Sbjct: 293 LTSEIPRSLRRCVSLLNLDLSMNQLAGPIPPELGELPSLQRLSLHANRLAGTVPASLTNL 352

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L  L +S N L G +     SL NL  L    NSL+G IP + S+ T + N  +  N+
Sbjct: 353 VNLTILELSENHLSGPLPASIGSLRNLRRLIVQNNSLSGQIPASISNCTQLANASMSFNL 412

Query: 706 FTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           F+G +   L  L  L  L++  N   G IP  L     LQ    S NS
Sbjct: 413 FSGPLPAGLGRLQSLMFLSLGQNSLAGDIPDDLFDCGQLQKLDLSENS 460



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 4/158 (2%)
 Frame = +1

Query: 355 TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMA 528
           +G +   L +L+S+    +  N+L   +P  L     +QKL+L+ N FTGGL   + Q+ 
Sbjct: 414 SGPLPAGLGRLQSLMFLSLGQNSLAGDIPDDLFDCGQLQKLDLSENSFTGGLSRLVGQLG 473

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            L  L +  N L GE+     ++T L +L    N  AG++P + S++++++ + L +N  
Sbjct: 474 NLTVLQLQGNALSGEIPEEIGNMTKLISLKLGRNRFAGHVPASISNMSSLQLLDLGHNRL 533

Query: 709 TGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
            G    +V     L  L   +N F G IP  +  + SL
Sbjct: 534 DGVFPAEVFELRQLTILGAGSNRFAGPIPDAVANLRSL 571



 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 47/161 (29%), Positives = 76/161 (47%), Gaps = 5/161 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           +L G++   L  L ++T  ++S N+L   LP  +    N+++L +  N  +G +P SIS 
Sbjct: 340 RLAGTVPASLTNLVNLTILELSENHLSGPLPASIGSLRNLRRLIVQNNSLSGQIPASISN 399

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              L   ++S N   G +      L +L  L    NSLAG+IP        ++ + L  N
Sbjct: 400 CTQLANASMSFNLFSGPLPAGLGRLQSLMFLSLGQNSLAGDIPDDLFDCGQLQKLDLSEN 459

Query: 703 VFTGTIDVLANLPLDNLNV---ENNHFTGWIPPQLQGINSL 816
            FTG +  L    L NL V   + N  +G IP ++  +  L
Sbjct: 460 SFTGGLSRLVG-QLGNLTVLQLQGNALSGEIPEEIGNMTKL 499



 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 47/181 (25%), Positives = 84/181 (46%), Gaps = 4/181 (2%)
 Frame = +1

Query: 289 SWKGVSCSG-NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ 465
           +W GV+C G  +VT IQ+   +L G++   L  + ++                      Q
Sbjct: 79  NWTGVACDGAGQVTSIQLPESKLRGALSPFLGNISTL----------------------Q 116

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
            ++L  N F GG+P  + ++  LE L VS N   G +     + + +  L  + N+L G 
Sbjct: 117 VIDLTSNAFAGGIPPQLGRLGELEQLVVSSNYFAGGIPSSLCNCSAMWALALNVNNLTGA 176

Query: 646 IPQTFSSLTNMK--NMYLQNNVFTGTIDVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           IP     L+N++    YL NN+       +A L  +  +++  N  +G IPP++  +++L
Sbjct: 177 IPSCIGDLSNLEIFEAYL-NNLDGELPPSMAKLKGIMVVDLSCNQLSGSIPPEIGDLSNL 235

Query: 817 Q 819
           Q
Sbjct: 236 Q 236



 Score = 37.4 bits (85), Expect = 0.36
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T + ISG  L G +   +  LK + T D+S N    ++P  L     ++ LNL+ N F 
Sbjct: 694 LTTLNISGNDLDGEIPADIAALKHIQTLDVSRNAFAGAIPPALANLTALRSLNLSSNTFE 753

Query: 496 GGLP 507
           G +P
Sbjct: 754 GPVP 757



>gb:AY534122S2_1612173 Aegilops tauschii transposons Caspar, XJ,
           Angela, and XJ, complete sequence; LRR protein WM1.7
           (WM1.7) and LRR protein WM1.12 (WM1.12) genes, complete
           cds; transposons Ophelia2, Angela3s, and XJ3, complete
           sequence; LRR protein WM1.3 (WM1.3) gene, complete cds;
           Stowaway MITE, transposons XJ1, Jody, Angela, and XJ and
           Stowaway MITE, complete sequence; LRR protein WM1.2
           (WM1.2) and LLR protein WM1.1 (WM1.1) genes, complete
           cds; transposons XJ, XA, Angela, and Fred and WM1.11
           gene, complete sequence; RPM1-like sequence and LRR
           protein WM1.10 (WM1.10) genes, complete cds; and
           transposon XJ, complete sequence.
          Length = 1060

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 62/179 (34%), Positives = 95/179 (53%), Gaps = 13/179 (7%)
 Frame = +1

Query: 319 RVTEIQISG---LQLTGSMGFQLDQLKSVTTFDISTNNLGN--------SLPYQLPPNVQ 465
           RV +I  +G   + +TG+    + +L S+   D+S N +          SLP     N+Q
Sbjct: 304 RVLDISYNGNPDMMMTGN----IKKLCSLEILDLSGNRINGDIESLFVESLPQCTRKNLQ 359

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
           KL+L+ N FTG LP  +S  + L  L++S+N L G +     +LT L++LD  +N L G+
Sbjct: 360 KLDLSYNNFTGTLPNIVSDFSKLSILSLSNNNLVGPIPAQLGNLTCLTSLDLFWNHLNGS 419

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           IP    +LT + ++ L  N  TG+I   L NL  L  L + +N+ T  IPP+L    SL
Sbjct: 420 IPPELGALTTLTSLDLSMNDLTGSIPAELGNLRYLSELCLSDNNITAPIPPELMNSTSL 478



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 2/137 (1%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           ++++ + +S   L G +  QL  L  +T+ D+  N+L  S+P +L     +  L+L+ N 
Sbjct: 380 SKLSILSLSNNNLVGPIPAQLGNLTCLTSLDLFWNHLNGSIPPELGALTTLTSLDLSMND 439

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +P  +  +  L  L +S N +   +    ++ T+L+ LD S N L G++P    SL
Sbjct: 440 LTGSIPAELGNLRYLSELCLSDNNITAPIPPELMNSTSLTHLDLSSNHLNGSVPTEIGSL 499

Query: 670 TNMKNMYLQNNVFTGTI 720
            N+  +YL NN FTG I
Sbjct: 500 NNLIYLYLSNNRFTGVI 516



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 63/246 (25%), Positives = 105/246 (42%), Gaps = 51/246 (20%)
 Frame = +1

Query: 238  PPQLTKWTANGGDPCGESWKGVS-----CSGNRVTEIQISGLQLTGS-------MGFQLD 381
            PP L +   N  D    + KG        + +  T + IS  Q++GS       M F+  
Sbjct: 566  PPGLQRLKTNALDISNTTLKGEIPDWFWSTFSNATYLDISNNQISGSLPAHMHSMAFEKL 625

Query: 382  QLKS-------------VTTFDISTNNLGNSLPYQLPPN-VQKLNLAGNGFTGGLPYSIS 519
             L S             +T  DIS N    ++P  L  + ++ L++  N   G +P SI 
Sbjct: 626  HLGSNRLTGPIPTLPTNITLLDISNNTFSETIPSNLGASRLEILSMHSNQIGGYIPESIC 685

Query: 520  QMAPLEYLNVSHNQLQGEVTVMF-----------------------VSLTNLSTLDFSFN 630
            ++  L YL++S+N L+GEV   F                        + T L  LD S+N
Sbjct: 686  KLEQLLYLDLSNNILEGEVPHCFHFYKIEHLILSNNSLSGKIPAFLQNNTGLQFLDVSWN 745

Query: 631  SLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQG 804
              +G +P    +L N++ + L +N+F+  I  D+     L  L++  N+F+G IP  +  
Sbjct: 746  RFSGRLPTWIGNLVNLRFLVLSHNIFSDNIPVDITKLGHLQYLDLSRNNFSGGIPWHMSN 805

Query: 805  INSLQT 822
            +  + T
Sbjct: 806  LTFMST 811



 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 38/118 (32%), Positives = 62/118 (52%), Gaps = 8/118 (6%)
 Frame = +1

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFV------SLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           +I ++  LE L++S N++ G++  +FV      +  NL  LD S+N+  G +P   S  +
Sbjct: 321 NIKKLCSLEILDLSGNRINGDIESLFVESLPQCTRKNLQKLDLSYNNFTGTLPNIVSDFS 380

Query: 673 NMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            +  + L NN   G I   L NL  L +L++  NH  G IPP+L  + +L +   S N
Sbjct: 381 KLSILSLSNNNLVGPIPAQLGNLTCLTSLDLFWNHLNGSIPPELGALTTLTSLDLSMN 438



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 40/133 (30%), Positives = 62/133 (46%), Gaps = 6/133 (4%)
 Frame = +1

Query: 334  QISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLP 507
            QI  +   G        L    + D+S N+L   +P  +     +  LNL+ N  +G +P
Sbjct: 840  QILSVNTKGQQLIYHGTLAYFVSIDLSCNSLTGEIPTDITSLAALMNLNLSSNQLSGQIP 899

Query: 508  YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ----TFSSLTN 675
              I  M  L  L++S N+L GE+     +LT+LS ++ S NSL+G IP        +L N
Sbjct: 900  SMIGAMQSLVSLDLSQNKLSGEIPSSLSNLTSLSYMNLSCNSLSGRIPSGPQLDILNLDN 959

Query: 676  MKNMYLQNNVFTG 714
               +Y+ N    G
Sbjct: 960  QSLIYIGNTGLCG 972



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 47/177 (26%), Positives = 77/177 (43%), Gaps = 3/177 (1%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV-QKLNLAGNGF 492
            +   + IS   L G +  +      + T  DIS N +  SLP  +     +KL+L  N  
Sbjct: 573  KTNALDISNTTLKGEIPDWFWSTFSNATYLDISNNQISGSLPAHMHSMAFEKLHLGSNRL 632

Query: 493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
            TG +P   +    +  L++S+N    E     +  + L  L    N + G IP++   L 
Sbjct: 633  TGPIP---TLPTNITLLDISNNTFS-ETIPSNLGASRLEILSMHSNQIGGYIPESICKLE 688

Query: 673  NMKNMYLQNNVFTGTIDVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
             +  + L NN+  G +    +   +++L + NN  +G IP  LQ    LQ    SWN
Sbjct: 689  QLLYLDLSNNILEGEVPHCFHFYKIEHLILSNNSLSGKIPAFLQNNTGLQFLDVSWN 745



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 2/95 (2%)
 Frame = +1

Query: 409  ISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV 582
            +S N+L   +P  L  N  +Q L+++ N F+G LP  I  +  L +L +SHN     + V
Sbjct: 718  LSNNSLSGKIPAFLQNNTGLQFLDVSWNRFSGRLPTWIGNLVNLRFLVLSHNIFSDNIPV 777

Query: 583  MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
                L +L  LD S N+ +G IP   S+LT M  +
Sbjct: 778  DITKLGHLQYLDLSRNNFSGGIPWHMSNLTFMSTL 812



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 46/167 (27%), Positives = 75/167 (44%), Gaps = 15/167 (8%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLP---YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH 555
           L  +   D+S N   +SL    +    +++ L+L  N   G  P ++  M  L  L++S+
Sbjct: 251 LTKLEKLDLSWNFFKHSLGSGWFWKVTSLKYLHLEWNLLFGKFPDTLGNMTYLRVLDISY 310

Query: 556 NQLQGEVTVMFVS----LTNLSTLDFSFNSLAGNIPQTF------SSLTNMKNMYLQNNV 705
           N   G   +M       L +L  LD S N + G+I   F       +  N++ + L  N 
Sbjct: 311 N---GNPDMMMTGNIKKLCSLEILDLSGNRINGDIESLFVESLPQCTRKNLQKLDLSYNN 367

Query: 706 FTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           FTGT+  + +    L  L++ NN+  G IP QL  +  L +    WN
Sbjct: 368 FTGTLPNIVSDFSKLSILSLSNNNLVGPIPAQLGNLTCLTSLDLFWN 414



 Score = 39.3 bits (90), Expect = 0.095
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 25/155 (16%)
 Frame = +1

Query: 232 NSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQI-------------------SGLQL 354
           N+   L  W   G D C   W+GVSC       I++                   S   L
Sbjct: 55  NNTNLLASW--KGQDCC--RWRGVSCCNQTGHVIKLHLRNPNVTLDAYGYDHACASASAL 110

Query: 355 TGSMGFQLDQLKSVTTFDISTNNL---GNSLPYQLPP--NVQKLNLAGNGFTGGLPYSIS 519
            G +   L  LK +   D+S N L    + +P+ L    N++ LNL+G  FTG +P  + 
Sbjct: 111 FGEISPSLLSLKHLKHLDLSMNCLLGPNSQIPHLLGSMGNLRYLNLSGIPFTGRVPSHLG 170

Query: 520 QMAPLEYLNVSHNQLQGEVTVMF-VSLTNLSTLDF 621
            ++ ++YL++      G+ + M+ + +T L+ L F
Sbjct: 171 NLSKMQYLDLGQ---AGDYSDMYSMDITWLTKLPF 202



>gb:AF053996_1764490 Lycopersicon pimpinellifolium Hcr2-2A (Hcr2-2A)
           gene, complete cds.
          Length = 802

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 58/175 (33%), Positives = 89/175 (50%), Gaps = 4/175 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           ++I G  L GS+  ++  L+S+T   +STN L  S+P  L    N+  L+L  N  +G +
Sbjct: 148 LRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGKLNNLSFLSLYDNQLSGSI 207

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  I  +  L  L +++N L G +     +L NLS L    N L+G IPQ    L ++  
Sbjct: 208 PDEIDYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSLTY 267

Query: 685 MYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           + L NN   G+I  ++     L NL++ NN   G IPP++  + SL     S NS
Sbjct: 268 LRLNNNFLNGSIPREIGYLRSLTNLHLNNNFLNGSIPPEIGNLRSLSIIDLSINS 322



 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 62/219 (28%), Positives = 99/219 (45%), Gaps = 29/219 (13%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNN 423
           L  WT +  + C + W GV C   RV  + I+   + G++  F    L  +   ++S NN
Sbjct: 49  LASWTQSS-NACRD-WYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNN 106

Query: 424 LGNSLPYQL--------------------PPN------VQKLNLAGNGFTGGLPYSISQM 525
           +  ++P ++                    PP       +Q L + GN   G +P  I  +
Sbjct: 107 ISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYL 166

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L  L++S N L G +      L NLS L    N L+G+IP     LT++ ++YL NN 
Sbjct: 167 RSLTDLSLSTNFLNGSIPASLGKLNNLSFLSLYDNQLSGSIPDEIDYLTSLTDLYLNNNF 226

Query: 706 FTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
             G+I   L NL  L  L++  N  +G+IP ++  + SL
Sbjct: 227 LNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSL 265



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 54/177 (30%), Positives = 85/177 (48%), Gaps = 7/177 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           I +S   L GS+   L  L++V +  +  NNL   +P  +    +++ L L  N   G +
Sbjct: 316 IDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKV 375

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  +  ++ L+ L +S N L GE+     +L +L  LD   NSL G IPQ F ++  ++ 
Sbjct: 376 PQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQV 435

Query: 685 MYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQT---GGNSWN 840
             +QNN  +GT+    ++   L +LN+  N   G IP  L     LQ    G N  N
Sbjct: 436 FDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLN 492



 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 50/170 (29%), Positives = 88/170 (51%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ ++   L GS+   L  LK+++   +  N L   +P ++    ++  L L  N   
Sbjct: 217 LTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSLTYLRLNNNFLN 276

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  I  +  L  L++++N L G +     +L +LS +D S NSL G+IP +  +L N
Sbjct: 277 GSIPREIGYLRSLTNLHLNNNFLNGSIPPEIGNLRSLSIIDLSINSLKGSIPASLGNLRN 336

Query: 676 MKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +++M+L  N  T  I + + NL  L  L +  N+  G +P  L  I+ LQ
Sbjct: 337 VQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQ 386



 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 32/84 (38%), Positives = 50/84 (59%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           ++L+ N F G +P  +     L  LN+SHN L+G++     SL+ + +LD SFN L+G I
Sbjct: 599 IDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSLSVVESLDLSFNQLSGEI 658

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
           PQ  +SLT++  + L +N   G I
Sbjct: 659 PQQLASLTSLGFLNLSHNYLQGCI 682



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 5/123 (4%)
 Frame = +1

Query: 361 SMGFQLDQLKSV---TTFDISTNNLGNSLPYQLPPNV--QKLNLAGNGFTGGLPYSISQM 525
           S G +L+ ++ +   T  D+S N     +P  L   +  + LN++ NG  G +P S+  +
Sbjct: 582 SKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSL 641

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + +E L++S NQL GE+     SLT+L  L+ S N L G IPQ     T   N Y  N+ 
Sbjct: 642 SVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSYEGNDG 701

Query: 706 FTG 714
             G
Sbjct: 702 LRG 704



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 47/179 (26%), Positives = 78/179 (43%), Gaps = 15/179 (8%)
 Frame = +1

Query: 307 CSGNRVTEIQISGLQ--------LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
           C GN      ISGLQ        L+G +   +  L+S+   D+  N+L  ++P Q   N+
Sbjct: 378 CLGN------ISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSLEGAIP-QCFGNI 430

Query: 463 QKL---NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
             L   ++  N  +G L  + S  + L  LN+  N+L+GE+     +   L  LD   N 
Sbjct: 431 NTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNH 490

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQL 798
           L    P    +L  ++ + L +N   G I      +    L  +++ NN F+  +P  L
Sbjct: 491 LNDTFPMWLGTLLELRVLRLTSNKLHGPIRSSGAEIMFPALRTIDLSNNAFSKDLPTSL 549



 Score = 39.3 bits (90), Expect = 0.095
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)
 Frame = +1

Query: 658 FSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           FSSL  ++N+ L NN  +GTI   + NL  L  L++ NN  +G IPPQ   ++ LQ
Sbjct: 91  FSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQ 146



>gb:ADPGIP_1745523 A.deliciosa pgip mRNA for polygalacturonase
           inhibitor.
          Length = 327

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 71/235 (30%), Positives = 108/235 (45%), Gaps = 7/235 (2%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           A++LL+ FL    PS     +P D  VL  +  +LN+P  L  W  +  D C   W  V 
Sbjct: 6   AISLLL-FLSLLSPSLSDRCNPNDKKVLLRIKQALNNPYLLASWNPDN-DCC--DWYNVD 61

Query: 307 C--SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA 480
           C  + NR+  + I    ++G +   +                   LPY      +KL+  
Sbjct: 62  CDLTTNRIIALTIFSGNISGQIPAAV-----------------GDLPYLQTLIFRKLS-- 102

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF 660
               TG +P +IS+++ L+ + +S   L G V   F  L NL+ LD SFN L G+IP + 
Sbjct: 103 --NLTGQIPSAISKLSNLKMVRLSWTNLSGPVPSFFSQLKNLTFLDLSFNDLTGSIPSSL 160

Query: 661 SSLTNMKNMYLQNNVFTGTI-----DVLANLPLDNLNVENNHFTGWIPPQLQGIN 810
           S LTN+  ++L  N  TG I     +    +P  +L + +N  TG IP  L  +N
Sbjct: 161 SKLTNLDAIHLDRNKLTGPIPNSFGEFTGQVP--DLYLSHNQLTGSIPKTLGDLN 213



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 2/113 (1%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGF 492
           +V ++ +S  QLTGS+   L  L + T  D+S N L   + +    N  +Q ++ + N F
Sbjct: 190 QVPDLYLSHNQLTGSIPKTLGDL-NFTVIDVSRNMLSGDISFMFGSNKTIQIVDFSRNKF 248

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
              L   +   + L  L+++HN++ G + V    L +L  L+ S+N L G+IP
Sbjct: 249 QFDLSKVVFPQS-LTSLDLNHNKIYGSLPVGLTKL-DLQYLNVSYNRLCGHIP 299



>gb:OSJN00189_1696455 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0095H06, complete sequence.
          Length = 1135

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 57/179 (31%), Positives = 96/179 (53%), Gaps = 5/179 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +  +++ G +L G++   +  ++S+   D+ +N L   +P +L     +Q L+L+ N  T
Sbjct: 451 LVRLRLGGNRLAGTIPAAVAGMRSINFLDLGSNRLAGGVPAELGNCSQLQMLDLSNNTLT 510

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G LP S++ +  L+ ++VSHNQL G V   F  L  LS L  S NSL+G IP       N
Sbjct: 511 GALPESLAGVRGLQEIDVSHNQLTGGVPDAFGRLEALSRLVLSGNSLSGAIPAALGKCRN 570

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLD-NLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           ++ + L +N  +G I  ++ A   LD  LN+  N  TG IP ++  ++ L     S+N+
Sbjct: 571 LELLDLSDNALSGRIPDELCAIDGLDIALNLSRNGLTGPIPARISALSKLSVLDLSYNA 629



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 51/169 (30%), Positives = 86/169 (50%), Gaps = 7/169 (4%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQ 522
           QL GS+   L  L ++   D+S N+L  ++P    L  N+ KL L  N  +G +P  I +
Sbjct: 388 QLEGSIPASLAGLANLQALDLSHNHLTGAIPPGIFLLRNLTKLLLLSNDLSGVIPPEIGK 447

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
            A L  L +  N+L G +      + +++ LD   N LAG +P    + + ++ + L NN
Sbjct: 448 AASLVRLRLGGNRLAGTIPAAVAGMRSINFLDLGSNRLAGGVPAELGNCSQLQMLDLSNN 507

Query: 703 VFTGTI-DVLANL-PLDNLNVENNHFTGWIPP---QLQGINSLQTGGNS 834
             TG + + LA +  L  ++V +N  TG +P    +L+ ++ L   GNS
Sbjct: 508 TLTGALPESLAGVRGLQEIDVSHNQLTGGVPDAFGRLEALSRLVLSGNS 556



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 45/159 (28%), Positives = 75/159 (47%), Gaps = 4/159 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G +     +L ++    ++   +  +LP  L    ++Q L++     +G +P  ++  
Sbjct: 197 LGGEIPESFSRLSNLVVLGLADTKISGALPASLGRLQSLQTLSIYTTMLSGSIPAELAGC 256

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L  + +  N L G +     +L  L  L    NSL G IP TF +LT++ ++ L  N 
Sbjct: 257 GNLTNVYLYENSLSGPLPPSLGALPRLQKLLLWQNSLTGPIPDTFGNLTSLVSLDLSINA 316

Query: 706 FTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
            +G I   L  LP L +L + +N+ TG IPP L    SL
Sbjct: 317 ISGAIPASLGRLPALQDLMLSDNNLTGTIPPALANATSL 355



 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 58/238 (24%), Positives = 102/238 (42%), Gaps = 9/238 (3%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG 315
           LL+  LL+   S  A      A + + L ++   PP    W+ +   PC  S  G   + 
Sbjct: 5   LLLLHLLSFSSSTAASASSEVAFLTQWLNTTAARPPD---WSPSASSPCKWSHVGCDAAT 61

Query: 316 NRVTEIQISGLQLTGSMGFQL-DQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGN 486
             VT +    + L   +   +   L S+ +  +S  NL   +P    L   +  L+L+GN
Sbjct: 62  GSVTSVTFQSVHLAAPLPPGICAALPSLASLVVSDANLTGGVPDDLHLCRRLAVLDLSGN 121

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL-TNLSTLDFSFNSLAGNIPQTFS 663
             +G +P S+     +  L ++ NQL G +     +L  +L  L    N L+G +P +  
Sbjct: 122 SLSGPIPASLGNATAMASLALNSNQLSGPIPASLGNLAASLRDLLLFDNRLSGELPASLG 181

Query: 664 SLTNMKNMYLQNNVFTG-----TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
            L  ++++    N   G     +   L+NL +  L + +   +G +P  L  + SLQT
Sbjct: 182 ELRLLESLRAGGNRDLGGEIPESFSRLSNLVV--LGLADTKISGALPASLGRLQSLQT 237



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/115 (32%), Positives = 63/115 (54%), Gaps = 3/115 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ---KLNLAGNGF 492
           ++ + +SG  L+G++   L + +++   D+S N L   +P +L         LNL+ NG 
Sbjct: 547 LSRLVLSGNSLSGAIPAALGKCRNLELLDLSDNALSGRIPDELCAIDGLDIALNLSRNGL 606

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           TG +P  IS ++ L  L++S+N L G +  +   L NL TL+ S N+  G +P T
Sbjct: 607 TGPIPARISALSKLSVLDLSYNALDGGLAPL-AGLDNLVTLNVSNNNFTGYLPDT 660



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 50/166 (30%), Positives = 76/166 (45%), Gaps = 5/166 (3%)
 Frame = +1

