BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7644
         (681 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|A26014|A26014 histone H3 - wheat>pir|S04520|S04520 histone H...   262   4e-69   Triticum aestivum [Canadian hard winter wheat]
gb:AY787658_1628404 Camellia sinensis histone 3 mRNA, complete cds.   261   6e-69   
pir|S04099|S04099 histone H3 (variant H3R-21) - rice>pir|S57626|...   261   8e-69   Oryza sativa Japonica Group [Japonica rice]
gb:ALFHISH3A_1818977 Alfalfa histone H3 (H3-1.1) gene, complete ...   261   1e-68   
pir|A02631|HSPM3 histone H3 - garden pea (tentative sequence)         260   1e-68   
sp|P02300|H3_PEA|H3_PEA Histone H3.>pir|S00373|S00373 histone H3 - wheat     260   1e-68   Pisum sativum [garden pea]
pir|S56707|S56707 histone H3 homolog - common tobacco                 259   3e-68   Nicotiana tabacum [American tobacco]
sp|P59226|H3_ARATH|H3_ARATH Histone H3.>sp|P05203|H3_MAIZE Histone H3.         259   3e-68   Arabidopsis thaliana [mouse-ear cress]
sp|P08903|H3_ENCAL|H3_ENCAL Histone H3.>pir|A23604|HSEAH3 histone H3 - Al...   258   7e-68   Encephalartos altensteinii
gb:AY158954_2077138 Mus musculus histone protein Hist2h3c1 gene,...   257   1e-67   
pir|A25564|A25564 histone H3 - rice>gb:OSU25664_1698417 Oryza sa...   257   1e-67   Oryza sativa Japonica Group [Japonica rice]
gb:BC074969_1989469 Homo sapiens histone 2, H3c, mRNA (cDNA clon...   257   2e-67   
pir|S18716|HSCH3 histone H3 - chicken>pir|A56580|A56580 histone ...   257   2e-67   
gb:BC069305_1987917 Homo sapiens histone 1, H3i, mRNA (cDNA clon...   256   2e-67   
pir|S10097|S10097 histone H3 - fruit fly (Drosophila melanogaste...   256   2e-67   Drosophila melanogaster
pir|I37446|HSHU3 histone H3.1 - human>pir|I49398|I49398 histone ...   256   2e-67   
gb:AF323993_1262651 Trichinella pseudospiralis histone H3.3 mRNA...   256   3e-67   
pir|T27037|T27037 hypothetical protein Y49E10.6 - Caenorhabditis...   256   3e-67   Caenorhabditis elegans [roundworm]
pir|JN0687|JN0687 histone H3 - sea squirt (Styela plicata)            256   3e-67   Styela plicata
pir|S06743|S06743 histone H3 - mouse>gb:MMHIS2A3_2115292 Mouse H...   256   3e-67   Mus musculus [mouse]
gb:AY267746_1314539 Mytilus chilensis histone H3 (H3) gene, comp...   255   4e-67   
gb:AB044538_1195711 Drosophila pseudoobscura H3 gene for histone...   255   4e-67   
gb:AB019406_1193858 Drosophila erecta gene for histone H3, compl...   255   4e-67   
pir|S24346|S24346 histon H3 protein [similarity] - Arabidopsis t...   255   4e-67   Arabidopsis thaliana [mouse-ear cress]
pir|I48092|I48092 histone H3.2 - long-tailed hamster>gb:CLH2A232...   255   4e-67   Cricetulus longicaudatus [lesser long-tailed hamster]
pir|S32638|S32638 histone H3.l - African clawed frog>gb:XLH3LHIS...   255   4e-67   Xenopus laevis [clawed frog]
pir|S01198|S01198 histone H3 - starfish (Dermasterias imbricata)...   255   4e-67   Dermasterias imbricata
sp|P08860|H32_ORYSA|H32_ORYSA Histone H3.                                       255   4e-67   Oryza sativa [red rice]
gb:ODI494848_1391108 Oikopleura dioica H3.1 gene, H4.1 gene, H1....   255   6e-67   
sp|P16105|H32_BOVIN|H32_BOVIN Histone H3 (H3.2).>sp|P02299|H3_DROME Histon...   255   6e-67   Bos taurus [bovine]
gb:CHKH3A_2569086 Chicken histone H3 gene (intronless).               254   7e-67   
gb:XLA556872_2153926 Expression vector pET3-H3 H3 gene for Xenop...   254   7e-67   
pir|A27501|HSHU33 histone H3.3 [validated] - human>pir|S61218|S6...   254   7e-67   
sp|P16106|H31_HUMAN|H31_HUMAN Histone H3.1 (H3/a) (H3/c) (H3/d) (H3/f) (H3...   254   7e-67   Homo sapiens [man]
gb:AB044539_1195712 Drosophila persimilis H3 gene for histone 3,...   254   1e-66   
pir|T16361|T16361 hypothetical protein F45E1.6 - Caenorhabditis ...   254   1e-66   Caenorhabditis elegans [roundworm]
pir|JQ0757|JQ0757 histone H3 - staghorn coral>gb:ACPH342BA_12082...   254   1e-66   Acropora formosa
gb:AF467728_1802430 Oryza sativa disease-resistent-related prote...   254   1e-66   
gb:AB003784_1192887 Drosophila simulans DNA for Histone H3, comp...   254   1e-66   
pir|I49395|I49395 histone H3.2 protein - shrew mouse>gb:MPMP323_...   254   1e-66   Mus pahari [Gairdner's shrew-mouse]
sp|Q8WSF1|H33_TRIPS|H33_TRIPS Histone H3.3.                                     254   1e-66   Trichinella pseudospiralis
gb:AY533212_2086314 Chinchilla lanigera histone H3.3B mRNA, comp...   253   2e-66   
gb:BC067493_1987393 Homo sapiens histone 1, H3i, mRNA (cDNA clon...   253   2e-66   
pir|S04241|HSKW3 histone H3 - Caenorhabditis elegans>gb:AC024696...   253   2e-66   
sp|P02298|H3_PSAMI|H3_PSAMI Histone H3, embryonic.>pir|C90776|HSUR3M hist...   253   2e-66   Psammechinus miliaris [sand sea urchin]
sp|P11105|H32_MEDSA|H32_MEDSA Histone H3.2, minor.>sp|P59169|H33_ARATH His...   253   2e-66   Medicago sativa [alfalfa]
gb:HUMHIS3PRM_2031938 Human histone H3 gene, complete cds.            253   2e-66   
gb:HSH3B_2013661 H.sapiens H3/b gene.                                 253   2e-66   
gb:BC067494_1987394 Homo sapiens histone 1, H3i, mRNA (cDNA clon...   253   2e-66   
gb:SULHISL34_1398180 Sea urchin (L.pictus) late-stage histone H3...   253   2e-66   
gb:AY028698_1288298 Trichinella spiralis histone H3 mRNA, comple...   253   2e-66   
gb:CR858345_1182526 Pongo pygmaeus mRNA; cDNA DKFZp459A2130 (fro...   253   2e-66   
pir|S50140|S50140 histone H3.3 - sea urchin (Paracentrotus livid...   253   2e-66   Paracentrotus lividus [common sea urchin]
gb:BC021768_2093619 Mus musculus H3 histone, family 3B, mRNA (cD...   253   3e-66   
gb:BC066884_1987126 Homo sapiens histone 1, H3i, mRNA (cDNA clon...   253   3e-66   
gb:AF517876_1807678 Griffithsia japonica isolate Gj410 putative ...   253   3e-66   
sp|P06351|H33_HUMAN|H33_HUMAN Histone H3.3 (H3.A) (H3.B) (H3.3Q).               253   3e-66   Homo sapiens [man]
gb:SPHISH34_1397973 Sea urchin (S. purpuratus) late embryonic H3...   252   4e-66   
gb:S64499_1396692 Styela plicata H3 histone and H4 histone genes...   252   4e-66   
gb:AY267745_1314538 Mytilus californianus histone H3 (H3) gene, ...   252   4e-66   
pir|I50244|I50244 histone 3.3A - chicken>gb:CHKH33A2_2569084 Chi...   252   4e-66   Gallus gallus [bantam]
sp|P22843|H3_ACRFO|H3_ACRFO Histone H3.                                        252   4e-66   Acropora formosa
sp|Q10453|H33_CAEEL|H33_CAEEL Histone H3.3.                                     252   4e-66   Caenorhabditis elegans [roundworm]
gb:BC045982_2549494 Danio rerio zgc:56193, mRNA (cDNA clone MGC:...   252   5e-66   
gb:BC081561_1989811 Homo sapiens H3 histone, family 3A, mRNA (cD...   252   5e-66   
gb:AY880411_1180453 Gekko japonicus GekBS180P mRNA, complete cds.     252   5e-66   
gb:AY124026_1580098 Griffithsia japonica histone H3 mRNA, comple...   251   6e-66   
pir|S57473|S57473 histone H3 - human>gb:AF531308_1906162 Homo sa...   251   8e-66   Homo sapiens [man]
sp|Q93081|H3B_HUMAN|H3B_HUMAN Histone H3/b.                                     251   8e-66   Homo sapiens [man]
gb:HSJ998N21_2016708 Human DNA sequence from clone RP5-998N21 on...   251   1e-65   
gb:AB011479_1511438 Arabidopsis thaliana genomic DNA, chromosome...   251   1e-65   
sp|P06352|H3_STRPU|H3_STRPU Histone H3, embryonic.>pir|A02629|HSUR3P hist...   250   1e-65   Strongylocentrotus purpuratus [purple urchin]
gb:PALH370A_1391544 Paracentrotus lividus H3 histone, clone Ph70.     250   2e-65   
gb:AY181030_1307636 Toxoplasma gondii histone H3 mRNA, complete ...   250   2e-65   
gb:AF361949_1265575 Eimeria tenella histone 3 (H3) mRNA, complet...   250   2e-65   
pir|S59581|S59581 histone H3 (clones CH-II and CH-III) - Chlamyd...   250   2e-65   Chlamydomonas reinhardtii
sp|P08898|H3_CAEEL|H3_CAEEL Histone H3.                                        250   2e-65   Caenorhabditis elegans [roundworm]
gb:AY378165_1603824 Cichorium intybus histone H3 protein mRNA, c...   249   3e-65   
pir|JQ1983|JQ1983 H3.3 like histone MH921 - mouse                     249   3e-65   Mus musculus [mouse]
sp|Q16695|H3T_HUMAN|H3T_HUMAN Histone H3.4 (H3t) (H3/t) (H3/g).                 249   3e-65   Homo sapiens [man]
pir|S59592|S59592 histone H3 (clone CH-I) - Chlamydomonas reinha...   249   4e-65   Chlamydomonas reinhardtii
gb:SPHIS1_1397970 Sea urchin genes for the histones H2B and H3.       248   5e-65   
sp|P08437|H3_VOLCA|H3_VOLCA Histone H3.                                        248   7e-65   Volvox carteri
gb:AY130243_1302427 Toxoplasma gondii histone H3.3 variant mRNA,...   248   9e-65   
pir|E27399|HSZP3 histone H3.1 [similarity] - fission yeast  (Sch...   248   9e-65   
gb:AF304365_1784380 Rubus idaeus histone H3 gene, partial cds.        246   2e-64   
gb:AY086702_1571746 Arabidopsis thaliana clone 268982 mRNA, comp...   246   2e-64   
gb:AY347801_1177962 Malus x domestica clone 13-2 histone 3 mRNA,...   246   3e-64   
pir|S59123|S59123 histone H3 - Chlamydomonas reinhardtii>gb:CREH...   246   3e-64   Chlamydomonas reinhardtii
sp|P02302|H32_XENLA|H32_XENLA Histone H3.2.>pir|A02634|HSXL32 histone H3.2...   246   3e-64   Xenopus laevis [clawed frog]
sp|P09988|H31_SCHPO|H31_SCHPO Histone H3.1/H3.2.                                246   3e-64   Schizosaccharomyces pombe
gb:AF517884_1807686 Griffithsia japonica isolate Gj475 histone H...   245   5e-64   
gb:MAL249812_1685567 Mortierella alpina H3.1 and H4.1 genes for ...   245   6e-64   
gb:AC011810_1537510 Arabidopsis thaliana chromosome I BAC T6J4 g...   245   6e-64   
pir|S32621|S32621 histone H3.r - African clawed frog>gb:XLH3HIS_...   245   6e-64   Xenopus laevis [clawed frog]
gb:SPHIS33_1721817 Fission yeast histone genes H3.3 and H4.3.         244   8e-64   
gb:AY181029_1307635 Plasmodium falciparum histone H3 gene, compl...   244   8e-64   
sp|P50564|H3_CHLRE|H3_CHLRE Histone H3.                                        244   1e-63   Chlamydomonas reinhardtii
gb:ODI494850_1391113 Oikopleura dioica H3.2 gene for histone h3.2.    244   1e-63   
sp|Q9U7D1|H3_MASBA|H3_MASBA Histone H3.>gb:AF140033_1244286 Phreatamoeba ...   244   1e-63   Mastigamoeba balamuthi
pir|T26178|T26178 hypothetical protein W05B10.1 - Caenorhabditis...   243   2e-63   Caenorhabditis elegans [roundworm]
pir|JQ1984|JQ1984 H3.3 like histone MH321 - mouse                     243   2e-63   Mus musculus [mouse]
sp|Q9HDN1|H3_MORAP|H3_MORAP Histone H3.                                        243   2e-63   Mortierella alpina
gb:CR382400_1375003 Plasmodium falciparum chromosome 6, complete...   243   3e-63   
sp|P10651|H33_SCHPO|H33_SCHPO Histone H3.3.                                     243   3e-63   Schizosaccharomyces pombe
pir|S41499|S41499 histone H3 - Tetrahymena thermophila>gb:TETHIS...   242   4e-63   Tetrahymena thermophila
gb:CR382133_1666750 Debaryomyces hansenii chromosome A of strain...   241   1e-62   
gb:AAQ238321_1192476 Asellus aquaticus 5S rRNA gene, histone H2B...   241   1e-62   
sp|P15511|H31_TETPY|H31_TETPY Histone H3.1.>pir|A28852|A28852 histone H3.1...   240   1e-62   Tetrahymena pyriformis
pir|S11938|S11938 histone H3 - Emericella nidulans>gb:BX649607_1...   239   2e-62   Aspergillus nidulans
gb:AY062173_1564992 Neurospora crassa histone H3 (hh3) and histo...   239   3e-62   
gb:MSU09462_1687261 Medicago sativa Regen S clone pH3c126 histon...   239   4e-62   
gb:AE017350_1759187 Cryptococcus neoformans var. neoformans JEC2...   238   6e-62   
gb:CR382138_1670773 Debaryomyces hansenii chromosome F of strain...   238   6e-62   
gb:MSHIS3C2_1687116 Medicago sativa mRNA for histone H3 clone pH...   238   7e-62   
gb:BC066906_1987144 Homo sapiens cDNA clone MGC:87082 IMAGE:5267...   238   9e-62   
gb:AF280091_1782874 Ajellomyces capsulatus histone H3 gene, comp...   238   9e-62   
gb:GMU38425_1680656 Glycine max histone H3 gene, partial cds, cl...   238   9e-62   
sp|P61832|H3_ASPFU|H3_ASPFU Histone H3.>sp|P23753|H3_EMENI Histone H3.>sp...   238   9e-62   Aspergillus fumigatus
pir|S07350|S07350 histone H3 - Neurospora crassa>gb:NCHISH3_1690...   237   1e-61   Neurospora crassa
sp|P07041|H3_NEUCR|H3_NEUCR Histone H3.>sp|P61835|H3_TRIRE Histone H3.         237   1e-61   
gb:TAU38422_1724710 Triticum aestivum histone H3 gene, partial c...   237   2e-61   
gb:GMU38424_1680655 Glycine max histone H3 gene, partial cds, cl...   236   4e-61   
gb:CR382125_1657601 Kluyveromyces lactis strain NRRL Y-1140 chro...   236   4e-61   
pir|S45265|HSBY3 histone H3 - yeast (Saccharomyces cerevisiae)>p...   236   4e-61   
sp|Q9P427|H3_AJECA|H3_AJECA Histone H3.                                        236   4e-61   Histoplasma capsulatum
gb:AE017342_1754716 Cryptococcus neoformans var. neoformans JEC2...   235   6e-61   
gb:AY125216_1301669 Gromphadorhina portentosa histone 3 gene, pa...   235   6e-61   
gb:AY125225_1301678 Grylloblatta campodeiformis histone 3 gene, ...   234   8e-61   
pir|B28852|B28852 histone H3.2 - Tetrahymena pyriformis               234   1e-60   Tetrahymena pyriformis
gb:AF520061_1807845 Candida glabrata SOK1p (SOK1) gene, partial ...   234   1e-60   
gb:TAU38423_1724711 Triticum aestivum histone H3 gene, partial c...   234   1e-60   
sp|P61833|H31_CANGA|H31_CANGA Histone H3.1.>sp|P61831|H3_KLULA Histone H3....   234   1e-60   [Candida] glabrata
gb:MSU09463_1687262 Medicago sativa Regen S clone pH3c127 histon...   233   2e-60   
gb:AY554000_1613520 Saccharomyces cerevisiae strain M5 histone H...   233   2e-60   
pir|A23981|HSDK34 histone H3.4 - muscovy duck>gb:CIIHISH3A_25697...   233   2e-60   
pir|C86332|C86332 probable histone H3 [imported] - Arabidopsis t...   233   3e-60   Arabidopsis thaliana [mouse-ear cress]
sp|P15512|H32_TETPY|H32_TETPY Histone H3.2.                                     232   4e-60   Tetrahymena pyriformis
sp|Q8NJS5|H32_CANGA|H32_CANGA Histone H3.2.                                     232   5e-60   [Candida] glabrata
gb:AY125258_1301711 Tropidoderus childrenii histone 3 gene, part...   231   7e-60   
gb:AY125239_1301692 Extatosoma tiaratum histone 3 gene, partial ...   231   7e-60   
gb:AF466825_1273585 Euplotes octocarinatus histone H3v gene, com...   231   7e-60   
pir|S41501|S41501 histone H3.3 - Tetrahymena thermophila>gb:TETH...   231   7e-60   Tetrahymena thermophila
sp|P06902|H34_CAIMO|H34_CAIMO Histone H3.4.                                     231   7e-60   Cairina moschata [muscovy]
gb:ENU12630_1676749 Emericella nidulans R153 core histone H3 (H3...   229   3e-59   
gb:AB116640_1527592 Lentinula edodes Le. fbg21 mRNA for histone ...   229   3e-59   
sp|P90543|H3_EUPCR|H3_EUPCR Histone H3.                                        229   3e-59   Moneuplotes crassus
sp|P41353|H33_TETTH|H33_TETTH Histone H3.3 (HV2).                               229   3e-59   Tetrahymena thermophila
gb:AY667159_1432272 Felis catus clone E95 H3 histone family 3A m...   228   8e-59   
gb:AY125226_1301679 Nasutitermes sp. IS06 histone 3 gene, partia...   228   8e-59   
gb:PFU14735_1395010 Plasmodium falciparum histone H3 mRNA, compl...   228   1e-58   
pir|B96786|B96786 protein F10A5.19 [imported] - Arabidopsis thal...   226   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AX972809_1488118 Sequence 3612 from Patent EP1104808.              224   1e-57   
gb:DDU76664_1377418 Dictyostelium discoideum histone H3 (DdH3) m...   224   1e-57   
gb:AY125237_1301690 Orxines macklottii histone 3 gene, partial c...   224   1e-57   
gb:ECA270221_1384167 Entodinium caudatum partial mRNA for histon...   224   1e-57   
gb:MSHIS3C3_1687117 Medicago sativa mRNA for histone H3 clone pH...   223   3e-57   
pir|S04521|S04521 histone H3 (clone pH3c-1) - alfalfa (fragment)      223   3e-57   Medicago sativa [alfalfa]
gb:AJ849511_1284696 Actinoposthia beklemischevi partial H3 gene ...   222   4e-57   
gb:AY725658_1624582 Cylindrocladium asiaticum strain CBS 114073 ...   222   5e-57   
gb:ECA270203_1384149 Entodinium caudatum partial mRNA for histon...   222   5e-57   
gb:AY125236_1301689 Oreophoetes peruana histone 3 gene, partial ...   221   7e-57   
gb:AY125260_1301713 Sungaya inexpectata histone 3 gene, partial ...   221   1e-56   
gb:AY125252_1301705 Neohirasea sp. WS29 histone 3 gene, partial ...   221   1e-56   
gb:AY125242_1301695 Aretaon asperrimus histone 3 gene, partial c...   221   1e-56   
gb:NPHISTOH3_1691072 N.pseudonarcissus mRNA for histone H3.           220   2e-56   
gb:HVU38420_1682699 Hordeum vulgare histone H3 gene, partial cds...   220   2e-56   
gb:AB195238_1203106 Paramecium caudatum macronuclear H3 mRNA for...   220   2e-56   
pir|T04411|T04411 histone H3 - barley (fragment)                      220   2e-56   Hordeum vulgare [barley]
gb:AY725691_1624615 Calonectria ilicicola strain CBS 113903 hist...   220   2e-56   
gb:AY338614_1320798 Machilis sp. AR01 histone 3 gene, partial cd...   219   3e-56   
pir|A02630|A02630 histone H3 - fruit fly (Drosophila melanogaste...   218   6e-56   Drosophila melanogaster
gb:AY725689_1624613 Calonectria ilicicola strain CBS 112223 hist...   218   8e-56   
gb:AY338631_1320814 Anthopotamus sp. Eph22 histone 3 gene, parti...   218   8e-56   
gb:AY338630_1320813 Caenis sp. Eph19 histone 3 gene, partial cds.     217   2e-55   
gb:AGHISTH3_1281990 A.gambiae H3 gene, partial.                       217   2e-55   
gb:AY725693_1624617 Calonectria ilicicola strain CPC 10450 histo...   216   2e-55   
gb:TVH3141_1401229 T.vaginalis DNA for histone H3-1 and histone ...   216   2e-55   
gb:AJ849501_1284686 Paraphanostoma macroposthium partial H3 gene...   216   2e-55   
gb:CR382132_1666023 Yarrowia lipolytica chromosome F of strain C...   216   3e-55   
gb:AF093108_1767587 Tortula ruralis histone H3 (rnp49) mRNA, par...   215   5e-55   
gb:AF466826_1273586 Euplotes octocarinatus histone H3p gene, com...   214   1e-54   
gb:AJ849510_1284695 Eumecynostomum altitudi partial H3 gene for ...   213   2e-54   
pir|T20426|T20426 hypothetical protein E03A3.3 - Caenorhabditis ...   213   2e-54   Caenorhabditis elegans [roundworm]
gb:AY125250_1301703 Gratidia hispidula histone 3 gene, partial cds.   213   2e-54   
gb:AY744849_1349168 Aetalion reticulatum histone 3 (H3) gene, pa...   211   7e-54   
gb:AY125267_1301720 Phobaeticus heusii histone 3 gene, partial cds.   211   7e-54   
gb:AF404591_1796748 Alternaria arborescens isolate CR2 histone g...   211   9e-54   
gb:AF112370_2474546 Squalus acanthias histone H3.3 mRNA, partial...   211   1e-53   
gb:PMU84116_1395492 Psammechinus miliaris cleavage stage histone...   210   2e-53   
gb:AY744850_1349169 Pectinariophyes reticulata histone 3 (H3) ge...   209   3e-53   
gb:AAN436950_1192465 Amphiporus angulatus partial H3 gene for hi...   209   3e-53   
gb:MMHIH3_2115288 Mouse gene coding for embryonic H3 histone.         209   5e-53   
gb:AF404636_1796793 Lewia infectoria isolate CR12 histone gene, ...   209   5e-53   
gb:AF314469_1785311 Fusarium cerealis strain MRC3926 histone H3 ...   209   5e-53   
gb:AY662942_2542832 Gobiocichla ethelwynnae histone H3a gene, pa...   208   6e-53   
gb:AY662901_2542792 Paretroplus menarambo histone H3a gene, part...   208   6e-53   
gb:AY539179_2536732 Aulorhynchus flavidus histone H3 gene, parti...   208   6e-53   
gb:AY655594_2542396 Oryzias latipes histone H3a gene, partial cds.    208   8e-53   
gb:AY539211_2536761 Pseudogramma thaumasium histone H3 gene, par...   208   8e-53   
gb:PSP436966_1395809 Poseidonemertes sp. 508 partial H3 gene for...   208   8e-53   
gb:NYA436959_1391010 Nemertellina yamaokai partial H3 gene for h...   208   8e-53   
gb:HDU436987_1385864 Hubrechtella dubia partial H3 gene for hist...   208   8e-53   
gb:AF110849_1242030 Euperipatoides leuckartii histone H3 (H3) ge...   208   8e-53   
gb:AY662898_2542790 Paretroplus cf. kieneri 'Amboaboa' histone H...   207   1e-52   
gb:AY655555_2542358 Rheocles derhami histone H3a gene, partial cds.   207   1e-52   
gb:TEL436968_1399991 Tetrastemma elegans partial H3 gene for his...   207   1e-52   
gb:RSA436982_1396517 Ramphogordius sanguineus partial H3 gene fo...   207   1e-52   
gb:AY744885_1349204 Ophiderma definita histone 3 (H3) gene, part...   207   1e-52   
gb:AY744858_1349177 Lepyronia quadrangularis histone 3 (H3) gene...   207   1e-52   
gb:AY520722_1332800 Poecilasma inaequilaterale histone H3 gene, ...   207   1e-52   
gb:AY078705_1296428 Lepthyphantes minutus specimen-voucher G47 h...   207   1e-52   
gb:AY070161_1294624 Corbicula fluminea histone H3 gene, partial ...   207   1e-52   
gb:AY662903_2542794 Paretroplus polyactis 'South' histone H3a ge...   207   1e-52   
gb:AY662885_2542778 Lachnolaimus maximus histone H3a gene, parti...   207   1e-52   
gb:AY662882_2542775 Pristolepis fasciata histone H3a gene, parti...   207   1e-52   
gb:AY662881_2542774 Polycentropsis abbreviata histone H3a gene, ...   207   1e-52   
gb:AY539278_2536826 Labrisomus multiporosus histone H3 gene, par...   207   1e-52   
gb:AY539262_2536810 Gramma loreto histone H3 gene, partial cds.       207   1e-52   
gb:AY539176_2536729 Chilara taylori histone H3 gene, partial cds.     207   1e-52   
gb:PSP436964_1395808 Paranemertes sp. 249 partial H3 gene for hi...   207   1e-52   
gb:NMI436973_1390901 Nectonemertes mirabilis partial H3 gene for...   207   1e-52   
gb:AY557448_1335281 Neoteuthis thielei histone H3 gene, partial ...   207   1e-52   
gb:AY662948_2542838 Oreochromis mossambicus histone H3a gene, pa...   207   2e-52   
gb:AY662927_2542818 Chaetobranchopsis orbicularis histone H3a ge...   207   2e-52   
gb:AY655587_2542390 Labidesthes sicculus histone H3a gene, parti...   207   2e-52   
gb:AY557413_1335246 Graneledone verrucosa histone H3 gene, parti...   207   2e-52   
gb:AY070142_1294605 Lepidopleurus cajetanus histone H3 gene, par...   207   2e-52   
gb:AF519316_1278874 Cleosiphon aspergillus isolate DNA100393 his...   207   2e-52   
gb:AF110870_1242051 Triops australiensis histone H3 (H3) gene, p...   207   2e-52   
sp|P02301|H34_MOUSE|H34_MOUSE Histone H3.4 (Embryonic).>pir|A02633|HSMS34 ...   207   2e-52   Mus musculus [mouse]
gb:AY662929_2542820 Cichlasoma bimaculatum histone H3a gene, par...   206   2e-52   
gb:AF404629_1796786 Lewia infectoria isolate CR30 histone gene, ...   206   2e-52   
gb:TWI436969_1401308 Tetrastemma wilsoni partial H3 gene for his...   206   2e-52   
gb:RPU436984_1396484 Riserius pugetensis partial H3 gene for his...   206   2e-52   
gb:AY070152_1294615 Limaria hians histone H3 gene, partial cds.       206   2e-52   
gb:AJ849512_1284697 Philocelis karlingi partial H3 gene for hist...   206   2e-52   