Query: 334 QISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGG-L 504
           Q+SG  +  S+G     L+ +  FD   N L   LP  L     ++ L   GN   GG +
Sbjct: 146 QLSG-PIPASLGNLAASLRDLLLFD---NRLSGELPASLGELRLLESLRAGGNRDLGGEI 201

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P S S+++ L  L ++  ++ G +      L +L TL      L+G+IP   +   N+ N
Sbjct: 202 PESFSRLSNLVVLGLADTKISGALPASLGRLQSLQTLSIYTTMLSGSIPAELAGCGNLTN 261

Query: 685 MYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           +YL  N  +G +   L  LP L  L +  N  TG IP     + SL
Sbjct: 262 VYLYENSLSGPLPPSLGALPRLQKLLLWQNSLTGPIPDTFGNLTSL 307



>gb:AY064972_1566148 Arabidopsis thaliana AT4g08850/T32A17_160 mRNA,
           complete cds.
          Length = 1045

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 67/263 (25%), Positives = 114/263 (43%), Gaps = 32/263 (12%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVL-RGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           V L+I  +L+   +  A  +  +A +  +  F++  S  +L+ W          SW GV+
Sbjct: 30  VLLIISIVLSCSFAVSATVEEANALLKWKSTFTNQTSSSKLSSWVNPNTSSFCTSWYGVA 89

Query: 307 CSGNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNNLG------------------ 429
           CS   +  + ++   + G+   F    L ++T  D+S N                     
Sbjct: 90  CSLGSIIRLNLTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDL 149

Query: 430 --NSLPYQLPP------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM 585
             N L  ++PP      N+  L+L  N   G +P  I ++  +  + +  N L G +   
Sbjct: 150 SINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSS 209

Query: 586 FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV----LANLPLDNL 753
           F +LT L  L    NSL+G+IP    +L N++ + L  N  TG I      L N+ L  L
Sbjct: 210 FGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTL--L 267

Query: 754 NVENNHFTGWIPPQLQGINSLQT 822
           N+  N  +G IPP++  + +L T
Sbjct: 268 NMFENQLSGEIPPEIGNMTALDT 290



 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 42/137 (30%), Positives = 82/137 (59%), Gaps = 2/137 (1%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           NR++++Q++G +L+G +   +  L ++   D+S+N   + +P  L   P +  +NL+ N 
Sbjct: 526 NRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRND 585

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
               +P  +++++ L+ L++S+NQL GE++  F SL NL  LD S N+L+G IP +F  +
Sbjct: 586 LDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDM 645

Query: 670 TNMKNMYLQNNVFTGTI 720
             + ++ + +N   G I
Sbjct: 646 LALTHVDVSHNNLQGPI 662



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 4/171 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +VTEI I    LTG +      L  +    +  N+L  S+P ++   PN+++L L  N  
Sbjct: 191 KVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNL 250

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P S   +  +  LN+  NQL GE+     ++T L TL    N L G IP T  ++ 
Sbjct: 251 TGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIK 310

Query: 673 NMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +  ++L  N   G+I  ++     + +L +  N  TG +P     + +L+
Sbjct: 311 TLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALE 361



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 48/167 (28%), Positives = 82/167 (49%), Gaps = 4/167 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           I +S     G +    +Q + +  F +S N++  ++P ++     + +L+L+ N  TG L
Sbjct: 459 IDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGEL 518

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P SIS +  +  L ++ N+L G++      LTNL  LD S N  +  IP T ++L  +  
Sbjct: 519 PESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYY 578

Query: 685 MYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           M L  N    TI + L  L  L  L++  N   G I  Q + + +L+
Sbjct: 579 MNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLE 625



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 44/169 (26%), Positives = 76/169 (44%), Gaps = 5/169 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           +LTG +   L  +K++    +  N L  S+P +L    ++  L ++ N  TG +P S  +
Sbjct: 297 KLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGK 356

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  LE+L +  NQL G +     + T L+ L    N+  G +P T               
Sbjct: 357 LTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDT--------------- 401

Query: 703 VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL---QTGGNSWN 840
                  +     L+NL +++NHF G +P  L+   SL   +  GNS++
Sbjct: 402 -------ICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFS 443



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 36/172 (20%), Positives = 78/172 (45%), Gaps = 7/172 (4%)
 Frame = +1

Query: 325 TEIQISGLQLTGSMGFQLDQL---KSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           TE+ +  L      GF  D +     +    +  N+    +P  L    ++ ++   GN 
Sbjct: 382 TELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNS 441

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           F+G +  +      L ++++S+N   G+++  +     L     S NS+ G IP    ++
Sbjct: 442 FSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNM 501

Query: 670 TNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           T +  + L +N  TG + + ++N+  +  L +  N  +G IP  ++ + +L+
Sbjct: 502 TQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLE 553



>pir|T00502|T00502 probable receptor-like protein kinase At2g23300
           [imported] - Arabidopsis thaliana>gb:AC002391_1530628
           Arabidopsis thaliana chromosome 2 clone T20D16 map
           CIC06C07, complete sequence.
          Length = 773

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 55/190 (28%), Positives = 84/190 (44%), Gaps = 2/190 (1%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L  W  +  +PC  SW+GV C+ +                         V T  +  +NL
Sbjct: 53  LQSWNYDHDNPC--SWRGVLCNND-----------------------SRVVTLSLPNSNL 87

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
             S+P  L    N+Q LNL+ N   G LP        L +L++S+N + GE+ V    L 
Sbjct: 88  VGSIPSDLGFLQNLQSLNLSNNSLNGSLPVEFFAADKLRFLDLSNNLISGEIPVSIGGLH 147

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTG 780
           NL TL+ S N   G +P   +SL ++  + L+NN F+G         +  L++ +N   G
Sbjct: 148 NLQTLNLSDNIFTGKLPANLASLGSLTEVSLKNNYFSGEFPGGGWRSVQYLDISSNLING 207

Query: 781 WIPPQLQGIN 810
            +PP   G N
Sbjct: 208 SLPPDFSGDN 217



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 2/105 (1%)
 Frame = +1

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           +  ++ L+  N  H+       V+  + + + TL    ++L G+IP     L N++++ L
Sbjct: 47  LDPLSLLQSWNYDHDNPCSWRGVLCNNDSRVVTLSLPNSNLVGSIPSDLGFLQNLQSLNL 106

Query: 694 QNNVFTGTIDV--LANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
            NN   G++ V   A   L  L++ NN  +G IP  + G+++LQT
Sbjct: 107 SNNSLNGSLPVEFFAADKLRFLDLSNNLISGEIPVSIGGLHNLQT 151



>pir|B85089|B85089 receptor protein kinase-like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV25_1544601 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           25.>gb:ATT32A17_1555906 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T32A17 (ESSA project).
          Length = 1027

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 67/263 (25%), Positives = 114/263 (43%), Gaps = 32/263 (12%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVL-RGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           V L+I  +L+   +  A  +  +A +  +  F++  S  +L+ W          SW GV+
Sbjct: 12  VLLIISIVLSCSFAVSATVEEANALLKWKSTFTNQTSSSKLSSWVNPNTSSFCTSWYGVA 71

Query: 307 CSGNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNNLG------------------ 429
           CS   +  + ++   + G+   F    L ++T  D+S N                     
Sbjct: 72  CSLGSIIRLNLTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDL 131

Query: 430 --NSLPYQLPP------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM 585
             N L  ++PP      N+  L+L  N   G +P  I ++  +  + +  N L G +   
Sbjct: 132 SINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSS 191

Query: 586 FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV----LANLPLDNL 753
           F +LT L  L    NSL+G+IP    +L N++ + L  N  TG I      L N+ L  L
Sbjct: 192 FGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTL--L 249

Query: 754 NVENNHFTGWIPPQLQGINSLQT 822
           N+  N  +G IPP++  + +L T
Sbjct: 250 NMFENQLSGEIPPEIGNMTALDT 272



 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 42/137 (30%), Positives = 82/137 (59%), Gaps = 2/137 (1%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           NR++++Q++G +L+G +   +  L ++   D+S+N   + +P  L   P +  +NL+ N 
Sbjct: 508 NRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRND 567

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
               +P  +++++ L+ L++S+NQL GE++  F SL NL  LD S N+L+G IP +F  +
Sbjct: 568 LDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSGQIPPSFKDM 627

Query: 670 TNMKNMYLQNNVFTGTI 720
             + ++ + +N   G I
Sbjct: 628 LALTHVDVSHNNLQGPI 644



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 4/171 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
           +VTEI I    LTG +      L  +    +  N+L  S+P ++   PN+++L L  N  
Sbjct: 173 KVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNL 232

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P S   +  +  LN+  NQL GE+     ++T L TL    N L G IP T  ++ 
Sbjct: 233 TGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIK 292

Query: 673 NMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            +  ++L  N   G+I  ++     + +L +  N  TG +P     + +L+
Sbjct: 293 TLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALE 343



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 48/167 (28%), Positives = 82/167 (49%), Gaps = 4/167 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           I +S     G +    +Q + +  F +S N++  ++P ++     + +L+L+ N  TG L
Sbjct: 441 IDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGEL 500

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P SIS +  +  L ++ N+L G++      LTNL  LD S N  +  IP T ++L  +  
Sbjct: 501 PESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYY 560

Query: 685 MYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           M L  N    TI + L  L  L  L++  N   G I  Q + + +L+
Sbjct: 561 MNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLE 607



 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 44/169 (26%), Positives = 76/169 (44%), Gaps = 5/169 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           +LTG +   L  +K++    +  N L  S+P +L    ++  L ++ N  TG +P S  +
Sbjct: 279 KLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGK 338

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  LE+L +  NQL G +     + T L+ L    N+  G +P T               
Sbjct: 339 LTALEWLFLRDNQLSGPIPPGIANSTELTVLQVDTNNFTGFLPDT--------------- 383

Query: 703 VFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL---QTGGNSWN 840
                  +     L+NL +++NHF G +P  L+   SL   +  GNS++
Sbjct: 384 -------ICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFS 425



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 34/174 (19%), Positives = 80/174 (45%), Gaps = 4/174 (2%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAG 483
           +   +T +Q+     TG +   + +   +    +  N+    +P  L    ++ ++   G
Sbjct: 362 NSTELTVLQVDTNNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKG 421

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N F+G +  +      L ++++S+N   G+++  +     L     S NS+ G IP    
Sbjct: 422 NSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIW 481

Query: 664 SLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           ++T +  + L +N  TG + + ++N+  +  L +  N  +G IP  ++ + +L+
Sbjct: 482 NMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLE 535



>gb:AP004158_1838368 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1118_F05.
          Length = 827

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 71/223 (31%), Positives = 107/223 (47%), Gaps = 7/223 (3%)
 Frame = +1

Query: 133 ALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS 312
           A ++ FL  A  +AVA    TDA  +   F+ +          A+G   CG  W GV+C 
Sbjct: 3   ARVVLFLAVAVVAAVAQEPNTDAYFVSRFFAKMGRAAP-----ASGAAVCG--WPGVACD 55

Query: 313 GN-RVTEIQISGLQLTGSMGFQ-LDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLNL 477
           G  RV E   +G+ L G++    + +L  + + D+S N L  +LP   +++  ++ +LNL
Sbjct: 56  GEGRVVEFSAAGMGLEGAVPEDTVGKLARLRSLDLSGNRLA-ALPNDLWEVGASLLELNL 114

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           + N   G LP +I   A L+ L+VSHN   G +     S+  L  LD S N   G +  T
Sbjct: 115 SRNAIRGDLPNNIVNFAALQVLDVSHNAFSGALPPALGSIAALRVLDASHNLFQGQLLGT 174

Query: 658 -FSSLTNMKNMYLQNNVFTGTI-DVLANLPLDNLNVENNHFTG 780
             S  TN+ +M L  N   G + D+   L L  LN+  N   G
Sbjct: 175 VISGWTNLSSMDLSGNALDGDLPDLSPLLSLSYLNLSGNRLRG 217



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 54/193 (27%), Positives = 91/193 (47%), Gaps = 26/193 (13%)
 Frame = +1

Query: 298 GVSCSG-NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN 474
           G   SG   ++ + +SG  L G +   L  L S++  ++S N L  S+       ++ ++
Sbjct: 173 GTVISGWTNLSSMDLSGNALDGDLP-DLSPLLSLSYLNLSGNRLRGSVIGAFHEQMKVID 231

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTV---------------------MFV 591
           L+ N F+G    S    + L YL++S N+L GE +V                     + V
Sbjct: 232 LSNNSFSGLNFSSGYAGSSLAYLDLSGNELTGEFSVGNRFQNLKHLNLAFNQLSVANLLV 291

Query: 592 SLTNLSTLDF---SFNSLAGNIPQTFSS-LTNMKNMYLQNNVFTGTIDVLANLPLDNLNV 759
           S+  +S L+F   S   L G IP+  SS L+ +K + L  N  +G +  L+++ L  L++
Sbjct: 292 SMGEISGLEFVNLSSTGLHGQIPRELSSQLSRLKVLDLSRNNISGVVPDLSSIRLQVLDL 351

Query: 760 ENNHFTGWIPPQL 798
             N+ TG IP  L
Sbjct: 352 SVNNLTGEIPVAL 364



 Score = 38.1 bits (87), Expect = 0.21
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +1

Query: 310 SGNRVTEIQISGL--QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG 483
           SG     +  +GL  Q+   +  QL +LK     D+S NN+   +P      +Q L+L+ 
Sbjct: 297 SGLEFVNLSSTGLHGQIPRELSSQLSRLK---VLDLSRNNISGVVPDLSSIRLQVLDLSV 353

Query: 484 NGFTGGLPYS-ISQMAPLEYLNVSHNQL 564
           N  TG +P + + ++  +E  N S+N L
Sbjct: 354 NNLTGEIPVALVKKLVSMERFNFSYNNL 381



>gb:AF053997_1764491 Lycopersicon esculentum Hcr2-5B (Hcr2-5B) gene,
           complete cds.
          Length = 799

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 5/195 (2%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNN 423
           L  WT +  + C + W GV C   RV  + I+   + G++  F    L  +   D+S NN
Sbjct: 49  LASWTTSS-NAC-KDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNN 106

Query: 424 LGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
           +  ++P ++    N+  L+L  N  +G +P  I  +A L+ + + +N L G +      L
Sbjct: 107 ISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYL 166

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNH 771
            +L+ L    N L+G+IP +  ++TN+  ++L  N  +G I  ++     L  L+++ N 
Sbjct: 167 RSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINF 226

Query: 772 FTGWIPPQLQGINSL 816
            +G IP  L  +N+L
Sbjct: 227 LSGSIPASLGNLNNL 241



 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 51/161 (31%), Positives = 81/161 (50%), Gaps = 4/161 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           QL+G +  ++  L+S+T   +  N L  S+P  L    N+  L L  N  +G +P  I  
Sbjct: 202 QLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGY 261

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L YL++  N L G +     +L NLS L    N L+G+IP+    L+++ N+YL NN
Sbjct: 262 LRSLTYLDLKENALNGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTNLYLGNN 321

Query: 703 VFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGINSLQ 819
              G I     N+  L  L + +N+  G IP  +  + SL+
Sbjct: 322 SLIGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLE 362



 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 55/206 (26%), Positives = 90/206 (43%), Gaps = 31/206 (15%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N ++ + +   QL+GS+  ++  L S+T   +  N+L   +P       N+Q L L  N 
Sbjct: 287 NNLSRLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLIGLIPASFGNMRNLQALFLNDNN 346

Query: 490 FTGGLPYSISQMAPLEYL------------------------NVSHNQLQGEVTVMFVSL 597
             G +P  +  +  LE L                        ++S N   GE+     +L
Sbjct: 347 LIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISDLLVLSMSSNSFSGELPSSISNL 406

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNH 771
           T+L  LDF  N+L G IPQ F ++++++   +QNN  +GT+    ++   L +LN+  N 
Sbjct: 407 TSLKILDFGRNNLEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNE 466

Query: 772 FTGWIPPQLQGINSLQT---GGNSWN 840
               IP  L     LQ    G N  N
Sbjct: 467 LEDEIPWSLDNCKKLQVLDLGDNQLN 492



 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 34/84 (40%), Positives = 50/84 (59%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           ++L+ N F G +P  +  +  +  LNVSHN LQG +     SL+ L +LD SFN L+G I
Sbjct: 596 IDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEI 655

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
           PQ  +SLT ++ + L +N   G I
Sbjct: 656 PQQLASLTFLEFLNLSHNYLQGCI 679



 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 39/112 (34%), Positives = 56/112 (50%), Gaps = 2/112 (1%)
 Frame = +1

Query: 385 LKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN 558
           L   T  D+S+N     +P  L     ++ LN++ N   G +P S+  ++ LE L++S N
Sbjct: 590 LSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFN 649

Query: 559 QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
           QL GE+     SLT L  L+ S N L G IPQ     T   N Y+ N+   G
Sbjct: 650 QLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYIGNDGLRG 701



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 4/124 (3%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLAGNGFTGGLPYSISQM 525
           L G++      + S+  FD+  N L  +LP  + +  ++  LNL GN     +P+S+   
Sbjct: 419 LEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNC 478

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL--TNMKNMYLQN 699
             L+ L++  NQL     +   +L  L  L  + N L G I  + + +   +++ + L  
Sbjct: 479 KKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSR 538

Query: 700 NVFT 711
           N F+
Sbjct: 539 NAFS 542



 Score = 42.4 bits (98), Expect = 0.011
 Identities = 46/196 (23%), Positives = 88/196 (44%), Gaps = 20/196 (10%)
 Frame = +1

Query: 313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGN 486
            G  +  + + G +L   + + LD  K +   D+  N L ++ P  L   P ++ L L  N
Sbjct: 454  GCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSN 513

Query: 487  GFTGGLPYSISQMA--PLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFS---------FN 630
               G +  S +++    L  +++S N    ++ T +F  L  + T+D +         ++
Sbjct: 514  KLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYEIYYD 573

Query: 631  SLAGNIPQTFSSLTNMKNMY----LQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPP 792
            S+          +  + ++Y    L +N F G I  VL +L  +  LNV +N   G+IP 
Sbjct: 574  SVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPS 633

Query: 793  QLQGINSLQTGGNSWN 840
             L  ++ L++   S+N
Sbjct: 634  SLGSLSILESLDLSFN 649



>gb:AC118284_1739500 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1087_C03, complete
           sequence.>gb:AC144740_1744189 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0075A10,
           complete sequence.
          Length = 1014

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 66/227 (29%), Positives = 104/227 (45%), Gaps = 33/227 (14%)
 Frame = +1

Query: 238 PPQLTKWTANGGDPCGESWKGVSCSGN---RVTEIQISGLQLTGS-------------MG 369
           P  L  WT +    C   W  VSC G    RVT + +  + + G+             + 
Sbjct: 50  PAALASWT-DAAPHC--RWVYVSCDGGGTGRVTSLSLPNVAVAGAVPDAIGGLTALTVLN 106

Query: 370 FQ-----------LDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGGLP 507
            Q           L  L ++T+ D+S N++G  LP    +L  N+  L L  N FTG +P
Sbjct: 107 LQNTSVGGVFPAFLYNLTAITSIDLSMNSIGGELPADIDRLGKNLTYLALNNNNFTGVIP 166

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA-GNIPQTFSSLTNMKN 684
            ++S++  L+   ++ NQL G +      LT+L TL    N    G +P +F +LT++K 
Sbjct: 167 AAVSKLKNLKVFTLNCNQLTGTIPAALGELTSLETLKLEVNQFTPGELPGSFKNLTSLKT 226

Query: 685 MYLQNNVFTGTID--VLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           ++L     TG     V   + ++ L++  N FTG IPP +  I  LQ
Sbjct: 227 VWLAQCNLTGDFPSYVTEMMEMEYLDLSQNSFTGSIPPGIWNIPKLQ 273



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 58/194 (29%), Positives = 91/194 (46%), Gaps = 2/194 (1%)
 Frame = +1

Query: 223 SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTT 402
           +SL + P L        +  GE    +      +T +  +   LTGS+  +L    ++T 
Sbjct: 410 ASLATCPALLSLQLQDNELSGEVPAALWTETRLITVLLQNNGHLTGSLPEKL--YWNLTR 467

Query: 403 FDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL-EYLNVSHNQLQGEVT 579
             I  N     LP      +QK N   N F+G +P   +   PL + L++S NQL G + 
Sbjct: 468 LYIHNNRFSGRLP-ATATKLQKFNAENNLFSGEIPDGFAAGMPLLQELDLSRNQLSGAIP 526

Query: 580 VMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLPLDNLN 756
           V   SL+ LS ++FS N   G+IP    S+  +  + L +N  +G I   L +L ++ LN
Sbjct: 527 VSIASLSGLSQMNFSRNQFTGDIPAGLGSMPVLTLLDLSSNKLSGGIPTSLGSLKINQLN 586

Query: 757 VENNHFTGWIPPQL 798
           + +N  TG IP  L
Sbjct: 587 LSSNQLTGEIPAAL 600



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 50/159 (31%), Positives = 80/159 (50%), Gaps = 6/159 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
           + ++   LTG     + ++  +   D+S N+   S+P  +   P +Q L L  N  TG +
Sbjct: 227 VWLAQCNLTGDFPSYVTEMMEMEYLDLSQNSFTGSIPPGIWNIPKLQYLFLYTNQLTGDV 286

Query: 505 PYSIS-QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
             +     A L YL++S NQL G +   F SL NL+ L    N+ +G IP + + L ++ 
Sbjct: 287 VVNGKIGAASLIYLDISENQLTGTIPESFGSLMNLTNLALMTNNFSGEIPASLAQLPSLV 346

Query: 682 NMYLQNNVFTGTI--DVLANLP-LDNLNVENNHFTGWIP 789
            M L  N  TG I  ++  + P L ++ V+NN  TG IP
Sbjct: 347 IMKLFENNLTGQIPAELGKHSPFLRDIEVDNNDLTGPIP 385



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 4/150 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPPNVQK--LNLAGNGFTGGLPYSISQ 522
           LTG +  +L +    +   ++  N+L   +P  +  N +   ++ AGN   G +P S++ 
Sbjct: 355 LTGQIPAELGKHSPFLRDIEVDNNDLTGPIPEGVCDNRRLWIISAAGNRLNGSIPASLAT 414

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS-LAGNIPQTFSSLTNMKNMYLQN 699
              L  L +  N+L GEV     + T L T+    N  L G++P+      N+  +Y+ N
Sbjct: 415 CPALLSLQLQDNELSGEVPAALWTETRLITVLLQNNGHLTGSLPEKL--YWNLTRLYIHN 472

Query: 700 NVFTGTIDVLANLPLDNLNVENNHFTGWIP 789
           N F+G +   A   L   N ENN F+G IP
Sbjct: 473 NRFSGRLPATAT-KLQKFNAENNLFSGEIP 501



>gb:AY075690_1567829 Arabidopsis thaliana AT5g20480/F7C8_70 mRNA,
           complete cds.>gb:BT005820_1638742 Arabidopsis thaliana
           At5g20480/F7C8_70 gene, complete cds.
          Length = 1031

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 68/239 (28%), Positives = 115/239 (48%), Gaps = 7/239 (2%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP-CGESWKGV 303
           A+ LL+   + A      +TD       +   S  N    L  W  N   P C  +W GV
Sbjct: 11  ALTLLLQVCIFAQARFSNETDMQALLEFKSQVSENNKREVLASW--NHSSPFC--NWIGV 66

Query: 304 SCSGNR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKL 471
           +C   R  V  + + G +LTG +   +  L  +   +++ N+ G+++P ++     +Q L
Sbjct: 67  TCGRRRERVISLNLGGFKLTGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYL 126

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           N++ N   G +P S+S  + L  +++S N L   V     SL+ L+ LD S N+L GN P
Sbjct: 127 NMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFP 186

Query: 652 QTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQT 822
            +  +LT+++ +    N   G I D +A L  +    +  N F+G  PP L  I+SL++
Sbjct: 187 ASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLES 245



 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 49/172 (28%), Positives = 90/172 (52%), Gaps = 5/172 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGF 492
           R+  + +S   L G +   L     ++T D+S+N+LG+ +P +L     +  L+L+ N  
Sbjct: 122 RLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNL 181

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG  P S+  +  L+ L+ ++NQ++GE+      LT +     + NS +G  P    +++
Sbjct: 182 TGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNIS 241

Query: 673 NMKNMYLQNNVFTGTIDVLANLPLDNLN---VENNHFTGWIPPQLQGINSLQ 819
           +++++ L +N F+G +       L NL    +  N FTG IP  L  I+SL+
Sbjct: 242 SLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLE 293



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 54/205 (26%), Positives = 92/205 (44%), Gaps = 29/205 (14%)
 Frame = +1

Query: 313  GNRVT--EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKLNLA 480
            GN V+  E+ +    L+G +     +L ++   D+ +N +   +P  +     +QKL+L 
Sbjct: 390  GNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLN 449

Query: 481  GNGFTGGLPYSIS------------------------QMAPLEYLNVSHNQLQGEVTVMF 588
             N F G +P S+                         Q+  L Y+++S+N L G      
Sbjct: 450  SNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEV 509

Query: 589  VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLPLDNLNVEN 765
              L  L  L  S+N L+G +PQ      +M+ +++Q N F G I D+   + L N++  N
Sbjct: 510  GKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNVDFSN 569

Query: 766  NHFTGWIPPQLQGINSLQTGGNSWN 840
            N+ +G IP  L  + SL+    S N
Sbjct: 570  NNLSGRIPRYLASLPSLRNLNLSMN 594



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 50/168 (29%), Positives = 86/168 (51%), Gaps = 11/168 (6%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKL----NLAGNGFTGGLPY 510
           Q TG++   L  + S+  FDIS+N L  S+P       N+  L    N  GN  + GL +
Sbjct: 277 QFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEF 336

Query: 511 --SISQMAPLEYLNVSHNQLQGEVTVMFVSL-TNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
             +++    LEYL+V +N+L GE+     +L T L++L    N ++G IP    +L +++
Sbjct: 337 IGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQ 396

Query: 682 NMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            + L+ N+ +G + V     L L  +++ +N  +G IP     +  LQ
Sbjct: 397 ELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQ 444



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 40/154 (25%), Positives = 80/154 (51%), Gaps = 4/154 (2%)
 Frame = +1

Query: 391 SVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQL 564
           ++T+  +  N +  ++P+ +    ++Q+L+L  N  +G LP S  ++  L+ +++  N +
Sbjct: 370 TLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAI 429

Query: 565 QGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANL 738
            GE+   F ++T L  L  + NS  G IPQ+      + ++++  N   GTI  ++L   
Sbjct: 430 SGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIP 489

Query: 739 PLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            L  +++ NN  TG  P ++  +  L   G S+N
Sbjct: 490 SLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYN 523



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 49/184 (26%), Positives = 87/184 (47%), Gaps = 34/184 (18%)
 Frame = +1

Query: 370 FQLDQLKSVTTFDIS-TNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLN 546
           + +  L+S++  D S + NL     Y LP N+++L L  N FTG +P +++ ++ LE  +
Sbjct: 238 YNISSLESLSLADNSFSGNLRADFGYLLP-NLRRLLLGTNQFTGAIPKTLANISSLERFD 296

Query: 547 VSHNQLQGEVTVMFVSL------------------------------TNLSTLDFSFNSL 636
           +S N L G + + F  L                              T L  LD  +N L
Sbjct: 297 ISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRL 356

Query: 637 AGNIPQTFSSL-TNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGI 807
            G +P + ++L T + +++L  N+ +GTI  D+   + L  L++E N  +G +P     +
Sbjct: 357 GGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKL 416

Query: 808 NSLQ 819
            +LQ
Sbjct: 417 LNLQ 420



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 35/126 (27%), Positives = 65/126 (51%), Gaps = 2/126 (1%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG--NGFTGGLPYSISQ 522
           +L G++  ++ Q+ S+   D+S N L    P ++      + L    N  +G +P +I  
Sbjct: 476 RLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGG 535

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              +E+L +  N   G +  +   L +L  +DFS N+L+G IP+  +SL +++N+ L  N
Sbjct: 536 CLSMEFLFMQGNSFDGAIPDIS-RLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMN 594

Query: 703 VFTGTI 720
            F G +
Sbjct: 595 KFEGRV 600



>gb:ATAC018363_1543678 Arabidopsis thaliana chromosome III BAC F13E7
           genomic sequence, complete sequence.>gb:BT006352_1639239
           Arabidopsis thaliana At3g02880/F13E7_17 gene, complete
           cds.>gb:AF372969_1792681 Arabidopsis thaliana
           AT3g02880/F13E7_17 mRNA, complete cds.
          Length = 627

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 62/235 (26%), Positives = 100/235 (42%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           ++L + FL     +AV     +D   L  + +S+   P L  W  +   PC  +W GV C
Sbjct: 7   LSLSVVFLFVFYLAAVTSDLESDRRALLAVRNSVRGRPLL--WNMSASSPC--NWHGVHC 62

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
              RVT +++ G  L GS+                   +GN         ++ L+L  N 
Sbjct: 63  DAGRVTALRLPGSGLFGSLPI---------------GGIGNLT------QLKTLSLRFNS 101

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P   S +  L YL +  N   GE+  +  +L ++  ++   N  +G IP   +S 
Sbjct: 102 LSGPIPSDFSNLVLLRYLYLQGNAFSGEIPSLLFTLPSIIRINLGENKFSGRIPDNVNSA 161

Query: 670 TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNS 834
           T +  +YL+ N  +G I  +  LPL   NV +N   G IP  L         GN+
Sbjct: 162 TRLVTLYLERNQLSGPIPEI-TLPLQQFNVSSNQLNGSIPSSLSSWPRTAFEGNT 215



>gb:AP004747_1844318 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0407A09.
          Length = 1001

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 61/172 (35%), Positives = 85/172 (49%), Gaps = 6/172 (3%)
 Frame = +1

Query: 292 WKGVSCSGN---RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-YQLPPN 459
           W+GV C+     RV  + +S   LTG +   L  L  +   D+  NNL  SLP       
Sbjct: 68  WQGVKCTSTGPWRVMALNLSSQSLTGQIRSSLGNLSFLNILDLGDNNLLGSLPRLGNLKQ 127

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           +Q L L  N  TG +P  ++  + L Y+++S N L G +     SL+NL+ L  S N L 
Sbjct: 128 LQALYLYKNNLTGIIPDELTNCSSLTYIDLSGNALTGALPPNLGSLSNLAYLYLSANKLT 187

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
           G IPQ   ++T +  +YL  N F G I D L  LP L  L +  N  +G IP
Sbjct: 188 GTIPQALGNITTLVEIYLDTNRFEGGIPDKLWQLPNLTILALGQNMLSGDIP 239



 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 52/167 (31%), Positives = 79/167 (47%), Gaps = 4/167 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           LTG +   + +L  +    +  NN   S+P  +   P +  L+LA N F G +P S+  +
Sbjct: 409 LTGKIDEWVPKLTKLQKLLLHRNNFSGSIPSSIAELPRLSTLSLAYNAFDGPIPSSLGNL 468

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L+ L +SHN L+G +      L  L  L  S N L G IP T S   ++ N+ + NN 
Sbjct: 469 SGLQKLYLSHNNLEGVIPPELSYLKQLINLSLSENKLTGEIPGTLSQCKDLANIQMGNNF 528

Query: 706 FTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
            TG I V       L  LN+ +N  +G IP  L  +  +     S+N
Sbjct: 529 LTGNIPVTFGDLKSLGVLNLSHNSLSGTIPTTLNDLPVMSKLDLSYN 575



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 47/171 (27%), Positives = 81/171 (47%), Gaps = 9/171 (5%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQ----LDQLKSVTTFDISTNNLGNSLPYQ---LPPNVQKLNLAGNG 489
           ++ + L+ +   G++    L    ++    ++ N L   +P     LP  +Q+L L+ N 
Sbjct: 325 LENNSLEASDGQGWEFLHALRNCSNLELLSLAQNQLQGEIPNSIGDLPLKLQQLVLSENK 384

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            +G +P SI  +  L  L++  N L G++      LT L  L    N+ +G+IP + + L
Sbjct: 385 LSGEVPASIGNLQGLFRLSLDLNNLTGKIDEWVPKLTKLQKLLLHRNNFSGSIPSSIAEL 444

Query: 670 TNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
             +  + L  N F G I   L NL  L  L + +N+  G IPP+L  +  L
Sbjct: 445 PRLSTLSLAYNAFDGPIPSSLGNLSGLQKLYLSHNNLEGVIPPELSYLKQL 495



 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 42/136 (30%), Positives = 66/136 (48%), Gaps = 2/136 (1%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN--LAGNGF 492
           R++ + ++     G +   L  L  +    +S NNL   +P +L    Q +N  L+ N  
Sbjct: 446 RLSTLSLAYNAFDGPIPSSLGNLSGLQKLYLSHNNLEGVIPPELSYLKQLINLSLSENKL 505

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P ++SQ   L  + + +N L G + V F  L +L  L+ S NSL+G IP T + L 
Sbjct: 506 TGEIPGTLSQCKDLANIQMGNNFLTGNIPVTFGDLKSLGVLNLSHNSLSGTIPTTLNDLP 565

Query: 673 NMKNMYLQNNVFTGTI 720
            M  + L  N   G I
Sbjct: 566 VMSKLDLSYNRLQGKI 581



 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 2/112 (1%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           ++ +S   L G +  +L  LK +    +S N L   +P  L    ++  + +  N  TG 
Sbjct: 473 KLYLSHNNLEGVIPPELSYLKQLINLSLSENKLTGEIPGTLSQCKDLANIQMGNNFLTGN 532

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           +P +   +  L  LN+SHN L G +      L  +S LD S+N L G IP T
Sbjct: 533 IPVTFGDLKSLGVLNLSHNSLSGTIPTTLNDLPVMSKLDLSYNRLQGKIPMT 584



 Score = 33.1 bits (74), Expect = 6.8
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +  IQ+    LTG++      LKS+   ++S N+L  ++P  L   P + KL+L+ N   
Sbjct: 519 LANIQMGNNFLTGNIPVTFGDLKSLGVLNLSHNSLSGTIPTTLNDLPVMSKLDLSYNRLQ 578

Query: 496 GGLP 507
           G +P
Sbjct: 579 GKIP 582



>gb:AP003898_1834956 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1663_D06.>gb:AP005734_1856838 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0032E15.
          Length = 646

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 59/181 (32%), Positives = 93/181 (51%), Gaps = 7/181 (3%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVL--RGLFSSLNSPPQLTKWTANGGDPCGESWKGV 303
           V LL+  L+    +A AD     A++L  R      + P     W  +   PCG +W+GV
Sbjct: 10  VLLLLLLLVLVARAAAADMAGDRAALLALRDAVGGRHLP-----WDPSAPTPCGGAWRGV 64

Query: 304 SCS--GNRVTEIQISGLQLTGSMGF-QLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--K 468
            CS  G+RVTE+++ G  L G++    +  L ++ T  +  N +   +P  +   VQ   
Sbjct: 65  GCSASGDRVTELRLPGKSLRGAVPVGTVGNLTALRTLSLRMNAISGGIPADIGGCVQLRS 124

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           LNL+GN   GGLP  +  +A LE +++S N+L G V+  F  L +L+TL+   N   G +
Sbjct: 125 LNLSGNRLAGGLPEGLFSLALLEKVDLSGNRLTGGVSPEFSRLASLTTLNLDRNGFDGTL 184

Query: 649 P 651
           P
Sbjct: 185 P 185



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 2/77 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-PNVQKLNLAGNGFTGG- 501
           ++ +SG +LTG +  +  +L S+TT ++  N    +LP  L  PN+ + N++ NG  GG 
Sbjct: 148 KVDLSGNRLTGGVSPEFSRLASLTTLNLDRNGFDGTLPGNLTLPNLARFNVSYNGQLGGA 207

Query: 502 LPYSISQMAPLEYLNVS 552
           +P S++ M    +L  S
Sbjct: 208 VPASLAGMPASAFLGTS 224



>gb:AP003237_1825947 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0046E05.
          Length = 526

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 52/163 (31%), Positives = 90/163 (55%), Gaps = 7/163 (4%)
 Frame = +1

Query: 322 VTEIQISGLQL-TGS---MGFQLDQLKSVTTFDISTNNLGNSLPYQLP-PNVQKLNLAGN 486
           +TE+ ++   L TGS   +   +  +  +T+  +S  NL   LP+    PN+  L+L+GN
Sbjct: 254 LTELTVADTPLATGSPSELAVVVSHMGHLTSLTLSNANLSGFLPHHWHCPNLTHLDLSGN 313

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             TG +P +++ ++ + +LN+S N L G +      L +L+T+D S NS++G IP T S+
Sbjct: 314 RITGAIPDTLTLLSAITHLNLSSNDLNGNIPTSIGDLISLTTIDLSNNSISGRIPDTVST 373

Query: 667 LTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIP 789
           L  ++ + L +N   G+I    +    L  LN+E N F G +P
Sbjct: 374 LPELEVLNLGSNRLNGSIPQFLSEMRGLKELNLEGNDFDGMVP 416



>gb:AF244890_1780447 Glycine max receptor-like protein kinase 3
           (RLK3) mRNA, complete cds.
          Length = 1012

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 60/199 (30%), Positives = 95/199 (47%), Gaps = 4/199 (2%)
 Frame = +1

Query: 235 SPPQLTKWTANGGDP-CGESWKGVSCSGNR-VTEIQISGLQLTGSMGFQLDQLKSVTTFD 408
           +PP LT W  N   P C  SW GV+C   R VT + ++GL L+G +   +  L       
Sbjct: 42  TPPLLTSW--NSSTPYC--SWLGVTCDNRRHVTSLDLTGLDLSGPLSADVAHL------- 90

Query: 409 ISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
                          P +  L+LA N F+G +P S+S ++ L +LN+S+N          
Sbjct: 91  ---------------PFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSEL 135

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVE 762
             L NL  LD   N++ G +P   + + N+++++L  N F+G I  +      L  L V 
Sbjct: 136 SRLQNLEVLDLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVS 195

Query: 763 NNHFTGWIPPQLQGINSLQ 819
            N   G IPP++  ++SL+
Sbjct: 196 GNELEGTIPPEIGNLSSLR 214



 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 65/239 (27%), Positives = 107/239 (44%), Gaps = 20/239 (8%)
 Frame = +1

Query: 166 PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT-----E 330
           P AVA         L G F S   PP+  +W         +  + ++ SGN +      E
Sbjct: 156 PLAVAQMQNLRHLHLGGNFFSGQIPPEYGRW---------QRLQYLAVSGNELEGTIPPE 206

Query: 331 I-QISGLQ---------LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN-- 474
           I  +S L+          TG +  ++  L  +   D +   L   +P  L   +QKL+  
Sbjct: 207 IGNLSSLRELYIGYYNTYTGGIPPEIGNLSELVRLDAAYCGLSGEIPAALG-KLQKLDTL 265

Query: 475 -LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
            L  N  +G L   +  +  L+ +++S+N L GE+   F  L N++ L+   N L G IP
Sbjct: 266 FLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIP 325

Query: 652 QTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           +    L  ++ + L  N FTG+I   +  N  L+ +++ +N  TG +P  L   N+LQT
Sbjct: 326 EFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCSGNTLQT 384



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 4/178 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY--QLPPNVQKLNLAGNGFT 495
           +T I++    L GS+   L  L  +T  ++  N L    P    +  N+ ++ L+ N  +
Sbjct: 406 LTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLS 465

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G LP SI   + ++ L +  N   G +      L  LS +DFS N  +G I    S    
Sbjct: 466 GVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKL 525

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           +  + L  N  +G I  ++     L+ LN+  NH  G IP  +  + SL +   S+N+
Sbjct: 526 LTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYNN 583



 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 48/177 (27%), Positives = 86/177 (48%), Gaps = 2/177 (1%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQ 375
           + S+ RGLF      P+LT+         GE  +  S + N + +I +S  QL+G +   
Sbjct: 417 NGSIPRGLFGL----PKLTQVELQDNYLSGEFPEVGSVAVN-LGQITLSNNQLSGVLPPS 471

Query: 376 LDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNV 549
           +    SV    +  N     +P Q+     + K++ +GN F+G +   ISQ   L +L++
Sbjct: 472 IGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDL 531

Query: 550 SHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           S N+L G++      +  L+ L+ S N L G IP + SS+ ++ ++    N  +G +
Sbjct: 532 SRNELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYNNLSGLV 588



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 36/118 (30%), Positives = 64/118 (54%), Gaps = 6/118 (5%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK------LNLAG 483
           V ++ + G   TG +  Q+ +L+ ++  D S    GN     + P + +      L+L+ 
Sbjct: 478 VQKLILDGNMFTGRIPPQIGRLQQLSKIDFS----GNKFSGPIVPEISQCKLLTFLDLSR 533

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           N  +G +P  I+ M  L YLN+S N L G +     S+ +L+++DFS+N+L+G +P T
Sbjct: 534 NELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYNNLSGLVPGT 591



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 41/170 (24%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFT 495
           +T + +   +L G++   + +L ++    +  NN   S+P  L  N  +  ++L+ N  T
Sbjct: 310 ITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLT 369

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G LP  +     L+ L    N L G +     S  +L+ +    N L G+IP+    L  
Sbjct: 370 GTLPTYLCSGNTLQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPK 429

Query: 676 MKNMYLQNNVFTGTIDVLANLP--LDNLNVENNHFTGWIPPQLQGINSLQ 819
           +  + LQ+N  +G    + ++   L  + + NN  +G +PP +   +S+Q
Sbjct: 430 LTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQ 479



>gb:AC082645_1733172 Oryza sativa chromosome 3 BAC OSJNBb0033N16
           genomic sequence, complete sequence.
          Length = 686

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 67/212 (31%), Positives = 96/212 (45%), Gaps = 1/212 (0%)
 Frame = +1

Query: 169 SAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE-SWKGVSCSGNRVTEIQISG 345
           +A+AD    DA   R L +  ++  +   W  NG DP G  SW GV+C G RV  +++ G
Sbjct: 27  AAMADDLAGDA---RALLAFRDAVGRHVAW--NGSDPGGACSWTGVTCEGGRVAVLRLPG 81

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM 525
             L G                +    LGN         +  L+L  N   G LP  ++  
Sbjct: 82  AALAGR---------------VPEGTLGNLTA------LHTLSLRLNALAGALPGDLTSA 120

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           A L  + ++ N+L GE    F++L  L  L    N L+G+IP    +LT +K + L+NN 
Sbjct: 121 AALRNVFLNGNRLSGEFPRAFLALQGLVRLAIGGNDLSGSIPPALGNLTRLKVLLLENNR 180

Query: 706 FTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ 801
           F+G I  L   PL   NV  N   G IP  L+
Sbjct: 181 FSGEIPDLKQ-PLQQFNVSFNQLNGSIPATLR 211



>gb:BT006440_1639327 Arabidopsis thaliana At1g60630 gene, complete
           cds.
          Length = 652

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 67/221 (30%), Positives = 101/221 (45%), Gaps = 2/221 (0%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS-CS 312
           L+  F L +P  +      +D   L  L SS++ P     W   G DPC  +W+GV  C 
Sbjct: 11  LVFAFFLISPVRS------SDVEALLSLKSSID-PSNSIPW--RGTDPC--NWEGVKKCM 59

Query: 313 GNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
             RV+++ +  L L+GS+ G  L+QL  +       N+L  S+P          NL+G  
Sbjct: 60  KGRVSKLVLENLNLSGSLNGKSLNQLDQLRVLSFKGNSLSGSIP----------NLSG-- 107

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
                      +  L+ L ++ N   GE      SL  L T+  S N  +G IP +   L
Sbjct: 108 -----------LVNLKSLYLNDNNFSGEFPESLTSLHRLKTVVLSRNRFSGKIPSSLLRL 156

Query: 670 TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPP 792
           + +   Y+Q+N+F+G+I  L    L   NV NN  +G IPP
Sbjct: 157 SRLYTFYVQDNLFSGSIPPLNQATLRFFNVSNNQLSGHIPP 197



>gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSERK1
           mRNA for SERK-family receptor-like protein kinase,
           complete cds.>gb:AP005164_1848543 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0054L03.
          Length = 624

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 57/184 (30%), Positives = 95/184 (51%), Gaps = 4/184 (2%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKG 300
           WAV  ++   L  P + V      DA  L  L ++L  P   L  W     +PC  +W  
Sbjct: 6   WAVWAVLLLRLLVPAARVLANMEGDA--LHSLRTNLVDPNNVLQSWDPTLVNPC--TWFH 61

Query: 301 VSCSG-NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKL 471
           V+C+  N V  + +    L+G++  QL QLK++   ++ +NN+  ++P +L    N+  L
Sbjct: 62  VTCNNDNSVIRVDLGNAALSGTLVPQLGQLKNLQYLELYSNNISGTIPSELGNLTNLVSL 121

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L  N FTG +P S+  +  L +L +++N L G +     ++T L  LD S N+L+G +P
Sbjct: 122 DLYLNNFTGPIPDSLGNLLKLRFLRLNNNSLSGSIPKSLTAITALQVLDLSNNNLSGEVP 181

Query: 652 QTFS 663
            T S
Sbjct: 182 STGS 185



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 33/113 (29%), Positives = 60/113 (53%), Gaps = 2/113 (1%)
 Frame = +1

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           +V +++L     +G L   + Q+  L+YL +  N + G +     +LTNL +LD   N+ 
Sbjct: 69  SVIRVDLGNAALSGTLVPQLGQLKNLQYLELYSNNISGTIPSELGNLTNLVSLDLYLNNF 128

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIP 789
            G IP +  +L  ++ + L NN  +G+I   + A   L  L++ NN+ +G +P
Sbjct: 129 TGPIPDSLGNLLKLRFLRLNNNSLSGSIPKSLTAITALQVLDLSNNNLSGEVP 181



>gb:AE016959_1023555 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091680_1734896
           Oryza sativa chromosome 10 BAC OSJNBa0034L04 genomic
           sequence, complete sequence.>gb:AE017114_1753374 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           68 of 77 of the complete sequence.
          Length = 737

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 54/169 (31%), Positives = 84/169 (49%), Gaps = 5/169 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNGFTGGLPYSISQ 522
           L GS    + +  ++T  D+S NN   S+P  LP   PN+  LNL+ N F+G +P SI +
Sbjct: 208 LNGSFPEFVIRSGNLTFLDLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGR 267

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L  L +  N L G V V   S++ L  LD  FN L G IP     L  ++ + + N 
Sbjct: 268 LTKLLDLRIDSNNLTGGVPVFLGSMSQLKVLDLGFNPLGGTIPPVLGQLQMLQQLSIMNA 327

Query: 703 VFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
               T+   L NL  L  + +  N  +G +PP+  G+ +++    S N+
Sbjct: 328 ELVSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNN 376



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 58/249 (23%), Positives = 106/249 (42%), Gaps = 31/249 (12%)
 Frame = +1

Query: 163 PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-------- 318
           P SA A    +    L    +SL+    L+ WT      C  +W+GV+C           
Sbjct: 26  PASAEAAASSSQTDALLAWKASLDDAASLSDWT-RAAPVC--TWRGVACDAAGSVASLRL 82

Query: 319 ------------------RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY 444
                              +TE+ ++   L G++  ++ +L+S+ + D+ +N    S+P 
Sbjct: 83  RSLRLRGGIHALDFAALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDGSIPP 142

Query: 445 QLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD 618
           Q      +  L L  N   G +P+ +S++  + ++++  N L G     F  +  ++ L 
Sbjct: 143 QFGDLSGLVDLRLYNNNLVGAIPHQLSRLPKIAHVDLGANYLTGLDFRKFSPMPTMTFLS 202

Query: 619 FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDN---LNVENNHFTGWIP 789
              NSL G+ P+      N+  + L +N F+G+I  +    L N   LN+  N F+G IP
Sbjct: 203 LFLNSLNGSFPEFVIRSGNLTFLDLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIP 262

Query: 790 PQLQGINSL 816
             +  +  L
Sbjct: 263 ASIGRLTKL 271



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 30/210 (14%)
 Frame = +1

Query: 283  GESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP-- 456
            GE    +  S   +   Q+     TG +  +L +   +    +  N L  S+P  L    
Sbjct: 379  GEIPPALFTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLT 438

Query: 457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM----------------- 585
            +++ L+L+ N  TGG+P  +  ++ L +L +SHN + G +                    
Sbjct: 439  SLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSGNS 498

Query: 586  --------FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG---TIDVLA 732
                    F  L +L  L  S N L G +P  + +L N++ + L NN F+G   T+    
Sbjct: 499  SNSRSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNY 558

Query: 733  NLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
            N  L+++++ +N FTG  P  L+   +L T
Sbjct: 559  NCSLESVHLADNGFTGVFPSSLEMCKALIT 588



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 3/177 (1%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP---PNVQKLNLAGNGF 492
           +T +++S  QL+G +  +   ++++  F ISTNNL   +P  L    P +    +  N F
Sbjct: 343 LTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSWPELISFQVQNNLF 402

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +P  + +   L  L +  N+L G +     SLT+L  LD S N L G IP     L+
Sbjct: 403 TGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLS 462

Query: 673 NMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           ++  + L +N  +G I           N+ NN        ++QG++   + GNS NS
Sbjct: 463 HLTFLKLSHNSISGPIPG---------NMGNNF-------KMQGVD--HSSGNSSNS 501



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 46/171 (26%), Positives = 88/171 (51%), Gaps = 7/171 (4%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL---AGNGFTG 498
           ++ +S   LTG +  +L  L  +T   +S N++   +P  +  N +   +   +GN    
Sbjct: 442 DLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSGNSSNS 501

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT-N 675
                  Q+  L+ L +S+N+L G++   + +L NL  +D S N+ +G IP   ++   +
Sbjct: 502 RSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCS 561

Query: 676 MKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQL-QGINSLQ 819
           +++++L +N FTG       +   L  L++ NN F G IPP + +G+ SL+
Sbjct: 562 LESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLK 612