gb:AF110862_1242043 Archisotoma sp. histone H3 (H3) gene, partia...   206   2e-52   
gb:AY662910_2542801 Paratilapia polleni 'Ravelobe' histone H3a g...   206   3e-52   
gb:AY539273_2536821 Gymnodraco acuticeps histone H3 gene, partia...   206   3e-52   
gb:AY539272_2536820 Harpagifer kerguelensis histone H3 gene, par...   206   3e-52   
gb:AY539253_2536803 Careproctus melanurus histone H3 gene, parti...   206   3e-52   
gb:AY539236_2536786 Myoxocephalus polyacanthocephalus histone H3...   206   3e-52   
gb:AY539191_2536743 Pontinus longispinis histone H3 gene, partia...   206   3e-52   
gb:AY491355_1330511 Stagmomantis limbata isolate MN031 histone 3...   206   3e-52   
gb:AY491323_1330479 Blattidae sp. B02 histone 3 gene, partial cd...   206   3e-52   
gb:AY428834_1326012 Siro rubens histone H3 gene, partial cds.         206   3e-52   
gb:ALA436953_1285061 Amphiporus lactifloreus partial H3 gene for...   206   3e-52   
gb:AF416841_1269324 Anadara grandis isolate grandis97 histone 3 ...   206   3e-52   
gb:AF110859_1242040 Unixenus mjobergi histone H3 (H3) gene, part...   206   3e-52   
gb:AF110855_1242036 Cormocephalus sp. histone H3 (H3) gene, part...   206   3e-52   
gb:PCO436983_1391812 Parborlasia corrugatus partial H3 gene for ...   206   4e-52   
gb:AY744856_1349175 Clastoptera obtusa histone 3 (H3) gene, part...   206   4e-52   
gb:AY579139_1338780 Margaritifera falcata MCZ DNA100671 histone ...   206   4e-52   
gb:AY557424_1335257 Sepioteuthis lessoniana histone H3 gene, par...   206   4e-52   
gb:AY520717_1332795 Verruca stroemia histone H3 gene, partial cds.    206   4e-52   
gb:AY428832_1326010 Owenia fusiformis histone H3 gene, partial cds.   206   4e-52   
gb:AY377783_1324322 Architeuthis dux histone H3 gene, partial cd...   206   4e-52   
gb:AY377762_1324301 Prochaetoderma sp. AO-2003 histone H3 gene, ...   206   4e-52   
gb:AY377753_1324292 Plaxiphora albida histone H3 gene, partial cds.   206   4e-52   
gb:AY377736_1324275 Callochiton septemvalvis histone H3 gene, pa...   206   4e-52   
gb:AF519304_1278862 Phascolosoma granulatum isolate DNA100201 hi...   206   4e-52   
gb:AY662953_2542843 Tylochromis pulcher histone H3a gene, partia...   205   5e-52   
gb:AY662933_2542824 Pterophyllum scalare histone H3a gene, parti...   205   5e-52   
gb:AY539223_2536773 Normanichthys crockeri histone H3 gene, part...   205   5e-52   
gb:AY557451_1335284 Ommastrephes bartramii histone H3 gene, part...   205   5e-52   
gb:AY557433_1335266 Discoteuthis laciniosa histone H3 gene, part...   205   5e-52   
gb:AY557425_1335258 Chtenopteryx sicula histone H3 gene, partial...   205   5e-52   
gb:AY377737_1324276 Lepidochitona cinerea histone H3 gene, parti...   205   5e-52   
gb:AF110867_1242048 Hutchinsoniella macracantha histone H3 (H3) ...   205   5e-52   
gb:AE014134_1127604 Drosophila melanogaster chromosome 2L, compl...   205   5e-52   
gb:AY662936_2542827 Teleocichla sp. JSS-2004 histone H3a gene, p...   205   7e-52   
gb:AY662913_2542804 Ptychochromoides betsileanus histone H3a gen...   205   7e-52   
gb:AY662879_2542772 Hermosilla azurea histone H3a gene, partial ...   205   7e-52   
gb:AY655585_2542388 Atherinella panamensis histone H3a gene, par...   205   7e-52   
gb:AY539270_2536818 Bathymaster signatus histone H3 gene, partia...   205   7e-52   
gb:AY539200_2536750 Pterois volitans histone H3 gene, partial cd...   205   7e-52   
gb:AY725694_1624618 Cylindrocladium pseudonaviculatum strain CPC...   205   7e-52   
gb:AY870290_1354597 Epeorus latifolium histone H3 gene, partial ...   205   7e-52   
gb:AY557449_1335282 Octopoteuthis sicula histone H3 gene, partia...   205   7e-52   
gb:AY491371_1330527 Statilia apicalis isolate MN048 histone 3 ge...   205   7e-52   
gb:AY377767_1324306 Epimenia australis histone H3 gene, partial ...   205   7e-52   
gb:AY377747_1324286 Lepidozona mertensii histone H3 gene, partia...   205   7e-52   
gb:AF110861_1242042 Nipponentomon sp. histone H3 (H3) gene, part...   205   7e-52   
gb:AY662947_2542837 Oreochromis esculentus histone H3a gene, par...   204   9e-52   
gb:AY662926_2542817 Astronotus ocellatus histone H3a gene, parti...   204   9e-52   
gb:AY655591_2542394 Cololabis saira histone H3a gene, partial cds.    204   9e-52   
gb:AY539215_2536765 Bembras japonica histone H3 gene, partial cds.    204   9e-52   
gb:ECU65646_1384235 Euplotes crassus developmental-specific hist...   204   9e-52   
gb:AY557428_1335261 Batoteuthis skolops histone H3 gene, partial...   204   9e-52   
gb:AY377761_1324300 Cryptoplax japonica histone H3 gene, partial...   204   9e-52   
gb:AY377760_1324299 Cryptochiton stelleri histone H3 gene, parti...   204   9e-52   
gb:AY377751_1324290 Lorica volvox histone H3 gene, partial cds.       204   9e-52   
gb:AY377748_1324287 Stenoplax alata histone H3 gene, partial cds.     204   9e-52   
gb:AY231011_1311251 Rugathodes sexpunctatus histone H3A (H3A) ge...   204   9e-52   
gb:AJ849509_1284694 Mecynostomum auritum partial H3 gene for his...   204   9e-52   
gb:AF370815_1266382 Callibaetis ferrugineus histone H3 gene, par...   204   9e-52   
gb:AF110866_1242047 Atalophlebia sp. histone H3 (H3) gene, parti...   204   9e-52   
gb:AY662945_2542835 Hemichromis guttatus histone H3a gene, parti...   204   1e-51   
gb:AY662931_2542822 Dicrossus sp. JSS-2004 histone H3a gene, par...   204   1e-51   
gb:AY539239_2536789 Triglops scepticus histone H3 gene, partial ...   204   1e-51   
gb:AY539204_2536754 Synanceia verrucosa histone H3 gene, partial...   204   1e-51   
gb:PSP436975_1395810 Protopelagonemertes sp. 544 partial H3 gene...   204   1e-51   
gb:AY744853_1349172 Clastoptera proteus histone 3 (H3) gene, par...   204   1e-51   
gb:AY579141_1338782 Margaritifera falcata MCZ DNA100844 histone ...   204   1e-51   
gb:AY491354_1330510 Ima sp. MN030 histone 3 gene, partial cds.        204   1e-51   
gb:AY125269_1301722 Agathemera crassa histone 3 gene, partial cds.    204   1e-51   
gb:AF110848_1242029 Oroperipatus corrodai histone H3 (H3) gene, ...   204   1e-51   
gb:AY662921_2542812 Ptychochromis sp. 'Makira' histone H3a gene,...   204   2e-51   
gb:AY662875_2542768 Badis badis histone H3a gene, partial cds.        204   2e-51   
gb:AY539238_2536788 Taurulus bubalis histone H3 gene, partial cds.    204   2e-51   
gb:AY539227_2536777 Cottus bairdii histone H3 gene, partial cds....   204   2e-51   
gb:AY539225_2536775 Marukawichthys ambulator histone H3 gene, pa...   204   2e-51   
gb:AF314482_1785324 Gibberella zeae strain MRC4712 histone H3 ge...   204   2e-51   
gb:AY377742_1324281 Nuttallochiton mirandus histone H3 gene, par...   204   2e-51   
gb:AF110858_1242039 Epicyliosoma sp. AMcL-1999 histone H3 (H3) g...   204   2e-51   
gb:AY662895_2542788 Paretroplus kieneri 'Kinkony' histone H3a ge...   203   2e-51   
gb:AY539189_2536742 Trachyscorpia cristulata histone H3 gene, pa...   203   2e-51   
gb:AY557445_1335278 Lepidoteuthis grimaldii histone H3 gene, par...   203   2e-51   
gb:AY231014_1311254 Steatoda bipunctata histone H3A (H3A) gene, ...   203   2e-51   
gb:AJ849502_1284687 Paraphanostoma brachyposthium partial H3 gen...   203   2e-51   
gb:AF110865_1242046 Petrobiinae gen. sp. histone H3 (H3) gene, p...   203   2e-51   
gb:AY655593_2542395 Mugil cephalus histone H3a gene, partial cds.     203   3e-51   
gb:AF110876_1242057 Lychas marmoreus histone H3 (H3) gene, parti...   203   3e-51   
gb:AY662891_2542784 Etroplus suratensis histone H3a gene, partia...   202   3e-51   
gb:AY655580_2542383 Atherinomorus lacunosus histone H3a gene, pa...   202   3e-51   
gb:AY655576_2542379 Marosatherina ladigesi histone H3a gene, par...   202   3e-51   
gb:AY231020_1311260 Tidarren sisyphoides histone H3A (H3A) gene,...   202   3e-51   
gb:AF110863_1242044 Tricholepidion gretschi histone H3 (H3) gene...   202   3e-51   
gb:AF110860_1242041 Campodea tillyardi histone H3 (H3) gene, par...   202   3e-51   
gb:AF110857_1242038 Pauropodinae gen. sp. histone H3 (H3) gene, ...   202   3e-51   
gb:AY662937_2542828 Tomocichla asfraci histone H3a gene, partial...   202   4e-51   
gb:AY655584_2542387 Iso rhothophilus histone H3a gene, partial cds.   202   4e-51   
gb:AY655570_2542373 Chilatherina bleheri histone H3a gene, parti...   202   4e-51   
gb:AY725674_1624598 Cylindrocladium pacificum strain CBS 114037 ...   202   4e-51   
gb:AY744860_1349179 Liorhina sp. JRC-2004 histone 3 (H3) gene, p...   202   4e-51   
gb:AY377772_1324311 Rhabdus rectius histone H3 gene, partial cds.     202   4e-51   
gb:AK011431_1156396 Mus musculus 10 days embryo whole body cDNA,...   182   5e-51   
gb:AY070144_1294607 Rhabdus rectius histone H3 gene, partial cds.     202   6e-51   
gb:AJ849505_1284690 Paraphanostoma crassum partial H3 gene for h...   202   6e-51   
gb:AY539242_2536792 Asprocottus pulcher histone H3 gene, partial...   201   8e-51   
gb:AF314480_1785322 Gibberella zeae strain MRC1113 histone H3 ge...   201   8e-51   
gb:AY744874_1349193 Tettigarcta crinita histone 3 (H3) gene, par...   201   8e-51   
gb:AY428837_1326015 Halicryptus spinulosus histone H3 gene, part...   201   8e-51   
gb:AY383572_1324760 Hydra vulgaris H3L-like histone gene, partia...   201   8e-51   
gb:AY655582_2542385 Craterocephalus honoriae histone H3a gene, p...   201   1e-50   
gb:AF314481_1785323 Gibberella zeae strain MRC1115 histone H3 ge...   201   1e-50   
gb:FSE276797_1679270 Fucus serratus partial H3 gene for putative...   201   1e-50   
gb:AY383569_1324758 Ciona intestinalis H3L-like histone gene, pa...   201   1e-50   
gb:AF370818_1266385 Balanus balanus histone H3 gene, partial cds...   201   1e-50   
gb:AY662899_2542791 Paretroplus maculatus histone H3a gene, part...   200   2e-50   
gb:AY539184_2536737 Helicolenus dactylopterus histone H3 gene, p...   200   2e-50   
gb:AF110868_1242049 Lasionectes exleyi histone H3 (H3) gene, par...   200   2e-50   
gb:AY539222_2536772 Zaniolepis frenatus histone H3 gene, partial...   200   2e-50   
gb:AY435462_1606094 Cephalosporium gramineum strain CG1 histone ...   200   2e-50   
gb:AY084075_1296742 Squamigera latebricola histone H3 gene, part...   200   2e-50   
gb:AY539235_2536785 Microcottus sellaris histone H3 gene, partia...   199   3e-50   
gb:AY539183_2536736 Dactylopterus volitans histone H3 gene, part...   199   3e-50   
gb:AY725666_1624590 Cylindrocladium hongkongense strain CBS 1147...   199   3e-50   
gb:AY125266_1301719 Oncotophasma martini histone 3 gene, partial...   199   3e-50   
gb:AF110873_1242054 Kempina mikado histone H3 (H3) gene, partial...   199   3e-50   
gb:AF110847_1242028 Tasmanipatus barretti histone H3 (H3) gene, ...   199   3e-50   
gb:AY725661_1624585 Cylindrocladium chinense strain CBS 114827 h...   199   4e-50   
gb:AY662893_2542786 Paretroplus dambabe histone H3a gene, partia...   199   5e-50   
gb:AY383568_1948830 Homo sapiens H3L-like histone gene, partial ...   199   5e-50   
gb:AY435458_1606090 Cephalosporium maydis strain CM2A1 histone H...   199   5e-50   
gb:PEL436972_1391924 Pelagonemertes sp. 545 partial H3 gene for ...   199   5e-50   
gb:AF110850_1242031 Craterostigmus tasmanianus histone H3 (H3) g...   199   5e-50   
gb:AY662906_2542797 Paretroplus polyactis 'North' histone H3a ge...   198   6e-50   
gb:AY539259_2536807 Grammistes sexlineatus histone H3 gene, part...   198   6e-50   
gb:AY557439_1335272 Gonatus antarcticus histone H3 gene, partial...   198   6e-50   
gb:AF370816_1266383 Periplaneta americana histone H3 gene, parti...   198   6e-50   
gb:AF110874_1242055 Ammothella biunguiculata histone H3 (H3) gen...   198   6e-50   
gb:AY662935_2542826 Satanoperca leucosticta histone H3a gene, pa...   198   8e-50   
gb:AY662928_2542819 Cichla temensis histone H3a gene, partial cds.    198   8e-50   
sp|P81198|H34_STYLE|H34_STYLE Histone H3-4 (Fragment).>gb:SLH34P_1397686 S...   197   1e-49   
gb:AY539212_2536762 Peristedion gracile histone H3 gene, partial...   197   1e-49   
gb:AF281802_1782975 Cryphonectria parasitica isolate CRY_44 hist...   197   1e-49   
gb:AY435463_1606095 Nalanthamala diospyri histone H3 gene, parti...   197   1e-49   
gb:AF110853_1242034 Lithobius sydneyensis histone H3 (H3) gene, ...   197   1e-49   
gb:AY662949_2542839 Pelmatochromis nigrofasciatus histone H3a ge...   197   2e-49   
gb:AY539244_2536794 Nautichthys pribilovius histone H3 gene, par...   197   2e-49   
gb:AY725665_1624589 Calonectria kyotensis strain CBS 114552 hist...   197   2e-49   
gb:AF110869_1242050 Nebalia sp. histone H3 (H3) gene, partial cds.    197   2e-49   
gb:AY752256_1626811 Cercospora apii strain CBS 536.71 histone H3...   196   2e-49   
gb:AY383570_1429971 Oryctolagus cuniculus H3L-like histone gene,...   196   2e-49   
gb:AY557412_1335245 Benthoctopus sp. ARL-2004 histone H3 gene, p...   196   2e-49   
gb:AY744859_1349178 Cosmoscarta sp. JRC-2004 histone 3 (H3) gene...   196   3e-49   
gb:AY125240_1301693 Ctenomorphodes briareus histone 3 gene, part...   196   3e-49   
gb:AF110851_1242032 Schizoribautia sp. histone H3 (H3) gene, par...   196   3e-49   
gb:AY662938_2542829 Astatoreochromis alluaudi histone H3a gene, ...   196   4e-49   
gb:AY539261_2536809 Plectranthias kelloggi histone H3 gene, part...   196   4e-49   
gb:AY539205_2536755 Aploactisoma milesii histone H3 gene, partia...   196   4e-49   
gb:AY338635_1320818 Chaquihua sp. Eph80 histone 3 gene, partial ...   196   4e-49   
gb:AY539182_2536735 Aulostomus maculatus histone H3 gene, partia...   195   5e-49   
gb:AY339297_1600584 Pilidiella diplodiella strain STE-U 3708 his...   195   5e-49   
gb:AF110872_1242053 Branchianella sp. 3 histone H3 (H3) gene, pa...   195   5e-49   
gb:AY655595_2542397 Percopsis omiscomaycus histone H3a gene, par...   195   7e-49   
gb:AY752254_1626809 Cladosporium cladosporioides strain ATCC 666...   195   7e-49   
gb:AF110854_1242035 Allothereua maculata histone H3 (H3) gene, p...   194   9e-49   
gb:AY491328_1330484 Tenodera aridifolia isolate MN002 histone 3 ...   194   1e-48   
gb:AY539276_2536824 Parapercis ramsayi histone H3 gene, partial ...   194   2e-48   
gb:AP005696_1856228 Oryza sativa (japonica cultivar-group) genom...   193   2e-48   
gb:AY557430_1335263 Cranchia scabra histone H3 gene, partial cds.     193   2e-48   
gb:AY491376_1330532 Cliomantis sp. MN055 histone 3 gene, partial...   193   3e-48   
gb:AY539228_2536778 Cottus carolinae histone H3 gene, partial cds.    192   3e-48   
gb:AY539196_2536747 Scorpaenopsis macrochir histone H3 gene, par...   192   3e-48   
gb:AY752268_1626823 Mycosphaerella citri isolate X126 histone H3...   192   3e-48   
gb:AY231010_1311250 Robertus neglectus histone H3A (H3A) gene, p...   192   3e-48   
gb:AY744876_1349195 Pintalia alta histone 3 (H3) gene, partial cds.   192   5e-48   
gb:AY752255_1626810 Davidiella tassiana strain ATCC 66670 histon...   192   6e-48   
gb:AF519301_1278859 Phascolion strombi isolate DNA100101 histone...   191   8e-48   
gb:AY725668_1624592 Cylindrocladium indonesiae strain CBS 112823...   191   1e-47   
gb:AY338625_1320808 Polyplocia sp. Eph132 histone 3 gene, partia...   191   1e-47   
gb:AY070145_1294608 Haliotis tuberculata histone H3 gene, partia...   191   1e-47   
pir|T20427|T20427 hypothetical protein E03A3.4 - Caenorhabditis ...   191   1e-47   
gb:AY662880_2542773 Monocirrhus polyacanthus histone H3a gene, p...   190   2e-47   
gb:AF150832_1772570 Fusarium oxysporum histone H3 gene, partial ...   190   2e-47   
sp|P81200|H36_STYLE|H36_STYLE Histone H3-6 (Fragment).>gb:SLH36P_1397688 S...   190   2e-47   
sp|P81197|H33_STYLE|H33_STYLE Histone H3-3 (Fragment).>gb:SLH33P_1397685 S...   190   2e-47   
pir|E90085|E90085 Histone H3 [imported] - Guillardia theta nucle...   189   3e-47   
sp|P81195|H31_STYLE|H31_STYLE Histone H3-1 (Fragment).>gb:SLH31P_1397683 S...   189   3e-47   
gb:AY539216_2536766 Elates ransonnetii histone H3 gene, partial ...   189   5e-47   
gb:AF150870_1772608 Fusarium proliferatum strain MRC6569 histone...   189   5e-47   
sp|P81199|H35_STYLE|H35_STYLE Histone H3-5 (Fragment).>gb:SLH35P_1397687 S...   189   5e-47   
gb:AY725657_1624581 Cylindrocladium asiaticum strain CBS 112952 ...   188   7e-47   
gb:AF374064_1792762 Fusarium subglutinans strain KSU993 histone ...   188   9e-47   
gb:AY725654_1624578 Cylindrocladium asiaticum strain CBS 112705 ...   188   9e-47   
gb:AY662939_2542830 Chalinochromis popelini histone H3a gene, pa...   187   1e-46   
gb:AF185231_1248567 Idanthyrsus pennatus histone H3 (H3) gene, p...   187   1e-46   
pir|T49905|T49905 histone H3-like protein - Arabidopsis thaliana...   187   1e-46   
sp|P81202|H38_STYLE|H38_STYLE Histone H3-8 (Fragment).>gb:SLH38P_1397690 S...   187   1e-46   
gb:AY354893_1601819 Amphicarpaea bracteata th histone H3-D gene,...   187   1e-46   
gb:AY491366_1330522 Tarachina sp. MN043 histone 3 gene, partial ...   187   1e-46   
gb:AF185262_1248598 Lumbricus terrestris histone H3 (H3) gene, p...   187   1e-46   
gb:AY539229_2536779 Cottus poecilopus histone H3 gene, partial cds.   187   2e-46   
gb:AY539206_2536756 Aetapcus maculatus histone H3 gene, partial ...   187   2e-46   
gb:AF236775_1779612 Fusarium subglutinans strain MRC7875 histone...   187   2e-46   
sp|P81201|H37_STYLE|H37_STYLE Histone H3-7 (Fragment).>sp|P81196|H39_STYLE...   186   3e-46   
gb:AY583719_1339053 Phyllodoce sp. AMEBU14763 histone H3 gene, p...   186   4e-46   
gb:AF185261_1248597 Scoloplos simplex histone H3 (H3) gene, part...   186   4e-46   
gb:AF185241_1248577 Amphitritides harpa histone H3 (H3) gene, pa...   186   4e-46   
gb:AF185234_1248570 Owenia fusiformis histone H3 (H3) gene, part...   186   4e-46   
gb:BVU308402_1643189 Beta vulgaris partial H3 gene for histone H3.    185   6e-46   
gb:SLH32P_1397684 Stylonychia lemnae histone H3-2 gene, partial.      185   6e-46   
gb:AF185236_1248572 Glycera sp. AMW196835 histone H3 (H3) gene, ...   185   7e-46   
gb:AF185232_1248568 Amphiglena terebro histone H3 (H3) gene, par...   185   7e-46   
gb:AY725672_1624596 Cylindrocladium malesianum strain CBS 112752...   184   1e-45   
gb:ECU65645_1384234 Euplotes crassus developmental-specific hist...   184   1e-45   
gb:AF185256_1248592 Euclymene trinalis histone H3 (H3) gene, par...   184   1e-45   
gb:AF185246_1248582 Mesochaetopterus sp. AMW22402 histone H3 (H3...   184   1e-45   
gb:AY725697_1624621 Cylindrocladium sumatrense strain CBS 112832...   184   2e-45   
gb:AY539252_2536802 Cyclopterus lumpus histone H3 gene, partial ...   183   2e-45   
gb:AY725656_1624580 Cylindrocladium asiaticum strain CBS 112938 ...   183   3e-45   
gb:AY491377_1330533 Gyromantis occidentalis isolate MN056 histon...   182   4e-45   
gb:AF374048_1792746 Fusarium subglutinans strain M3869 histone H...   182   5e-45   
gb:AY491372_1330528 Statilia apicalis isolate MN050 histone 3 ge...   182   5e-45   
gb:AY491347_1330503 Stagmomantis carolina isolate MN023 histone ...   182   5e-45   
gb:AY070162_1294625 Sphaerium striatinum histone H3 gene, partia...   182   5e-45   
gb:AY539210_2536760 Lepidotrigla spinosa histone H3 gene, partia...   181   8e-45   
gb:AY725696_1624620 Cylindrocladium sumatrense strain CBS 112829...   181   8e-45   
gb:AY354901_1601827 Amphicarpaea bracteata fh histone H3-D gene,...   181   8e-45   
gb:AY539237_2536787 Radulinus asprellus histone H3 gene, partial...   181   1e-44   
gb:AF409101_1797014 Ophiostoma novo-ulmi subsp. americanum histo...   181   1e-44   
gb:AF342700_1264085 Amphicteis dalmatica histone H3 gene, partia...   181   1e-44   
gb:AY377759_1324298 Acanthochitona crinita histone H3 gene, part...   180   2e-44   
gb:AF342702_1264087 Amaeana trilobata histone H3 gene, partial cds.   180   2e-44   
gb:AF185257_1248593 Mediomastus australiensis histone H3 (H3) ge...   180   2e-44   
gb:AF374055_1792753 Fusarium subglutinans strain Fst26 histone H...   179   3e-44   
gb:PPE436963_1395567 Paranemertes peregrina partial H3 gene for ...   179   3e-44   
gb:AY539194_2536745 Scorpaena plumieri histone H3 gene, partial ...   179   4e-44   
gb:AP005696_1856225 Oryza sativa (japonica cultivar-group) genom...   179   4e-44   
gb:AY725660_1624584 Cylindrocladium chinense strain CBS 112744 h...   179   4e-44   
gb:AY354895_1601821 Amphicarpaea bracteata dhr histone H3-D gene...   179   4e-44   
gb:AY557426_1335259 Architeuthis dux histone H3 gene, partial cds.    179   4e-44   
gb:AY491358_1330514 Heterochaetula sp. MN034 histone 3 gene, par...   179   4e-44   
gb:AB098793_1410162 Bos taurus mRNA for similar to H3 histone, f...   178   7e-44   
gb:AY557406_1335240 Stauroteuthis syrtensis histone H3 gene, par...   177   1e-43   
gb:AY725699_1624623 Cylindrocladiella lageniformis strain CPC 56...   177   2e-43   
gb:AY354896_1601822 Amphicarpaea bracteata cvs histone H3-D gene...   176   3e-43   
gb:AL512343_1928412 Human DNA sequence from clone RP11-396C23 on...   176   3e-43   
gb:AY231015_1311255 Styposis selis histone H3A (H3A) gene, parti...   176   4e-43   
gb:AY491345_1330501 Calofulcinia australis isolate MN021 histone...   175   6e-43   
gb:AF185258_1248594 Notomastus torquatus histone H3 (H3) gene, p...   173   3e-42   
gb:PFL306232_2577907 Platichthys flesus partial mRNA for histone...   172   4e-42   
gb:AF342703_1264088 Lysilla pacifica histone H3 gene, partial cds.    172   4e-42   
gb:AF033675_1234666 Aplysia cf. juliana histone H3 gene, partial...   171   1e-41   
gb:DVU82932_1384016 Drosophila virilis histone H3 (H3) gene, par...   171   1e-41   
gb:AY725700_1624624 Cylindrocladiella peruviana strain CPC 5614 ...   170   2e-41   
gb:AB099028_1410351 Bos taurus mRNA for similar to H3 histone, f...   170   2e-41   
gb:AY070143_1294606 Acanthochitona crinita histone H3 gene, part...   170   2e-41   
gb:AJ849503_1284688 Childiid sp. YIT-2004 partial H3 gene for hi...   170   2e-41   
gb:AF033694_1234685 Ischnochiton australis histone H3 gene, part...   170   2e-41   
gb:AY662923_2542814 Acarichthys heckelii histone H3a gene, parti...   169   3e-41   
gb:AF033676_1234667 Austrocochlea porcata histone H3 gene, parti...   169   3e-41   
gb:AF033706_1234697 Onchidium sp. histone H3 gene, partial cds.>...   169   4e-41   
gb:AF033699_1234690 Notocrater houbricki histone H3 gene, partia...   169   4e-41   
gb:AF033695_1234686 Lepetodrillus fucensis histone H3 gene, part...   169   4e-41   
gb:AF033701_1234692 Nerita atramentosa histone H3 gene, partial ...   169   5e-41   
gb:AE017341_1753893 Cryptococcus neoformans var. neoformans JEC2...   168   7e-41   