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 48/195 (24%), Positives = 85/195 (43%), Gaps = 29/195 (14%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP------------------- 441
           ++ +++I    LTG +   L  +  +   D+  N LG ++P                   
Sbjct: 270 KLLDLRIDSNNLTGGVPVFLGSMSQLKVLDLGFNPLGGTIPPVLGQLQMLQQLSIMNAEL 329

Query: 442 -YQLPP------NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV-TVMFVSL 597
              LPP      N+  + L+ N  +GGLP   + M  +   ++S N L GE+   +F S 
Sbjct: 330 VSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSW 389

Query: 598 TNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID-VLANL-PLDNLNVENNH 771
             L +     N   G IP        +  +++  N  +G+I   L +L  L++L++ +N 
Sbjct: 390 PELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDND 449

Query: 772 FTGWIPPQLQGINSL 816
            TG IPP+L  ++ L
Sbjct: 450 LTGGIPPELGHLSHL 464



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 53/220 (24%), Positives = 86/220 (39%), Gaps = 70/220 (31%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPNVQKLNLAGNGFTGG 501
            + +S  +LTG +      L+++   D+S N     +P        +++ ++LA NGFTG 
Sbjct: 516  LYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCSLESVHLADNGFTGV 575

Query: 502  LPYSISQ-------------------------MAPLEYLNVSHNQLQGEVTVMFVSLTNL 606
             P S+                           +  L++L++  N   GE+     +L+ L
Sbjct: 576  FPSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLKFLSLKSNNFTGEIPSELSNLSQL 635

Query: 607  STLDFSFNSLAGNIPQTFSSLTNMKN-------------MYL---------------QNN 702
              LD S N L G IP++F +LT+MKN              Y+               Q  
Sbjct: 636  QLLDISNNGLTGLIPKSFGNLTSMKNPNTLSAQETLEWSSYINWLLYSDGIDTIWKGQEQ 695

Query: 703  VFTGTIDVLANL--------------PLDNLNVENNHFTG 780
             F  TI++L  +               LD LN+ NNH +G
Sbjct: 696  FFEKTIELLTGINLSGAIPPSLADISTLDILNLSNNHLSG 735



>pir|E96631|E96631 probable receptor kinase F8A5.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_893739 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC002292_1530143 Arabidopsis thaliana BAC
           F8A5, complete sequence.
          Length = 645

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 67/221 (30%), Positives = 101/221 (45%), Gaps = 2/221 (0%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS-CS 312
           L+  F L +P  +      +D   L  L SS++ P     W   G DPC  +W+GV  C 
Sbjct: 4   LVFAFFLISPVRS------SDVEALLSLKSSID-PSNSIPW--RGTDPC--NWEGVKKCM 52

Query: 313 GNRVTEIQISGLQLTGSM-GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
             RV+++ +  L L+GS+ G  L+QL  +       N+L  S+P          NL+G  
Sbjct: 53  KGRVSKLVLENLNLSGSLNGKSLNQLDQLRVLSFKGNSLSGSIP----------NLSG-- 100

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
                      +  L+ L ++ N   GE      SL  L T+  S N  +G IP +   L
Sbjct: 101 -----------LVNLKSLYLNDNNFSGEFPESLTSLHRLKTVVLSRNRFSGKIPSSLLRL 149

Query: 670 TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPP 792
           + +   Y+Q+N+F+G+I  L    L   NV NN  +G IPP
Sbjct: 150 SRLYTFYVQDNLFSGSIPPLNQATLRFFNVSNNQLSGHIPP 190



>gb:AP004747_1844313 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0407A09.
          Length = 997

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 67/221 (30%), Positives = 110/221 (49%), Gaps = 12/221 (5%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSPPQ--LTKWTANGGDPCGESWKGVSCSGN---RVTEIQISGLQLT 357
           TD   L G   ++ + P   L+ W  +    C  SW GV CS     RVT + ++G  L+
Sbjct: 25  TDMLSLLGFKEAITNDPSGVLSNWNTSI-HLC--SWNGVWCSPKHPGRVTALNLAGQGLS 81

Query: 358 GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK---LNLAGNGFTGGLPYSISQMA 528
           G++   +  L  V T D+S NN    +P+    N+QK   LNL+ N   G +P +++  +
Sbjct: 82  GTISSSVGNLTFVRTLDLSNNNFSGQMPHLA--NLQKMQVLNLSFNTLDGIIPNTLTNCS 139

Query: 529 PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF 708
            +  L++  N L+G +      L NL  +D S N+L G IP +  +++ ++ +YLQ N  
Sbjct: 140 NMRKLDLYTNLLEGAIPPPIGRLRNLVYIDLSRNNLTGIIPASLKNISLLETIYLQRNQL 199

Query: 709 TGTI----DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
            G+I       +N+ L  L    N  +G IP  L  ++SL+
Sbjct: 200 EGSIPDELGQFSNISLMALGA--NRLSGNIPASLFNLSSLR 238



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 50/181 (27%), Positives = 80/181 (44%), Gaps = 6/181 (3%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           N +  + + G +L+G +   +  L  +    +  N L  S+   +     ++ LNL  N 
Sbjct: 363 NTLRYLVLGGNELSGIVPSCIGNLSGLIQLSLDVNKLTGSISPWIGNLKYLEYLNLGKNR 422

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           FTG +PYSI  +  L  L +  N  +G +     +   L  LD ++N+L G IP   S+L
Sbjct: 423 FTGPIPYSIGSLTRLTELYLEKNAFEGHIPPSLGNPPLLLKLDLTYNNLQGTIPWEISNL 482

Query: 670 TNMKNMYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGNSW 837
             +  + L +N  TG I    D   NL    + ++ N  TG IP  L  +  L     S 
Sbjct: 483 RQLVYLKLTSNKLTGNIPNALDRCQNLV--TIQMDQNFLTGTIPISLGNLKGLSVLNLSH 540

Query: 838 N 840
           N
Sbjct: 541 N 541



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 48/172 (27%), Positives = 85/172 (49%), Gaps = 9/172 (5%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQ-LDQLKSVTTFDI---STNNLGNSLPYQ---LPPNVQKLNLAGN 486
           +++++ L+   + G++ LD L + T  ++   + N L   +P     L   ++ L L GN
Sbjct: 314 DLELNMLEAKDTEGWKFLDALTNCTALEVLALAENQLQGVIPNSIGSLSNTLRYLVLGGN 373

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +G +P  I  ++ L  L++  N+L G ++    +L  L  L+   N   G IP +  S
Sbjct: 374 ELSGIVPSCIGNLSGLIQLSLDVNKLTGSISPWIGNLKYLEYLNLGKNRFTGPIPYSIGS 433

Query: 667 LTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           LT +  +YL+ N F G I   L N P L  L++  N+  G IP ++  +  L
Sbjct: 434 LTRLTELYLEKNAFEGHIPPSLGNPPLLLKLDLTYNNLQGTIPWEISNLRQL 485



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 2/119 (1%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G++ +++  L+ +    +++N L  ++P  L    N+  + +  N  TG +P S+  +
Sbjct: 471 LQGTIPWEISNLRQLVYLKLTSNKLTGNIPNALDRCQNLVTIQMDQNFLTGTIPISLGNL 530

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
             L  LN+SHN L G +  +   L  LS LD S+N+L G IP+     T   ++YL+ N
Sbjct: 531 KGLSVLNLSHNILSGTIPAVLGDLPLLSKLDLSYNNLQGEIPRIELFRT---SVYLEGN 586



 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 45/161 (27%), Positives = 73/161 (45%), Gaps = 10/161 (6%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           I +S   LTG +   L  +  + T  +  N L  S+P +L    N+  + L  N  +G +
Sbjct: 168 IDLSRNNLTGIIPASLKNISLLETIYLQRNQLEGSIPDELGQFSNISLMALGANRLSGNI 227

Query: 505 PYSISQMAPLEYLNVSHNQLQGEV-TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P S+  ++ L  L +  N L G + + M   LTNL  L    N   G++P +  + + ++
Sbjct: 228 PASLFNLSSLRILELRANLLGGILPSNMGNHLTNLQHLFMGQNMFKGHVPASLGNASMLE 287

Query: 682 NMYLQNNVFTGTIDV-------LANLPLDNLNVENNHFTGW 783
            + LQ+N FTG I         L  L L+   +E     GW
Sbjct: 288 TIVLQSNNFTGRIPTSLGKLSNLYKLDLELNMLEAKDTEGW 328



>gb:AP004562_1841637 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0470F10.
          Length = 702

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 65/229 (28%), Positives = 104/229 (45%), Gaps = 34/229 (14%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPTDASV-----LRGLFSSLNSPPQLTKWTANGGDPCGES--W 294
           LL+  LL++  + VA   P+ AS      L  L ++L+   +L    A GGDPCG    +
Sbjct: 17  LLLFPLLHSSLADVAAAAPSSASAAEVDALMELKAALDPSGRLLPSWARGGDPCGRGDYF 76

Query: 295 KGVSCSGN-RVTEIQISGL------------------------QLTGSMGFQLDQLKSVT 399
           +GVSC    RV  + + G                         +L G++  QL  L  + 
Sbjct: 77  EGVSCDARGRVAAVSLQGKGLAGAISPAVAMLPGLTGLYLHYNELAGAIPRQLGDLPMLA 136

Query: 400 TFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGE 573
              +  NNL  ++P +L   P +Q L L  N  +G +P  + Q+  L  L +  NQL G 
Sbjct: 137 ELYLGVNNLSGTIPVELGRLPALQVLQLGYNQLSGSIPTQLGQLKKLTVLALQSNQLTGA 196

Query: 574 VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           +      L  L+ LD S N L G+IP   +++  +  + L+NN  +G++
Sbjct: 197 IPASLGDLPELARLDLSSNRLFGSIPSKLAAIPKLATLDLRNNTLSGSV 245



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 31/87 (35%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +1

Query: 562 LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL 738
           L G ++     L  L+ L   +N LAG IP+    L  +  +YL  N  +GTI V L  L
Sbjct: 97  LAGAISPAVAMLPGLTGLYLHYNELAGAIPRQLGDLPMLAELYLGVNNLSGTIPVELGRL 156

Query: 739 P-LDNLNVENNHFTGWIPPQLQGINSL 816
           P L  L +  N  +G IP QL  +  L
Sbjct: 157 PALQVLQLGYNQLSGSIPTQLGQLKKL 183



>gb:AC121365_1740180 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0053E05, complete sequence.
          Length = 471

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 76/267 (28%), Positives = 124/267 (46%), Gaps = 34/267 (12%)
 Frame = +1

Query: 118 LPWAVALLIGFLLNAPPSAVADT--DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES 291
           +P A  +L+  LL+   +A A    DP +   L  +  +++S  +   W + G DPCG  
Sbjct: 1   MPVASVVLLLHLLSMAAAATAALAMDPAERETLLLVMEAVSSDRE---WRSVGPDPCGSP 57

Query: 292 WKGVSC-----SGN---RVTEIQISGLQLTGS-------------MGFQLDQLKSVTTFD 408
           W G+ C     +GN       + ++ L    +             + F L  L+S+   D
Sbjct: 58  WPGLECKPVPAAGNVSSAAARLHVTRLDFGVAPNPTCKDGAAFPHLAFALPHLQSLFLVD 117

Query: 409 ISTNNLGNSLPYQLPPN-------VQKLNLAGN-GFTGGLPYSISQMAPLEYLNVSHNQL 564
              N    +  + LPP+       +Q+L++  N   +G LP  +S +  L+ L VS N L
Sbjct: 118 CFKNPAATT-AFTLPPSANLTSSRLQQLSVRSNPSLSGTLPPQLSSIRSLQVLTVSQNAL 176

Query: 565 -QGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL 738
            +GEV      L +L  LD S+NSL G IP     L ++  + L  N F+G+I   L +L
Sbjct: 177 IRGEVPQGIGELKSLVHLDLSYNSLTGTIPSRIGELRSLVGLDLSYNSFSGSIPGQLGDL 236

Query: 739 P-LDNLNVENNHFTGWIPPQLQGINSL 816
             L  L++ +N+ TG +P  + G+ SL
Sbjct: 237 AMLQKLDLSSNNLTGGVPATITGLTSL 263



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 50/169 (29%), Positives = 91/169 (53%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           +  + +S   LTG++  ++ +L+S+   D+S N+   S+P QL     +QKL+L+ N  T
Sbjct: 191 LVHLDLSYNSLTGTIPSRIGELRSLVGLDLSYNSFSGSIPGQLGDLAMLQKLDLSSNNLT 250

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           GG+P +I+ +  L +L +S+N L G +      L +L  L    N +   +P     +  
Sbjct: 251 GGVPATITGLTSLTFLALSNNGLSGHLPAGLSDLLDLQYLIMENNPMGVPLPSELGDIAR 310

Query: 676 MKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
           ++ + L N+ ++G+I + L  L  L  L++ENN+ TG IP  L  +  +
Sbjct: 311 LQELRLANSGYSGSIPETLGRLASLTTLSLENNNLTGRIPAGLSRLKRM 359



>gb:AC111015_1738814 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1131_E09, complete sequence.
          Length = 523

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 76/267 (28%), Positives = 124/267 (46%), Gaps = 34/267 (12%)
 Frame = +1

Query: 118 LPWAVALLIGFLLNAPPSAVADT--DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES 291
           +P A  +L+  LL+   +A A    DP +   L  +  +++S  +   W + G DPCG  
Sbjct: 1   MPVASVVLLLHLLSMAAAATAALAMDPAERETLLLVMEAVSSDRE---WRSVGPDPCGSP 57

Query: 292 WKGVSC-----SGN---RVTEIQISGLQLTGS-------------MGFQLDQLKSVTTFD 408
           W G+ C     +GN       + ++ L    +             + F L  L+S+   D
Sbjct: 58  WPGLECKPVPAAGNVSSAAARLHVTRLDFGVAPNPTCKDGAAFPHLAFALPHLQSLFLVD 117

Query: 409 ISTNNLGNSLPYQLPPN-------VQKLNLAGN-GFTGGLPYSISQMAPLEYLNVSHNQL 564
              N    +  + LPP+       +Q+L++  N   +G LP  +S +  L+ L VS N L
Sbjct: 118 CFKNPAATT-AFTLPPSANLTSSRLQQLSVRSNPSLSGTLPPQLSSIRSLQVLTVSQNAL 176

Query: 565 -QGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL 738
            +GEV      L +L  LD S+NSL G IP     L ++  + L  N F+G+I   L +L
Sbjct: 177 IRGEVPQGIGELKSLVHLDLSYNSLTGTIPSRIGELRSLVGLDLSYNSFSGSIPGQLGDL 236

Query: 739 P-LDNLNVENNHFTGWIPPQLQGINSL 816
             L  L++ +N+ TG +P  + G+ SL
Sbjct: 237 AMLQKLDLSSNNLTGGVPATITGLTSL 263



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 50/169 (29%), Positives = 91/169 (53%), Gaps = 4/169 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           +  + +S   LTG++  ++ +L+S+   D+S N+   S+P QL     +QKL+L+ N  T
Sbjct: 191 LVHLDLSYNSLTGTIPSRIGELRSLVGLDLSYNSFSGSIPGQLGDLAMLQKLDLSSNNLT 250

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           GG+P +I+ +  L +L +S+N L G +      L +L  L    N +   +P     +  
Sbjct: 251 GGVPATITGLTSLTFLALSNNGLSGHLPAGLSDLLDLQYLIMENNPMGVPLPSELGDIAR 310

Query: 676 MKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQLQGINSL 816
           ++ + L N+ ++G+I + L  L  L  L++ENN+ TG IP  L  +  +
Sbjct: 311 LQELRLANSGYSGSIPETLGRLASLTTLSLENNNLTGRIPAGLSRLKRM 359



>gb:ZMA277702_1731487 Zea mays mRNA for SERK1
           protein.>gb:ZMA400868_1731516 Zea mays serk1 gene for
           somatic embryogenesis receptor-like kinase 1, exons
           1-11.
          Length = 622

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/183 (29%), Positives = 96/183 (52%), Gaps = 3/183 (1%)
 Frame = +1

Query: 124 WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV 303
           W  A++   ++   P  VA+T+      LR      N+   L  W     +PC  +W  V
Sbjct: 8   WWSAVVFSVVVGVIP-VVANTEGDALYSLRQSLKDNNNV--LQSWDPTLVNPC--TWFHV 62

Query: 304 SCS-GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLN 474
           +C+  N V  + +   QL+G +  QL QLK++   ++ +NN+   +P +L    N+  L+
Sbjct: 63  TCNPDNSVIRLDLGNAQLSGPLVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLD 122

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
           L  N FTGG+P ++ Q++ L +L +++N L G++     ++  L  LD S N+L+G +P 
Sbjct: 123 LYLNNFTGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVPS 182

Query: 655 TFS 663
           + S
Sbjct: 183 SGS 185



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 35/113 (30%), Positives = 60/113 (53%), Gaps = 2/113 (1%)
 Frame = +1

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           +V +L+L     +G L   + Q+  ++YL +  N + G +     +LTNL +LD   N+ 
Sbjct: 69  SVIRLDLGNAQLSGPLVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLDLYLNNF 128

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
            G IP T   L+ ++ + L NN  +G I   L N+  L  L++ NN+ +G +P
Sbjct: 129 TGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVLDLSNNNLSGGVP 181



>gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0002J11, complete
            sequence.>gb:OSJN00283_1697938 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBb0116K07, complete
            sequence.
          Length = 1104

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/182 (29%), Positives = 91/182 (50%), Gaps = 29/182 (15%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGL 504
            + ++    T  +  ++  L  +  F+IS+N LG S+P ++     +Q+L+L+ N F G L
Sbjct: 512  LDLTNNYFTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCTMLQRLDLSQNSFEGSL 571

Query: 505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTL----------------------- 615
            P  +  +  LE L+ + N+L GE+  +   L++L+ L                       
Sbjct: 572  PNEVGSLPQLELLSFADNRLSGEIPPILGKLSHLTALQIGGNQFSGGIPKELGLLSSLQI 631

Query: 616  --DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGW 783
              + S+N+L+GNIP    +L  ++N++L NN  TG I D  ANL  L   NV  N+ TG 
Sbjct: 632  AMNLSYNNLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANLSSLLEFNVSYNNLTGA 691

Query: 784  IP 789
            +P
Sbjct: 692  LP 693



 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 56/198 (28%), Positives = 95/198 (47%), Gaps = 8/198 (4%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNR---VTEIQISGLQLTGSMGFQLDQLKSVTTFDIST 417
           L  W      PCG  WKGV+CS      V  + +S + L+G++   +  L  +T  D+S 
Sbjct: 51  LDDWNPEDPSPCG--WKGVNCSSGSTPAVVSLNLSNMNLSGTVDPSIGGLAELTNLDLSF 108

Query: 418 NNLGNSLPYQLPPNVQKL---NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
           N    ++P ++  N  KL   NL  N F G +P  + ++A +   N+ +N+L G +    
Sbjct: 109 NGFSGTIPAEIG-NCSKLTGLNLNNNQFQGTIPAELGKLAMMITFNLCNNKLFGAIPDEI 167

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVE 762
            ++ +L  L    N+L+G+IP T   L N+K + L  N  +G I V     L L    + 
Sbjct: 168 GNMASLEDLVGYSNNLSGSIPHTIGRLKNLKTVRLGQNAISGNIPVEIGECLNLVVFGLA 227

Query: 763 NNHFTGWIPPQLQGINSL 816
            N   G +P ++  + ++
Sbjct: 228 QNKLGGPLPKEIGKLTNM 245



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 45/159 (28%), Positives = 79/159 (49%), Gaps = 4/159 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
           L+GS+   + +LK++ T  +  N +  ++P ++    N+    LA N   G LP  I ++
Sbjct: 183 LSGSIPHTIGRLKNLKTVRLGQNAISGNIPVEIGECLNLVVFGLAQNKLGGPLPKEIGKL 242

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             +  L +  NQL   +     +  NL T+    N+L G IP T  ++ N++ +YL  N+
Sbjct: 243 TNMTDLILWGNQLSSVIPPEIGNCINLRTIALYDNNLVGPIPATIGNIQNLQRLYLYRNL 302

Query: 706 FTGTIDV-LANLPL-DNLNVENNHFTGWIPPQLQGINSL 816
             GTI + + NL L + ++   N  TG +P +   I  L
Sbjct: 303 LNGTIPLEIGNLSLAEEIDFSENVLTGGVPKEFGKIPRL 341



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 42/153 (27%), Positives = 75/153 (49%), Gaps = 4/153 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQM 525
           L G +   +  ++++    +  N L  ++P ++      ++++ + N  TGG+P    ++
Sbjct: 279 LVGPIPATIGNIQNLQRLYLYRNLLNGTIPLEIGNLSLAEEIDFSENVLTGGVPKEFGKI 338

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L  L +  NQL G +      L NLS LD S N+L+G IP  F  ++ +  + L NN+
Sbjct: 339 PRLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTLSGPIPACFQYMSRLIQLQLFNNM 398

Query: 706 FTGTIDVLANL--PLDNLNVENNHFTGWIPPQL 798
            +G I     +   L  ++  NN+ TG IP  L
Sbjct: 399 LSGDIPPRFGIYSRLWVVDFSNNNITGQIPRDL 431



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 47/182 (25%), Positives = 84/182 (46%), Gaps = 27/182 (14%)
 Frame = +1

Query: 316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQ---------------- 447
            +++    IS  +L GS+  ++     +   D+S N+   SLP +                
Sbjct: 531  SKLVVFNISSNRLGGSIPLEIFNCTMLQRLDLSQNSFEGSLPNEVGSLPQLELLSFADNR 590

Query: 448  ----LPPNVQKLN------LAGNGFTGGLPYSISQMAPLEY-LNVSHNQLQGEVTVMFVS 594
                +PP + KL+      + GN F+GG+P  +  ++ L+  +N+S+N L G +     +
Sbjct: 591  LSGEIPPILGKLSHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYNNLSGNIPSELGN 650

Query: 595  LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHF 774
            L  L  L  + N L G IP TF++L+++    +  N  TG    L  +PL + N+ +  F
Sbjct: 651  LALLENLFLNNNKLTGEIPDTFANLSSLLEFNVSYNNLTG---ALPTIPLFD-NMASTSF 706

Query: 775  TG 780
             G
Sbjct: 707  LG 708



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 50/192 (26%), Positives = 83/192 (43%), Gaps = 28/192 (14%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGG 501
           EI  S   LTG +  +  ++  +    +  N L   +P +L    N+ KL+L+ N  +G 
Sbjct: 319 EIDFSENVLTGGVPKEFGKIPRLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTLSGP 378

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA-------------- 639
           +P     M+ L  L + +N L G++   F   + L  +DFS N++               
Sbjct: 379 IPACFQYMSRLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFSNNNITGQIPRDLCRQSNLI 438

Query: 640 ----------GNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGW 783
                     GNIP   +S  ++  + L +N  TG+   D+   + L  + +  N F G 
Sbjct: 439 LLNLGANKLIGNIPHGITSCKSLVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFNGP 498

Query: 784 IPPQLQGINSLQ 819
           IPPQ+    SLQ
Sbjct: 499 IPPQIGNCKSLQ 510



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 44/162 (27%), Positives = 79/162 (48%), Gaps = 6/162 (3%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           +L G +  ++ +L ++T   +  N L + +P ++    N++ + L  N   G +P +I  
Sbjct: 230 KLGGPLPKEIGKLTNMTDLILWGNQLSSVIPPEIGNCINLRTIALYDNNLVGPIPATIGN 289

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
           +  L+ L +  N L G + +   +L+    +DFS N L G +P+ F  +  +  +YL  N
Sbjct: 290 IQNLQRLYLYRNLLNGTIPLEIGNLSLAEEIDFSENVLTGGVPKEFGKIPRLYLLYLFQN 349

Query: 703 VFTGTID----VLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
             TG I     VL N  L  L++  N  +G IP   Q ++ L
Sbjct: 350 QLTGPIPTELCVLRN--LSKLDLSINTLSGPIPACFQYMSRL 389



>gb:OSJN00123_1695267 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0071D01, complete
           sequence.>gb:OSJN00195_1696535 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0015G09, complete
           sequence.
          Length = 891

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 61/230 (26%), Positives = 112/230 (48%), Gaps = 29/230 (12%)
 Frame = +1

Query: 217 LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV 396
           L +SL +  +L + + +G +  G   K +      + +++  G Q+TG +  ++ +L ++
Sbjct: 250 LITSLTNCTRLLELSMDGNNLNGSLPKSIGNLSTHLQKLKFGGNQITGIIPDEIGKLINL 309

Query: 397 TTFDISTNNLGNSLPY--------------------QLPPNVQKLNLAG------NGFTG 498
           +  +I+TN     +P                     Q+P  +  L+  G      N  +G
Sbjct: 310 SLLEINTNKQSGQIPMTIGNLKKLFILNLSMNELSGQIPSTIGNLSQLGQLYLDNNNLSG 369

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLST-LDFSFNSLAGNIPQTFSSLTN 675
            +P +I Q   L  LN+S N L G + +  V++++LS  LD S N L+G IPQ   +L N
Sbjct: 370 KIPANIGQCIRLAMLNLSVNNLDGSIPIELVNISSLSLGLDLSNNKLSGLIPQQVGTLHN 429

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           + ++   NN  +G I   ++    L +LN+ENN+ +G IP  L  + ++Q
Sbjct: 430 LGHLNFSNNQLSGQIPSSLIQCAVLLSLNLENNNLSGSIPESLSQLPAIQ 479



 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 49/141 (34%), Positives = 75/141 (53%), Gaps = 5/141 (3%)
 Frame = +1

Query: 418 NNLGNSLPYQ---LPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF 588
           NNL  SLP     L  ++QKL   GN  TG +P  I ++  L  L ++ N+  G++ +  
Sbjct: 268 NNLNGSLPKSIGNLSTHLQKLKFGGNQITGIIPDEIGKLINLSLLEINTNKQSGQIPMTI 327

Query: 589 VSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVE 762
            +L  L  L+ S N L+G IP T  +L+ +  +YL NN  +G I  ++   + L  LN+ 
Sbjct: 328 GNLKKLFILNLSMNELSGQIPSTIGNLSQLGQLYLDNNNLSGKIPANIGQCIRLAMLNLS 387

Query: 763 NNHFTGWIPPQLQGINSLQTG 825
            N+  G IP +L  I+SL  G
Sbjct: 388 VNNLDGSIPIELVNISSLSLG 408



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 41/145 (28%), Positives = 81/145 (55%), Gaps = 3/145 (2%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           + ++G  L+G +   L  + S+++  +  NNL   +P  L    N+ KL+L+GN  +G +
Sbjct: 92  LDLTGNLLSGRIPPSLANISSLSSILLGQNNLSGPIPESLSQIANLNKLDLSGNRLSGFV 151

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTV-MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P ++   + LE+  + +N L G++   +  +L NL +L  S N   G+IP + ++ +N++
Sbjct: 152 PVTLYNKSSLEFFGIGNNSLIGKIPPDIGHTLPNLKSLVMSLNRFDGSIPTSLANASNLQ 211

Query: 682 NMYLQNNVFTGTIDVLANLPLDNLN 756
            + L +N  +G++  L +  L NLN
Sbjct: 212 MLDLSSNHLSGSVPALGS--LRNLN 234



 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 36/139 (25%), Positives = 74/139 (53%), Gaps = 4/139 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL----AG 483
           +++ ++ +    L+G +   + Q   +   ++S NNL  S+P +L  N+  L+L    + 
Sbjct: 355 SQLGQLYLDNNNLSGKIPANIGQCIRLAMLNLSVNNLDGSIPIELV-NISSLSLGLDLSN 413

Query: 484 NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           N  +G +P  +  +  L +LN S+NQL G++    +    L +L+   N+L+G+IP++ S
Sbjct: 414 NKLSGLIPQQVGTLHNLGHLNFSNNQLSGQIPSSLIQCAVLLSLNLENNNLSGSIPESLS 473

Query: 664 SLTNMKNMYLQNNVFTGTI 720
            L  ++ + L  N  +G +
Sbjct: 474 QLPAIQQIDLSENNLSGVV 492



 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 43/179 (24%), Positives = 82/179 (45%), Gaps = 28/179 (15%)
 Frame = +1

Query: 346 LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSI- 516
           ++LTG +   +  L S+ +  ++ NNL  ++P  L    ++ +LNL+ N  +G +P S  
Sbjct: 1   MELTGVLPDCIGNLTSLQSLLLARNNLEGTIPESLARSSSLIELNLSRNNLSGEIPPSFF 60

Query: 517 -----------------------SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSF 627
                                    M  L +L+++ N L G +     ++++LS++    
Sbjct: 61  NGSSKLVTVDLQTNSFVGKIPLPRNMGTLRFLDLTGNLLSGRIPPSLANISSLSSILLGQ 120

Query: 628 NSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLA--NLPLDNLNVENNHFTGWIPPQL 798
           N+L+G IP++ S + N+  + L  N  +G + V       L+   + NN   G IPP +
Sbjct: 121 NNLSGPIPESLSQIANLNKLDLSGNRLSGFVPVTLYNKSSLEFFGIGNNSLIGKIPPDI 179



>gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0036B21, complete sequence.
          Length = 628

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/161 (31%), Positives = 86/161 (53%), Gaps = 4/161 (2%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCS-GNRVTEIQISGLQLTGSM 366
           T+   L  L  SL      L  W     +PC  +W  V+C+  N V  + +   QL+G++
Sbjct: 33  TEGDALYSLRQSLKDANNVLQSWDPTLVNPC--TWFHVTCNPDNSVIRVDLGNAQLSGAL 90

Query: 367 GFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEY 540
             QL QLK++   ++ +NN+  ++P +L    N+  L+L  N FTG +P ++ Q+  L +
Sbjct: 91  VPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNFTGFIPETLGQLYKLRF 150

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           L +++N L G +     ++T L  LD S N+L+G +P T S
Sbjct: 151 LRLNNNSLSGSIPKSLTNITTLQVLDLSNNNLSGEVPSTGS 191



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 2/113 (1%)
 Frame = +1

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           +V +++L     +G L   + Q+  L+YL +  N + G +     +LTNL +LD   N+ 
Sbjct: 75  SVIRVDLGNAQLSGALVPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNF 134

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
            G IP+T   L  ++ + L NN  +G+I   L N+  L  L++ NN+ +G +P
Sbjct: 135 TGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQVLDLSNNNLSGEVP 187



 Score = 34.7 bits (78), Expect = 2.3
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 3/101 (2%)
 Frame = +1

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           +++ + QL G +      L NL  L+   N+++G IP    +LTN               
Sbjct: 79  VDLGNAQLSGALVPQLGQLKNLQYLELYSNNISGTIPNELGNLTN--------------- 123

Query: 721 DVLANLPLDNLNVENNHFTGWIPP---QLQGINSLQTGGNS 834
                  L +L++  N+FTG+IP    QL  +  L+   NS
Sbjct: 124 -------LVSLDLYLNNFTGFIPETLGQLYKLRFLRLNNNS 157



>gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somatic
           embryogenesis protein kinase 1 mRNA, complete cds.
          Length = 628

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/161 (31%), Positives = 86/161 (53%), Gaps = 4/161 (2%)
 Frame = +1

Query: 193 TDASVLRGLFSSLNSPPQ-LTKWTANGGDPCGESWKGVSCS-GNRVTEIQISGLQLTGSM 366
           T+   L  L  SL      L  W     +PC  +W  V+C+  N V  + +   QL+G++
Sbjct: 33  TEGDALYSLRQSLKDANNVLQSWDPTLVNPC--TWFHVTCNPDNSVIRVDLGNAQLSGAL 90

Query: 367 GFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEY 540
             QL QLK++   ++ +NN+  ++P +L    N+  L+L  N FTG +P ++ Q+  L +
Sbjct: 91  VPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNFTGFIPETLGQLYKLRF 150

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS 663
           L +++N L G +     ++T L  LD S N+L+G +P T S
Sbjct: 151 LRLNNNSLSGSIPKSLTNITTLQVLDLSNNNLSGEVPSTGS 191



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 2/113 (1%)
 Frame = +1

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           +V +++L     +G L   + Q+  L+YL +  N + G +     +LTNL +LD   N+ 
Sbjct: 75  SVIRVDLGNAQLSGALVPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNF 134

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIP 789
            G IP+T   L  ++ + L NN  +G+I   L N+  L  L++ NN+ +G +P
Sbjct: 135 TGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQVLDLSNNNLSGEVP 187



 Score = 34.7 bits (78), Expect = 2.3
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 3/101 (2%)
 Frame = +1

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           +++ + QL G +      L NL  L+   N+++G IP    +LTN               
Sbjct: 79  VDLGNAQLSGALVPQLGQLKNLQYLELYSNNISGTIPNELGNLTN--------------- 123

Query: 721 DVLANLPLDNLNVENNHFTGWIPP---QLQGINSLQTGGNS 834
                  L +L++  N+FTG+IP    QL  +  L+   NS
Sbjct: 124 -------LVSLDLYLNNFTGFIPETLGQLYKLRFLRLNNNS 157



>gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinase
           homolog (At4g30520) mRNA, complete
           cds.>gb:AY096538_1576080 Arabidopsis thaliana putative
           receptor kinase-like protein (At4g30520) mRNA, complete
           cds.
          Length = 648

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/181 (29%), Positives = 92/181 (50%), Gaps = 6/181 (3%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASV--LRGLFSSLNSPP-QLTKWTANGGDPCGESWKG 300
           + LL  FL     +    ++P +  V  L  + ++L+ P   L  W     DPC  SW  
Sbjct: 13  IHLLYSFLFLCFSTLTLSSEPRNPEVEALISIRNNLHDPHGALNNWDEFSVDPC--SWAM 70

Query: 301 VSCS-GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKL 471
           ++CS  N V  +      L+G +   +  L ++    +  NN+   +P +L   P +Q L
Sbjct: 71  ITCSPDNLVIGLGAPSQSLSGGLSESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTL 130

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L+ N F+G +P SI Q++ L+YL +++N L G        + +LS LD S+N+L+G +P
Sbjct: 131 DLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYNNLSGPVP 190

Query: 652 Q 654
           +
Sbjct: 191 K 191



 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 2/109 (1%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           L       +GGL  SI  +  L  +++ +N + G++      L  L TLD S N  +G+I
Sbjct: 82  LGAPSQSLSGGLSESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDI 141

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIP 789
           P +   L++++ + L NN  +G     L+ +P L  L++  N+ +G +P
Sbjct: 142 PVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYNNLSGPVP 190



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQG 804
           SL+G + ++  +LTN++ + LQNN  +G I   L  LP L  L++ NN F+G IP  +  
Sbjct: 88  SLSGGLSESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQ 147

Query: 805 INSLQ 819
           ++SLQ
Sbjct: 148 LSSLQ 152



>gb:AY060554_1564862 Arabidopsis thaliana AT5g63710/MBK5_19 mRNA,
           complete cds.>gb:AY142025_1582862 Arabidopsis thaliana
           At5g63710/MBK5_19 mRNA, complete cds.
          Length = 614

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQ 375
           +   L  L  SLN      KWT +   PC  SW  V+C G  V  + ++    TG++   
Sbjct: 53  EGGALLQLRDSLNDSSNRLKWTRDFVSPC-YSWSYVTCRGQSVVALNLASSGFTGTLSPA 111

Query: 376 LDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNV 549
           + +LK + T ++  N+L  +LP  L    N+Q LNL+ N F+G +P S SQ++ L++L++
Sbjct: 112 ITKLKFLVTLELQNNSLSGALPDSLGNMVNLQTLNLSVNSFSGSIPASWSQLSNLKHLDL 171

Query: 550 SHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           S N L G +   F S   + T DFS   L
Sbjct: 172 SSNNLTGSIPTQFFS---IPTFDFSGTQL 197



>gb:AC016163_1538126 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.
          Length = 846

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 54/173 (31%), Positives = 90/173 (52%), Gaps = 4/173 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           N++  + ++   LTG +   L  L  +   ++ +N L   +P  +     ++ L+LA N 
Sbjct: 157 NQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNN 216

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
             G +P S+  ++ L +L ++HNQL GEV     +L  L  + F  NSL+GNIP +F++L
Sbjct: 217 LIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANL 276

Query: 670 TNMKNMYLQNNVFTGT--IDVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
           T +    L +N FT T   D+     L+  +V  N F+G  P  L  I SL++
Sbjct: 277 TKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLES 329



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 52/220 (23%), Positives = 94/220 (42%), Gaps = 53/220 (24%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNG 489
           +R+  +++   +L G +   +  LK +    +++NNL   +P  L    N+  L L  N 
Sbjct: 181 SRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQ 240

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT----------------------- 600
             G +P SI  +  L  ++  +N L G + + F +LT                       
Sbjct: 241 LVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIF 300

Query: 601 -NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID------------------ 723
            NL   D S+NS +G  P++   + +++++YLQ N FTG I+                  
Sbjct: 301 HNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRN 360

Query: 724 ---------VLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
                    +   L L+ L++ +N+FTG IPP +  + +L
Sbjct: 361 RLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNL 400



 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 44/175 (25%), Positives = 85/175 (48%), Gaps = 7/175 (4%)
 Frame = +1

Query: 289 SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPY---QLPPN 459
           S++  S     + E+ ++     G + + + +L S+   D+S N    S+P        +
Sbjct: 433 SFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGS 492

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           +++LNL  N F+G LP   S+   L  L+VSHNQL+G+     ++   L  ++   N + 
Sbjct: 493 IKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIK 552

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPP 792
              P    SL ++  + L++N F G +      +    L  +++ +N+F+G +PP
Sbjct: 553 DIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPP 607



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 66/244 (27%), Positives = 108/244 (44%), Gaps = 14/244 (5%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA---NGGDPCGESWKG 300
           ++LL+  L ++ P    D         RG F    S   + +W        D C   W G
Sbjct: 18  LSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCC--LWNG 75

Query: 301 VSCS--GNRVTEIQISGLQL-----TGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-- 453
           V+C+    +V  + I    L     T S  F+L  L+ +   D++  NL   +P  L   
Sbjct: 76  VTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHL---DLTNCNLYGEIPSSLGNL 132

Query: 454 PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
            ++  +NL  N F G +P SI  +  L +L +++N L GE+     +L+ L  L+   N 
Sbjct: 133 SHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNR 192

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGI 807
           L G IP +   L  ++N+ L +N   G I   L NL  L +L + +N   G +P  +  +
Sbjct: 193 LVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNL 252

Query: 808 NSLQ 819
             L+
Sbjct: 253 IELR 256



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 42/138 (30%), Positives = 70/138 (50%), Gaps = 11/138 (7%)
 Frame = +1

Query: 406  DISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVT 579
            D S N +  ++P  L     ++ LNL+GN FT  +P  ++ +  LE L++S N+L G++ 
Sbjct: 663  DFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIP 722

Query: 580  VMFVSLTNLSTLDFSFNSLAGNIP-------QTFSSLTNMKNMYLQNNVF--TGTIDVLA 732
                +L+ LS ++FS N L G +P       Q  SS  +   +Y   ++   TG ++  +
Sbjct: 723  QDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTS 782

Query: 733  NLPLDNLNVENNHFTGWI 786
             LP D    E N F  W+
Sbjct: 783  QLPEDLSEAEENMF-NWV 799



 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 57/213 (26%), Positives = 92/213 (43%), Gaps = 37/213 (17%)
 Frame = +1

Query: 289 SWKGVSCSGN------RVTEIQI---SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP 441
           S++  S SGN       +T++ I   S    T +  F +    ++  FD+S N+     P
Sbjct: 259 SFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFP 318

Query: 442 YQLP--PNVQKLNLAGNGFTGGL-------------------------PYSISQMAPLEY 540
             L   P+++ + L  N FTG +                         P SIS++  LE 
Sbjct: 319 KSLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEE 378

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           L++SHN   G +      L NL  LD S N+L G +P   + L  +  M L +N F+   
Sbjct: 379 LDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVP---ACLWRLNTMVLSHNSFSSFE 435

Query: 721 DVLANLPL-DNLNVENNHFTGWIPPQLQGINSL 816
           +      L + L++ +N F G IP  +  ++SL
Sbjct: 436 NTSQEEALIEELDLNSNSFQGPIPYMICKLSSL 468



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 27/84 (32%), Positives = 44/84 (52%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           ++ +GN   G +P S+  +  L  LN+S N     +     +LT L TLD S N L+G I
Sbjct: 662 IDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQI 721

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
           PQ  ++L+ +  M   +N+  G +
Sbjct: 722 PQDLAALSFLSYMNFSHNLLQGPV 745



>gb:AX138089_1462210 Sequence 35 from Patent EP1094113.
          Length = 609

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQ 375
           +   L  L  SLN      KWT +   PC  SW  V+C G  V  + ++    TG++   
Sbjct: 48  EGGALLQLRDSLNDSSNRLKWTRDFVSPC-YSWSYVTCRGQSVVALNLASSGFTGTLSPA 106

Query: 376 LDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNV 549
           + +LK + T ++  N+L  +LP  L    N+Q LNL+ N F+G +P S SQ++ L++L++
Sbjct: 107 ITKLKFLVTLELQNNSLSGALPDSLGNMVNLQTLNLSVNSFSGSIPASWSQLSNLKHLDL 166

Query: 550 SHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           S N L G +   F S   + T DFS   L
Sbjct: 167 SSNNLTGSIPTQFFS---IPTFDFSGTQL 192



>gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.
          Length = 649

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/181 (29%), Positives = 92/181 (50%), Gaps = 6/181 (3%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASV--LRGLFSSLNSPP-QLTKWTANGGDPCGESWKG 300
           + LL  FL     +    ++P +  V  L  + ++L+ P   L  W     DPC  SW  
Sbjct: 13  IHLLYSFLFLCFSTLTLSSEPRNPEVEALISIRNNLHDPHGALNNWDEFSVDPC--SWAM 70

Query: 301 VSCS-GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKL 471
           ++CS  N V  +      L+G +   +  L ++    +  NN+   +P +L   P +Q L
Sbjct: 71  ITCSPDNLVIGLGAPSQSLSGGLSESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTL 130

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           +L+ N F+G +P SI Q++ L+YL +++N L G        + +LS LD S+N+L+G +P
Sbjct: 131 DLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYNNLSGPVP 190

Query: 652 Q 654
           +
Sbjct: 191 K 191



 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 2/109 (1%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           L       +GGL  SI  +  L  +++ +N + G++      L  L TLD S N  +G+I
Sbjct: 82  LGAPSQSLSGGLSESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDI 141

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIP 789
           P +   L++++ + L NN  +G     L+ +P L  L++  N+ +G +P
Sbjct: 142 PVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYNNLSGPVP 190



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQG 804
           SL+G + ++  +LTN++ + LQNN  +G I   L  LP L  L++ NN F+G IP  +  
Sbjct: 88  SLSGGLSESIGNLTNLRQVSLQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQ 147

Query: 805 INSLQ 819
           ++SLQ
Sbjct: 148 LSSLQ 152



>gb:CQ768549_1451792 Sequence 44 from Patent
           WO2004007712.>gb:AX120055_1461707 Sequence 38 from
           Patent WO0129240.>gb:AB005234_1509345 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1 clone:MBK5.
          Length = 579

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = +1

Query: 196 DASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQ 375
           +   L  L  SLN      KWT +   PC  SW  V+C G  V  + ++    TG++   
Sbjct: 18  EGGALLQLRDSLNDSSNRLKWTRDFVSPC-YSWSYVTCRGQSVVALNLASSGFTGTLSPA 76

Query: 376 LDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQMAPLEYLNV 549
           + +LK + T ++  N+L  +LP  L    N+Q LNL+ N F+G +P S SQ++ L++L++
Sbjct: 77  ITKLKFLVTLELQNNSLSGALPDSLGNMVNLQTLNLSVNSFSGSIPASWSQLSNLKHLDL 136

Query: 550 SHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           S N L G +   F S   + T DFS   L
Sbjct: 137 SSNNLTGSIPTQFFS---IPTFDFSGTQL 162



>pir|T10725|T10725 protein kinase Xa21 (EC 2.7.1.-) A1, receptor
           type - long-staminate rice>gb:OLRKLP2_1692252 Oryza
           longistaminata receptor kinase-like protein gene, family
           member A1, complete cds.
          Length = 996

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 69/236 (29%), Positives = 109/236 (46%), Gaps = 9/236 (3%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTDPT-DASVLRGLFSSL--NSPPQLTKWTANG-GDPCGESWKGV 303
           LL   LL  P S+  D D   D   L    SSL       L  W  +G G  C  +W GV
Sbjct: 11  LLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHC--TWVGV 68

Query: 304 SCSG---NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN 474
            C     +RV ++++    LTG +   L  L  + T  +S N+L                
Sbjct: 69  VCGRRHPHRVVKLRLRSSNLTGIISPSLGNLSFLRTLQLSNNHL---------------- 112

Query: 475 LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
                 +G +P  +S+++ L+ L ++ N L GE+     +LT+LS L+ + N+L+G+IP 
Sbjct: 113 ------SGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGSIPS 166

Query: 655 TFSSLTNMKNMYLQNNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQLQGINSL 816
           +   LT + N+ L  N+ +G+I         L  L++  NH +G IP  +  I+SL
Sbjct: 167 SLGKLTGLYNLALAENMLSGSIPTSFGQLRRLSFLSLAFNHLSGAIPDPIWNISSL 222



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 54/183 (29%), Positives = 98/183 (53%), Gaps = 8/183 (4%)
 Frame = +1

Query: 292 WKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPP-- 456
           WK ++   N   + E++++G +  G +   +  L S + +  I  N +  SLP  +    
Sbjct: 313 WKFMTALTNCSNLQEVELAGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLV 372

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           N+Q L+LA N  TG LP S S++  L  L V +N+L G + +   +LT L+ ++  FN+ 
Sbjct: 373 NLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNRLIGSLPLTIGNLTQLTNMEVQFNAF 432

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLPL--DNLNVENNHFTGWIPPQLQGI 807
            G IP T  +LT +  + L +N F G I + + ++P   + L+V +N+  G IP ++  +
Sbjct: 433 GGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKL 492

Query: 808 NSL 816
            ++
Sbjct: 493 KNI 495



 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 56/177 (31%), Positives = 88/177 (49%), Gaps = 6/177 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL---NLAGNGFTGG 501
           + +   +L GS+   +  L  +T  ++  N  G ++P  L  N+ KL   NL  N F G 
Sbjct: 401 LTVDNNRLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLG-NLTKLFQINLGHNNFIGQ 459

Query: 502 LPYSISQMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
           +P  I  +  L E L+VSHN L+G +      L N+       N L+G IP T      +
Sbjct: 460 IPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLL 519

Query: 679 KNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           ++++LQNN   G+I + L  L  LD L++  N+ +G IP  L  +  L +   S+NS
Sbjct: 520 QHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMTLLHSLNLSFNS 576



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 3/124 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           + E      +L+G +   + + + +    +  N L  S+P  L     +  L+L+GN  +
Sbjct: 495 IVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLS 554

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS-LAGNIPQTFSSLT 672
           G +P S+  M  L  LN+S N   GEV    V   N S +    N+ + G IP+      
Sbjct: 555 GQIPMSLGDMTLLHSLNLSFNSFHGEVPTNGV-FANASEIYIQGNAHICGGIPELHLPTC 613

Query: 673 NMKN 684
           ++K+
Sbjct: 614 SLKS 617



>gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1063

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 83/297 (27%), Positives = 128/297 (43%), Gaps = 61/297 (20%)
 Frame = +1

Query: 127 AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS 306
           A ALL+   L +P S+   T+   +S+L+ L    N       W  N  D C   W+GV+
Sbjct: 28  AFALLLLLSLASPTSSC--TEQERSSLLQFLSGLSNDGGLAVSWR-NAADCC--KWEGVT 82

Query: 307 CSGN-RVTEIQIS--GLQ----------------------LTGSMGFQLDQLKSVTTFDI 411
           CS +  VT++ ++  GL+                      L+G +  +L    S+T  DI
Sbjct: 83  CSADGTVTDVSLASKGLEGRISPSLGNLTGLLRLNLSHNSLSGGLPLELMASSSITVLDI 142

Query: 412 STNNL----------------------GNSLPYQLP-------PNVQKLNLAGNGFTGGL 504
           S N+L                       NS   Q P        N+  LN + N FTG +
Sbjct: 143 SFNHLKGEIHELPSSTPVRPLQVLNISSNSFTGQFPSATWEMMKNLVMLNASNNSFTGHI 202

Query: 505 PYSI-SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           P +  S  A L  L + +N L G +   F +   L  L    N+L+GN+P    + T+++
Sbjct: 203 PSNFCSSSASLTALALCYNHLSGSIPPGFGNCLKLRVLKVGHNNLSGNLPGDLFNATSLE 262

Query: 682 NMYLQNNVFTGTID--VLANL-PLDNLNVENNHFTGWIPP---QLQGINSLQTGGNS 834
            +   NN   G I+  ++ NL  L  L++E N+ TGWIP    QL+ +  L  G N+
Sbjct: 263 YLSFPNNELNGVINGTLIVNLRNLSTLDLEGNNITGWIPDSIGQLKRLQDLHLGDNN 319



 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 46/168 (27%), Positives = 85/168 (50%), Gaps = 6/168 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN---LAGNGFTGG 501
           +++    L+G++   L    S+       N L   +   L  N++ L+   L GN  TG 
Sbjct: 240 LKVGHNNLSGNLPGDLFNATSLEYLSFPNNELNGVINGTLIVNLRNLSTLDLEGNNITGW 299

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ-TFSSLTNM 678
           +P SI Q+  L+ L++  N + GE+     + T+L T++   N+ +GN+    FS+L+N+
Sbjct: 300 IPDSIGQLKRLQDLHLGDNNISGELPSALSNCTHLITINLKRNNFSGNLSNVNFSNLSNL 359