>pir|A26014|A26014 histone H3 - wheat>pir|S04520|S04520 histone H3
           (clone pH3c-1) - alfalfa>gb:MSHIS311_1687114 Medicago
           sativa H3 histone gene ALH3-1.1.>gb:MSHIS3C1_1687115
           Medicago sativa mRNA for histone H3 clone
           pH3c-1.>gb:MSU09459_1687258 Medicago sativa cultivar
           Chief histone H3.1 gene, 5' region and complete
           cds.>gb:TAHI02_1724566 Wheat histone H3
           gene.>gb:AF026803_1762212 Onobrychis viciifolia histone
           H3 mRNA, complete cds.
          Length = 136

 Score =  262 bits (670), Expect = 4e-69
 Identities = 135/136 (99%), Positives = 136/136 (100%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AY787658_1628404 Camellia sinensis histone 3 mRNA, complete cds.
          Length = 136

 Score =  261 bits (668), Expect = 6e-69
 Identities = 134/136 (98%), Positives = 136/136 (100%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAE+YLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAESYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKDMQLARRIRGERA
Sbjct: 121 MPKDMQLARRIRGERA 136



>pir|S04099|S04099 histone H3 (variant H3R-21) -
           rice>pir|S57626|S57626 histone H3 -
           maize>pir|S06250|S06250 histone H3 [similarity] -
           Arabidopsis thaliana>gb:AE005172_889926 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AB011479_1511439 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MNA5.>gb:AB024028_1515726 Arabidopsis thaliana
           genomic DNA, chromosome 3, TAC
           clone:K1G2.>gb:AB026295_1516917 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6,
           clone:P0681F10.>gb:AB026295_1516918 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6,
           clone:P0681F10.>gb:AB032544_1518716 Nicotiana tabacum
           B34 mRNA for H3 histone, complete
           cds.>gb:ATF12B17_1548334 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F12B17 (ESSA
           project).>gb:ATF12B17_1548335 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F12B17 (ESSA
           project).>gb:ATHH3GA_1553221 A.thaliana histone H3 gene,
           complete cds.>gb:ATHH3GB_1553222 A.thaliana histone H3
           gene, complete cds.>gb:ATHHISH3A_1553227 Arabidopsis
           thaliana histone H3 gene, complete
           cds.>gb:AY037250_1560144 Arabidopsis thaliana
           AT3g27360/K1G2_6 mRNA, complete cds.>gb:AY039904_1560418
           Arabidopsis thaliana AT5g65360/MNA5_9 mRNA, complete
           cds.>gb:AY077654_1567856 Arabidopsis thaliana
           AT3g27360/K1G2_6 mRNA, complete cds.>gb:AY081741_1569001
           Arabidopsis thaliana AT5g65360/MNA5_9 mRNA, complete
           cds.>gb:AY084316_1569408 Arabidopsis thaliana clone
           10388 mRNA, complete sequence.>gb:BNU54827_1633691
           Brassica napus histone H3 homolog mRNA, complete
           cds.>gb:BT003051_1636633 Arabidopsis thaliana At5g10400
           gene, complete cds.>gb:BT003162_1636743 Arabidopsis
           thaliana At1g09200 mRNA, complete
           cds.>gb:BT005805_1638727 Arabidopsis thaliana clone
           RAFL14-90-M08 (R20110) putative histone H3 (At5g10390)
           mRNA, complete cds.>gb:BT006068_1638962 Arabidopsis
           thaliana clone U20110 putative histone H3 (At5g10390)
           mRNA, complete cds.>gb:MZEH3A_1687923 Corn histone H3
           (H3C3) gene, complete cds.>gb:MZEH3C2_1687924 Maize (Zea
           mays) histone H3 gene (H3C2), complete
           cds.>gb:MZEH3C4_1687925 Maize (Zea mays) histone H3 gene
           (H3C4), complete cds.>gb:MZEHISH3A_1687929 Zea mays
           histone H3 gene, complete cds.>gb:OSHIS311_1693031 Oryza
           sativa H3 histone gene H3R-11.>gb:OSHIS321_1693032 Oryza
           sativa H3 histone H3R-21 clone
           RH3-2.>gb:OSJN00062_1694167 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0108J11, complete
           sequence.>gb:OSU77296_1698514 Oryza sativa histone 3
           mRNA, complete cds.>gb:PUMHISH3A_1702870 P.crispum
           histone H3 (PcH3-7) gene, complete
           cds.>gb:PUMHISH3B_1702871 P.crispum histone H3 (PcH3-20)
           gene, complete cds.>gb:PUMHISH3C_1702872 P.crispum
           histone H3 (PcH3-16) gene, complete
           cds.>gb:T12M4_1723379 Arabidopsis thaliana chromosome 1
           BAC T12M4 sequence, complete
           sequence.>gb:ZMHIS3DNA_1731881 Z.mays histone H3
           gene.>gb:AC134930_1741935 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0042J17,
           complete sequence.>gb:AF239930_1779966 Euphorbia esula
           histone H3 mRNA, complete cds.>gb:AF370577_1792360
           Arabidopsis thaliana histone H3 (MNA5.8) mRNA, complete
           cds.>gb:AF532170_1809417 Orobanche cumana histone H3
           mRNA, complete cds.>gb:AK117157_1815204 Arabidopsis
           thaliana At5g65360 mRNA for putative histone H3
           (sp|P05203), complete cds, clone:
           RAFL16-69-P16.>gb:AOHISTH3_1819651 A.officinalis mRNA
           for Histone H3.>gb:AP003270_1826869 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0505D12.>gb:AP005828_1858613 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0702F05.>gb:AP005828_1858618 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0702F05.>gb:AP005828_1858619 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0702F05.
          Length = 136

 Score =  261 bits (667), Expect = 8e-69
 Identities = 134/136 (98%), Positives = 136/136 (100%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:ALFHISH3A_1818977 Alfalfa histone H3 (H3-1.1) gene, complete
           cds.
          Length = 136

 Score =  261 bits (666), Expect = 1e-68
 Identities = 134/136 (98%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSS VSALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSVVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|A02631|HSPM3 histone H3 - garden pea (tentative sequence)
          Length = 135

 Score =  260 bits (665), Expect = 1e-68
 Identities = 134/135 (99%), Positives = 135/135 (100%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>sp|P02300|H3_PEA Histone H3.>pir|S00373|S00373 histone H3 - wheat
          Length = 135

 Score =  260 bits (665), Expect = 1e-68
 Identities = 134/135 (99%), Positives = 135/135 (100%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>pir|S56707|S56707 histone H3 homolog - common tobacco
          Length = 136

 Score =  259 bits (662), Expect = 3e-68
 Identities = 133/136 (97%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QL RRIRGERA
Sbjct: 121 MPKDIQLPRRIRGERA 136



>sp|P59226|H3_ARATH Histone H3.>sp|P05203|H3_MAIZE Histone H3.
          Length = 135

 Score =  259 bits (662), Expect = 3e-68
 Identities = 133/135 (98%), Positives = 135/135 (100%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>sp|P08903|H3_ENCAL Histone H3.>pir|A23604|HSEAH3 histone H3 -
           Altenstein's bread tree
          Length = 135

 Score =  258 bits (659), Expect = 7e-68
 Identities = 132/135 (97%), Positives = 135/135 (100%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:AY158954_2077138 Mus musculus histone protein Hist2h3c1 gene,
           complete cds.
          Length = 181

 Score =  257 bits (657), Expect = 1e-67
 Identities = 132/140 (94%), Positives = 137/140 (97%)
 Frame = +3

Query: 72  AVGEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQ 251
           +V  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQ
Sbjct: 42  SVFAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ 101

Query: 252 KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK 431
           KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct: 102 KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK 161

Query: 432 RVTIMPKDMQLARRIRGERA 491
           RVTIMPKD+QLARRIRGERA
Sbjct: 162 RVTIMPKDIQLARRIRGERA 181



>pir|A25564|A25564 histone H3 - rice>gb:OSU25664_1698417 Oryza
           sativa histone H3 gene, complete cds.>gb:RICHIS3_1703629
           Rice histone 3 gene, complete cds.
          Length = 136

 Score =  257 bits (657), Expect = 1e-67
 Identities = 132/136 (97%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQ+SAV ALQEAAE YLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQTSAVRALQEAAERYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:BC074969_1989469 Homo sapiens histone 2, H3c, mRNA (cDNA clone
           IMAGE:30915509), partial cds.
          Length = 145

 Score =  257 bits (656), Expect = 2e-67
 Identities = 131/136 (96%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 10  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 69

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 70  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 129

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 130 MPKDIQLARRIRGERA 145



>pir|S18716|HSCH3 histone H3 - chicken>pir|A56580|A56580 histone H3
           - midge (Chironomus thummi thummi)>pir|S09655|S09655
           histone H3 - fruit fly (Drosophila
           hydei)>pir|A56618|A56618 histone H3 - spoonworm (Urechis
           caupo)>pir|A56654|A56654 histone H3 - Tigriopus
           californicus>pir|I49397|I49397 histone H3.2 protein -
           shrew mouse>pir|S11315|S11315 histone H3 - polychaete
           (Platynereis dumerilii)>pir|I51448|I51448 histone H3 -
           African clawed frog>pir|I50460|I50460 H3 histone -
           muscovy duck>pir|JH0304|JH0304 histone H3.2 -
           mouse>gb:AE014134_1130045 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AK010121_1155549
           Mus musculus adult male tongue cDNA, RIKEN full-length
           enriched library, clone:2310069A13 product:HISTONE H3-VI
           homolog [Gallus gallus], full insert
           sequence.>gb:AK020421_1160421 Mus musculus 12 days
           embryo embryonic body between diaphragm region and neck
           cDNA, RIKEN full-length enriched library,
           clone:9430017D03 product:HISTONE H3-VI homolog [Gallus
           gallus], full insert sequence.>gb:AB019400_1193852
           Drosophila melanogaster gene for histone H3, complete
           cds.>gb:AB019401_1193853 Drosophila simulans gene for
           histone H3, complete cds.>gb:AB019402_1193854 Drosophila
           sechellia gene for histone H3, complete
           cds.>gb:AB019403_1193855 Drosophila mauritiana gene for
           histone H3, complete cds.>gb:AB019404_1193856 Drosophila
           teissieri gene for histone H3, complete
           cds.>gb:AB019405_1193857 Drosophila yakuba gene for
           histone H3, complete cds.>gb:AB019407_1193859 Drosophila
           orena gene for histone H3, complete
           cds.>gb:AB044540_1195713 Drosophila takahashii H3 gene
           for histone 3, complete cds.>gb:AB044541_1195714
           Drosophila ficusphila H3 gene for histone 3, complete
           cds.>gb:AB044542_1195715 Drosophila immigrans H3 gene
           for histone 3, complete cds.>gb:AB044543_1195716
           Drosophila lutescens H3 gene for histone 3, complete
           cds.>gb:AB044544_1195717 Drosophila americana H3 gene
           for histone 3, complete cds.>gb:AE003670_1220152
           Drosophila melanogaster chromosome 2L, section 79 of 83
           of the complete sequence.>gb:AF378198_1266763
           Rhynchosciara americana histone H1 (rah1), histone H3
           (rah3), histone H4 (rah4), histone H2A (rah2a), and
           histone H2B (rah2b) genes, complete
           cds.>gb:AY064472_1293728 Aplysia californica histone H3
           (His.H3) gene, complete cds.>gb:AY267739_1314531 Mytilus
           galloprovincialis histone H4 (H4), histone H2B (H2B),
           histone H2A (H2A), histone H3 (H3), and histone H1 (H1)
           genes, complete cds; and 5S ribosomal RNA and 5S
           ribosomal RNA genes, complete
           sequence.>gb:AY267747_1314540 Mytilus trossulus histone
           H3 (H3) gene, complete cds.>gb:AY267748_1314541 Mytilus
           galloprovincialis histone H3 (H3) gene, complete
           cds.>gb:AY267749_1314542 Mytilus edulis histone H3 (H3)
           gene, complete cds.>gb:CTHIS_1375869 C.thummi genes for
           histones H1, H2A, H3 and H4.>gb:CTHIST_1375870
           Chironomus thummi histone H1, H2A, H2B, H3, H4 genes
           with TFB1 insertion (foldback transposable
           element).>gb:CVHIST1_1376005 Chaetopterus variopedatus
           histone H1, histone H2B, histone H3, histone H4 and
           histone H2A genes, complete cds.>gb:DHHIST_1377658 D.
           HYDEI HISTONE GENES.>gb:DHHISTON_1377663 Drosophila
           hydei histone DNA repeat unit with genes for histones
           H1, H3, H4, H2A and H2B.>gb:MED492923_1389577 Mytilus
           edulis h4 gene, h2B gene, h2A gene and h3 gene, cluster
           UW06.>gb:MED492924_1389581 Mytilus edulis h4 gene, h2B
           gene, h2A gene and h3 gene, cluster
           UW15.>gb:MED492925_1389583 Mytilus edulis h4 gene for
           histone H4 and h3 gene for histone H3, cluster
           UW27.>gb:PDHISTCL_1391872 P.dumerilii histone gene
           cluster for core histones H2A, H2B, H3 and
           H4.>gb:TCH3H4_1399686 Tigriopus californicus DNA for
           histone H3 and histone H4.>gb:TIGH1234A_1400300
           Tigriopus californicus histone H1 gene, complete cds;
           histone H3 gene, complete cds; histone H4 gene, complete
           cds; histone H2B-1 gene, complete cds; and histone H2A
           gene, complete cds.>gb:UCHISTO_1407305 U.caupo gene for
           H2A, H2B, H3, and H4 histones.>gb:AF531307_1906161 Homo
           sapiens histone H3 (HIST2H3C) gene, complete
           cds.>gb:AL591493_1930086 Human DNA sequence from clone
           RP11-196G18 on chromosome 1 Contains a
           ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog,
           yeast) (UBE2D1) pseudogene, the FCGR1A gene for Fc
           fragment of IgG, high affinity Ia, receptor for (CD64),
           a novel gene similar to histone 2, H2be (HIST2H2BE), a
           novel gene similar to histone 2, H3c (HIST2H3C), the
           HIST2H4 gene for histone 2, H4, the HIST2H3C gene for
           histone 2, H3c, the HIST2H2AA gene for histone 2, H2aa,
           a histone 2, H2bd pseudogene (HIST2H2BD), a histone 2,
           H2bc pseudogene (HIST2H2BC), a novel gene similar to
           histone 2, H2aa (HIST2H2AA), a novel gene similar to
           histone 2, H3c (HIST2H3C), a novel gene similar to
           histone 1, H4 (HIST2H4), the HIST2H2BE gene for histone
           2, H2be, the HIST2H2AC gene for histone 2, H2ac, the
           HIST2H2AB gene for histone 2, H2ab, a novel protein
           similar to histone 2, a novel gene, the SV2A gene for
           synaptic vesicle glycoprotein 2A, the 3' end of the
           SF3B4 gene for splicing factor 3b, subunit 4, 49kDa and
           five CpG islands, complete sequence.>gb:AL591493_1930088
           Human DNA sequence from clone RP11-196G18 on chromosome
           1 Contains a ubiquitin-conjugating enzyme E2D 1 (UBC4/5
           homolog, yeast) (UBE2D1) pseudogene, the FCGR1A gene for
           Fc fragment of IgG, high affinity Ia, receptor for
           (CD64), a novel gene similar to histone 2, H2be
           (HIST2H2BE), a novel gene similar to histone 2, H3c
           (HIST2H3C), the HIST2H4 gene for histone 2, H4, the
           HIST2H3C gene for histone 2, H3c, the HIST2H2AA gene for
           histone 2, H2aa, a histone 2, H2bd pseudogene
           (HIST2H2BD), a histone 2, H2bc pseudogene (HIST2H2BC), a
           novel gene similar to histone 2, H2aa (HIST2H2AA), a
           novel gene similar to histone 2, H3c (HIST2H3C), a novel
           gene similar to histone 1, H4 (HIST2H4), the HIST2H2BE
           gene for histone 2, H2be, the HIST2H2AC gene for histone
           2, H2ac, the HIST2H2AB gene for histone 2, H2ab, a novel
           protein similar to histone 2, a novel gene, the SV2A
           gene for synaptic vesicle glycoprotein 2A, the 3' end of
           the SF3B4 gene for splicing factor 3b, subunit 4, 49kDa
           and five CpG islands, complete
           sequence.>gb:AL591493_1930093 Human DNA sequence from
           clone RP11-196G18 on chromosome 1 Contains a
           ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog,
           yeast) (UBE2D1) pseudogene, the FCGR1A gene for Fc
           fragment of IgG, high affinity Ia, receptor for (CD64),
           a novel gene similar to histone 2, H2be (HIST2H2BE), a
           novel gene similar to histone 2, H3c (HIST2H3C), the
           HIST2H4 gene for histone 2, H4, the HIST2H3C gene for
           histone 2, H3c, the HIST2H2AA gene for histone 2, H2aa,
           a histone 2, H2bd pseudogene (HIST2H2BD), a histone 2,
           H2bc pseudogene (HIST2H2BC), a novel gene similar to
           histone 2, H2aa (HIST2H2AA), a novel gene similar to
           histone 2, H3c (HIST2H3C), a novel gene similar to
           histone 1, H4 (HIST2H4), the HIST2H2BE gene for histone
           2, H2be, the HIST2H2AC gene for histone 2, H2ac, the
           HIST2H2AB gene for histone 2, H2ab, a novel protein
           similar to histone 2, a novel gene, the SV2A gene for
           synaptic vesicle glycoprotein 2A, the 3' end of the
           SF3B4 gene for splicing factor 3b, subunit 4, 49kDa and
           five CpG islands, complete sequence.>gb:AY648851_1958225
           Homo sapiens histone H3/o gene, complete
           cds.>gb:BC015544_1975165 Homo sapiens, histone gene
           complex 1, clone MGC:9629 IMAGE:3913365, mRNA, complete
           cds.>gb:AL590388_2070431 Mouse DNA sequence from clone
           RP23-480B19 on chromosome 13 Contains the Slc17a1 gene
           for solute carrier family 17 (vesicular glutamate
           transporter) member 1, two genes for novel solute
           carrier family 17 (Slc17) members, two novel genes, the
           gene for a novel C3HC4 type zinc finger (ring finger)
           protein, the gene for an H2a, an H2b, two genes for H3
           and two genes for H4 histone family members, a H2a
           histone family pseudogene, the H1f1 and H1f2 genes for
           H1 histone family members 1 and 2, the H3f2 gene for H3
           histone family, member 2 (H3.2), a novel pseudogene, the
           Hfe gene for hemochromatosis protein (Mr2) and two CpG
           islands, complete sequence.>gb:AL590388_2070435 Mouse
           DNA sequence from clone RP23-480B19 on chromosome 13
           Contains the Slc17a1 gene for solute carrier family 17
           (vesicular glutamate transporter) member 1, two genes
           for novel solute carrier family 17 (Slc17) members, two
           novel genes, the gene for a novel C3HC4 type zinc finger
           (ring finger) protein, the gene for an H2a, an H2b, two
           genes for H3 and two genes for H4 histone family
           members, a H2a histone family pseudogene, the H1f1 and
           H1f2 genes for H1 histone family members 1 and 2, the
           H3f2 gene for H3 histone family, member 2 (H3.2), a
           novel pseudogene, the Hfe gene for hemochromatosis
           protein (Mr2) and two CpG islands, complete
           sequence.>gb:AL592149_2070668 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AL592149_2070671 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AL592149_2070676 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AY158941_2077125 Mus musculus histone
           protein Hist2h2bb gene, complete
           cds.>gb:AY158947_2077131 Mus musculus histone protein
           Hist1h3f gene, complete cds.>gb:AY158948_2077132 Mus
           musculus histone protein Hist1h3e gene, complete
           cds.>gb:AY158949_2077133 Mus musculus histone protein
           Hist1h3d gene, complete cds.>gb:AY158950_2077134 Mus
           musculus histone protein Hist1h3c gene, complete
           cds.>gb:AY158951_2077135 Mus musculus histone protein
           Hist1h3b gene, complete cds.>gb:AY158955_2077139 Mus
           musculus histone protein Hist2h3b gene, complete
           cds.>gb:BC015270_2092113 Mus musculus histone 2, H3c2,
           mRNA (cDNA clone MGC:18559 IMAGE:4240748), complete
           cds.>gb:MMH2B143_2115126 M.musculus genes H2b-143,
           H3-143.>gb:MMHISH32_2115301 Mouse gene (H3.2) for
           histone H3.>gb:MMU62669_2122818 Mus musculus histone
           H3.2-F (H3-F), histone H2a.1-F (H2a-F), histone H2b-F
           (H2b-F) genes, complete cds.>gb:MMU62671_2122822 Mus
           musculus histone H3.2-B (H3-B) gene, complete
           cds.>gb:MMU62674_2122829 Mus musculus histone H2a.2-615
           (H2a-615), and histone H3.2-615 (H3-615) genes, complete
           cds.>gb:MMU62675_2122830 Mus musculus histone H3.2-616
           (H3-616), and histone H2b-616 (H2b-616) genes, complete
           cds.>gb:MPMPH312_2124703 M.pahari mpH312
           gene.>gb:MUSH2AX1X_2126123 Mouse histone H3.2 gene,
           complete cds.>gb:MUSHIS3A_2126200 Mouse histone H3
           (H3.2-221) gene, complete cds.>gb:MUSHIS3C_2126202 Mouse
           histone H3 (H3.2-614) gene, complete
           cds.>gb:CHKH3AA_2569087 Chicken histone H3 gene,
           complete cds.>gb:CMHIST34_2569888 Duck H3 and H4 histone
           genes.>gb:CMHIST34_2569889 Duck H3 and H4 histone
           genes.>gb:GGHIS1_2573190 Chicken duplicated genes for
           histone H2A, H4 and a histone H3
           gene.>gb:GGHISH3IV_2573195 G.gallus gene for histone
           H3-IV.>gb:GGHISH3V_2573196 G.gallus gene for histone
           H3-V.>gb:GGU37577_2573629 Gallus gallus histone H3-VI
           gene, complete cds.>gb:GGU37578_2573630 Gallus gallus
           histone H3-VII gene, complete cds.>gb:GGU37579_2573631
           Gallus gallus histone H3-VIII gene, complete
           cds.>gb:SGHIS2A3_2579890 Rainbow trout histone H2A and
           H3 genes.>gb:XELHX1H1_2581919 X.laevis histone H1B, H2A,
           H2B, and H4 genes, complete cds, and histone H3 gene, 3'
           end, gene cluster Xlhl.>gb:XELHX1H3_2581924 X.laevis
           histone H1B, H2A, H2B, and H4 genes, complete cds, and
           histone H3 gene, 3' end, gene cluster
           X1h3.>gb:XLHISH1_2582865 Xenopus laevis histone gene
           cluster Xlh1 with genes H3, H4, H2B, H2A and
           H1B.>gb:XLHISH3A_2582870 Xenopus laevis histone gene
           cluster XlH3-A with genes H1A, H2B, H3 and
           H4.>gb:XLHISH3G_2582872 Xenopus laevis gene for histone
           H3 (clone XLHW23).
          Length = 136

 Score =  257 bits (656), Expect = 2e-67
 Identities = 131/136 (96%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:BC069305_1987917 Homo sapiens histone 1, H3i, mRNA (cDNA clone
           IMAGE:7262745), partial cds.
          Length = 138

 Score =  256 bits (655), Expect = 2e-67
 Identities = 131/136 (96%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 3   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 62

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 63  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI 122

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 123 MPKDIQLARRIRGERA 138



>pir|S10097|S10097 histone H3 - fruit fly (Drosophila
           melanogaster)>gb:DMHISTL_1379598 Drosophila histone gene
           cluster, L form of repeating unit (5 kB).
          Length = 136

 Score =  256 bits (655), Expect = 2e-67
 Identities = 130/136 (95%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR+TI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRITI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|I37446|HSHU3 histone H3.1 - human>pir|I49398|I49398 histone
           H3.1 protein - shrew mouse>pir|I57019|I57019 H3 histone
           - rat>pir|S06755|S06755 histone H3.1 -
           mouse>gb:AK006742_1153699 Mus musculus adult male testis
           cDNA, RIKEN full-length enriched library,
           clone:1700049H14 product:H3 HISTONE homolog [Rattus
           norvegicus], full insert sequence.>gb:AK018952_1159841
           Mus musculus adult male testis cDNA, RIKEN full-length
           enriched library, clone:1700111A06 product:H3 HISTONE
           homolog [Rattus norvegicus], full insert
           sequence.>gb:AF531274_1906130 Homo sapiens histone H3
           (HIST1H3A) gene, complete cds.>gb:AF531275_1906131 Homo
           sapiens histone H3 (HIST1H3B) gene, complete
           cds.>gb:AF531276_1906132 Homo sapiens histone H3
           (HIST1H3C) gene, complete cds.>gb:AF531277_1906133 Homo
           sapiens histone H3 (HIST1H3D) gene, complete
           cds.>gb:AF531278_1906134 Homo sapiens histone H3
           (HIST1H3E) gene, complete cds.>gb:AF531279_1906135 Homo
           sapiens histone H3 (HIST1H3F) gene, complete
           cds.>gb:AF531280_1906136 Homo sapiens histone H3
           (HIST1H3G) gene, complete cds.>gb:AF531281_1906137 Homo
           sapiens histone H3 (HIST1H3H) gene, complete
           cds.>gb:AF531282_1906138 Homo sapiens histone H3
           (HIST1H3I) gene, complete cds.>gb:AF531283_1906139 Homo
           sapiens histone H3 (HIST1H3J) gene, complete
           cds.>gb:BC007518_1970782 Homo sapiens histone 1, H3h,
           mRNA (cDNA clone MGC:4577 IMAGE:3030790), complete
           cds.>gb:BC012185_1973507 Homo sapiens histone 1, H3g,
           mRNA (cDNA clone MGC:20474 IMAGE:4563941), complete
           cds.>gb:BC031333_1980130 Homo sapiens histone 1, H3d,
           mRNA (cDNA clone MGC:45668 IMAGE:3608479), complete
           cds.>gb:BC033095_1980796 Homo sapiens histone 1, H3d,
           mRNA (cDNA clone MGC:45669 IMAGE:5440523), complete
           cds.>gb:BC052981_1984896 Homo sapiens histone 1, H3e,
           mRNA (cDNA clone MGC:60079 IMAGE:6526461), complete
           cds.>gb:BC066245_1986996 Homo sapiens histone 1, H3a,
           mRNA (cDNA clone MGC:79340 IMAGE:7002068), complete
           cds.>gb:BC066246_1986997 Homo sapiens histone 1, H3a,
           mRNA (cDNA clone MGC:79341 IMAGE:7002069), complete
           cds.>gb:BC066247_1986998 Homo sapiens histone 1, H3a,
           mRNA (cDNA clone MGC:79342 IMAGE:7002070), complete
           cds.>gb:BC067490_1987390 Homo sapiens histone 1, H3a,
           mRNA (cDNA clone MGC:79343 IMAGE:7002071), complete
           cds.>gb:BC067491_1987391 Homo sapiens histone 1, H3a,
           mRNA (cDNA clone MGC:79344 IMAGE:7002072), complete
           cds.>gb:BC067492_1987392 Homo sapiens histone 1, H3f,
           mRNA (cDNA clone MGC:79345 IMAGE:7002073), complete
           cds.>gb:BC069133_1987821 Homo sapiens histone 1, H3b,
           mRNA (cDNA clone MGC:95414 IMAGE:7216989), complete
           cds.>gb:BC069303_1987915 Homo sapiens histone 1, H3a,
           mRNA (cDNA clone MGC:97421 IMAGE:7262697), complete
           cds.>gb:BC069818_1988369 Homo sapiens histone 1, H3f,
           mRNA (cDNA clone MGC:97445 IMAGE:7262721), complete
           cds.>gb:BC079835_1989710 Homo sapiens histone 1, H3g,
           mRNA (cDNA clone MGC:99533 IMAGE:5935692), complete
           cds.>gb:CR541858_1994085 Homo sapiens full open reading
           frame cDNA clone RZPDo834H0632D for gene HIST1H3A,
           histone 1, H3a; complete cds, incl.
           stopcodon.>gb:CR541983_1994209 Homo sapiens full open
           reading frame cDNA clone RZPDo834C0335D for gene
           HIST1H3F, histone 1, H3f; complete cds, incl.
           stopcodon.>gb:CR542011_1994237 Homo sapiens full open
           reading frame cDNA clone RZPDo834F0335D for gene
           HIST1H3F, histone 1, H3f; complete cds, without
           stopcodon.>gb:CR542014_1994240 Homo sapiens full open
           reading frame cDNA clone RZPDo834F0435D for gene
           HIST1H3E, histone 1, H3e; complete cds, without
           stopcodon.>gb:HS193B12_1997387 Human DNA sequence from
           clone RP1-193B12 on chromosome 6p21.3-22.3 Contains the
           H2AFD, H2BFD, H2AFI, H1F5, H3FF, H4FK, H3FJ, H2AFN, and
           H2BFN histone genes, the OR2B2 gene for olfactory
           receptor 2B2, histone H2B family member I pseudogene
           H2BFIP, a hypothetical protein pseudogene, ESTs, STSs,
           GSSs and CpG islands, complete
           sequence.>gb:HS193B12_1997390 Human DNA sequence from
           clone RP1-193B12 on chromosome 6p21.3-22.3 Contains the
           H2AFD, H2BFD, H2AFI, H1F5, H3FF, H4FK, H3FJ, H2AFN, and
           H2BFN histone genes, the OR2B2 gene for olfactory
           receptor 2B2, histone H2B family member I pseudogene
           H2BFIP, a hypothetical protein pseudogene, ESTs, STSs,
           GSSs and CpG islands, complete
           sequence.>gb:HS34B20_1998228 Human DNA sequence from
           clone RP1-34B20 on chromosome 6p21.31-22.2 Contains
           seventeen histone (pseudo)genes and gene RPS10P1 (40S
           Ribosomal protein S10 pseudogene 1), three CpG islands,
           ESTs, STSs and GSSs, complete
           sequence.>gb:HS34B20_1998235 Human DNA sequence from
           clone RP1-34B20 on chromosome 6p21.31-22.2 Contains
           seventeen histone (pseudo)genes and gene RPS10P1 (40S
           Ribosomal protein S10 pseudogene 1), three CpG islands,
           ESTs, STSs and GSSs, complete
           sequence.>gb:HS34B20_1998240 Human DNA sequence from
           clone RP1-34B20 on chromosome 6p21.31-22.2 Contains
           seventeen histone (pseudo)genes and gene RPS10P1 (40S
           Ribosomal protein S10 pseudogene 1), three CpG islands,
           ESTs, STSs and GSSs, complete
           sequence.>gb:HS34B20_1998242 Human DNA sequence from
           clone RP1-34B20 on chromosome 6p21.31-22.2 Contains
           seventeen histone (pseudo)genes and gene RPS10P1 (40S
           Ribosomal protein S10 pseudogene 1), three CpG islands,
           ESTs, STSs and GSSs, complete
           sequence.>gb:HS97D16_1999863 Human DNA sequence from
           clone RP1-97D16 on chromosome 6p21.3-22.2 Contains a
           novel pseudogene, a 60S Ribosomal protein L30 (RPL30)
           pseudogene, H4 histone family member F pseudogene H4FFP
           and histone genes H2BFC, H2AFC, H3FK. Contains ESTs,
           STSs, GSSs and two CpG islands, complete
           sequence.>gb:HSH31_2013657 H.sapiens H3.1 gene for H3
           histone.>gb:HSH3H_2013664 H.sapiens H3/h
           gene.>gb:HSH3I_2013665 H.sapiens H3/i
           gene.>gb:HSHISH3_2013817 Human histone H3
           gene.>gb:HSHISH3A_2013818 H.sapiens DNA for histone
           H3a.>gb:HSHISTN3F_2013824 H.sapiens gene for histone
           H3.>gb:HSZ83735_2028574 H.sapiens hH3/k
           gene.>gb:HSZ83737_2028576 H.sapiens hH3/j
           gene.>gb:HUMHISAA_2031940 Human histone H3.1 (H1F3)
           gene, complete cds.>gb:AL589651_2070355 Mouse DNA
           sequence from clone RP23-138F20 on chromosome 13
           Contains five genes for olfactory receptors, a novel
           gene, the H1f5 gene for H1 histone family member 5,
           three genes and one pseudogene for H2a histone family
           members, four genes for H2b, two genes for H4, and two
           genes for H3 histone family members and seven CpG
           islands, complete sequence.>gb:AL589651_2070363 Mouse
           DNA sequence from clone RP23-138F20 on chromosome 13
           Contains five genes for olfactory receptors, a novel
           gene, the H1f5 gene for H1 histone family member 5,
           three genes and one pseudogene for H2a histone family
           members, four genes for H2b, two genes for H4, and two
           genes for H3 histone family members and seven CpG
           islands, complete sequence.>gb:AL590388_2070428 Mouse
           DNA sequence from clone RP23-480B19 on chromosome 13
           Contains the Slc17a1 gene for solute carrier family 17
           (vesicular glutamate transporter) member 1, two genes
           for novel solute carrier family 17 (Slc17) members, two
           novel genes, the gene for a novel C3HC4 type zinc finger
           (ring finger) protein, the gene for an H2a, an H2b, two
           genes for H3 and two genes for H4 histone family
           members, a H2a histone family pseudogene, the H1f1 and
           H1f2 genes for H1 histone family members 1 and 2, the
           H3f2 gene for H3 histone family, member 2 (H3.2), a
           novel pseudogene, the Hfe gene for hemochromatosis
           protein (Mr2) and two CpG islands, complete
           sequence.>gb:AL592149_2070666 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AY158944_2077128 Mus musculus histone
           protein Hist1h3h gene, complete cds.>gb:AY158945_2077129
           Mus musculus histone protein Hist1h3i gene, complete
           cds.>gb:AY158946_2077130 Mus musculus histone protein
           Hist1h3g gene, complete cds.>gb:AY158952_2077136 Mus
           musculus histone protein Hist1h3a gene, complete
           cds.>gb:MMHISH31_2115300 Mouse gene (H3.1) for histone
           H3.>gb:MMHIST31_2115305 Murine H3.1 gene for histone
           H3.1.>gb:MMHIST431_2115307 M.musculus genes encoding
           histone H4, histone H3 and histone
           H1.1.>gb:MMU62670_2122821 Mus musculus histone H3.1-I
           (H3-I) gene, complete cds.>gb:MMU62672_2122823 Mus
           musculus histone H3.1-D (H3-D) and histone H4-D (H4-D)
           genes, complete cds.>gb:MPMPH3110_2124702 M.pahari
           mpH3110 gene.>gb:MPMPH315_2124704 M.pahari mpH315
           gene.>gb:MUSHIS3B_2126201 Mouse histone H3 (H3.1-221)
           gene, complete cds.>gb:MUSHIS3D_2126203 Mouse histone H3
           (H3.1-291) gene, complete cds.>gb:RATH3HISTO_2132440
           Rattus norvegicus H3 histone gene, complete cds.
          Length = 136