Query: 679 KNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           K + L  N F GT+   + +   L  L + +N+  G + P++  + SL
Sbjct: 360 KTLDLMGNKFEGTVPESIYSCTNLVALRLSSNNLQGQLSPKISNLKSL 407



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 32/84 (38%), Positives = 45/84 (53%)
 Frame = +1

Query: 469 LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           LNL+ N F+G +P  I Q+  L+ L++S N L GE+     +LTNL  LD S N L G I
Sbjct: 568 LNLSNNNFSGVIPQDIGQLKSLDILSLSSNNLSGEIPQQLGNLTNLQVLDLSSNHLTGAI 627

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTI 720
           P   ++L  +    +  N   G I
Sbjct: 628 PSALNNLHFLSTFNVSCNDLEGPI 651



 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 51/162 (31%), Positives = 77/162 (47%), Gaps = 15/162 (9%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLP---YQLPPNVQKLN----------LAGNG 489
           +L+GS+   + +L+S+   D+S N+L   +P    ++P  + K N          L    
Sbjct: 492 RLSGSIPPWIKRLESLFHLDLSNNSLIGGIPASLMEMPMLITKKNTTRLDPRVFELPIYR 551

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
              G  Y I+   P + LN+S+N   G +      L +L  L  S N+L+G IPQ   +L
Sbjct: 552 SAAGFQYRITSAFP-KVLNLSNNNFSGVIPQDIGQLKSLDILSLSSNNLSGEIPQQLGNL 610

Query: 670 TNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIP 789
           TN++ + L +N  TG I   L NL  L   NV  N   G IP
Sbjct: 611 TNLQVLDLSSNHLTGAIPSALNNLHFLSTFNVSCNDLEGPIP 652



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 48/167 (28%), Positives = 76/167 (45%), Gaps = 20/167 (11%)
 Frame = +1

Query: 376 LDQLKSVTTFDISTNNLGNSLPYQLP----PNVQKLNLAGNGFTGGLPYSISQMAPLEYL 543
           L   +++TT  I TN  G ++P         N++ L++A    +G +P  +S++  LE L
Sbjct: 427 LKDSRNLTTLLIGTNFYGEAMPEDNSIDGFQNLKVLSIANCSLSGNIPLWLSKLEKLEML 486

Query: 544 NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID 723
            +  N+L G +      L +L  LD S NSL G IP   +SL  M  +  + N  T    
Sbjct: 487 FLLDNRLSGSIPPWIKRLESLFHLDLSNNSLIGGIP---ASLMEMPMLITKKNT-TRLDP 542

Query: 724 VLANLPLDN----------------LNVENNHFTGWIPPQLQGINSL 816
            +  LP+                  LN+ NN+F+G IP  +  + SL
Sbjct: 543 RVFELPIYRSAAGFQYRITSAFPKVLNLSNNNFSGVIPQDIGQLKSL 589



 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 45/173 (26%), Positives = 81/173 (46%), Gaps = 7/173 (4%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           ++ + + G  +TG +   + QLK +    +  NN+   LP  L    ++  +NL  N F+
Sbjct: 286 LSTLDLEGNNITGWIPDSIGQLKRLQDLHLGDNNISGELPSALSNCTHLITINLKRNNFS 345

Query: 496 GGLP-YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           G L   + S ++ L+ L++  N+ +G V     S TNL  L  S N+L G +    S+L 
Sbjct: 346 GNLSNVNFSNLSNLKTLDLMGNKFEGTVPESIYSCTNLVALRLSSNNLQGQLSPKISNLK 405

Query: 673 NMKNMYLQNNVFTGTIDVLANLPLDNLNVE----NNHFTGWIPPQLQGINSLQ 819
           ++  + +  N  T   ++L  L  D+ N+       +F G   P+   I+  Q
Sbjct: 406 SLTFLSVGCNNLTNITNMLWILK-DSRNLTTLLIGTNFYGEAMPEDNSIDGFQ 457



 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 4/97 (4%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
           + +S    +G +   + QLKS+    +S+NNL   +P QL    N+Q L+L+ N  TG +
Sbjct: 568 LNLSNNNFSGVIPQDIGQLKSLDILSLSSNNLSGEIPQQLGNLTNLQVLDLSSNHLTGAI 627

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVT--VMFVSLTNLS 609
           P +++ +  L   NVS N L+G +     F + TN S
Sbjct: 628 PSALNNLHFLSTFNVSCNDLEGPIPNGAQFSTFTNSS 664



>gb:AP005826_1858575 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0758B01.
          Length = 993

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 53/164 (32%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGF 492
           R+T + +S + +TG +   L  L+ +   D S+N L   +P  +     +Q L L  NGF
Sbjct: 220 RLTYLWLSNMNITGEIPENLSSLRELNLLDFSSNKLQGKIPTWIWQHKKLQNLYLYANGF 279

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
           TG +  ++S +  +E ++VS N+L G +   F  LTNL+ L   FN L+G+IP +   L 
Sbjct: 280 TGEIEPNVSALNLVE-IDVSSNELIGTIPNGFGKLTNLTLLFLYFNKLSGSIPPSVGLLP 338

Query: 673 NMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
            + ++ L  N+ +G++  ++  + PL NL V NN+ +G +P  L
Sbjct: 339 KLTDIRLFGNMLSGSLPPELGKHSPLANLEVSNNNLSGKLPEGL 382



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 70/273 (25%), Positives = 105/273 (38%), Gaps = 78/273 (28%)
 Frame = +1

Query: 205 VLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQ 384
           +L  L +   S P L +W +     C  +W+G++C+   V  I +        +   +  
Sbjct: 37  ILLELKNHWGSSPALGRWNSTTTAHC--NWEGITCTNGAVIGISLPNQTFIKPIPPSICL 94

Query: 385 LKSVTTFDISTNNLGNSLPY--------------------QLPPNV-------QKLNLAG 483
           LK++T  D+S NN   S P                     QLP ++       + LNL+ 
Sbjct: 95  LKNLTRLDLSYNNFSTSFPTMLYNCSNLKFLDLSNNAFDGQLPSDLNHLSALLEHLNLSS 154

Query: 484 NGFTGGLPYS-------------------------ISQMAPLE----------------- 537
           N FTG +P S                         IS +A LE                 
Sbjct: 155 NHFTGRIPPSIGLFPRLKSLLLDTNQFDGRYPAEDISNLADLERLTLAVNPFVPAPFPVE 214

Query: 538 --------YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
                   YL +S+  + GE+     SL  L+ LDFS N L G IP        ++N+YL
Sbjct: 215 FGRLTRLTYLWLSNMNITGEIPENLSSLRELNLLDFSSNKLQGKIPTWIWQHKKLQNLYL 274

Query: 694 QNNVFTGTIDV-LANLPLDNLNVENNHFTGWIP 789
             N FTG I+  ++ L L  ++V +N   G IP
Sbjct: 275 YANGFTGEIEPNVSALNLVEIDVSSNELIGTIP 307



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 44/158 (27%), Positives = 76/158 (48%), Gaps = 22/158 (13%)
 Frame = +1

Query: 394 VTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF---------------------TGGLPY 510
           ++T  I  N    + P QLP N  +L+++ N F                     +G +P+
Sbjct: 438 LSTVMIQNNRFSGTFPKQLPWNFTRLDISNNKFSGPIPTLAGKMKVFIAANNLLSGEIPW 497

Query: 511 SISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMY 690
            ++ ++ +  +++S NQ+ G + +    L  L+TL+ S N ++GNIP  F  +T +  + 
Sbjct: 498 DLTGISQVTEVDLSRNQISGSLPMTIGVLARLNTLNLSGNQISGNIPAAFGFMTVLTILD 557

Query: 691 LQNNVFTGTIDVLAN-LPLDNLNVENNHFTGWIPPQLQ 801
           L +N  +G I    N L L+ LN+  N   G IP  LQ
Sbjct: 558 LSSNKLSGEIPKDFNKLRLNFLNLSMNQLIGEIPISLQ 595



 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 42/136 (30%), Positives = 69/136 (50%), Gaps = 2/136 (1%)
 Frame = +1

Query: 325 TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTG 498
           T + IS  + +G +     ++K    F  + N L   +P+ L     V +++L+ N  +G
Sbjct: 461 TRLDISNNKFSGPIPTLAGKMK---VFIAANNLLSGEIPWDLTGISQVTEVDLSRNQISG 517

Query: 499 GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
            LP +I  +A L  LN+S NQ+ G +   F  +T L+ LD S N L+G IP+ F+ L  +
Sbjct: 518 SLPMTIGVLARLNTLNLSGNQISGNIPAAFGFMTVLTILDLSSNKLSGEIPKDFNKL-RL 576

Query: 679 KNMYLQNNVFTGTIDV 726
             + L  N   G I +
Sbjct: 577 NFLNLSMNQLIGEIPI 592



 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +1

Query: 595 LTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN---LPLDNLNVEN 765
           L NL+ LD S+N+ + + P    + +N+K + L NN F G +    N     L++LN+ +
Sbjct: 95  LKNLTRLDLSYNNFSTSFPTMLYNCSNLKFLDLSNNAFDGQLPSDLNHLSALLEHLNLSS 154

Query: 766 NHFTGWIPPQL 798
           NHFTG IPP +
Sbjct: 155 NHFTGRIPPSI 165



 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 40/148 (27%), Positives = 67/148 (45%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT 495
           ++VTE+ +S  Q++GS+   +  L  + T                      LNL+GN  +
Sbjct: 503 SQVTEVDLSRNQISGSLPMTIGVLARLNT----------------------LNLSGNQIS 540

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P +   M  L  L++S N+L GE+   F  L  L+ L+ S N L G IP     ++ 
Sbjct: 541 GNIPAAFGFMTVLTILDLSSNKLSGEIPKDFNKL-RLNFLNLSMNQLIGEIP-----ISL 594

Query: 676 MKNMYLQNNVFTGTIDVLANLPLDNLNV 759
               Y Q+ +F   + V +N  + N  +
Sbjct: 595 QNEAYEQSFLFNPGLCVSSNNSVHNFPI 622



>gb:AJ864508_1814988 Phaseolus vulgaris ppgip3 gene for
           polygalacturonase inhibiting protein precursor.
          Length = 337

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 60/214 (28%), Positives = 95/214 (44%), Gaps = 10/214 (4%)
 Frame = +1

Query: 187 DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM 366
           +P D   L  +   L +P  L+ W  N  D C   W+GVSC  +  T  +++ L L    
Sbjct: 25  NPQDKQALLQIKKDLGNPTTLSSWLPNT-DCCKPEWEGVSCDIDTKT-YRVNSLDL---- 78

Query: 367 GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG-------NGFTGGLPYSISQM 525
                            N+L  + PY +P +V  L           N   G +P SI+++
Sbjct: 79  -----------------NDLSLTKPYPIPSSVANLPYLSFLYISRINNLVGPIPPSIAKL 121

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L +L ++H  + G++      +  L T+DFS+N+L+G +P + SSL N+  + L  N 
Sbjct: 122 TKLRFLYITHTNVSGQIPNFLSQMKTLITIDFSYNALSGTLPPSLSSLPNLLGISLDGNR 181

Query: 706 FTGTI-DVLANLP--LDNLNVENNHFTGWIPPQL 798
            +GTI     + P     L +  N  TG IP  L
Sbjct: 182 ISGTIPGSFGSFPKHFTVLTLSRNRLTGNIPATL 215



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 44/159 (27%), Positives = 73/159 (45%), Gaps = 19/159 (11%)
 Frame = +1

Query: 298 GVSCSGNRV---------------TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN 432
           G+S  GNR+               T + +S  +LTG++   L +L+ +   D+S N L  
Sbjct: 174 GISLDGNRISGTIPGSFGSFPKHFTVLTLSRNRLTGNIPATLAKLE-LAFVDLSENMLEG 232

Query: 433 SLPYQLPPN---VQKLNLAGNGFTGGL-PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
                   N   +QK+NLA N     L    +S+   LE L++ +N++ G +  +  SL 
Sbjct: 233 DASVLFGANKVNLQKINLAKNLLAFDLGKIRLSKSKDLEGLDLRNNRIYGTLPKVLTSLK 292

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
            L +L+ S+N+L G IPQ        ++ Y  N    G+
Sbjct: 293 YLKSLNVSYNNLCGQIPQGGKLQRFDESSYAHNKCLCGS 331



>gb:AJ786410_1814068 Phaseolus vulgaris bpgip3 gene for
           polygalacturonase inhibiting protein.
          Length = 337

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 60/214 (28%), Positives = 95/214 (44%), Gaps = 10/214 (4%)
 Frame = +1

Query: 187 DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM 366
           +P D   L  +   L +P  L+ W  N  D C   W+GVSC  +  T  +++ L L    
Sbjct: 25  NPQDKEALLQIKKDLGNPTTLSSWLPNT-DCCKPEWEGVSCDIDTKT-YRVNSLDL---- 78

Query: 367 GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG-------NGFTGGLPYSISQM 525
                            N+L  + PY +P +V  L           N   G +P SI+++
Sbjct: 79  -----------------NDLSLTKPYPIPSSVANLPYLSFLYISRINNLVGPIPPSIAKL 121

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
             L +L ++H  + G++      +  L T+DFS+N+L+G +P + SSL N+  + L  N 
Sbjct: 122 TKLRFLYITHTNVSGQIPNFLSQMKTLITIDFSYNALSGTLPPSLSSLPNLLGISLDGNR 181

Query: 706 FTGTI-DVLANLP--LDNLNVENNHFTGWIPPQL 798
            +GTI     + P     L +  N  TG IP  L
Sbjct: 182 ISGTIPGSFGSFPKHFTVLTLSRNRLTGNIPATL 215



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 44/159 (27%), Positives = 73/159 (45%), Gaps = 19/159 (11%)
 Frame = +1

Query: 298 GVSCSGNRV---------------TEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN 432
           G+S  GNR+               T + +S  +LTG++   L +L+ +   D+S N L  
Sbjct: 174 GISLDGNRISGTIPGSFGSFPKHFTVLTLSRNRLTGNIPATLAKLE-LAFVDLSENMLEG 232

Query: 433 SLPYQLPPN---VQKLNLAGNGFTGGL-PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
                   N   +QK+NLA N     L    +S+   LE L++ +N++ G +  +  SL 
Sbjct: 233 DASVLFGANKVNLQKINLAKNLLAFDLGKIRLSKSKDLEGLDLRNNRIYGTLPKVLTSLK 292

Query: 601 NLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT 717
            L +L+ S+N+L G IPQ        ++ Y  N    G+
Sbjct: 293 YLKSLNVSYNNLCGQIPQGGKLQRFDESSYAHNKCLCGS 331



>gb:OSJN00083_1694586 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064G10, complete sequence.
          Length = 497

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 70/252 (27%), Positives = 118/252 (46%), Gaps = 31/252 (12%)
 Frame = +1

Query: 136 LLIGFLLNAPPSAVADTD--------------PTDASVLRGLFSSLNSPPQLTKWTANGG 273
           LL+   L  PP A A  D              P D + L G  + +         T +GG
Sbjct: 20  LLVVAALLPPPRAEAGHDGAGGDDEPPPTPCSPADRAALLGFKAGVTVDTTGILATWDGG 79

Query: 274 DPCGESWKGVSCSG--NRVTEIQISGLQL--------TGSMGFQLDQLKSVTTFDI-STN 420
           + C  +W+GVSC     RV  +Q+    L         G++   L  L+ + T  I    
Sbjct: 80  NDCCGAWEGVSCDAATGRVVALQLEAPPLPPPRRSYMEGALSASLGGLEFLETLVIRDMA 139

Query: 421 NLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSI-SQMAPLEYLNVSHNQLQGEVTVMFV 591
            +G ++P  L     +++L L G+   GG+P S+ S MA L+YL+++ N+ +G++     
Sbjct: 140 RIGGAIPASLSRLSRLKQLYLEGSMLAGGVPGSVLSGMASLQYLSLAGNRFEGKLPPELG 199

Query: 592 SLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDN---LNVE 762
           SL  L  ++ + N L+G +P ++ +L+ +  + L NN+ +G I       L +   L++ 
Sbjct: 200 SLPGLVQINLAGNRLSGEVPPSYKNLSRLAYLDLSNNLLSGAIPAFFGQQLKSLAMLDLS 259

Query: 763 NNHFTGWIPPQL 798
           NN F+G IP  L
Sbjct: 260 NNGFSGEIPASL 271



 Score = 41.6 bits (96), Expect = 0.019
 Identities = 29/115 (25%), Positives = 47/115 (40%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG 489
           +G  +  + +SG  + G +   + +L  +   DIS N +                     
Sbjct: 376 AGASLRWLDVSGNAIGGQIPSSVWRLVGLQRLDISRNKI--------------------- 414

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
             G +P S++ MA L +L++S N L G +   F  +  L    F  N L G IPQ
Sbjct: 415 -RGTIPASVASMASLRWLDISGNALVGRIPDSFARMARLRHASFRGNKLCGKIPQ 468



>gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09
           (R20481) putative receptor protein kinase (At5g25930)
           mRNA, complete cds.>gb:T1N24_1723664 Arabidopsis
           thaliana BAC T1N24.
          Length = 1005

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 71/258 (27%), Positives = 111/258 (43%), Gaps = 32/258 (12%)
 Frame = +1

Query: 139 LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN 318
           L  FL + P S  +  +  D S L  L   L  PP L  W  N   PC  +W  ++C+  
Sbjct: 9   LFFFLTSIPLSVFSQFN--DQSTLLNLKRDLGDPPSLRLWN-NTSSPC--NWSEITCTAG 63

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNN------------------------L 426
            VT I       TG++   +  L ++   D+S N                         L
Sbjct: 64  NVTGINFKNQNFTGTVPTTICDLSNLNFLDLSFNYFAGEFPTVLYNCTKLQYLDLSQNLL 123

Query: 427 GNSLPY---QLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSL 597
             SLP    +L P +  L+LA NGF+G +P S+ +++ L+ LN+  ++  G        L
Sbjct: 124 NGSLPVDIDRLSPELDYLDLAANGFSGDIPKSLGRISKLKVLNLYQSEYDGTFPSEIGDL 183

Query: 598 TNLSTLDFSFNS--LAGNIPQTFSSLTNMKNMYLQNNVFTGTID--VLANL-PLDNLNVE 762
           + L  L  + N       IP  F  L  +K M+L+     G I   V  N+  L+++++ 
Sbjct: 184 SELEELRLALNDKFTPAKIPIEFGKLKKLKYMWLEEMNLIGEISPVVFENMTDLEHVDLS 243

Query: 763 NNHFTGWIPPQLQGINSL 816
            N+ TG IP  L G+ +L
Sbjct: 244 VNNLTGRIPDVLFGLKNL 261



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 47/174 (27%), Positives = 81/174 (46%), Gaps = 2/174 (1%)
 Frame = +1

Query: 283 GESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
           GE  + +   G  +T +Q+     +G    ++    S+ +  +S N+    LP  +  N+
Sbjct: 392 GEIPESLGDCGTLLT-VQLQNNDFSGKFPSRIWNASSMYSLQVSNNSFTGELPENVAWNM 450

Query: 463 QKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAG 642
            ++ +  N F+G +P  I   + L      +NQ  GE      SL+NL ++    N L G
Sbjct: 451 SRIEIDNNRFSGEIPKKIGTWSSLVEFKAGNNQFSGEFPKELTSLSNLISIFLDENDLTG 510

Query: 643 NIPQTFSSLTNMKNMYLQNNVFTGTID-VLANLP-LDNLNVENNHFTGWIPPQL 798
            +P    S  ++  + L  N  +G I   L  LP L NL++  N F+G IPP++
Sbjct: 511 ELPDEIISWKSLITLSLSKNKLSGEIPRALGLLPRLLNLDLSENQFSGGIPPEI 564



 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 45/188 (23%), Positives = 90/188 (47%), Gaps = 8/188 (4%)
 Frame = +1

Query: 301 VSCSGNRVTEIQISGL---QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQ 465
           +  S   +T++Q+  L   +LTG +   + +L  +  F I  N L   +P ++  +  ++
Sbjct: 298 IPVSIGNLTKLQVLNLFNNKLTGEIPPVIGKLPGLKEFKIFNNKLTGEIPAEIGVHSKLE 357

Query: 466 KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN 645
           +  ++ N  TG LP ++ +   L+ + V  N L GE+         L T+    N  +G 
Sbjct: 358 RFEVSENQLTGKLPENLCKGGKLQGVVVYSNNLTGEIPESLGDCGTLLTVQLQNNDFSGK 417

Query: 646 IPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL--- 816
            P    + ++M ++ + NN FTG +       +  + ++NN F+G IP ++   +SL   
Sbjct: 418 FPSRIWNASSMYSLQVSNNSFTGELPENVAWNMSRIEIDNNRFSGEIPKKIGTWSSLVEF 477

Query: 817 QTGGNSWN 840
           + G N ++
Sbjct: 478 KAGNNQFS 485



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 42/121 (34%), Positives = 67/121 (55%), Gaps = 2/121 (1%)
 Frame = +1

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           +++ ++L+ N  TG +P  +  +  L    +  N L GE+    +S TNL  LD S N+L
Sbjct: 236 DLEHVDLSVNNLTGRIPDVLFGLKNLTEFYLFANGLTGEIPKS-ISATNLVFLDLSANNL 294

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGIN 810
            G+IP +  +LT ++ + L NN  TG I  V+  LP L    + NN  TG IP ++ G++
Sbjct: 295 TGSIPVSIGNLTKLQVLNLFNNKLTGEIPPVIGKLPGLKEFKIFNNKLTGEIPAEI-GVH 353

Query: 811 S 813
           S
Sbjct: 354 S 354



 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 42/167 (25%), Positives = 75/167 (44%), Gaps = 4/167 (2%)
 Frame = +1

Query: 328 EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN--VQKLNLAGNGFTGG 501
           E +I   +LTG +  ++     +  F++S N L   LP  L     +Q + +  N  TG 
Sbjct: 334 EFKIFNNKLTGEIPAEIGVHSKLERFEVSENQLTGKLPENLCKGGKLQGVVVYSNNLTGE 393

Query: 502 LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK 681
           +P S+     L  + + +N   G+      + +++ +L  S NS  G +P+  +   NM 
Sbjct: 394 IPESLGDCGTLLTVQLQNNDFSGKFPSRIWNASSMYSLQVSNNSFTGELPENVA--WNMS 451

Query: 682 NMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSL 816
            + + NN F+G I         L      NN F+G  P +L  +++L
Sbjct: 452 RIEIDNNRFSGEIPKKIGTWSSLVEFKAGNNQFSGEFPKELTSLSNL 498



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 2/112 (1%)
 Frame = +1

Query: 247 LTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL 426
           L ++ A      GE  K ++   N ++ I +    LTG +  ++   KS+ T  +S N L
Sbjct: 474 LVEFKAGNNQFSGEFPKELTSLSNLIS-IFLDENDLTGELPDEIISWKSLITLSLSKNKL 532

Query: 427 GNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV 576
              +P  L   P +  L+L+ N F+GG+P  I  +  L   NVS N+L G +
Sbjct: 533 SGEIPRALGLLPRLLNLDLSENQFSGGIPPEIGSL-KLTTFNVSSNRLTGGI 583



>gb:AP004039_1836723 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1006_D05.>gb:AP005846_1858984 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:B1307A11.
          Length = 1115

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 61/187 (32%), Positives = 98/187 (52%), Gaps = 11/187 (5%)
 Frame = +1

Query: 292 WKGVSC--SGNR---VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP 456
           W+GV+C  SG R   V  + ++ L L G++   L  L  +    +  N L   +P +L  
Sbjct: 28  WRGVACGLSGRRTGRVVALDLTKLNLVGAISPLLGNLTYLRRLHLHKNRLHGEIPSELGH 87

Query: 457 --NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
             +++ LN + N   G +P ++S    +E + +  N+LQG++   F SL NL  L    N
Sbjct: 88  LRDLRHLNRSYNSIQGPIPATLSTCRGMENIWLYSNKLQGQIPSEFGSLQNLQALVLGEN 147

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DV--LANLPLDNLNVENNHFTGWIPPQL 798
            L G+IP    SL N+K + L+ N FTG I  D+  LANL +  L + +N  +G IP  +
Sbjct: 148 RLTGSIPSFIGSLANLKFLILEENNFTGEIPSDIGRLANLTV--LGLGSNQLSGPIPASI 205

Query: 799 QGINSLQ 819
             +++LQ
Sbjct: 206 GNLSALQ 212



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 46/166 (27%), Positives = 85/166 (51%), Gaps = 6/166 (3%)
 Frame = +1

Query: 319 RVTEIQISGL---QLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-YQLPPNVQKLNLAGN 486
           R+  + + GL   QL+G +   +  L ++    + +NNL  S+P  Q   +++   L  N
Sbjct: 183 RLANLTVLGLGSNQLSGPIPASIGNLSALQFLSVFSNNLVGSIPPMQRLSSLEFFELGKN 242

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
              G +P  +  ++ L  + +  N+L G +      L  L++LD S N+L G +P T  +
Sbjct: 243 NIEGSIPTWLGNLSSLLTVKLGGNRLDGNIPESLGKLKLLTSLDLSSNNLVGPVPDTIGN 302

Query: 667 LTNMKNMYLQNNVFTGTI-DVLANL-PLDNLNVENNHFTGWIPPQL 798
           L ++K  +++NN   G++   + NL  L+ LN++ N+  G IP  L
Sbjct: 303 LYSIKQFHVENNELEGSLPSSIFNLSSLEELNLQTNNLNGTIPLDL 348



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 57/204 (27%), Positives = 98/204 (48%), Gaps = 3/204 (1%)
 Frame = +1

Query: 223  SSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTT 402
            SS+ +   LT  +  G    GE     S S   + ++++S   LTG +  +L  +  ++T
Sbjct: 523  SSIGNLRMLTLLSVAGNALSGEI--PPSLSNCPLEQLKLSYNNLTGLIPKELFAISVLST 580

Query: 403  FDISTNN-LGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGE 573
              I  +N +   LP ++    N+  L+ + N  +G +P SI +   L+YLN S N LQG+
Sbjct: 581  SLILDHNFITGPLPSEVGNLTNLALLDFSSNLISGEIPSSIGECQSLQYLNTSGNLLQGQ 640

Query: 574  VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL 753
            +         L  LD S N+L+G+IP+   ++T + ++ L  N F G      ++P D +
Sbjct: 641  IPPSLDQPKGLLLLDLSHNNLSGSIPKFLGTMTGLASLNLSFNNFEG------DVPKDGI 694

Query: 754  NVENNHFTGWIPPQLQGINSLQTG 825
                  F+   P  ++G N L  G
Sbjct: 695  ------FSNATPALIEGNNGLCNG 712



 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 46/166 (27%), Positives = 78/166 (46%), Gaps = 6/166 (3%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
           + G +   L   + +    + +N L   +P +     N+Q L L  N  TG +P  I  +
Sbjct: 101 IQGPIPATLSTCRGMENIWLYSNKLQGQIPSEFGSLQNLQALVLGENRLTGSIPSFIGSL 160

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           A L++L +  N   GE+      L NL+ L    N L+G IP +  +L+ ++ + + +N 
Sbjct: 161 ANLKFLILEENNFTGEIPSDIGRLANLTVLGLGSNQLSGPIPASIGNLSALQFLSVFSNN 220

Query: 706 FTGTIDVLANL-PLDNLNVENNHFTGWIPPQLQGINSLQT---GGN 831
             G+I  +  L  L+   +  N+  G IP  L  ++SL T   GGN
Sbjct: 221 LVGSIPPMQRLSSLEFFELGKNNIEGSIPTWLGNLSSLLTVKLGGN 266



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 54/226 (23%), Positives = 92/226 (40%), Gaps = 61/226 (26%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL---AGNGF 492
           + +  +   +L GS+   +  L S+   ++ TNNL  ++P  L   + KL L   + N F
Sbjct: 306 IKQFHVENNELEGSLPSSIFNLSSLEELNLQTNNLNGTIPLDLGNRLPKLQLFLISENQF 365

Query: 493 TGGLPYSISQMAPLEYLNVSHNQLQGEV------------TVMFV--------------- 591
            G +P S+  ++ L ++   +N L G +            +V F                
Sbjct: 366 HGSIPPSLCNISTLRWIQTVNNSLSGTIPQCIGINQKSLYSVTFAVNQFETSNKYGWSFM 425

Query: 592 -SLTNLSTLDF----------------------------SFNSLAGNIPQTFSSLTNMKN 684
            SLTN S L                              ++NS+ G IP+   +L ++K 
Sbjct: 426 SSLTNCSNLRLLDVGDNKLTGELPNSIGNLSTRLEYFVTNYNSMTGKIPEGLGNLVSLKF 485

Query: 685 MYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
           + + NN + GTI D L  L  L+ L + NN+ +G IP  +  +  L
Sbjct: 486 IEMNNNFYEGTIPDSLGKLKNLNRLYLTNNNLSGSIPSSIGNLRML 531



>gb:AP003491_1829947 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0662B01.
          Length = 1094

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 79/298 (26%), Positives = 128/298 (42%), Gaps = 62/298 (20%)
 Frame = +1

Query: 112 MGLP-W-AVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGG 273
           +GLP W +VALLI   + A  S++    ++   TD + L  L    + P  +       G
Sbjct: 3   IGLPVWISVALLIALSIVASASSLGLSKSNGSDTDLAALLALKVHFSDPDNILAGNWTAG 62

Query: 274 DPCGESWKGVSCSGNR--VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-- 441
            P  + W GVSCS +R  VT +++ G+ L G +G  L  +  ++  +++   L  S+P  
Sbjct: 63  TPFCQ-WVGVSCSRHRQRVTALELPGIPLQGELGPHLGNISFLSVLNLTDTGLTGSVPDD 121

Query: 442 ---------------------------------YQLPPN---------------VQKLNL 477
                                              LP N               ++ ++L
Sbjct: 122 IGRLHRLKLIDLGHNALSGGIPATIGNLMRLQLLHLPSNQLSGPIPIELQALRRLRSIDL 181

Query: 478 AGNGFTGGLPYSISQMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ 654
            GN  TG +P S+    PL  YL++ +N L G +     SL  L  L+  +N+L G +PQ
Sbjct: 182 IGNYLTGSIPDSLFNNTPLLAYLSIGNNSLSGPIPGCIGSLPMLELLELQYNNLTGPVPQ 241

Query: 655 TFSSLTNMKNMYLQNNVFTGTI--DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
              +++ +  + L  N  TG+I  +   +LP L   ++ +N FTG IPP L     LQ
Sbjct: 242 AIFNMSRLTVVDLGFNSLTGSIPGNTSFSLPVLQWFSISHNRFTGQIPPGLAACPYLQ 299



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/174 (28%), Positives = 90/174 (51%), Gaps = 7/174 (4%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKS---VTTFDISTNNLGNSLPYQ---LPPNVQKLNL 477
           N + ++ I+   L G +G+ L  L +   ++T  I +N+   SLP     L   ++  + 
Sbjct: 417 NSLKQLSIAQNNLQGDIGYFLSILSNCINLSTLYIYSNHFTGSLPGSVGNLSSLLRVFSA 476

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N FTG LP  IS +  ++ L++  NQL G++    + + NL  L+   N+L+G+IP  
Sbjct: 477 FENSFTGELPAMISNLTGIQVLDLGGNQLHGKIPESIMMMRNLVFLNLETNNLSGSIPLN 536

Query: 658 FSSLTNMKNMYLQNNVFTG-TIDVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
              L N++ +Y+  N F+G  +D      L++L + +N  +  +PP L  ++ L
Sbjct: 537 TGMLNNIELIYIGTNKFSGLQLDPSNLTKLEHLALGHNQLSSTVPPSLFHLDRL 590



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 53/166 (31%), Positives = 83/166 (50%), Gaps = 6/166 (3%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL---PPNVQKLNLAGNG 489
           R+  + +   QL+G +  +L  L+ + + D+  N L  S+P  L    P +  L++  N 
Sbjct: 151 RLQLLHLPSNQLSGPIPIELQALRRLRSIDLIGNYLTGSIPDSLFNNTPLLAYLSIGNNS 210

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP-QTFSS 666
            +G +P  I  +  LE L + +N L G V     +++ L+ +D  FNSL G+IP  T  S
Sbjct: 211 LSGPIPGCIGSLPMLELLELQYNNLTGPVPQAIFNMSRLTVVDLGFNSLTGSIPGNTSFS 270

Query: 667 LTNMKNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQL 798
           L  ++   + +N FTG I   LA  P L  L V +N F G  P  L
Sbjct: 271 LPVLQWFSISHNRFTGQIPPGLAACPYLQVLRVGDNLFEGVFPSWL 316



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 54/193 (27%), Positives = 90/193 (46%), Gaps = 13/193 (6%)
 Frame = +1

Query: 304 SCSGN--RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP-----PNV 462
           +C GN   +T + ++  QL GS+   +  + S+    I+ NNL   + Y L       N+
Sbjct: 387 ACLGNLSALTILSLAENQLDGSVPATIGNMNSLKQLSIAQNNLQGDIGYFLSILSNCINL 446

Query: 463 QKLNLAGNGFTGGLPYSISQMAP-LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
             L +  N FTG LP S+  ++  L   +   N   GE+  M  +LT +  LD   N L 
Sbjct: 447 STLYIYSNHFTGSLPGSVGNLSSLLRVFSAFENSFTGELPAMISNLTGIQVLDLGGNQLH 506

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNLN---VENNHFTG--WIPPQLQG 804
           G IP++   + N+  + L+ N  +G+I +   + L+N+    +  N F+G    P  L  
Sbjct: 507 GKIPESIMMMRNLVFLNLETNNLSGSIPLNTGM-LNNIELIYIGTNKFSGLQLDPSNLTK 565

Query: 805 INSLQTGGNSWNS 843
           +  L  G N  +S
Sbjct: 566 LEHLALGHNQLSS 578



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 47/163 (28%), Positives = 82/163 (50%), Gaps = 9/163 (5%)
 Frame = +1

Query: 292  WKGVSCSGNRVTEIQISGL---QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNV 462
            + G+    + +T+++   L   QL+ ++   L  L  +   D+S N     LP  +  N+
Sbjct: 553  FSGLQLDPSNLTKLEHLALGHNQLSSTVPPSLFHLDRLILLDLSQNFFSGELPVDIG-NI 611

Query: 463  QKLNLAG---NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS 633
            +++N      N F G LP SI  +  L YLN+S N+    +   F +L+ L  LD S N+
Sbjct: 612  KQINYMDIYMNRFVGSLPDSIGHLQMLGYLNLSVNEFHDSIPDSFSNLSGLQILDISHNN 671

Query: 634  LAGNIPQTFSSLTNMKNMYLQNNVFTGTI---DVLANLPLDNL 753
            ++G IP+  ++ T++ N+ L  N   G I    V +N+ L +L
Sbjct: 672  ISGTIPKYLANFTSLANLNLSFNKLEGQIPEGGVFSNITLQSL 714



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 66/255 (25%), Positives = 109/255 (42%), Gaps = 21/255 (8%)
 Frame = +1

Query: 115 GLPWAVALLIGF-LLNAPPSAVADTDPTDASVLRGLFS--------------SLNSPPQL 249
           G+P  +  L+   LL+ P + ++   P +   LR L S              SL +   L
Sbjct: 141 GIPATIGNLMRLQLLHLPSNQLSGPIPIELQALRRLRSIDLIGNYLTGSIPDSLFNNTPL 200

Query: 250 TKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG 429
             + + G +       G   S   +  +++    LTG +   +  +  +T  D+  N+L 
Sbjct: 201 LAYLSIGNNSLSGPIPGCIGSLPMLELLELQYNNLTGPVPQAIFNMSRLTVVDLGFNSLT 260

Query: 430 NSLPYQLP---PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLT 600
            S+P       P +Q  +++ N FTG +P  ++    L+ L V  N  +G         T
Sbjct: 261 GSIPGNTSFSLPVLQWFSISHNRFTGQIPPGLAACPYLQVLRVGDNLFEGVFPSWLAKST 320

Query: 601 NLSTLDFSFNSL-AGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNH 771
           NLS +  S N L AG IP   S+LT +  + L+     G I V +  L  L  L++  N 
Sbjct: 321 NLSDVSLSRNHLDAGPIPAALSNLTMLTRLGLEMCNLIGAIPVGIGQLGQLSVLDLTTNQ 380

Query: 772 FTGWIPPQLQGINSL 816
            TG IP  L  +++L
Sbjct: 381 LTGPIPACLGNLSAL 395



>gb:AC151804_1745143 Solanum demissum chromosome 5 BAC PGEC475B22
           genomic sequence, complete sequence.
          Length = 991

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 70/250 (28%), Positives = 107/250 (42%), Gaps = 21/250 (8%)
 Frame = +1

Query: 130 VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC 309
           +  L  F L    SAV   + +D   L G  S +   P     + N      + W GV C
Sbjct: 63  LVFLFSFSLQHGASAVFLVNESDKLALLGFKSQITEDPSRVFVSWNDSVHFCQ-WTGVKC 121

Query: 310 S--GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNL 477
                RV  + + G++L G +   L  L  + + D + N   + +P QL     +Q LNL
Sbjct: 122 GLRHGRVIRLNLEGMRLAGMISGHLGNLSFLNSLDHAENAFHDKIPQQLIRLSRLQSLNL 181

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
           + N  TG +P ++S    L+ L + HN L G++     SLT L  L    N+L G  P +
Sbjct: 182 SFNYLTGEIPVNLSHCVKLKNLVLDHNTLVGQIPYQVGSLTKLVKLSLRNNNLTGLFPGS 241

Query: 658 FSSLTNMKNMYLQNNVFTGTIDV----------------LANL-PLDNLNVENNHFTGWI 786
             +LT+++ +YL  N   G +                  LAN   L  L+   N+FTG I
Sbjct: 242 IGNLTSLEELYLSYNNLEGQVPASLARLTKLRLPGLSSSLANASKLLELDFPINNFTGNI 301

Query: 787 PPQLQGINSL 816
           P     + +L
Sbjct: 302 PKGFGNLRNL 311



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 48/156 (30%), Positives = 80/156 (51%), Gaps = 4/156 (2%)
 Frame = +1

Query: 343 GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSI 516
           G +++GS+  ++  L ++   ++S NNL  S+P  +    N+  LN   N  TG +P SI
Sbjct: 371 GNRISGSIPREISNLVNLNLLEMSNNNLTGSIPDSIGRLTNLGGLNFGNNLLTGVIPSSI 430

Query: 517 SQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQ 696
             +  L YL    N+L+G +     + + L  L  S NSL G IPQ   +L+++ ++Y  
Sbjct: 431 GNLTKLVYLYFGLNRLEGNIPSTLGNCSQLLKLGISENSLTGTIPQQLFALSSLTDIYAS 490

Query: 697 NNVFTGTIDVLAN--LPLDNLNVENNHFTGWIPPQL 798
            N  +G + V       L  L+  +N+F+G IP  L
Sbjct: 491 YNSLSGPLPVYIGNWSHLTYLDFSHNNFSGMIPRTL 526



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 50/167 (29%), Positives = 84/167 (50%), Gaps = 3/167 (1%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ--KLNLAGNGFTGGLPYSISQM 525
           LTG +   +  L  +       N L  ++P  L    Q  KL ++ N  TG +P  +  +
Sbjct: 422 LTGVIPSSIGNLTKLVYLYFGLNRLEGNIPSTLGNCSQLLKLGISENSLTGTIPQQLFAL 481

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L  +  S+N L G + V   + ++L+ LDFS N+ +G IP+T      ++ +YL+ N 
Sbjct: 482 SSLTDIYASYNSLSGPLPVYIGNWSHLTYLDFSHNNFSGMIPRTLGKCLALREIYLKGNS 541

Query: 706 FTGTIDVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
             GTI  L +LP L +L++  N+ +G IP  +    SL     S+N+
Sbjct: 542 LQGTIPNLEDLPDLQSLDLSLNNLSGPIPHFIANFTSLLYLNLSFNN 588



 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 54/211 (25%), Positives = 93/211 (44%), Gaps = 33/211 (15%)
 Frame = +1

Query: 310 SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP------PNVQKL 471
           + +++ E+       TG++      L+++   ++ +N LG+     L        ++Q L
Sbjct: 283 NASKLLELDFPINNFTGNIPKGFGNLRNLLWLNVWSNQLGHGKHDDLVNSLTNCSSLQML 342

Query: 472 NLAGNGFTGGLPYS-ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI 648
           +   N F G LP S ++  + L+ L    N++ G +     +L NL+ L+ S N+L G+I
Sbjct: 343 HFGDNQFVGTLPQSTVNLSSQLQSLLFYGNRISGSIPREISNLVNLNLLEMSNNNLTGSI 402

Query: 649 PQTFSSLTNMKNMYLQNNVFTGTID------------------VLANLP--------LDN 750
           P +   LTN+  +   NN+ TG I                   +  N+P        L  
Sbjct: 403 PDSIGRLTNLGGLNFGNNLLTGVIPSSIGNLTKLVYLYFGLNRLEGNIPSTLGNCSQLLK 462

Query: 751 LNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           L +  N  TG IP QL  ++SL     S+NS
Sbjct: 463 LGISENSLTGTIPQQLFALSSLTDIYASYNS 493



 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 2/130 (1%)
 Frame = +1

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           V +LNL G    G +   +  ++ L  L+ + N    ++    + L+ L +L+ SFN L 
Sbjct: 128 VIRLNLEGMRLAGMISGHLGNLSFLNSLDHAENAFHDKIPQQLIRLSRLQSLNLSFNYLT 187

Query: 640 GNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINS 813
           G IP   S    +KN+ L +N   G I   V +   L  L++ NN+ TG  P  +  + S
Sbjct: 188 GEIPVNLSHCVKLKNLVLDHNTLVGQIPYQVGSLTKLVKLSLRNNNLTGLFPGSIGNLTS 247

Query: 814 LQTGGNSWNS 843
           L+    S+N+
Sbjct: 248 LEELYLSYNN 257



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 42/137 (30%), Positives = 62/137 (45%), Gaps = 26/137 (18%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL--------------------GNSLP 441
           +T+I  S   L+G +   +     +T  D S NN                     GNSL 
Sbjct: 484 LTDIYASYNSLSGPLPVYIGNWSHLTYLDFSHNNFSGMIPRTLGKCLALREIYLKGNSLQ 543

Query: 442 YQLP-----PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNL 606
             +P     P++Q L+L+ N  +G +P+ I+    L YLN+S N L+GEV V  +  +NL
Sbjct: 544 GTIPNLEDLPDLQSLDLSLNNLSGPIPHFIANFTSLLYLNLSFNNLEGEVPVTGI-FSNL 602

Query: 607 STLDFSFNS-LAGNIPQ 654
           S      NS L G I +
Sbjct: 603 SADVLIGNSGLCGGIQE 619



>gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein
           kinase (upk gene).
          Length = 1145

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 65/202 (32%), Positives = 97/202 (48%), Gaps = 8/202 (3%)
 Frame = +1

Query: 241 PQLTKWTANGGDPCGESWKGVSCS---GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDI 411
           P    W     +PC   W GV CS    N VTEI I  +Q+ G++  Q   L S+ +  I
Sbjct: 74  PFFESWDPRHENPC--KWTGVICSLDHENLVTEINIQSVQIAGNVPSQFAVLGSLRSLVI 131

Query: 412 STNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM 585
           S  NL  S+P ++    +++ L+L+GN   G +P  IS++  L+ L ++ NQLQG +   
Sbjct: 132 SAANLTGSIPAEIGGYESLEILDLSGNRLRGNIPAEISKLKNLKSLILNSNQLQGSIPAE 191

Query: 586 FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV-FTGTI-DVLANLP-LDNLN 756
             +  NL  L    N L+G IP     L N++      N    GT+ D L+N   L  L 
Sbjct: 192 IGNCHNLVDLVVFDNQLSGKIPAELGRLANLEVFRAGGNENIEGTLPDELSNCTNLVTLG 251

Query: 757 VENNHFTGWIPPQLQGINSLQT 822
           +   + +G IP     +  LQT
Sbjct: 252 LAETNISGKIPLSFGSLKKLQT 273



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 50/179 (27%), Positives = 90/179 (50%), Gaps = 5/179 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           +T++ +   +LTG++  ++    +++   +  N L N +P ++    N+  L+LA N F+
Sbjct: 463 LTKLLLLSNELTGALPPEIGNCVALSRLRLGNNRLLNQIPREIGKLENLVFLDLAMNQFS 522

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P  I   + L+ L++  N+L GE+      L  L  +D S N L G IP    +L  
Sbjct: 523 GSIPAEIGGCSQLQMLDLHGNRLGGELPRALGFLHGLQVVDLSANELTGLIPANLGNLVA 582

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQTGGN-SWNS 843
           +  + L  N  +G I  ++     L  L++  N F+G IPP++     L+   N SWN+
Sbjct: 583 LTKLTLNGNALSGAIPWEISRCTNLQLLDLSLNRFSGQIPPEMGKCKRLEIALNLSWNN 641



 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/175 (26%), Positives = 85/175 (48%), Gaps = 4/175 (2%)
 Frame = +1

Query: 304 SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNL 477
           SCS  +  ++  + L  +GS+      LK+++  +I+ NN+  S+P  L     + ++ L
Sbjct: 339 SCSSLKFVDLSTNSL--SGSIPDSFGSLKNLSELEITDNNVSGSIPAALANCTELTQIQL 396

Query: 478 AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT 657
             N  +G +P  +  +  L  L +  N L+G +     S  NL +LD S N L G+IP +
Sbjct: 397 YNNQISGQMPAELGALKKLTVLFLWQNNLEGPIPSSLGSCDNLQSLDLSHNRLTGSIPPS 456

Query: 658 FSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
              + N+  + L +N  TG +  ++   + L  L + NN     IP ++  + +L
Sbjct: 457 LFEIKNLTKLLLLSNELTGALPPEIGNCVALSRLRLGNNRLLNQIPREIGKLENL 511



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 51/170 (30%), Positives = 83/170 (48%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           +T+IQ+   Q++G M  +L  LK +T   +  NNL   +P  L    N+Q L+L+ N  T
Sbjct: 391 LTQIQLYNNQISGQMPAELGALKKLTVLFLWQNNLEGPIPSSLGSCDNLQSLDLSHNRLT 450

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P S+ ++  L  L +  N+L G +     +   LS L    N L   IP+    L N
Sbjct: 451 GSIPPSLFEIKNLTKLLLLSNELTGALPPEIGNCVALSRLRLGNNRLLNQIPREIGKLEN 510

Query: 676 MKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           +  + L  N F+G+I  ++     L  L++  N   G +P  L  ++ LQ
Sbjct: 511 LVFLDLAMNQFSGSIPAEIGGCSQLQMLDLHGNRLGGELPRALGFLHGLQ 560



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 44/161 (27%), Positives = 83/161 (51%), Gaps = 4/161 (2%)
 Frame = +1

Query: 352 LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQM 525
           L+G++  +L     +    +  N L  ++P +L     ++KL L  N   G +P  +   
Sbjct: 281 LSGTIPAELGNCSELVNLYLYENRLSGAIPRELGKLQKLEKLYLWDNELDGSIPAELGSC 340

Query: 526 APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV 705
           + L+++++S N L G +   F SL NLS L+ + N+++G+IP   ++ T +  + L NN 
Sbjct: 341 SSLKFVDLSTNSLSGSIPDSFGSLKNLSELEITDNNVSGSIPAALANCTELTQIQLYNNQ 400

Query: 706 FTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSLQT 822
            +G +  ++ A   L  L +  N+  G IP  L   ++LQ+
Sbjct: 401 ISGQMPAELGALKKLTVLFLWQNNLEGPIPSSLGSCDNLQS 441



 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 5/130 (3%)
 Frame = +1

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           N+Q + +AGN     +P   + +  L  L +S   L G +        +L  LD S N L
Sbjct: 106 NIQSVQIAGN-----VPSQFAVLGSLRSLVISAANLTGSIPAEIGGYESLEILDLSGNRL 160

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLDNLNVENNHFTGWIPPQLQGIN 810
            GNIP   S L N+K++ L +N   G+I   + N   L +L V +N  +G IP +L  + 
Sbjct: 161 RGNIPAEISKLKNLKSLILNSNQLQGSIPAEIGNCHNLVDLVVFDNQLSGKIPAELGRLA 220

Query: 811 SLQ---TGGN 831
           +L+    GGN
Sbjct: 221 NLEVFRAGGN 230



 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 41/172 (23%), Positives = 80/172 (46%), Gaps = 5/172 (2%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTN-NLGNSLPYQLP--PNVQKLNLAGN 486
           + + ++ +   QL+G +  +L +L ++  F    N N+  +LP +L    N+  L LA  
Sbjct: 196 HNLVDLVVFDNQLSGKIPAELGRLANLEVFRAGGNENIEGTLPDELSNCTNLVTLGLAET 255

Query: 487 GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS 666
             +G +P S   +  L+ L +    L G +     + + L  L    N L+G IP+    
Sbjct: 256 NISGKIPLSFGSLKKLQTLAIYTAFLSGTIPAELGNCSELVNLYLYENRLSGAIPRELGK 315

Query: 667 LTNMKNMYLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           L  ++ +YL +N   G+I  ++ +   L  +++  N  +G IP     + +L
Sbjct: 316 LQKLEKLYLWDNELDGSIPAELGSCSSLKFVDLSTNSLSGSIPDSFGSLKNL 367



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 25/95 (26%), Positives = 51/95 (53%), Gaps = 7/95 (7%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK-------LNLA 480
           +T++ ++G  L+G++ +++ +  ++   D+S N        Q+PP + K       LNL+
Sbjct: 583 LTKLTLNGNALSGAIPWEISRCTNLQLLDLSLNRFSG----QIPPEMGKCKRLEIALNLS 638