 Score =  256 bits (655), Expect = 2e-67
 Identities = 131/136 (96%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AF323993_1262651 Trichinella pseudospiralis histone H3.3 mRNA,
           complete cds.
          Length = 136

 Score =  256 bits (653), Expect = 3e-67
 Identities = 129/136 (94%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|T27037|T27037 hypothetical protein Y49E10.6 - Caenorhabditis
           elegans>gb:CEY49E10_1370320 Caenorhabditis elegans YAC
           Y49E10, complete sequence.
          Length = 136

 Score =  256 bits (653), Expect = 3e-67
 Identities = 129/136 (94%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKDMQLARRIRGERA
Sbjct: 121 MPKDMQLARRIRGERA 136



>pir|JN0687|JN0687 histone H3 - sea squirt (Styela plicata)
          Length = 136

 Score =  256 bits (653), Expect = 3e-67
 Identities = 130/136 (95%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSS+V ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSSVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|S06743|S06743 histone H3 - mouse>gb:MMHIS2A3_2115292 Mouse H2a
           and H3 histone genes.>gb:CHKH3AB_2569088 Chicken histone
           H3 gene, complete cds.
          Length = 136

 Score =  256 bits (653), Expect = 3e-67
 Identities = 130/136 (95%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCA+HAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAMHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AY267746_1314539 Mytilus chilensis histone H3 (H3) gene,
           complete cds.
          Length = 136

 Score =  255 bits (652), Expect = 4e-67
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QL RRIRGERA
Sbjct: 121 MPKDIQLVRRIRGERA 136



>gb:AB044538_1195711 Drosophila pseudoobscura H3 gene for histone 3,
           complete cds.
          Length = 136

 Score =  255 bits (652), Expect = 4e-67
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARK APATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKGAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AB019406_1193858 Drosophila erecta gene for histone H3, complete
           cds.
          Length = 136

 Score =  255 bits (652), Expect = 4e-67
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQT RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTTRKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|S24346|S24346 histon H3 protein [similarity] - Arabidopsis
           thaliana>gb:AY491505_1178431 Capsicum annuum histone
           H3-like protein mRNA, complete cds.>gb:AB015760_1512728
           Nicotiana tabacum mRNA for histone H3, complete
           cds.>gb:ATCHRIV92_1547987 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           92.>gb:ATCHRIV92_1547988 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 92.>gb:ATH3G_1552524
           A.thaliana H3 gene 1 and H3 gene 2 for H3.3-like histone
           variant.>gb:ATH3G_1552525 A.thaliana H3 gene 1 and H3
           gene 2 for H3.3-like histone
           variant.>gb:ATT30N20_1555816 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T30N20 (ESSA
           project).>gb:ATT5J17_1556166 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T5J17 (ESSA
           project).>gb:ATT5J17_1556167 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T5J17 (ESSA
           project).>gb:AY070749_1566898 Arabidopsis thaliana
           AT5g10980/T30N20_250 mRNA, complete
           cds.>gb:AY078027_1567996 Arabidopsis thaliana
           AT4g40030/T5J17_200 mRNA, complete
           cds.>gb:AY086668_1571712 Arabidopsis thaliana clone 2670
           mRNA, complete sequence.>gb:AY097375_1576370 Arabidopsis
           thaliana AT5g10980/T30N20_250 mRNA, complete
           cds.>gb:AY525328_1611571 Oryza sativa (japonica
           cultivar-group) putative histone H3 mRNA, complete
           cds.>gb:BT002391_1635994 Arabidopsis thaliana Histon H3
           (At4g40040) mRNA, complete cds.>gb:BT003326_1636750
           Arabidopsis thaliana Histone H3 (At4g40040) mRNA,
           complete cds.>gb:LEH33_1684329 L.esculentum mRNA for
           histone H3 variant H3.3.>gb:LTMRHIS3_1685417
           L.temulentum mRNA for histone H3.>gb:MSU09458_1687257
           Medicago sativa cultivar Chief histone H3.2 gene, 5'
           region and complete cds.>gb:MSU09460_1687259 Medicago
           sativa Regen S clone pH3c110 histone H3.2 mRNA, complete
           cds.>gb:MSU09461_1687260 Medicago sativa Regen S clone
           pH3c118 histone H3.2 mRNA, complete
           cds.>gb:MSU09464_1687263 Medicago sativa Regen S clone
           pH3c130 histone H3.2 mRNA, complete
           cds.>gb:MSU09465_1687264 Medicago sativa Regen S clone
           pH3c131 histone H3.2 mRNA, complete
           cds.>gb:PPI306723_1701358 Pinus pinaster mRNA for
           putative histone H3.>gb:AC092075_1735140 Oryza sativa
           chromosome 3 BAC OSJNBa0017N12 genomic sequence,
           complete sequence.>gb:AF024716_1762141 Gossypium
           hirsutum histone 3 mRNA, complete
           cds.>gb:AF093633_1767682 Oryza sativa histone H3 mRNA,
           complete cds.>gb:AF109910_1768705 Porteresia coarctata
           histone H3 mRNA, complete cds.>gb:AF385735_1794626
           Arabidopsis thaliana AT4g40030/T5J17_200 mRNA, complete
           cds.>gb:AF501624_1806544 Vitis vinifera histone H3.3
           mRNA, complete cds.>gb:AP000559_1820312 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6,
           clone:P0493C11.
          Length = 136

 Score =  255 bits (652), Expect = 4e-67
 Identities = 131/136 (96%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|I48092|I48092 histone H3.2 - long-tailed
           hamster>gb:CLH2A232_2111785 C.longicaudatus genes for
           histones H2a.2 and H3.2.
          Length = 136

 Score =  255 bits (652), Expect = 4e-67
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTV LREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVTLREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|S32638|S32638 histone H3.l - African clawed
           frog>gb:XLH3LHIS_2582839 X.laevis H3l gene for histone
           H3.
          Length = 136

 Score =  255 bits (652), Expect = 4e-67
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLC IHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|S01198|S01198 histone H3 - starfish (Dermasterias
           imbricata)>pir|S20678|S20678 histone H3 - starfish
           (Solaster stimpsoni)>pir|S01196|S01196 histone H3 -
           starfish (Pisaster brevispinus)>pir|S01197|S01197
           histone H3 - starfish (Pisaster
           ochraceus)>pir|S20669|S20669 histone H3 - starfish
           (Pycnopodia helianthoides)>gb:DIHIST3_1377708 Sea star
           (D.imbricata) histone H3 gene.>gb:LPH3H4_1388969
           Lytechinus pictus H3 and H4 gene.>gb:LPH3PLPA_1388970
           Lytechinus pictus early stage H3 gene from
           pLpa.>gb:PALH319A_1391543 P.lividus H3 histone, clone
           h19.>gb:PALHISH2H3_1391546 P.lividus histone H3 and H2A
           genes, complete cds.>gb:PBH4H3_1391715 P.brevispinus
           histone genes H4 and H3.>gb:PBHIST3_1391716 Sea star (P.
           brevispinus) histone H3 gene.>gb:PHH4H3_1395219
           P.helianthoides histone genes H4 and
           H3.>gb:PMHIS7_1395443 Sea urchin (P. miliaris) gene for
           histones H4, H2B, H3, H2A and H1 (in that order,
           containing many sequence gaps). (see also  for
           allelic sequence.).>gb:PMHISH3_1395454 Psammechinus
           miliaris gene for histone H3 (clone
           h19).>gb:POH4H3_1395535 P.ochraceus histone genes H4 and
           H3.>gb:POHIST3_1395536 Sea star (P.ochraceus) histone H3
           gene.>gb:SSH4H3_1398076 S.stimpsoni histone genes H4 and
           H3.>gb:SUPHISB3_1398204 P.miliaris histone H3 gene,
           clone h19, complete cds, clone h19.>gb:SUPHISP04_1398209
           Psammechinus miliaris histone H3 gene, complete
           cds.>gb:SUSH3N5A_1398244 S.drobachiensis H3 histone,
           clone Nor5.
          Length = 136

 Score =  255 bits (652), Expect = 4e-67
 Identities = 130/136 (95%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>sp|P08860|H32_ORYSA Histone H3.
          Length = 135

 Score =  255 bits (652), Expect = 4e-67
 Identities = 131/135 (97%), Positives = 133/135 (98%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQ+SAV ALQEAAE YLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQTSAVRALQEAAERYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:ODI494848_1391108 Oikopleura dioica H3.1 gene, H4.1 gene, H1.1
           gene, and H2A.1 gene.
          Length = 136

 Score =  255 bits (651), Expect = 6e-67
 Identities = 130/136 (95%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDT+LCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTHLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>sp|P16105|H32_BOVIN Histone H3 (H3.2).>sp|P02299|H3_DROME Histone
           H3.>pir|A02627|HSFI3 histone H3 - smallmouth buffalo
           fish>pir|A02626|HSRK3 histone H3 - striped
           catshark>pir|B92959|HSTR3 histone H3, gonadal - rainbow
           trout>pir|A93596|HSXL31 histone H3.1 - African clawed
           frog
          Length = 135

 Score =  255 bits (651), Expect = 6e-67
 Identities = 130/135 (96%), Positives = 134/135 (99%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:CHKH3A_2569086 Chicken histone H3 gene (intronless).
          Length = 136

 Score =  254 bits (650), Expect = 7e-67
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIA DFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAXDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:XLA556872_2153926 Expression vector pET3-H3 H3 gene for Xenopus
           laevis-like histone H3.
          Length = 136

 Score =  254 bits (650), Expect = 7e-67
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|A27501|HSHU33 histone H3.3 [validated] -
           human>pir|S61218|S61218 histone H3.3 - fruit fly
           (Drosophila hydei)>pir|S61220|S61220 histone H3.3 -
           fruit fly (Drosophila melanogaster)>pir|I50245|I50245
           histone H3.3B - chicken>pir|S10168|S10168 histone H3.3A
           - rabbit>pir|A45941|A45941 histone H3 - Atlantic surf
           clam>pir|S04186|S04186 histone H3.3 -
           mouse>pir|S34185|S34185 histone H3 -
           rat>gb:AE014298_1124907 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014298_1124908
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1124909 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014134_1127605
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AK002928_1151547 Mus musculus adult male
           kidney cDNA, RIKEN full-length enriched library,
           clone:0610043D20 product:H3 histone, family 3B, full
           insert sequence.>gb:AK037900_1164940 Mus musculus 16
           days neonate thymus cDNA, RIKEN full-length enriched
           library, clone:A130061A14 product:H3 histone, family 3A,
           full insert sequence.>gb:AK088075_1175181 Mus musculus 2
           days neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430003G07 product:H3 histone,
           family 3B, full insert sequence.>gb:AY231774_1177067
           Drosophila yakuba clone yak-em_His3.3A mRNA
           sequence.>gb:AE003446_1210089 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete
           sequence.>gb:AE003446_1210090 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete
           sequence.>gb:AE003446_1210091 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete
           sequence.>gb:AE003608_1217712 Drosophila melanogaster
           chromosome 2L, section 17 of 83 of the complete
           sequence.>gb:AJ626746_1283579 Oikopleura dioica mRNA for
           histone H3.3.>gb:AY035716_1288469 Anopheles gambiae
           histone 3A (HIS3A) mRNA, complete
           cds.>gb:AY071057_1295142 Drosophila melanogaster RE14004
           full length cDNA.>gb:AY118325_1300047 Drosophila
           melanogaster LD17717 full insert
           cDNA.>gb:AY119629_1301198 Drosophila melanogaster
           RE21618 full insert cDNA.>gb:DHHIS332_1377654 D.hydei
           mRNA for histone H3.3A.>gb:DHHIS334_1377655 D.hydei gene
           for histone H3.3B.>gb:DMH33A_1379577 D.melanogaster mRNA
           for histone H3.3 variant.>gb:DMH33Q_1379578
           D.melanogaster mRNA for histone H3.3Q
           (variant).>gb:DMHISH333_1379592 D.melanogaster genes for
           histone H3.3 and OST48.>gb:DMHSTH331_1379635
           D.melanogaster mRNA for histone
           H3.3.>gb:SIUHIS3A_1397632 Clam (S.solidissima) histone
           H3 mRNA, complete cds.>gb:AF469469_1420886 Sus scrofa
           histone H3.3A mRNA, complete cds.>gb:BT020962_1436320
           Bos taurus H3 histone, family 3A (H3F3A), mRNA, complete
           cds.>gb:OCH33A_1442172 Rabbit mRNA for histone
           H3.3A.>gb:AF218029_1890639 Homo sapiens clone PP781
           unknown mRNA.>gb:AL512343_1928411 Human DNA sequence
           from clone RP11-396C23 on chromosome 1 Contains the
           H3F3A gene for H3 histone, family 3A, a nove gene and
           four CpG islands, complete sequence.>gb:BC001124_1967314
           Homo sapiens H3 histone, family 3B (H3.3B), mRNA (cDNA
           clone MGC:2161 IMAGE:2988279), complete
           cds.>gb:BC006497_1970331 Homo sapiens H3 histone, family
           3B (H3.3B), mRNA (cDNA clone MGC:2160 IMAGE:2959756),
           complete cds.>gb:BC012813_1973783 Homo sapiens H3
           histone, family 3B (H3.3B), mRNA (cDNA clone MGC:4123
           IMAGE:2959756), complete cds.>gb:BC017558_1976163 Homo
           sapiens H3 histone, family 3B (H3.3B), mRNA (cDNA clone
           MGC:9614 IMAGE:3910031), complete
           cds.>gb:BC029405_1979476 Homo sapiens H3 histone, family
           3A, mRNA (cDNA clone MGC:32638 IMAGE:4077662), complete
           cds.>gb:BC038989_1982435 Homo sapiens H3 histone, family
           3A, mRNA (cDNA clone MGC:47761 IMAGE:6014954), complete
           cds.>gb:BC066901_1987139 Homo sapiens H3 histone, family
           3B (H3.3B), mRNA (cDNA clone MGC:87038 IMAGE:4826805),
           complete cds.>gb:BC067757_1987465 Homo sapiens H3
           histone, family 3B (H3.3B), mRNA (cDNA clone MGC:87039
           IMAGE:5294551), complete cds.>gb:BC081560_1989810 Homo
           sapiens H3 histone, family 3A, mRNA (cDNA clone
           MGC:87782 IMAGE:3884607), complete
           cds.>gb:HSHH3X3B_2013786 H.sapiens hH3.3B gene for
           histone H3.3.>gb:HSM805674_2017978 Homo sapiens mRNA;
           cDNA DKFZp686C2282 (from clone DKFZp686C2282); complete
           cds.>gb:HUMHISH3B_2031951 Human H3.3 histone, class B
           mRNA, complete cds.>gb:HUMHISH3C_2031952 Human H3.3
           histone class C mRNA, complete cds.>gb:BC002268_2089015
           Mus musculus H3 histone, family 3A, mRNA (cDNA clone
           MGC:7653 IMAGE:3495830), complete
           cds.>gb:BC012687_2091618 Mus musculus H3 histone, family
           3A, mRNA (cDNA clone MGC:13931 IMAGE:4224280), complete
           cds.>gb:BC037730_2098151 Mus musculus H3 histone, family
           3B, mRNA (cDNA clone MGC:47401 IMAGE:4500770), complete
           cds.>gb:BC063159_2105179 Rattus norvegicus H3 histone,
           family 3B, mRNA (cDNA clone MGC:72729 IMAGE:6921452),
           complete cds.>gb:BC078759_2106919 Rattus norvegicus H3
           histone, family 3B, mRNA (cDNA clone MGC:93264
           IMAGE:7112262), complete cds.>gb:BC083353_2108620 Mus
           musculus H3 histone, family 3A, mRNA (cDNA clone
           MGC:102150 IMAGE:5714859), complete
           cds.>gb:BC086580_2109704 Rattus norvegicus H3 histone,
           family 3B, mRNA (cDNA clone MGC:105789 IMAGE:7307209),
           complete cds.>gb:BC087725_2110189 Rattus norvegicus H3
           histone, family 3B, mRNA (cDNA clone MGC:105794
           IMAGE:7320825), complete cds.>gb:BC088835_2110615 Mus
           musculus H3 histone, family 3A, mRNA (cDNA clone
           MGC:102536 IMAGE:6437687), complete
           cds.>gb:MMH33REP_2115141 Murine mRNA for replacement
           variant histone H3.3.>gb:MMZ85979_2124633 M.musculus
           mRNA for histone H3.3A.>gb:RNH33_2134986 R.norvegicus
           mRNA for histone H3.3.>gb:AY701859_2544783 Gekko
           japonicus GekBS038P mRNA, complete
           cds.>gb:BC041218_2547856 Xenopus laevis hypothetical
           protein MGC52708, mRNA (cDNA clone MGC:52708
           IMAGE:4683607), complete cds.>gb:BC042290_2548109
           Xenopus laevis H3 histone, family 3B (H3.3B), mRNA (cDNA
           clone MGC:53509 IMAGE:5572537), complete
           cds.>gb:BC042309_2548121 Xenopus laevis H3 histone,
           family 3A, mRNA (cDNA clone MGC:52829 IMAGE:4884642),
           complete cds.>gb:BC049017_2550090 Danio rerio zgc:56418,
           mRNA (cDNA clone MGC:56418 IMAGE:5605456), complete
           cds.>gb:BC057444_2552091 Danio rerio zgc:64222, mRNA
           (cDNA clone MGC:64222 IMAGE:6799907), complete
           cds.>gb:BC061408_2553182 Xenopus tropicalis hypothetical
           protein MGC75998, mRNA (cDNA clone MGC:75998
           IMAGE:5384525), complete cds.>gb:BC070966_2555842
           Xenopus laevis hypothetical protein MGC78769, mRNA (cDNA
           clone MGC:78769 IMAGE:3400388), complete
           cds.>gb:BC071406_2556147 Danio rerio zgc:56193, mRNA
           (cDNA clone MGC:86731 IMAGE:6897814), complete
           cds.>gb:BC074158_2557676 Xenopus laevis MGC81913
           protein, mRNA (cDNA clone MGC:81913 IMAGE:7009277),
           complete cds.>gb:BC077035_2559772 Xenopus tropicalis
           MGC89877 protein, mRNA (cDNA clone MGC:89877
           IMAGE:7029267), complete cds.>gb:CHKH33B_2569085 Chicken
           histone gene encoding replacement variant
           H3.3B.>gb:GGHISH3B_2573194 Chicken mRNA for histone
           H3.3B.
          Length = 136

 Score =  254 bits (650), Expect = 7e-67
 Identities = 128/136 (94%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>sp|P16106|H31_HUMAN Histone H3.1 (H3/a) (H3/c) (H3/d) (H3/f) (H3/h)
           (H3/i) (H3/j) (H3/k) (H3/l).>pir|A02624|HSBO3 histone H3
           - bovine
          Length = 135

 Score =  254 bits (650), Expect = 7e-67
 Identities = 130/135 (96%), Positives = 133/135 (98%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:AB044539_1195712 Drosophila persimilis H3 gene for histone 3,
           complete cds.
          Length = 136

 Score =  254 bits (649), Expect = 1e-66
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPK +QLARRIRGERA
Sbjct: 121 MPKGIQLARRIRGERA 136



>pir|T16361|T16361 hypothetical protein F45E1.6 - Caenorhabditis
           elegans>gb:U28732_1402495 Caenorhabditis elegans cosmid
           F45E1, complete sequence.
          Length = 136

 Score =  254 bits (649), Expect = 1e-66
 Identities = 128/136 (94%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|JQ0757|JQ0757 histone H3 - staghorn coral>gb:ACPH342BA_1208271
           Acropora formosa histone H3 (H3), histone H2B (H2B),
           histone H2A (H2A), and histone H4 (H4) genes, complete
           cds.>gb:ACPH3AA_1208275 Acropora formosa histone H3
           protein (H3) gene, complete cds.>gb:S67324_1396755
           histone gene cluster: histone H3...histone H4 [Acropora
           formosa=coral, sperms, Genomic, 4 genes, 3764 nt].
          Length = 136

 Score =  254 bits (649), Expect = 1e-66
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAA KSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAAAKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AF467728_1802430 Oryza sativa disease-resistent-related protein
           (RH3) mRNA, complete cds.
          Length = 136

 Score =  254 bits (648), Expect = 1e-66
 Identities = 130/136 (95%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD++LARRIRGERA
Sbjct: 121 MPKDIKLARRIRGERA 136



>gb:AB003784_1192887 Drosophila simulans DNA for Histone H3,
           complete cds.
          Length = 136

 Score =  254 bits (648), Expect = 1e-66
 Identities = 129/136 (94%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKS PATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSVPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+E YLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASETYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|I49395|I49395 histone H3.2 protein - shrew
           mouse>gb:MPMP323_2124701 M.pahari genes mpH323 and
           mph2a23.
          Length = 136

 Score =  254 bits (648), Expect = 1e-66
 Identities = 129/136 (94%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QL RRIRGERA
Sbjct: 121 MPKDIQLVRRIRGERA 136



>sp|Q8WSF1|H33_TRIPS Histone H3.3.
          Length = 135

 Score =  254 bits (648), Expect = 1e-66
 Identities = 128/135 (94%), Positives = 134/135 (99%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:AY533212_2086314 Chinchilla lanigera histone H3.3B mRNA,
           complete cds.
          Length = 136

 Score =  253 bits (647), Expect = 2e-66
 Identities = 127/136 (93%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARR+RGERA
Sbjct: 121 MPKDIQLARRMRGERA 136



>gb:BC067493_1987393 Homo sapiens histone 1, H3i, mRNA (cDNA clone
           MGC:79347 IMAGE:7002079), complete cds.
          Length = 136

 Score =  253 bits (647), Expect = 2e-66
 Identities = 130/136 (95%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQ LVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQCLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|S04241|HSKW3 histone H3 - Caenorhabditis
           elegans>gb:AC024696_1204320 Caenorhabditis elegans
           cosmid F07B7, complete sequence.>gb:AF047656_1236452
           Caenorhabditis elegans cosmid F17E9, complete
           sequence.>gb:AF304122_1260559 Caenorhabditis elegans
           histone H3 (2O113) mRNA, complete
           cds.>gb:CEB0035_1359695 Caenorhabditis elegans cosmid
           B0035, complete sequence.>gb:CEF08G2_1362073
           Caenorhabditis elegans cosmid F08G2, complete
           sequence.>gb:CEF22B3_1362802 Caenorhabditis elegans
           cosmid F22B3, complete sequence.>gb:CEF54E12_1364449
           Caenorhabditis elegans cosmid F54E12, complete
           sequence.>gb:CEHIS10_1365096 C. elegans core histone
           genes H4(his-10) and H3(his-9).>gb:CET10C6_1367578
           Caenorhabditis elegans cosmid T10C6, complete
           sequence.>gb:CEZK131_1371497 Caenorhabditis elegans
           cosmid ZK131, complete sequence.>gb:CEZK131_1371501
           Caenorhabditis elegans cosmid ZK131, complete
           sequence.>gb:CEZK131_1371502 Caenorhabditis elegans
           cosmid ZK131, complete sequence.>gb:U58750_1405323
           Caenorhabditis elegans cosmid F55G1, complete
           sequence.>gb:U64843_1405736 Caenorhabditis elegans
           cosmid K06C4, complete sequence.>gb:U64843_1405741
           Caenorhabditis elegans cosmid K06C4, complete
           sequence.>gb:U64845_1405770 Caenorhabditis elegans
           cosmid F45F2, complete sequence.
          Length = 136

 Score =  253 bits (647), Expect = 2e-66
 Identities = 129/136 (94%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIR+ PFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>sp|P02298|H3_PSAMI Histone H3, embryonic.>pir|C90776|HSUR3M histone
           H3, embryonic - sea urchin (Psammechinus miliaris)
          Length = 135

 Score =  253 bits (647), Expect = 2e-66
 Identities = 129/135 (95%), Positives = 134/135 (99%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>sp|P11105|H32_MEDSA Histone H3.2, minor.>sp|P59169|H33_ARATH
           Histone H3.3.
          Length = 135

 Score =  253 bits (647), Expect = 2e-66
 Identities = 130/135 (96%), Positives = 132/135 (97%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:HUMHIS3PRM_2031938 Human histone H3 gene, complete cds.
          Length = 135

 Score =  253 bits (646), Expect = 2e-66
 Identities = 129/134 (96%), Positives = 132/134 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGE 485
           MPKD+QLARRIRGE
Sbjct: 121 MPKDIQLARRIRGE 134



>gb:HSH3B_2013661 H.sapiens H3/b gene.
          Length = 136

 Score =  253 bits (646), Expect = 2e-66
 Identities = 130/136 (95%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EA LVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEATLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:BC067494_1987394 Homo sapiens histone 1, H3i, mRNA (cDNA clone
           IMAGE:7002080), partial cds.
          Length = 137

 Score =  253 bits (646), Expect = 2e-66
 Identities = 129/134 (96%), Positives = 132/134 (98%)
 Frame = +3

Query: 90  RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELL 269
           RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELL
Sbjct: 4   RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL 63

Query: 270 IRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMP 449
           IRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTIMP
Sbjct: 64  IRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMP 123

Query: 450 KDMQLARRIRGERA 491
           KD+QLARRIRGERA
Sbjct: 124 KDIQLARRIRGERA 137



>gb:SULHISL34_1398180 Sea urchin (L.pictus) late-stage histone H3
           and H4 genes.
          Length = 136

 Score =  253 bits (646), Expect = 2e-66
 Identities = 129/136 (94%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           L IRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LFIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEAREAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AY028698_1288298 Trichinella spiralis histone H3 mRNA, complete
           cds.
          Length = 136

 Score =  253 bits (646), Expect = 2e-66
 Identities = 128/136 (94%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+ GGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSAGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVRE+AQD+KTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREVAQDYKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:CR858345_1182526 Pongo pygmaeus mRNA; cDNA DKFZp459A2130 (from
           clone DKFZp459A2130).
          Length = 136

 Score =  253 bits (646), Expect = 2e-66
 Identities = 127/136 (93%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRL REIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLAREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|S50140|S50140 histone H3.3 - sea urchin (Paracentrotus
           lividus)>gb:PLH33H_1395332 P.lividus H3.3 Histone
           mRNA.>gb:PLI277902_1395343 Paracentrotus lividus partial
           h3.3 gene for putative histone H3.3, exon 2 and joined
           CDS.
          Length = 136

 Score =  253 bits (646), Expect = 2e-66
 Identities = 127/136 (93%), Positives = 135/136 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKT+LRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTELRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:BC021768_2093619 Mus musculus H3 histone, family 3B, mRNA (cDNA
           clone MGC:25412 IMAGE:3157399), complete cds.
          Length = 136

 Score =  253 bits (645), Expect = 3e-66
 Identities = 127/136 (93%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVRE AQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVRETAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:BC066884_1987126 Homo sapiens histone 1, H3i, mRNA (cDNA clone
           MGC:79346 IMAGE:7002077), complete cds.
          Length = 136

 Score =  253 bits (645), Expect = 3e-66
 Identities = 130/136 (95%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           M KD+QLARRIRGERA
Sbjct: 121 MLKDIQLARRIRGERA 136



>gb:AF517876_1807678 Griffithsia japonica isolate Gj410 putative
           histone H3 protein mRNA, complete cds.
          Length = 136

 Score =  253 bits (645), Expect = 3e-66
 Identities = 128/135 (94%), Positives = 134/135 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHRFRPGTVALREIRK+QKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRFRPGTVALREIRKFQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LL+RKLPFQRLVREIAQDFK+DLRFQSSAV ALQEAAEAY+VGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLVRKLPFQRLVREIAQDFKSDLRFQSSAVLALQEAAEAYMVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGER 488
           MPKD+QLARRIRGER
Sbjct: 121 MPKDIQLARRIRGER 135



>sp|P06351|H33_HUMAN Histone H3.3 (H3.A) (H3.B) (H3.3Q).
          Length = 135

 Score =  253 bits (645), Expect = 3e-66
 Identities = 127/135 (94%), Positives = 134/135 (99%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:SPHISH34_1397973 Sea urchin (S. purpuratus) late embryonic H3
           and H4 histone genes.
          Length = 136

 Score =  252 bits (644), Expect = 4e-66
 Identities = 129/136 (94%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVRLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:S64499_1396692 Styela plicata H3 histone and H4 histone genes,
           complete cds.
          Length = 136

 Score =  252 bits (644), Expect = 4e-66
 Identities = 128/136 (94%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSS+V ALQEA+E YLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSSVMALQEASERYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QL RRIRGERA
Sbjct: 121 MPKDIQLGRRIRGERA 136



>gb:AY267745_1314538 Mytilus californianus histone H3 (H3) gene,
           complete cds.
          Length = 136

 Score =  252 bits (644), Expect = 4e-66
 Identities = 130/136 (95%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNL AIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLRAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>pir|I50244|I50244 histone 3.3A - chicken>gb:CHKH33A2_2569084
           Chicken histone gene encoding replacement variant H3.3A,
           segment 2 of 2.
          Length = 136

 Score =  252 bits (644), Expect = 4e-66
 Identities = 127/136 (93%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARK TGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKFTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>sp|P22843|H3_ACRFO Histone H3.
          Length = 135

 Score =  252 bits (644), Expect = 4e-66
 Identities = 129/135 (95%), Positives = 133/135 (98%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAA KSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAAAKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>sp|Q10453|H33_CAEEL Histone H3.3.
          Length = 135

 Score =  252 bits (644), Expect = 4e-66
 Identities = 127/135 (94%), Positives = 133/135 (98%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:BC045982_2549494 Danio rerio zgc:56193, mRNA (cDNA clone
           MGC:56193 IMAGE:5413809), complete cds.
          Length = 136

 Score =  252 bits (643), Expect = 5e-66
 Identities = 127/136 (93%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVAL EIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALGEIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:BC081561_1989811 Homo sapiens H3 histone, family 3A, mRNA (cDNA
           clone MGC:87783 IMAGE:5162817), complete cds.
          Length = 136

 Score =  252 bits (643), Expect = 5e-66
 Identities = 127/136 (93%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTA KSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTALKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AY880411_1180453 Gekko japonicus GekBS180P mRNA, complete cds.
          Length = 136

 Score =  252 bits (643), Expect = 5e-66
 Identities = 127/136 (93%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQ A+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQGASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AY124026_1580098 Griffithsia japonica histone H3 mRNA, complete
           cds.
          Length = 136

 Score =  251 bits (642), Expect = 6e-66
 Identities = 127/135 (94%), Positives = 134/135 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHRFRPGTVALREIR++QKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRFRPGTVALREIRRFQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LL+RKLPFQRLVREIAQDFK+DLRFQSSAV ALQEAAEAY+VGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLVRKLPFQRLVREIAQDFKSDLRFQSSAVLALQEAAEAYMVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGER 488
           MPKD+QLARRIRGER
Sbjct: 121 MPKDIQLARRIRGER 135



>pir|S57473|S57473 histone H3 - human>gb:AF531308_1906162 Homo
           sapiens histone H3 (HIST3H3) gene, complete
           cds.>gb:AL139288_1920542 Human DNA sequence from clone
           RP5-915N17 on chromosome 1q42.11-42.3, complete
           sequence.>gb:BC069079_1987777 Homo sapiens histone 3,
           H3, mRNA (cDNA clone MGC:95354 IMAGE:7216893), complete
           cds.>gb:CR542013_1994239 Homo sapiens full open reading
           frame cDNA clone RZPDo834E0435D for gene HIST3H3,
           histone 3, H3; complete cds, without
           stopcodon.>gb:HS2132H3_1997517 H.sapiens gene for
           histone H3.
          Length = 136

 Score =  251 bits (641), Expect = 8e-66
 Identities = 127/136 (93%), Positives = 132/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATK ARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRL+REIAQDFKTDLRFQSSAV ALQEA E+YLVGLFEDTNLC IHAKRVTI
Sbjct: 61  LLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>sp|Q93081|H3B_HUMAN Histone H3/b.
          Length = 135

 Score =  251 bits (641), Expect = 8e-66
 Identities = 129/135 (95%), Positives = 132/135 (97%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA EA LVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEATLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:HSJ998N21_2016708 Human DNA sequence from clone RP5-998N21 on
           chromosome 1 Contains a ubiquitin-conjugating enzyme
           HBUCE1 pseudogene, the FCGR1C gene for Fc fragment of
           IgG high affinity Ic receptor for (CD64), two novel
           genes, the HIST2H2BA gene for histone 2 H2ba, the gene
           for a novel protein similar to histone 2 H3c (HIST2H3C),
           a novel gene, a ribosomal protein L22 (RPL22)
           pseudogene, a novel gene and three CpG islands, complete
           sequence.
          Length = 136

 Score =  251 bits (640), Expect = 1e-65
 Identities = 128/136 (94%), Positives = 132/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQ+FKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQEFKTDLRFQSSAVMALQEAREAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QL  RIRGERA
Sbjct: 121 MPKDIQLVSRIRGERA 136



>gb:AB011479_1511438 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MNA5.
          Length = 139

 Score =  251 bits (640), Expect = 1e-65
 Identities = 128/136 (94%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTAR STGGKAPRKQLA KAAR+SAPATGGVKKPHRFRPGTVALR+IRKYQKSTE
Sbjct: 1   MARTKQTARISTGGKAPRKQLAPKAARQSAPATGGVKKPHRFRPGTVALRDIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           +LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  ILIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPK++QLARRIRGERA
Sbjct: 121 MPKEIQLARRIRGERA 136



>sp|P06352|H3_STRPU Histone H3, embryonic.>pir|A02629|HSUR3P histone
           H3, embryonic - sea urchin (Strongylocentrotus
           purpuratus)
          Length = 135

 Score =  250 bits (639), Expect = 1e-65
 Identities = 128/135 (94%), Positives = 133/135 (98%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLV LFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVRLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:PALH370A_1391544 Paracentrotus lividus H3 histone, clone Ph70.
          Length = 136

 Score =  250 bits (638), Expect = 2e-65
 Identities = 128/136 (94%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKA RKQLATKAARKSAPATGGVKKPHR+RPGTVA REIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKASRKQLATKAARKSAPATGGVKKPHRYRPGTVASREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:AY181030_1307636 Toxoplasma gondii histone H3 mRNA, complete
           cds.
          Length = 136

 Score =  250 bits (638), Expect = 2e-65
 Identities = 126/136 (92%), Positives = 134/136 (98%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP +GG+KKPHR+RPGTVALREIR+YQKST+
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPMSGGIKKPHRYRPGTVALREIRRYQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136



>gb:AF361949_1265575 Eimeria tenella histone 3 (H3) mRNA, complete
           cds.
          Length = 136

 Score =  250 bits (638), Expect = 2e-65
 Identities = 126/136 (92%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP  GG+KKPHR+RPGTVALREIR+YQKST+
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVAGGIKKPHRYRPGTVALREIRRYQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136



>pir|S59581|S59581 histone H3 (clones CH-II and CH-III) -
           Chlamydomonas reinhardtii>pir|S00940|S00940 histone H3 -
           Volvox carteri>gb:CRU16724_1673618 Chlamydomonas
           reinhardtii histone H3 (ch3-II), histone H4 (ch4-II),
           histone H2B (ch2b-II) and histone H2A (ch2a-II) genes,
           complete cds.>gb:CRU16725_1673622 Chlamydomonas
           reinhardtii histone H3 (ch3-III), histone H4 (ch4-III),
           histone H2B (ch2b-III) and histone H2A (ch2a-III) genes,
           complete cds.>gb:VCHIS34_1727020 Volvox carteri H3-I and
           H4-I genes for histones H3 and H4.>gb:VCHIS34A_1727022
           Volvox carteri H3-II and H4-II genes for histones H3 and
           H4.
          Length = 135

 Score =  250 bits (638), Expect = 2e-65
 Identities = 130/136 (95%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARK+ PATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE 59

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 60  LLIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 119

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 120 MPKDIQLARRIRGERA 135



>sp|P08898|H3_CAEEL Histone H3.
          Length = 135

 Score =  250 bits (638), Expect = 2e-65
 Identities = 127/135 (94%), Positives = 132/135 (97%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPA+GGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIR+ PFQRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>gb:AY378165_1603824 Cichorium intybus histone H3 protein mRNA,
           complete cds.
          Length = 136

 Score =  249 bits (636), Expect = 3e-65
 Identities = 129/136 (94%), Positives = 131/136 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKA    A ATGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAWNTLATATGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKDMQLARRIRGERA
Sbjct: 121 MPKDMQLARRIRGERA 136



>pir|JQ1983|JQ1983 H3.3 like histone MH921 - mouse
          Length = 135

 Score =  249 bits (636), Expect = 3e-65
 Identities = 125/135 (92%), Positives = 133/135 (98%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCA+HAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAVHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLA RIRGERA
Sbjct: 121 PKDIQLACRIRGERA 135



>sp|Q16695|H3T_HUMAN Histone H3.4 (H3t) (H3/t) (H3/g).
          Length = 135

 Score =  249 bits (636), Expect = 3e-65
 Identities = 126/135 (93%), Positives = 131/135 (97%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATK ARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRL+REIAQDFKTDLRFQSSAV ALQEA E+YLVGLFEDTNLC IHAKRVTIM
Sbjct: 61  LIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>pir|S59592|S59592 histone H3 (clone CH-I) - Chlamydomonas
           reinhardtii>gb:CRU16825_1673629 Chlamydomonas
           reinhardtii histone H3 (ch3-I) and histone H4 (ch4-I)
           genes, complete cds.
          Length = 135

 Score =  249 bits (635), Expect = 4e-65
 Identities = 129/136 (94%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARK+ PATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE 59

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           L+IRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 60  LVIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 119

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 120 MPKDIQLARRIRGERA 135



>gb:SPHIS1_1397970 Sea urchin genes for the histones H2B and H3.
          Length = 136

 Score =  248 bits (634), Expect = 5e-65
 Identities = 127/136 (93%), Positives = 132/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKT+LRFQSSAV ALQEA+EAYLVG   DTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVGXXXDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>sp|P08437|H3_VOLCA Histone H3.
          Length = 134

 Score =  248 bits (633), Expect = 7e-65
 Identities = 129/135 (95%), Positives = 132/135 (97%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARK+ PATGGVKKPHR+RPGTVALREIRKYQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTEL 59

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 60  LIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 119

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 120 PKDIQLARRIRGERA 134



>gb:AY130243_1302427 Toxoplasma gondii histone H3.3 variant mRNA,
           complete cds.
          Length = 136

 Score =  248 bits (632), Expect = 9e-65
 Identities = 124/136 (91%), Positives = 133/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP +GG+KKPHR+RPGTVALREIRK+QKST+
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPMSGGIKKPHRYRPGTVALREIRKFQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS A+ ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSQAILALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136



>pir|E27399|HSZP3 histone H3.1 [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:AB004538_1509139
           Schizosaccharomyces pombe 39 kb genomic DNA, clone
           c568.>gb:SPAC1834_1716819 S.pombe chromosome I cosmid
           c1834.>gb:SPBC1105_1718775 S.pombe chromosome II cosmid
           c1105.>gb:SPBC8D2_1720501 S.pombe chromosome II cosmid
           c8D2.>gb:SPHIS32_1721815 Fission yeast histone H3.2 and
           H4.2 genes.>gb:SPHIS41_1721820 Fission yeast genes for
           histone H4.1 and H3.1.
          Length = 136

 Score =  248 bits (632), Expect = 9e-65
 Identities = 124/136 (91%), Positives = 131/136 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARK+APATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA EAYLV LFEDTNLCAIH KRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHGKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
            PKDMQLARR+RGER+
Sbjct: 121 QPKDMQLARRLRGERS 136



>gb:AF304365_1784380 Rubus idaeus histone H3 gene, partial cds.
          Length = 132

 Score =  246 bits (629), Expect = 2e-64
 Identities = 126/132 (95%), Positives = 129/132 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTK+TARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKETARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIR 479
           MPKD+QLARRIR
Sbjct: 121 MPKDIQLARRIR 132



>gb:AY086702_1571746 Arabidopsis thaliana clone 268982 mRNA,
           complete sequence.
          Length = 136

 Score =  246 bits (629), Expect = 2e-64
 Identities = 128/136 (94%), Positives = 129/136 (94%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKS GGKAP KQLATKAARKSAP TGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSHGGKAPTKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LL RKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLNRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIR ERA
Sbjct: 121 MPKDVQLARRIRAERA 136



>gb:AY347801_1177962 Malus x domestica clone 13-2 histone 3 mRNA,
           partial cds.
          Length = 135

 Score =  246 bits (628), Expect = 3e-64
 Identities = 127/135 (94%), Positives = 129/135 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFK DLRFQS AV ALQEAAEAYLVGLFEDTNLCA HAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKIDLRFQSHAVLALQEAAEAYLVGLFEDTNLCATHAKRVTI 120

Query: 444 MPKDMQLARRIRGER 488
           MPKD+QLARRIR ER
Sbjct: 121 MPKDIQLARRIRCER 135



>pir|S59123|S59123 histone H3 - Chlamydomonas
           reinhardtii>gb:CREHIH3G_1673374 Chlamydomonas
           reinhardtii histone H3, histone H4, histone H2B, and
           histone H2A genes, complete cds.
          Length = 135

 Score =  246 bits (628), Expect = 3e-64
 Identities = 129/136 (94%), Positives = 132/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARK+ PATGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE 59

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAI AKRVTI
Sbjct: 60  LLIRKLPFQRLVREIAQDFKTDLRFQSQAVVALQEAAEAYLVGLFEDTNLCAITAKRVTI 119

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 120 MPKDIQLARRIRGERA 135



>sp|P02302|H32_XENLA Histone H3.2.>pir|A02634|HSXL32 histone H3.2 -
           African clawed frog
          Length = 135

 Score =  246 bits (628), Expect = 3e-64
 Identities = 125/135 (92%), Positives = 130/135 (96%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQL TKAA+K APATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLVTKAAKKCAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQ SAV ALQEA+EAYLV LFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQRSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 121 PKDIQLARRIRGERA 135



>sp|P09988|H31_SCHPO Histone H3.1/H3.2.
          Length = 135

 Score =  246 bits (627), Expect = 3e-64
 Identities = 123/135 (91%), Positives = 130/135 (96%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLA+KAARK+APATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA EAYLV LFEDTNLCAIH KRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHGKRVTIQ 120

Query: 447 PKDMQLARRIRGERA 491
           PKDMQLARR+RGER+
Sbjct: 121 PKDMQLARRLRGERS 135



>gb:AF517884_1807686 Griffithsia japonica isolate Gj475 histone H3.3
           protein mRNA, complete cds.
          Length = 137

 Score =  245 bits (626), Expect = 5e-64
 Identities = 128/137 (93%), Positives = 133/137 (97%), Gaps = 1/137 (0%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRK+QKST+
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPITGGVKKPHRYRPGTVALREIRKFQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYL-VGLFEDTNLCAIHAKRVT 440
           LLIRKLPFQRLVREIAQDFK+DLRFQSSAV ALQEAAEAYL  GLFEDTNLCAIHAKRVT
Sbjct: 61  LLIRKLPFQRLVREIAQDFKSDLRFQSSAVLALQEAAEAYLRGGLFEDTNLCAIHAKRVT 120

Query: 441 IMPKDMQLARRIRGERA 491
           IMPKD+QLARRIRGERA
Sbjct: 121 IMPKDIQLARRIRGERA 137



>gb:MAL249812_1685567 Mortierella alpina H3.1 and H4.1 genes for
           histone H3 and histone H4.>gb:MAL249813_1685569
           Mortierella alpina histone H3.2 and H4.2 genes for
           histone H3 and for histone H4.
          Length = 136

 Score =  245 bits (625), Expect = 6e-64
 Identities = 124/135 (91%), Positives = 130/135 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA+EAYLV LFEDTNL AIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEASEAYLVSLFEDTNLAAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGER 488
            PKD+ LARR+RGER
Sbjct: 121 QPKDIHLARRLRGER 135



>gb:AC011810_1537510 Arabidopsis thaliana chromosome I BAC T6J4
           genomic sequence, complete sequence.
          Length = 136

 Score =  245 bits (625), Expect = 6e-64
 Identities = 127/136 (93%), Positives = 129/136 (94%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQ+ARKS GGKAP KQLATKAARKSAP TGGVKKPHRFRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQSARKSHGGKAPTKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LL RKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLNRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIR ERA
Sbjct: 121 MPKDVQLARRIRAERA 136



>pir|S32621|S32621 histone H3.r - African clawed
           frog>gb:XLH3HIS_2582838 X.laevis H3r gene for histone
           H3.
          Length = 136

 Score =  245 bits (625), Expect = 6e-64
 Identities = 126/136 (92%), Positives = 130/136 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATG  KKPHR+RPGT ALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGESKKPHRYRPGTAALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKT LRFQSSAV ALQ A+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTXLRFQSSAVMALQXASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136



>gb:SPHIS33_1721817 Fission yeast histone genes H3.3 and H4.3.
          Length = 136

 Score =  244 bits (624), Expect = 8e-64
 Identities = 123/136 (90%), Positives = 130/136 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARK+APATGGVKKPHR+RP TVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPPTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA EAYLV LFEDTNLCAIH KRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHGKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
            PKDMQLARR+RGER+
Sbjct: 121 QPKDMQLARRLRGERS 136



>gb:AY181029_1307635 Plasmodium falciparum histone H3 gene, complete
           cds.>gb:CR382399_1374932 Plasmodium falciparum
           chromosome 6, complete sequence; segment 2/5.
          Length = 136

 Score =  244 bits (624), Expect = 8e-64
 Identities = 123/136 (90%), Positives = 132/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKST GKAPRKQLA+KAARKSAP + G+KKPHR+RPGTVALREIR+YQKST+
Sbjct: 1   MARTKQTARKSTAGKAPRKQLASKAARKSAPISAGIKKPHRYRPGTVALREIRRYQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQD+KTDLRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDYKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136



>sp|P50564|H3_CHLRE Histone H3.
          Length = 134

 Score =  244 bits (623), Expect = 1e-63
 Identities = 128/135 (94%), Positives = 131/135 (97%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARK+ PATGGVKKPHR+RPGTVALREIRKYQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTEL 59

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAI AKRVTIM
Sbjct: 60  LIRKLPFQRLVREIAQDFKTDLRFQSQAVVALQEAAEAYLVGLFEDTNLCAITAKRVTIM 119

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLARRIRGERA
Sbjct: 120 PKDIQLARRIRGERA 134



>gb:ODI494850_1391113 Oikopleura dioica H3.2 gene for histone h3.2.
          Length = 136

 Score =  244 bits (622), Expect = 1e-63
 Identities = 122/134 (91%), Positives = 131/134 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGG+KKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGIKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVRE+AQ +K+DLRFQSSAV ALQEA+EAYLVGLFED+NLCAIHAKRVT+
Sbjct: 61  LLIRKLPFQRLVRELAQQWKSDLRFQSSAVMALQEASEAYLVGLFEDSNLCAIHAKRVTV 120

Query: 444 MPKDMQLARRIRGE 485
           MPKDM LARRIRGE
Sbjct: 121 MPKDMALARRIRGE 134



>sp|Q9U7D1|H3_MASBA Histone H3.>gb:AF140033_1244286 Phreatamoeba
           balamuthi histone H3 mRNA, complete cds.
          Length = 135

 Score =  244 bits (622), Expect = 1e-63
 Identities = 125/136 (91%), Positives = 132/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRK +ATKA RK+AP  GGVKKPHRFRPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKAVATKA-RKTAPPVGGVKKPHRFRPGTVALREIRRYQKSTE 59

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A++ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 60  LLIRKLPFQRLVREIAQDFKTDLRFQSAAIAALQEAAEAYLVGLFEDTNLCAIHAKRVTI 119

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 120 MPKDIQLARRIRGERA 135



>pir|T26178|T26178 hypothetical protein W05B10.1 - Caenorhabditis
           elegans>gb:CEW05B10_1368921 Caenorhabditis elegans
           cosmid W05B10, complete sequence.
          Length = 136

 Score =  243 bits (620), Expect = 2e-63
 Identities = 124/136 (91%), Positives = 130/136 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRK LATKAARKSA  TG VKK HRFRPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKALATKAARKSAIVTGSVKKVHRFRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LL+RKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLLRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKDMQLARRIRGER+
Sbjct: 121 MPKDMQLARRIRGERS 136



>pir|JQ1984|JQ1984 H3.3 like histone MH321 - mouse
          Length = 135

 Score =  243 bits (620), Expect = 2e-63
 Identities = 123/135 (91%), Positives = 131/135 (97%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTA KSTGGKAPRK+LATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTAHKSTGGKAPRKKLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLA RIR ERA
Sbjct: 121 PKDIQLACRIRRERA 135



>sp|Q9HDN1|H3_MORAP Histone H3.
          Length = 135

 Score =  243 bits (620), Expect = 2e-63
 Identities = 123/134 (91%), Positives = 129/134 (96%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA+EAYLV LFEDTNL AIHAKRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEASEAYLVSLFEDTNLAAIHAKRVTIQ 120

Query: 447 PKDMQLARRIRGER 488
           PKD+ LARR+RGER
Sbjct: 121 PKDIHLARRLRGER 134



>gb:CR382400_1375003 Plasmodium falciparum chromosome 6, complete
           sequence; segment 3/5.>gb:PFU15994_1395011 Plasmodium
           falciparum histone H3 mRNA, complete cds.
          Length = 136

 Score =  243 bits (619), Expect = 3e-63
 Identities = 122/136 (89%), Positives = 132/136 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP + G+KKPHR+RPGTVALREIRK+QKST+
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVSTGIKKPHRYRPGTVALREIRKFQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQ++KTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQEYKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136



>sp|P10651|H33_SCHPO Histone H3.3.
          Length = 135

 Score =  243 bits (619), Expect = 3e-63
 Identities = 122/135 (90%), Positives = 129/135 (95%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLA+KAARK+APATGGVKKPHR+RP TVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPPTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA EAYLV LFEDTNLCAIH KRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHGKRVTIQ 120

Query: 447 PKDMQLARRIRGERA 491
           PKDMQLARR+RGER+
Sbjct: 121 PKDMQLARRLRGERS 135



>pir|S41499|S41499 histone H3 - Tetrahymena
           thermophila>gb:TETHIS31A_1400049 Tetrahymena thermophila
           histone H3 (HHT1) gene, complete
           cds.>gb:TETHIS32A_1400050 Tetrahymena thermophila
           histone H3 (HHT2) gene, complete cds.
          Length = 136

 Score =  242 bits (618), Expect = 4e-63
 Identities = 123/135 (91%), Positives = 130/135 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTG KAPRKQLA+KAARKSAPATGG+KKPHRFRPGTVALREIRKYQKST+
Sbjct: 1   MARTKQTARKSTGAKAPRKQLASKAARKSAPATGGIKKPHRFRPGTVALREIRKYQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVR+IA +FK +LRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHA+RVTI
Sbjct: 61  LLIRKLPFQRLVRDIAHEFKAELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTI 120

Query: 444 MPKDMQLARRIRGER 488
           M KDMQLARRIRGER
Sbjct: 121 MTKDMQLARRIRGER 135



>gb:CR382133_1666750 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.>gb:CR382136_1669183
           Debaryomyces hansenii chromosome D of strain CBS767 of
           Debaryomyces hansenii.
          Length = 136

 Score =  241 bits (614), Expect = 1e-62
 Identities = 120/136 (88%), Positives = 131/136 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR++QKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
             KD+QLARR+RGER+
Sbjct: 121 QKKDIQLARRLRGERS 136



>gb:AAQ238321_1192476 Asellus aquaticus 5S rRNA gene, histone H2B,
           histone H2A, histone H3 and histone H4.
          Length = 136

 Score =  241 bits (614), Expect = 1e-62
 Identities = 124/136 (91%), Positives = 129/136 (94%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK+   
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKKSYY 120

Query: 444 MPKDMQLARRIRGERA 491
             K +QLARRIRGERA
Sbjct: 121 HAKGLQLARRIRGERA 136



>sp|P15511|H31_TETPY Histone H3.1.>pir|A28852|A28852 histone H3.1 -
           Tetrahymena pyriformis
          Length = 135

 Score =  240 bits (613), Expect = 1e-62
 Identities = 122/134 (91%), Positives = 129/134 (96%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTG KAPRKQLA+KAARKSAPATGG+KKPHRFRPGTVALREIRKYQKST+L
Sbjct: 1   ARTKQTARKSTGAKAPRKQLASKAARKSAPATGGIKKPHRFRPGTVALREIRKYQKSTDL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVR+IA +FK +LRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHA+RVTIM
Sbjct: 61  LIRKLPFQRLVRDIAHEFKAELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHARRVTIM 120

Query: 447 PKDMQLARRIRGER 488
            KDMQLARRIRGER
Sbjct: 121 TKDMQLARRIRGER 134



>pir|S11938|S11938 histone H3 - Emericella
           nidulans>gb:BX649607_1643508 Aspergillus fumigatus BAC
           pilot project supercontig; segment
           3/3.>gb:PFU314855_1699949 Penicillium funiculosum H4.1
           gene and H3 gene.>gb:ANH3GENE_1819422 A.nidulans gene
           for core histone for H3.
          Length = 136

 Score =  239 bits (611), Expect = 2e-62
 Identities = 119/136 (87%), Positives = 131/136 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARK+AP+TGGVKKPHR++PGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKAAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
             KD+QLARR+RGER+
Sbjct: 121 QSKDIQLARRLRGERS 136



>gb:AY062173_1564992 Neurospora crassa histone H3 (hh3) and histone
           H4 (hh4-1) genes, complete cds.>gb:AY669068_1620742
           Chaetomium globosum histone H3 mRNA, complete
           cds.>gb:NCB7K22_1690197 Neurospora crassa DNA linkage
           group II BAC clone B7K22.>gb:AF520775_1807865 Hypocrea
           jecorina histone H3 gene, complete cds.
          Length = 136

 Score =  239 bits (610), Expect = 3e-62
 Identities = 119/135 (88%), Positives = 130/135 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ E+YLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGER 488
             KD+QLARR+RGER
Sbjct: 121 QSKDIQLARRLRGER 135



>gb:MSU09462_1687261 Medicago sativa Regen S clone pH3c126 histone
           H3.2 mRNA, partial cds.
          Length = 127

 Score =  239 bits (609), Expect = 4e-62
 Identities = 122/127 (96%), Positives = 124/127 (97%)
 Frame = +3

Query: 111 KSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQ 290
           KSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQ
Sbjct: 1   KSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQ 60

Query: 291 RLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLAR 470
           RLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLAR
Sbjct: 61  RLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAR 120

Query: 471 RIRGERA 491
           RIRGERA
Sbjct: 121 RIRGERA 127



>gb:AE017350_1759187 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 138

 Score =  238 bits (608), Expect = 6e-62
 Identities = 122/138 (88%), Positives = 131/138 (94%), Gaps = 2/138 (1%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPA--TGGVKKPHRFRPGTVALREIRKYQKS 257
           MARTKQTARKSTGGKAPRKQLATKAARK AP+  +GGVKKPHR+RPGTVALREIR+YQKS
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKQAPSQVSGGVKKPHRYRPGTVALREIRRYQKS 60

Query: 258 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRV 437
           TELLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQEA+EAYLV LFEDTNL AIHAKRV
Sbjct: 61  TELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEASEAYLVSLFEDTNLAAIHAKRV 120

Query: 438 TIMPKDMQLARRIRGERA 491
           TI PKD+QLARR+RGER+
Sbjct: 121 TIQPKDLQLARRLRGERS 138



>gb:CR382138_1670773 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 136

 Score =  238 bits (608), Expect = 6e-62
 Identities = 119/136 (87%), Positives = 130/136 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP +GGVKKPHR++PGTVALREIR++QKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVSGGVKKPHRYKPGTVALREIRRFQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQEA EAYLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
             KD+QLARR+RGER+
Sbjct: 121 QKKDIQLARRLRGERS 136



>gb:MSHIS3C2_1687116 Medicago sativa mRNA for histone H3 clone
           pH3c-3.>gb:PSAJ2555_1702034 Pisum sativum mRNA for
           histone H3.
          Length = 123

 Score =  238 bits (607), Expect = 7e-62
 Identities = 122/123 (99%), Positives = 123/123 (100%)
 Frame = +3

Query: 123 GKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVR 302
           GKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVR
Sbjct: 1   GKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVR 60

Query: 303 EIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRG 482
           EIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRG
Sbjct: 61  EIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 120

Query: 483 ERA 491
           ERA
Sbjct: 121 ERA 123



>gb:BC066906_1987144 Homo sapiens cDNA clone MGC:87082
           IMAGE:5267388, complete cds.
          Length = 135

 Score =  238 bits (606), Expect = 9e-62
 Identities = 123/136 (90%), Positives = 129/136 (94%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKS P+T GVK PHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVK-PHRYRPGTVALREIRRYQKSTE 59

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDF TDLRFQS+ V ALQEA+EAYLVGL EDTNLCAIHAKRVTI
Sbjct: 60  LLIRKLPFQRLVREIAQDFNTDLRFQSAVVGALQEASEAYLVGLLEDTNLCAIHAKRVTI 119

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QLARRIRGERA
Sbjct: 120 MPKDIQLARRIRGERA 135



>gb:AF280091_1782874 Ajellomyces capsulatus histone H3 gene,
           complete cds.
          Length = 136

 Score =  238 bits (606), Expect = 9e-62
 Identities = 118/136 (86%), Positives = 130/136 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARK+AP+TGGVKKPHR++PG VALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKAAPSTGGVKKPHRYKPGAVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
             KD+QLARR+RGER+
Sbjct: 121 QSKDIQLARRLRGERS 136



>gb:GMU38425_1680656 Glycine max histone H3 gene, partial cds, clone
           S2.>gb:GMU38426_1680657 Glycine max histone H3 gene,
           partial cds, clone S3.>gb:GMU38427_1680658 Glycine max
           histone H3 gene, partial cds, clone S4.
          Length = 127

 Score =  238 bits (606), Expect = 9e-62
 Identities = 121/127 (95%), Positives = 124/127 (97%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVT+
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTM 120

Query: 444 MPKDMQL 464
           MPKD+QL
Sbjct: 121 MPKDIQL 127



>sp|P61832|H3_ASPFU Histone H3.>sp|P23753|H3_EMENI Histone
           H3.>sp|P61834|H3_PENFN Histone H3.
          Length = 135

 Score =  238 bits (606), Expect = 9e-62
 Identities = 118/135 (87%), Positives = 130/135 (96%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLA+KAARK+AP+TGGVKKPHR++PGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLASKAARKAAPSTGGVKKPHRYKPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAKRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTIQ 120

Query: 447 PKDMQLARRIRGERA 491
            KD+QLARR+RGER+
Sbjct: 121 SKDIQLARRLRGERS 135



>pir|S07350|S07350 histone H3 - Neurospora crassa>gb:NCHISH3_1690569
           Neurospora crassa DNA for histone H3.
          Length = 136

 Score =  237 bits (605), Expect = 1e-61
 Identities = 118/135 (87%), Positives = 129/135 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFK+DLRFQSSA+  LQE+ E+YLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKSDLRFQSSAIGLLQESVESYLVSLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGER 488
             KD+QLARR+RGER
Sbjct: 121 QSKDIQLARRLRGER 135



>sp|P07041|H3_NEUCR Histone H3.>sp|P61835|H3_TRIRE Histone H3.
          Length = 135

 Score =  237 bits (605), Expect = 1e-61
 Identities = 118/134 (88%), Positives = 129/134 (96%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ E+YLV LFEDTNLCAIHAKRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQ 120

Query: 447 PKDMQLARRIRGER 488
            KD+QLARR+RGER
Sbjct: 121 SKDIQLARRLRGER 134



>gb:TAU38422_1724710 Triticum aestivum histone H3 gene, partial cds,
           clone W1.
          Length = 127

 Score =  237 bits (604), Expect = 2e-61
 Identities = 121/127 (95%), Positives = 123/127 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALRE RKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALRETRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQL 464
           MPKD+QL
Sbjct: 121 MPKDIQL 127



>gb:GMU38424_1680655 Glycine max histone H3 gene, partial cds, clone
           S1.
          Length = 127

 Score =  236 bits (601), Expect = 4e-61
 Identities = 121/127 (95%), Positives = 123/127 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSA  TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSASTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQL 464
           MPKD+QL
Sbjct: 121 MPKDIQL 127



>gb:CR382125_1657601 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 176

 Score =  236 bits (601), Expect = 4e-61
 Identities = 118/136 (86%), Positives = 130/136 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR++QKSTE
Sbjct: 41  MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE 100

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI
Sbjct: 101 LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI 160

Query: 444 MPKDMQLARRIRGERA 491
             KD++LARR+RGER+
Sbjct: 161 QKKDIKLARRLRGERS 176



>pir|S45265|HSBY3 histone H3 - yeast (Saccharomyces
           cerevisiae)>pir|S07892|HSVK3L histone H3 - yeast
           (Kluyveromyces marxianus var.
           lactis)>gb:AY558343_1614570 Saccharomyces cerevisiae
           clone FLH111339.01X YBR010W gene, complete
           cds.>gb:AY692987_1623034 Saccharomyces cerevisiae clone
           FLH114237.01X YNL031C gene, complete
           cds.>gb:CR380949_1649586 Candida glabrata strain CBS138
           chromosome C complete sequence.>gb:CR380954_1651485
           Candida glabrata strain CBS138 chromosome H complete
           sequence.>gb:CR380959_1653939 Candida glabrata strain
           CBS138 chromosome M complete
           sequence.>gb:CR382125_1658007 Kluyveromyces lactis
           strain NRRL Y-1140 chromosome E of strain NRRL Y-1140 of
           Kluyveromyces lactis.>gb:KLTRPLOC_1683681 Kluyveromyces
           lactis TRP1 gene, HHT1 gene and IPP gene for
           N-(5'-phosphoribosyl)anthranilate isomerase, histone H3
           and inorganic pyrophosphatase (EC 3.6.1.1)
           respectively.>gb:SCH3H401_1708420 Yeast genes for
           histone H3 and H4 (copy-I genes from
           PMS191).>gb:SCH3H402_1708422 Yeast genes for histone H3
           and H4 (copy-II genes from plasmids PMS201 and
           PMS202).>gb:SCYBR010W_1711223 S.cerevisiae chromosome II
           reading frame ORF YBR010w.>gb:SCYNL031C_1713617
           S.cerevisiae chromosome XIV reading frame ORF
           YNL031c.>gb:AE016817_1747182 Ashbya gossypii (=
           Eremothecium gossypii) ATCC 10895 chromosome IV,
           complete sequence.>gb:AE016818_1748161 Ashbya gossypii
           (= Eremothecium gossypii) ATCC 10895 chromosome V,
           complete sequence.>gb:AF296170_1783983 Zygosaccharomyces
           bailii histone H3 gene, complete
           cds.>gb:AF520060_1807839 Candida glabrata YBR005Wp
           (YBR005W), UGA5p (UGA5), YBR007Cp (YBR007C), HHF1p
           (HHF1), HHT1p (HHT1), and TRP1p (TRP1) genes, complete
           cds; tRNA-Thr gene, complete sequence; MNT3Ap (MNT3A)
           gene, complete cds; and MNT3Bp (MNT3B) gene, partial
           cds.
          Length = 136

 Score =  236 bits (601), Expect = 4e-61
 Identities = 118/136 (86%), Positives = 130/136 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR++QKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
             KD++LARR+RGER+
Sbjct: 121 QKKDIKLARRLRGERS 136



>sp|Q9P427|H3_AJECA Histone H3.
          Length = 135

 Score =  236 bits (601), Expect = 4e-61
 Identities = 117/135 (86%), Positives = 129/135 (95%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLA+KAARK+AP+TGGVKKPHR++PG VALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLASKAARKAAPSTGGVKKPHRYKPGAVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAKRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTIQ 120

Query: 447 PKDMQLARRIRGERA 491
            KD+QLARR+RGER+
Sbjct: 121 SKDIQLARRLRGERS 135



>gb:AE017342_1754716 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 138

 Score =  235 bits (599), Expect = 6e-61
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 2/138 (1%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARK--SAPATGGVKKPHRFRPGTVALREIRKYQKS 257
           MARTKQTARKSTGGKAPRKQLATKAARK  +  A GGVKKPHR+RPGTVALREIR+YQKS
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKQTTTSAAGGVKKPHRYRPGTVALREIRRYQKS 60

Query: 258 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRV 437
           TELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLV LFEDTNL AIHAKRV
Sbjct: 61  TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVSLFEDTNLAAIHAKRV 120

Query: 438 TIMPKDMQLARRIRGERA 491
           TI PKD+QLARR+RGER+
Sbjct: 121 TIQPKDLQLARRLRGERS 138



>gb:AY125216_1301669 Gromphadorhina portentosa histone 3 gene,
           partial cds.>gb:AY125217_1301670 Supella longipalpa
           histone 3 gene, partial cds.>gb:AY125218_1301671 Doru
           spiculiferum histone 3 gene, partial
           cds.>gb:AY125219_1301672 Echinosoma sp. DM11 histone 3
           gene, partial cds.>gb:AY125220_1301673 Chelisoches morio
           histone 3 gene, partial cds.>gb:AY125221_1301674
           Oligotoma nigra histone 3 gene, partial
           cds.>gb:AY125222_1301675 Teratembia n. sp. EB07 histone
           3 gene, partial cds.>gb:AY125223_1301676 Hexagenia sp.
           EP03 histone 3 gene, partial cds.>gb:AY125224_1301677
           Cinygmula sp. EP13 histone 3 gene, partial
           cds.>gb:AY125227_1301680 Tenodera aridifolia histone 3
           gene, partial cds.>gb:AY125228_1301681 Ophiogomphus
           severus histone 3 gene, partial cds.>gb:AY125229_1301682
           Argia vivida histone 3 gene, partial
           cds.>gb:AY125230_1301683 Stenopelmatus fuscus histone 3
           gene, partial cds.>gb:AY125231_1301684 Melanoplus sp.
           OR18 histone 3 gene, partial cds.>gb:AY125232_1301685
           Pterophylla camellifolia histone 3 gene, partial
           cds.>gb:AY125233_1301686 Isoperla davisi histone 3 gene,
           partial cds.>gb:AY125234_1301687 Plumiperla diversa
           histone 3 gene, partial cds.>gb:AY125235_1301688
           Diapheromera femorata histone 3 gene, partial
           cds.>gb:AY125238_1301691 Eurycantha insularis histone 3
           gene, partial cds.>gb:AY125241_1301694 Heteropteryx
           dilatata histone 3 gene, partial
           cds.>gb:AY125243_1301696 Anisomorpha ferruginea histone
           3 gene, partial cds.>gb:AY125244_1301697 Paraphasma
           rufipes histone 3 gene, partial cds.>gb:AY125245_1301698
           Phyllium bioculatum histone 3 gene, partial
           cds.>gb:AY125246_1301699 Timema knulli histone 3 gene,
           partial cds.>gb:AY125249_1301702 Sceptrophasma
           langkawicensis histone 3 gene, partial
           cds.>gb:AY125251_1301704 Neohirasea maerens histone 3
           gene, partial cds.>gb:AY125254_1301707 Lopaphus
           perakensis histone 3 gene, partial
           cds.>gb:AY125255_1301708 Baculum thaii histone 3 gene,
           partial cds.>gb:AY125261_1301714 Lamponius guerini
           histone 3 gene, partial cds.>gb:AY125263_1301716
           Bacillus rossius histone 3 gene, partial
           cds.>gb:AY125264_1301717 Sipyloidea sipylus histone 3
           gene, partial cds.>gb:AY125265_1301718 Lopaphus
           sphalerus histone 3 gene, partial cds.
          Length = 124

 Score =  235 bits (599), Expect = 6e-61
 Identities = 119/124 (95%), Positives = 123/124 (99%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDM 458
           PKD+
Sbjct: 121 PKDI 124



>gb:AY125225_1301678 Grylloblatta campodeiformis histone 3 gene,
           partial cds.
          Length = 123

 Score =  234 bits (598), Expect = 8e-61
 Identities = 119/123 (96%), Positives = 122/123 (99%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKD 455
           PKD
Sbjct: 121 PKD 123



>pir|B28852|B28852 histone H3.2 - Tetrahymena pyriformis
          Length = 136

 Score =  234 bits (597), Expect = 1e-60
 Identities = 118/135 (87%), Positives = 127/135 (94%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTG KAPRKQLATKAARKSAP +GGVKKPH+FRPGTVALREIRKYQK+T+
Sbjct: 1   MARTKQTARKSTGVKAPRKQLATKAARKSAPVSGGVKKPHKFRPGTVALREIRKYQKTTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVR+IA + K D+RFQS A+ ALQEAAEAYLVGLFEDTNLCAIHA+RVTI
Sbjct: 61  LLIRKLPFQRLVRDIAMEMKNDIRFQSQAILALQEAAEAYLVGLFEDTNLCAIHARRVTI 120

Query: 444 MPKDMQLARRIRGER 488
           M KDMQLARRIRGER
Sbjct: 121 MTKDMQLARRIRGER 135



>gb:AF520061_1807845 Candida glabrata SOK1p (SOK1) gene, partial
           cds; HHF2p (HHF2) and HHT2p (HHT2) genes, complete cds;
           and IPP1p (IPP1) gene, partial cds.
          Length = 136

 Score =  234 bits (596), Expect = 1e-60
 Identities = 117/136 (86%), Positives = 129/136 (94%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR++QKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
              D++LARR+RGER+
Sbjct: 121 QKNDIKLARRLRGERS 136



>gb:TAU38423_1724711 Triticum aestivum histone H3 gene, partial cds,
           clone W2.
          Length = 127

 Score =  234 bits (596), Expect = 1e-60
 Identities = 119/127 (93%), Positives = 123/127 (96%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKST+
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRL+REIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTN CAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLLREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNPCAIHAKRVTI 120

Query: 444 MPKDMQL 464
           MPKD+QL
Sbjct: 121 MPKDIQL 127



>sp|P61833|H31_CANGA Histone H3.1.>sp|P61831|H3_KLULA Histone
           H3.>sp|P61830|H3_YEAST Histone H3.>sp|P61836|H3_ZYGBA
           Histone H3.
          Length = 135

 Score =  234 bits (596), Expect = 1e-60
 Identities = 117/135 (86%), Positives = 129/135 (95%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR++QKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQ 120

Query: 447 PKDMQLARRIRGERA 491
            KD++LARR+RGER+
Sbjct: 121 KKDIKLARRLRGERS 135



>gb:MSU09463_1687262 Medicago sativa Regen S clone pH3c127 histone
           H3.2 mRNA, partial cds.
          Length = 124

 Score =  233 bits (595), Expect = 2e-60
 Identities = 119/124 (95%), Positives = 121/124 (97%)
 Frame = +3

Query: 120 GGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLV 299
           GGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLV
Sbjct: 1   GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLV 60

Query: 300 REIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIR 479
           REIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIR
Sbjct: 61  REIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR 120

Query: 480 GERA 491
           GERA
Sbjct: 121 GERA 124



>gb:AY554000_1613520 Saccharomyces cerevisiae strain M5 histone H3
           (HHT2) gene, partial cds.>gb:AY554001_1613521
           Saccharomyces cerevisiae strain M8 histone H3 (HHT2)
           gene, partial cds.>gb:AY554002_1613522 Saccharomyces
           cerevisiae strain M13 histone H3 (HHT2) gene, partial
           cds.>gb:AY554003_1613523 Saccharomyces cerevisiae strain
           M14 histone H3 (HHT2) gene, partial
           cds.>gb:AY554004_1613524 Saccharomyces cerevisiae strain
           M22 histone H3 (HHT2) gene, partial
           cds.>gb:AY554005_1613525 Saccharomyces cerevisiae strain
           M32 histone H3 (HHT2) gene, partial
           cds.>gb:AY554006_1613526 Saccharomyces cerevisiae strain
           M34 histone H3 (HHT2) gene, partial
           cds.>gb:AY554007_1613527 Saccharomyces cerevisiae strain
           YPS163 histone H3 (HHT2) gene, partial
           cds.>gb:AY554008_1613528 Saccharomyces cerevisiae strain
           S288C histone H3 (HHT2) gene, partial cds.
          Length = 134

 Score =  233 bits (595), Expect = 2e-60
 Identities = 117/134 (87%), Positives = 128/134 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR++QKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGE 485
             KD++LARR+RGE
Sbjct: 121 QKKDIKLARRLRGE 134



>pir|A23981|HSDK34 histone H3.4 - muscovy duck>gb:CIIHISH3A_2569707
           Duck H3.4 variant histone gene.
          Length = 136

 Score =  233 bits (595), Expect = 2e-60
 Identities = 121/136 (88%), Positives = 126/136 (92%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTA KSTG KAPRKQLATKAA KSAPA GGVKKPH +RPGTVAL EI +YQKSTE
Sbjct: 1   MARTKQTACKSTGRKAPRKQLATKAAHKSAPAMGGVKKPHCYRPGTVALHEIHRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLI KLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRV+I
Sbjct: 61  LLICKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVSI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKD+QL RRIRGERA
Sbjct: 121 MPKDIQLTRRIRGERA 136



>pir|C86332|C86332 probable histone H3 [imported] - Arabidopsis
           thaliana>gb:AE005172_890951 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007797_1536219 Arabidopsis thaliana
           chromosome I BAC F6F9 genomic sequence, complete
           sequence.
          Length = 137

 Score =  233 bits (593), Expect = 3e-60
 Identities = 122/137 (89%), Positives = 127/137 (92%), Gaps = 1/137 (0%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSA-PATGGVKKPHRFRPGTVALREIRKYQKST 260
           MARTKQTARKSTGGK PRK+LATKAARK+  P  GGVK+ HRFRPGTVALREIRKYQKST
Sbjct: 1   MARTKQTARKSTGGKGPRKELATKAARKTRRPYRGGVKRAHRFRPGTVALREIRKYQKST 60

Query: 261 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           +LLIRKLPFQRLVREIAQDFK DLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  DLLIRKLPFQRLVREIAQDFKVDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVT 120

Query: 441 IMPKDMQLARRIRGERA 491
           IM KD+QLARRIRGERA
Sbjct: 121 IMSKDIQLARRIRGERA 137



>sp|P15512|H32_TETPY Histone H3.2.
          Length = 135

 Score =  232 bits (592), Expect = 4e-60
 Identities = 117/134 (87%), Positives = 126/134 (94%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTG KAPRKQLATKAARKSAP +GGVKKPH+FRPGTVALREIRKYQK+T+L
Sbjct: 1   ARTKQTARKSTGVKAPRKQLATKAARKSAPVSGGVKKPHKFRPGTVALREIRKYQKTTDL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVR+IA + K D+RFQS A+ ALQEAAEAYLVGLFEDTNLCAIHA+RVTIM
Sbjct: 61  LIRKLPFQRLVRDIAMEMKNDIRFQSQAILALQEAAEAYLVGLFEDTNLCAIHARRVTIM 120

Query: 447 PKDMQLARRIRGER 488
            KDMQLARRIRGER
Sbjct: 121 TKDMQLARRIRGER 134



>sp|Q8NJS5|H32_CANGA Histone H3.2.
          Length = 135

 Score =  232 bits (591), Expect = 5e-60
 Identities = 116/135 (85%), Positives = 128/135 (94%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR++QKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNL AIHAKRVTI 
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQ 120

Query: 447 PKDMQLARRIRGERA 491
             D++LARR+RGER+
Sbjct: 121 KNDIKLARRLRGERS 135



>gb:AY125258_1301711 Tropidoderus childrenii histone 3 gene, partial
           cds.
          Length = 122

 Score =  231 bits (590), Expect = 7e-60
 Identities = 117/122 (95%), Positives = 121/122 (99%)
 Frame = +3

Query: 93  TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLI 272
           TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLI
Sbjct: 1   TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLI 60

Query: 273 RKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPK 452
           RKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPK
Sbjct: 61  RKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPK 120

Query: 453 DM 458
           D+
Sbjct: 121 DI 122



>gb:AY125239_1301692 Extatosoma tiaratum histone 3 gene, partial
           cds.>gb:AY125259_1301712 Haaniella dehaanii histone 3
           gene, partial cds.
          Length = 123

 Score =  231 bits (590), Expect = 7e-60
 Identities = 117/122 (95%), Positives = 121/122 (99%)
 Frame = +3

Query: 93  TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLI 272
           TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLI
Sbjct: 2   TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLI 61

Query: 273 RKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPK 452
           RKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPK
Sbjct: 62  RKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPK 121

Query: 453 DM 458
           D+
Sbjct: 122 DI 123



>gb:AF466825_1273585 Euplotes octocarinatus histone H3v gene,
           complete cds.>gb:ECU75429_1384243 Euplotes crassus
           macronuclear linear DNA, complete sequence, with histone
           H3 gene, complete cds.
          Length = 136

 Score =  231 bits (590), Expect = 7e-60
 Identities = 117/136 (86%), Positives = 126/136 (92%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARK+ GGKAPRK +  K+ARK+A  T G+KKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKNVGGKAPRKHIGQKSARKTASTTAGMKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQ+FK DLRFQSSAV ALQEAAEAYLV LFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQEFKGDLRFQSSAVLALQEAAEAYLVSLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           MPKDMQLARRIRGER+
Sbjct: 121 MPKDMQLARRIRGERS 136



>pir|S41501|S41501 histone H3.3 - Tetrahymena
           thermophila>gb:TETHIS33A_1400051 Tetrahymena thermophila
           histone variant hv2 (HHT3) gene, complete cds.
          Length = 136

 Score =  231 bits (590), Expect = 7e-60
 Identities = 116/135 (85%), Positives = 127/135 (94%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTG KAPRKQLATKAARKSAP +GGVKKPH+FRPGTVALREIRKYQK+T+
Sbjct: 1   MARTKQTARKSTGVKAPRKQLATKAARKSAPVSGGVKKPHKFRPGTVALREIRKYQKTTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVR+IA + K+D+RFQS A+ ALQEAAEAYLVGLFEDTNLCAIHA+RVTI
Sbjct: 61  LLIRKLPFQRLVRDIAMEMKSDIRFQSQAILALQEAAEAYLVGLFEDTNLCAIHARRVTI 120

Query: 444 MPKDMQLARRIRGER 488
           M KD+ LARRIRGER
Sbjct: 121 MTKDLHLARRIRGER 135



>sp|P06902|H34_CAIMO Histone H3.4.
          Length = 135

 Score =  231 bits (590), Expect = 7e-60
 Identities = 120/135 (88%), Positives = 125/135 (92%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTA KSTG KAPRKQLATKAA KSAPA GGVKKPH +RPGTVAL EI +YQKSTEL
Sbjct: 1   ARTKQTACKSTGRKAPRKQLATKAAHKSAPAMGGVKKPHCYRPGTVALHEIHRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LI KLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRV+IM
Sbjct: 61  LICKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVSIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKD+QL RRIRGERA
Sbjct: 121 PKDIQLTRRIRGERA 135



>gb:ENU12630_1676749 Emericella nidulans R153 core histone H3 (H3)
           gene and H4.1 (H4.1) gene, complete cds.
          Length = 140

 Score =  229 bits (585), Expect = 3e-59
 Identities = 119/140 (85%), Positives = 131/140 (93%), Gaps = 4/140 (2%)
 Frame = +3

Query: 84  MARTKQTARKS---TGGKAPRKQLATKAARKSAPATGGVKKPHRFRPG-TVALREIRKYQ 251
           MARTKQTARKS   TGGKAPRKQLA+KAARK+AP+TGGVKKPHR++PG TVALREIR+YQ
Sbjct: 1   MARTKQTARKSSKSTGGKAPRKQLASKAARKAAPSTGGVKKPHRYKPGGTVALREIRRYQ 60

Query: 252 KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK 431
           KSTELLIRKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAK
Sbjct: 61  KSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAK 120

Query: 432 RVTIMPKDMQLARRIRGERA 491
           RVTI  KD+QLARR+RGER+
Sbjct: 121 RVTIQSKDIQLARRLRGERS 140



>gb:AB116640_1527592 Lentinula edodes Le. fbg21 mRNA for histone H3,
           complete cds.
          Length = 143

 Score =  229 bits (585), Expect = 3e-59
 Identities = 121/143 (84%), Positives = 128/143 (89%), Gaps = 7/143 (4%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPA-------TGGVKKPHRFRPGTVALREIR 242
           MARTKQTARKSTGGKAPRKQLA+K+A KS+ A        GGVKKPHRFRPGTVALREIR
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKSATKSSAARKTAQGAAGGVKKPHRFRPGTVALREIR 60

Query: 243 KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAI 422
           +YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEAAEAYLV LFEDTNL AI
Sbjct: 61  RYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVSLFEDTNLAAI 120

Query: 423 HAKRVTIMPKDMQLARRIRGERA 491
           HAKRVTI PKD+ LARR+RGER+
Sbjct: 121 HAKRVTIQPKDLALARRLRGERS 143



>sp|P90543|H3_EUPCR Histone H3.
          Length = 135

 Score =  229 bits (585), Expect = 3e-59
 Identities = 116/135 (85%), Positives = 125/135 (92%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARK+ GGKAPRK +  K+ARK+A  T G+KKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKNVGGKAPRKHIGQKSARKTASTTAGMKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQ+FK DLRFQSSAV ALQEAAEAYLV LFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQEFKGDLRFQSSAVLALQEAAEAYLVSLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGERA 491
           PKDMQLARRIRGER+
Sbjct: 121 PKDMQLARRIRGERS 135



>sp|P41353|H33_TETTH Histone H3.3 (HV2).
          Length = 135

 Score =  229 bits (585), Expect = 3e-59
 Identities = 115/134 (85%), Positives = 126/134 (94%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTG KAPRKQLATKAARKSAP +GGVKKPH+FRPGTVALREIRKYQK+T+L
Sbjct: 1   ARTKQTARKSTGVKAPRKQLATKAARKSAPVSGGVKKPHKFRPGTVALREIRKYQKTTDL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVR+IA + K+D+RFQS A+ ALQEAAEAYLVGLFEDTNLCAIHA+RVTIM
Sbjct: 61  LIRKLPFQRLVRDIAMEMKSDIRFQSQAILALQEAAEAYLVGLFEDTNLCAIHARRVTIM 120

Query: 447 PKDMQLARRIRGER 488
            KD+ LARRIRGER
Sbjct: 121 TKDLHLARRIRGER 134



>gb:AY667159_1432272 Felis catus clone E95 H3 histone family 3A
           mRNA, partial cds.
          Length = 122

 Score =  228 bits (581), Expect = 8e-59
 Identities = 114/122 (93%), Positives = 121/122 (99%)
 Frame = +3

Query: 126 KAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVRE 305
           KAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPFQRLVRE
Sbjct: 1   KAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVRE 60

Query: 306 IAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGE 485
           IAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGE
Sbjct: 61  IAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 120

Query: 486 RA 491
           RA
Sbjct: 121 RA 122



>gb:AY125226_1301679 Nasutitermes sp. IS06 histone 3 gene, partial
           cds.
          Length = 124

 Score =  228 bits (581), Expect = 8e-59
 Identities = 116/124 (93%), Positives = 120/124 (96%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPR QLATKAA KSAPATGGVK PHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRNQLATKAACKSAPATGGVKNPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDM 458
           PKD+
Sbjct: 121 PKDI 124



>gb:PFU14735_1395010 Plasmodium falciparum histone H3 mRNA, complete
           cds.
          Length = 136

 Score =  228 bits (580), Expect = 1e-58
 Identities = 116/136 (85%), Positives = 126/136 (92%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           M RTKQT RKSTGGKAPRKQLA+K  RKSAP + G+KKPHR+RPGTVALREIRK QKST+
Sbjct: 1   MERTKQTERKSTGGKAPRKQLASKEERKSAPVSTGIKKPHRYRPGTVALREIRKSQKSTD 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQ++KTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQEYKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQLARRIRGERA 491
           + KD+QLARRIRGER+
Sbjct: 121 ILKDIQLARRIRGERS 136



>pir|B96786|B96786 protein F10A5.19 [imported] - Arabidopsis
           thaliana>gb:AE005173_895098 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC006434_1534222 Genomic sequence for
           Arabidopsis thaliana BAC F10A5, complete sequence.
          Length = 236

 Score =  226 bits (576), Expect = 3e-58
 Identities = 116/124 (93%), Positives = 118/124 (95%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKS GGKAPR  LATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSHGGKAPRTLLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQD+KTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKD 455
           MPKD
Sbjct: 121 MPKD 124



 Score =  210 bits (534), Expect = 2e-53
 Identities = 107/112 (95%), Positives = 109/112 (97%)
 Frame = +3

Query: 156 AARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLR 335
           AARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLR
Sbjct: 125 AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLR 184

Query: 336 FQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA 491
           FQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct: 185 FQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 236



>gb:AX972809_1488118 Sequence 3612 from Patent EP1104808.
          Length = 136

 Score =  224 bits (571), Expect = 1e-57
 Identities = 116/132 (87%), Positives = 123/132 (93%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS+     +  A+  LVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSAXSVRCRRLAKX-LVGLFEDTNLCAIHAKRVTI 119

Query: 444 MPKDMQLARRIR 479
           MPKD+QLARRIR
Sbjct: 120 MPKDIQLARRIR 131



>gb:DDU76664_1377418 Dictyostelium discoideum histone H3 (DdH3)
           mRNA, complete cds.
          Length = 139

 Score =  224 bits (571), Expect = 1e-57
 Identities = 114/139 (82%), Positives = 125/139 (89%), Gaps = 3/139 (2%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAP---ATGGVKKPHRFRPGTVALREIRKYQK 254
           MARTKQTARKSTG K PRK + +K A K  P   ++GGVKK HRFRPGTVALREIRKYQK
Sbjct: 1   MARTKQTARKSTGAKVPRKHIGSKQAHKQTPVSSSSGGVKKVHRFRPGTVALREIRKYQK 60

Query: 255 STELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           ST+LLIRKLPFQRLVREIAQ+FKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  STDLLIRKLPFQRLVREIAQEFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR 120

Query: 435 VTIMPKDMQLARRIRGERA 491
           VTIMPKD+ LARRIRGER+
Sbjct: 121 VTIMPKDIHLARRIRGERS 139



>gb:AY125237_1301690 Orxines macklottii histone 3 gene, partial
           cds.>gb:AY125268_1301721 Dimorphodes prostasis histone 3
           gene, partial cds.
          Length = 118

 Score =  224 bits (571), Expect = 1e-57
 Identities = 114/118 (96%), Positives = 117/118 (99%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 118



>gb:ECA270221_1384167 Entodinium caudatum partial mRNA for histone
           H3 (H3 gene), clone L36.
          Length = 134

 Score =  224 bits (570), Expect = 1e-57
 Identities = 113/134 (84%), Positives = 124/134 (92%), Gaps = 2/134 (1%)
 Frame = +3

Query: 93  TKQTARKST--GGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           TKQTARK     GKAPRKQ+  KAARKSAPA GG+KKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   TKQTARKQATPAGKAPRKQVGNKAARKSAPAMGGIKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVRE+AQ FK+DLRFQS+AV ALQEA+E+YLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREVAQQFKSDLRFQSTAVLALQEASESYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGER 488
           PKD+QLARRIRGE+
Sbjct: 121 PKDIQLARRIRGEK 134



>gb:MSHIS3C3_1687117 Medicago sativa mRNA for histone H3 clone
           pH3c-11.
          Length = 119

 Score =  223 bits (567), Expect = 3e-57
 Identities = 114/119 (95%), Positives = 116/119 (97%)
 Frame = +3

Query: 135 RKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQ 314
           RKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQ
Sbjct: 1   RKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQ 60

Query: 315 DFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA 491
           DFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct: 61  DFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 119



>pir|S04521|S04521 histone H3 (clone pH3c-1) - alfalfa (fragment)
          Length = 119

 Score =  223 bits (567), Expect = 3e-57
 Identities = 114/119 (95%), Positives = 116/119 (97%)
 Frame = +3

Query: 135 RKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQ 314
           RKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQ
Sbjct: 1   RKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQ 60

Query: 315 DFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA 491
           DFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct: 61  DFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 119



>gb:AJ849511_1284696 Actinoposthia beklemischevi partial H3 gene for
           histone H3.
          Length = 119

 Score =  222 bits (566), Expect = 4e-57
 Identities = 111/119 (93%), Positives = 118/119 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           LLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+E+YLVGLFEDTNLCAIHAKRVT
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSTAIMALQEASESYLVGLFEDTNLCAIHAKRVT 119



>gb:AY725658_1624582 Cylindrocladium asiaticum strain CBS 114073
           histone H3 gene, exons 1 through 3 and partial
           cds.>gb:AY725662_1624586 Cylindrocladium colombiense
           strain CBS 112220 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725663_1624587 Cylindrocladium
           colombiense strain CBS 112221 histone H3 gene, exons 1
           through 3 and partial cds.>gb:AY725673_1624597
           Cylindrocladium multiphialidicum strain CBS 112678
           histone H3 gene, exons 1 through 3 and partial
           cds.>gb:AY725676_1624600 Calonectria ilicicola strain
           CBS 190.50 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725677_1624601 Calonectria ilicicola
           strain CBS 111805 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725678_1624602 Calonectria ilicicola
           strain CBS 112209 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725679_1624603 Calonectria ilicicola
           strain CBS 112210 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725680_1624604 Calonectria ilicicola
           strain CBS 112211 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725681_1624605 Calonectria ilicicola
           strain CBS 112212 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725682_1624606 Calonectria ilicicola
           strain CBS 112213 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725683_