Query: 481 GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM 585
            N  +G +P   S +  L  L++SHN L G ++ +
Sbjct: 639 WNNLSGSIPAQFSGLTKLASLDLSHNLLSGNLSAL 673



>gb:AB025613_1516373 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2I5.
          Length = 946

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 76/280 (27%), Positives = 132/280 (47%), Gaps = 38/280 (13%)
 Frame = +1

Query: 94  LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG 273
           +KM   +GL + + +L+ F +    S  A TD +D + L+ L +  ++  +  K      
Sbjct: 1   MKMSSRIGL-FKLLILLFFQIY---SVYAFTDGSDFTALQALKNEWDTLSKSWK----SS 52

Query: 274 DPCGESWKGVSCSG-NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTN---------N 423
           DPCG  W G++C+  NRV  I ++   L G +  ++  L  + T D++ N         N
Sbjct: 53  DPCGTEWVGITCNNDNRVVSISLTNRNLKGKLPTEISTLSELQTLDLTGNPELSGPLPAN 112

Query: 424 LGN------------SLPYQLPPNV------QKLNLAGNGFTGGLPYSISQMAPLEYLNV 549
           +GN            +    +P ++       +L+L  N F+G +P S+ +++ L + ++
Sbjct: 113 IGNLRKLTFLSLMGCAFNGPIPDSIGNLEQLTRLSLNLNKFSGTIPASMGRLSKLYWFDI 172

Query: 550 SHNQLQGEVTVM-FVSLTNLSTL------DFSFNSLAGNIPQ-TFSSLTNMKNMYLQNNV 705
           + NQL+G++ V    SL  L  L       F  N L+G IP+  FSS   + ++    N 
Sbjct: 173 ADNQLEGKLPVSDGASLPGLDMLLQTGHFHFGNNKLSGEIPEKLFSSEMTLLHVLFDGNQ 232

Query: 706 FTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGINSLQ 819
           FTG+I     L   L  L ++ N  +G IP  L  + +LQ
Sbjct: 233 FTGSIPESLGLVQNLTVLRLDRNRLSGDIPSSLNNLTNLQ 272



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 52/181 (28%), Positives = 90/181 (49%), Gaps = 5/181 (2%)
 Frame = +1

Query: 283 GESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--P 456
           GE  + +  S   +  +   G Q TGS+   L  ++++T   +  N L   +P  L    
Sbjct: 210 GEIPEKLFSSEMTLLHVLFDGNQFTGSIPESLGLVQNLTVLRLDRNRLSGDIPSSLNNLT 269

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQ-GEVTVMFVSLTNLSTLDFSFNS 633
           N+Q+L+L+ N FTG LP +++ +  L  L+VS+N L    V      L +LSTL      
Sbjct: 270 NLQELHLSDNKFTGSLP-NLTSLTSLYTLDVSNNPLALSPVPSWIPFLNSLSTLRLEDIQ 328

Query: 634 LAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL--PLDNLNVENNHFTGWIPPQLQGI 807
           L G +P +  S   ++ + L++N+   T+D+  N    LD +++ +N  TG+  P    +
Sbjct: 329 LDGPVPTSLFSPLQLQTVSLKHNLINTTLDLGTNYSKQLDFVDLRDNFITGYKSPANNPV 388

Query: 808 N 810
           N
Sbjct: 389 N 389



>gb:AE016959_1020712 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079179_1732383
           Oryza sativa chromosome 10 clone OSJNBa0079B05, complete
           sequence.>gb:AC116601_1739309 Oryza sativa chromosome 10
           clone OSJNAa0079B05, complete
           sequence.>gb:AE017051_1750531 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 5 of 77 of the
           complete sequence.
          Length = 1098

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 63/203 (31%), Positives = 101/203 (49%), Gaps = 4/203 (1%)
 Frame = +1

Query: 220 FSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVT 399
           FSSL   P LT    +     G     +S S + +T + +   QLTG M  ++ +L+ +T
Sbjct: 82  FSSL---PFLTYIDLSSNSVYGPIPSSIS-SLSALTYLDLQLNQLTGRMPDEISELQRLT 137

Query: 400 TFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGE 573
             D+S NNL   +P  +     + +L++  N  +G +P  I  +A L+ L +S+N L GE
Sbjct: 138 MLDLSYNNLTGHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGE 197

Query: 574 VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANL-PLD 747
           +     +LTNL T     N L+G +P     LTN++ + L +N  TG I   + NL  + 
Sbjct: 198 IPTTLANLTNLDTFYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEIPTCIGNLTKMI 257

Query: 748 NLNVENNHFTGWIPPQLQGINSL 816
            L +  N   G IPP++  +  L
Sbjct: 258 KLYLFRNQIIGSIPPEIGNLAML 280



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 44/148 (29%), Positives = 76/148 (51%), Gaps = 4/148 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGLPYSISQ 522
           Q++GS+   L  L  +   D+S N +  S+P +     N+Q L+L  N  +G +P S+  
Sbjct: 337 QISGSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGN 396

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              ++ LN   NQL   +   F ++TN+  LD + NSL+G +P    + T++K ++L  N
Sbjct: 397 FQNMQNLNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLN 456

Query: 703 VFTGTI--DVLANLPLDNLNVENNHFTG 780
           +F G +   +     L  L ++ N  TG
Sbjct: 457 MFNGPVPRSLKTCTSLVRLFLDGNQLTG 484



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 50/168 (29%), Positives = 83/168 (49%), Gaps = 6/168 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           +Q+S   L+G +   L  L ++ TF +  N L   +P +L    N+Q L L  N  TG +
Sbjct: 187 LQLSNNTLSGEIPTTLANLTNLDTFYLDGNELSGPVPPKLCKLTNLQYLALGDNKLTGEI 246

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN 684
           P  I  +  +  L +  NQ+ G +     +L  L+ L  + N L G++P    +LT + N
Sbjct: 247 PTCIGNLTKMIKLYLFRNQIIGSIPPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNN 306

Query: 685 MYLQNNVFTGTI----DVLANLPLDNLNVENNHFTGWIPPQLQGINSL 816
           ++L  N  TG+I     +++N  L NL + +N  +G IP  L  +  L
Sbjct: 307 LFLHENQITGSIPPGLGIISN--LQNLILHSNQISGSIPGTLANLTKL 352



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 57/204 (27%), Positives = 95/204 (46%), Gaps = 29/204 (14%)
 Frame = +1

Query: 319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGF 492
            ++ ++ +   +L+G +  +      +   +I+ N +  ++P  L   PN+ +L L+ N  
Sbjct: 495  KLKKMSLMSNRLSGQISPKWGACPELAILNIAENMITGTIPPALSKLPNLVELKLSSNHV 554

Query: 493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT 672
             G +P  I  +  L  LN+S N+L G +     +L +L  LD S NSL+G IP+     T
Sbjct: 555  NGVIPPEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEYLDVSRNSLSGPIPEELGRCT 614

Query: 673  NMKNMYLQNNVFTG----TIDVLAN---------------LPLD--------NLNVENNH 771
             ++ + + NN F+G    TI  LA+               LP D         LN+ +N 
Sbjct: 615  KLQLLRINNNHFSGNLPATIGNLASIQIMLDVSNNKLDGLLPQDFGRMQMLVFLNLSHNQ 674

Query: 772  FTGWIPPQLQGINSLQTGGNSWNS 843
            FTG IP     + SL T   S+N+
Sbjct: 675  FTGRIPTSFASMVSLSTLDASYNN 698



 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 43/170 (25%), Positives = 89/170 (52%), Gaps = 4/170 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFT 495
           +T++ ++  +L GS+  +L  L  +    +  N +  S+P  L    N+Q L L  N  +
Sbjct: 280 LTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQNLILHSNQIS 339

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN 675
           G +P +++ +  L  L++S NQ+ G +   F +L NL  L    N ++G+IP++  +  N
Sbjct: 340 GSIPGTLANLTKLIALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQN 399

Query: 676 MKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQ 819
           M+N+  ++N  + ++     N+  +  L++ +N  +G +P  +    SL+
Sbjct: 400 MQNLNFRSNQLSNSLPQEFGNITNMVELDLASNSLSGQLPANICAGTSLK 449



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 45/160 (28%), Positives = 74/160 (46%), Gaps = 27/160 (16%)
 Frame = +1

Query: 331  IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP--PNVQKLNLAGNGFTGGL 504
            + +S  +L+GS+  QL  L+ +   D+S N+L   +P +L     +Q L +  N F+G L
Sbjct: 571  LNLSFNKLSGSIPSQLGNLRDLEYLDVSRNSLSGPIPEELGRCTKLQLLRINNNHFSGNL 630

Query: 505  PYSISQMAPLE-------------------------YLNVSHNQLQGEVTVMFVSLTNLS 609
            P +I  +A ++                         +LN+SHNQ  G +   F S+ +LS
Sbjct: 631  PATIGNLASIQIMLDVSNNKLDGLLPQDFGRMQMLVFLNLSHNQFTGRIPTSFASMVSLS 690

Query: 610  TLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVL 729
            TLD S+N+L G +P          + +L N    G +  L
Sbjct: 691  TLDASYNNLEGPLPAGRLFQNASASWFLNNKGLCGNLSGL 730



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 46/168 (27%), Positives = 84/168 (50%), Gaps = 4/168 (2%)
 Frame = +1

Query: 349 QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNGFTGGLPYSISQ 522
           QL+ S+  +   + ++   D+++N+L   LP  +    +++ L L+ N F G +P S+  
Sbjct: 409 QLSNSLPQEFGNITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPVPRSLKT 468

Query: 523 MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN 702
              L  L +  NQL G+++  F     L  +    N L+G I   + +   +  + +  N
Sbjct: 469 CTSLVRLFLDGNQLTGDISKHFGVYPKLKKMSLMSNRLSGQISPKWGACPELAILNIAEN 528

Query: 703 VFTGTI-DVLANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWN 840
           + TGTI   L+ LP L  L + +NH  G IPP++  + +L +   S+N
Sbjct: 529 MITGTIPPALSKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFN 576



>pir|T04313|T04313 protein kinase Xa21 (EC 2.7.1.-), receptor type -
           rice>gb:OSU72724_1698502 Oryza sativa receptor
           kinase-like protein gene, family member E, complete cds.
          Length = 813

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 54/183 (29%), Positives = 97/183 (53%), Gaps = 8/183 (4%)
 Frame = +1

Query: 292 WKGVSCSGN--RVTEIQISGLQLTGSMGFQLDQLKS-VTTFDISTNNLGNSLPYQLPP-- 456
           WK ++   N   + E+++ G +  G +   +  L S + +  I  N +  SLP  +    
Sbjct: 315 WKFMTALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLV 374

Query: 457 NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL 636
           N+Q L+LA N  TG LP S S++  L  L V +N+L G + +   +LT L+ ++  FN+ 
Sbjct: 375 NLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAF 434

Query: 637 AGNIPQTFSSLTNMKNMYLQNNVFTGTIDV-LANLPL--DNLNVENNHFTGWIPPQLQGI 807
            G IP T  +LT +  + L +N F G I + + ++P   + L+V +N+  G IP ++  +
Sbjct: 435 GGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKL 494

Query: 808 NSL 816
            ++
Sbjct: 495 KNI 497



 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 55/177 (31%), Positives = 87/177 (49%), Gaps = 6/177 (3%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL---NLAGNGFTGG 501
           + +   +L GS+   +  L  +T  ++  N  G ++P  L  N+ KL   NL  N F G 
Sbjct: 403 LTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLG-NLTKLFQINLGHNNFIGQ 461

Query: 502 LPYSISQMAPL-EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM 678
           +P  I  +  L E L+VSHN L+G +      L N+       N L+G  P T      +
Sbjct: 462 IPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPSTIGECQLL 521

Query: 679 KNMYLQNNVFTGTIDV-LANLP-LDNLNVENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           ++++LQNN   G+I + L  L  LD L++  N+ +G IP  L  +  L +   S+NS
Sbjct: 522 QHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNS 578



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 68/275 (24%), Positives = 117/275 (42%), Gaps = 39/275 (14%)
 Frame = +1

Query: 109 LMGLPWAVALLIGFLLNAPPSAVADTDPTDAS----VLRGLFSSL--NSPPQLTKWTANG 270
           ++ LP  + +L    L   PS+  D    DA+     L    SSL       L  W  +G
Sbjct: 1   MISLPLLLFVLFFSALLLFPSSSDDDGGGDAAGDELALLSFKSSLLYQGGQSLASWNTSG 60

Query: 271 -GDPCGESWKGVSCSG---NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL 438
            G  C  +W GV C     +RV ++++    L G +   L  L  + T  +S N+L   +
Sbjct: 61  HGQHC--TWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKI 118

Query: 439 PYQLP--------------------------PNVQKLNLAGNGFTGGLPYSISQMAPLEY 540
           P +L                            ++  L L  N  +G +P S+ ++  L  
Sbjct: 119 PQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTD 178

Query: 541 LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI 720
           L ++ N L G +   F  L  LS L  +FN+L+G IP    +++++    + +N  +GT+
Sbjct: 179 LALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTL 238

Query: 721 --DVLANLP-LDNLNVENNHFTGWIPPQLQGINSL 816
             +  +NLP L  + +  N F G IP  +   +++
Sbjct: 239 PTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNI 273



 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 44/175 (25%), Positives = 93/175 (53%), Gaps = 7/175 (4%)
 Frame = +1

Query: 316 NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNG 489
           +R+ ++ ++   L+G +   L  L S++  +++ N L  ++P  L     +  L LA N 
Sbjct: 126 SRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENT 185

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP-QTFSS 666
            +G +P S  Q+  L +L+++ N L G +     ++++L+  +   N L+G +P   FS+
Sbjct: 186 LSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPTNAFSN 245

Query: 667 LTNMKNMYLQNNVFTGTIDV----LANLPLDNLNVENNHFTGWIPPQLQGINSLQ 819
           L +++ +Y+  N F G I       +N+ +  + +  N F+G +PP++  + +LQ
Sbjct: 246 LPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGL--NSFSGVVPPEIGRMRNLQ 298



 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 5/133 (3%)
 Frame = +1

Query: 451 PPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
           P  V KL L  +   G +  S+  ++ L  L +S N L G++      L+ L  L  +FN
Sbjct: 77  PHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQELSRLSRLQQLVLNFN 136

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTGTI-DVLANLP-LDNLNVENNHFTGWIPP---Q 795
           SL+G IP    +LT++  + L NN  +G I   L  L  L +L +  N  +G IP    Q
Sbjct: 137 SLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQ 196

Query: 796 LQGINSLQTGGNS 834
           L+ ++ L    N+
Sbjct: 197 LRRLSFLSLAFNN 209



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 29/128 (22%), Positives = 63/128 (49%), Gaps = 4/128 (3%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL---AGNGF 492
           +T++ ++   L+GS+     QL+ ++   ++ NNL  ++P  +  N+  L +     N  
Sbjct: 176 LTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIW-NISSLTIFEVISNKL 234

Query: 493 TGGLPYS-ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
           +G LP +  S +  L+ + + +NQ  G +     + +N+S      NS +G +P     +
Sbjct: 235 SGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRM 294

Query: 670 TNMKNMYL 693
            N++ + L
Sbjct: 295 RNLQRLEL 302



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFT 495
           + E      +L+G     + + + +    +  N L  S+P  L     +  L+L+GN  +
Sbjct: 497 IVEFHADSNKLSGENPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLS 556

Query: 496 GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS-LAGNIPQTFSSLT 672
           G +P S+  M  L  LN+S N   GEV    V   N S +    N+ + G IP+      
Sbjct: 557 GQIPMSLGDMPLLHSLNLSFNSFHGEVPTNGV-FANASEIYIQGNAHICGGIPELHLPTC 615

Query: 673 NMKN 684
           ++K+
Sbjct: 616 SLKS 619



>pir|T10636|T10636 hypothetical protein T13K14.100 - Arabidopsis
           thaliana>gb:ATCHRIV54_1545932 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           54.>gb:ATT13K14_1554427 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T13K14 (ESSA project).
          Length = 1143

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 49/148 (33%), Positives = 76/148 (51%), Gaps = 3/148 (2%)
 Frame = +1

Query: 280 CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL-DQLKSVTTFDISTNNLGNSLPYQLPP 456
           C  SW G+ C+G  V  + +  L LT    F L   L  +    +S N+L   LP  L  
Sbjct: 41  CPSSWNGIVCNGGNVAGVVLDNLGLTADADFSLFSNLTKLVKLSMSNNSLSGVLPNDLGS 100

Query: 457 --NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN 630
             ++Q L+L+ N F+  LP  I +   L  L++S N   GE+      L +L +LD S N
Sbjct: 101 FKSLQFLDLSDNLFSSSLPKEIGRSVSLRNLSLSGNNFSGEIPESMGGLISLQSLDMSSN 160

Query: 631 SLAGNIPQTFSSLTNMKNMYLQNNVFTG 714
           SL+G +P++ + L ++  + L +N FTG
Sbjct: 161 SLSGPLPKSLTRLNDLLYLNLSSNGFTG 188



 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 46/164 (28%), Positives = 90/164 (54%), Gaps = 3/164 (1%)
 Frame = +1

Query: 319 RVTEIQISGLQLTGSMGFQLD-QLKSVTTFDISTNNLGNSLPYQL--PPNVQKLNLAGNG 489
           R   + +S  +LTGS+  ++      +   DIS+N+L   +P  L   P +++++L  NG
Sbjct: 411 RANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEIHLQNNG 470

Query: 490 FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL 669
            TG +    S  + +  L++SHN+  G++  +F SLTNL  L+ + N+L+G++P + + +
Sbjct: 471 MTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNLSGSLPSSMNDI 530

Query: 670 TNMKNMYLQNNVFTGTIDVLANLPLDNLNVENNHFTGWIPPQLQ 801
            ++ ++ +  N FTG +    +  +   NV  N  +G +P  L+
Sbjct: 531 VSLSSLDVSQNHFTGPLPSNLSSNIMAFNVSYNDLSGTVPENLK 574



 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 53/191 (27%), Positives = 89/191 (46%), Gaps = 25/191 (13%)
 Frame = +1

Query: 322 VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP-------------------- 441
           +T + +SG  L+G +   +    ++ T D+S+N+L   LP                    
Sbjct: 322 LTTLDLSGNNLSGPVSSIMST--TLHTLDLSSNSLTGELPLLTGGCVLLDLSNNQFEGNL 379

Query: 442 --YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMF-VSLTNLST 612
             +    N++ L+L+ N FTG  P +  Q+    +LN+S+N+L G +          L  
Sbjct: 380 TRWSKWENIEYLDLSQNHFTGSFPDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRV 439

Query: 613 LDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVL--ANLPLDNLNVENNHFTGWI 786
           LD S NSL G IP    S+  ++ ++LQNN  TG I  L  +   +  L++ +N F G +
Sbjct: 440 LDISSNSLEGPIPGALLSMPTLEEIHLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDL 499

Query: 787 PPQLQGINSLQ 819
           P     + +LQ
Sbjct: 500 PGVFGSLTNLQ 510



 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 52/190 (27%), Positives = 86/190 (45%), Gaps = 28/190 (14%)
 Frame = +1

Query: 331 IQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP--NVQKLNLAGNGFTGGL 504
           + +SG   +G +   +  L S+ + D+S+N+L   LP  L    ++  LNL+ NGFTG +
Sbjct: 131 LSLSGNNFSGEIPESMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKM 190

Query: 505 PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFS-------------------- 624
           P     ++ LE L++  N + G +   F  LTN S +D S                    
Sbjct: 191 PRGFELISSLEVLDLHGNSIDGNLDGEFFLLTNASYVDISGNRLVTTSGKLLPGVSESIK 250

Query: 625 -----FNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL-PLDNLNVENNHFTGWI 786
                 N L G++   F    N+K + L  N+ +G +     +  L+ L + NN F+G +
Sbjct: 251 HLNLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGELPGFNYVYDLEVLKLSNNRFSGSL 310

Query: 787 PPQLQGINSL 816
           P  L   +SL
Sbjct: 311 PNNLLKGDSL 320



 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 2/131 (1%)
 Frame = +1

Query: 298 GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP--YQLPPNVQKL 471
           G   S   + EI +    +TG++G        +   D+S N     LP  +    N+Q L
Sbjct: 453 GALLSMPTLEEIHLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVL 512

Query: 472 NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP 651
           NLA N  +G LP S++ +  L  L+VS N   G +     S  N+   + S+N L+G +P
Sbjct: 513 NLAANNLSGSLPSSMNDIVSLSSLDVSQNHFTGPLPSNLSS--NIMAFNVSYNDLSGTVP 570

Query: 652 QTFSSLTNMKN 684
           +      N+KN
Sbjct: 571 E------NLKN 575



 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 30/89 (33%), Positives = 54/89 (60%), Gaps = 2/89 (2%)
 Frame = +1

Query: 583 MFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI--DVLANLPLDNLN 756
           +F +LT L  L  S NSL+G +P    S  +++ + L +N+F+ ++  ++  ++ L NL+
Sbjct: 73  LFSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRSVSLRNLS 132

Query: 757 VENNHFTGWIPPQLQGINSLQTGGNSWNS 843
           +  N+F+G IP  + G+ SLQ+   S NS
Sbjct: 133 LSGNNFSGEIPESMGGLISLQSLDMSSNS 161



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 19/78 (24%), Positives = 40/78 (51%)
 Frame = +1

Query: 298 GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL 477
           GV  S   +  + ++   L+GS+   ++ + S+++ D+S N+    LP  L  N+   N+
Sbjct: 501 GVFGSLTNLQVLNLAANNLSGSLPSSMNDIVSLSSLDVSQNHFTGPLPSNLSSNIMAFNV 560

Query: 478 AGNGFTGGLPYSISQMAP 531
           + N  +G +P ++    P
Sbjct: 561 SYNDLSGTVPENLKNFPP 578



>pir|C96756|C96756 receptor-like protein kinase homolog [imported] -
           Arabidopsis thaliana>gb:AE005173_894853 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536451 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.>gb:AK117384_1815422 Arabidopsis thaliana
           At1g73070 mRNA for unknown protein, complete cds, clone:
           RAFL16-96-P09.
          Length = 598

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 58/213 (27%), Positives = 93/213 (43%), Gaps = 30/213 (14%)
 Frame = +1

Query: 238 PPQLTK-WTANGGDPCGESWKGVSCSGNR-VTEIQISGLQLTGSMGFQLDQLKSVTTFDI 411
           PP+LT  W  N  +    +W G+ C  ++ VT +  +G  ++G +G ++ QLKS+   D+
Sbjct: 45  PPELTSTWKTNASEATPCNWFGIICDDSKKVTSLNFTGSGVSGQLGPEIGQLKSLEILDM 104

Query: 412 STNNLGNSLPYQLP--------------------------PNVQKLNLAGNGFTGGLPYS 513
           S+NN    +P  L                            ++  L L  N  TG LP S
Sbjct: 105 SSNNFSGIIPSSLGNCSSLVYIDLSENSFSGKVPDTLGSLKSLADLYLYSNSLTGELPKS 164

Query: 514 ISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYL 693
           + ++  L YL+V HN L G +         L  L    N   G IP++  + + ++ +YL
Sbjct: 165 LFRIPVLNYLHVEHNNLTGLIPQNVGEAKELLHLRLFDNQFTGTIPESIGNCSKLEILYL 224

Query: 694 QNNVFTGTIDVLANL--PLDNLNVENNHFTGWI 786
             N   G++    NL   L +L V NN   G +
Sbjct: 225 HKNKLVGSLPASLNLLESLTDLFVANNSLRGTV 257



 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 52/159 (32%), Positives = 86/159 (54%), Gaps = 5/159 (3%)
 Frame = +1

Query: 337 ISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA---GNGFTGGLP 507
           +SG  L+G++   L  LK++T  ++S N L  S+P +L  N   LNL     N   GG+P
Sbjct: 297 VSG-NLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELG-NCSSLNLLKLNDNQLVGGIP 354

Query: 508 YSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNM 687
            ++ ++  LE L +  N+  GE+ +    + +L+ L    N+L G +P+  + L N+K +
Sbjct: 355 SALGKLRKLESLELFENRFSGEIPIEIWKIQSLTQLLVYRNNLTGKLPEEITKLKNLKIV 414

Query: 688 YLQNNVFTGTI--DVLANLPLDNLNVENNHFTGWIPPQL 798
            L NN F G I  ++  N  L+ ++   N+FTG IP  L
Sbjct: 415 TLFNNSFYGVIPPNLGLNSNLEIIDFIGNNFTGEIPRNL 453



 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/112 (36%), Positives = 64/112 (57%), Gaps = 2/112 (1%)
 Frame = +1

Query: 460 VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA 639
           V  LN  G+G +G L   I Q+  LE L++S N   G +     + ++L  +D S NS +
Sbjct: 75  VTSLNFTGSGVSGQLGPEIGQLKSLEILDMSSNNFSGIIPSSLGNCSSLVYIDLSENSFS 134

Query: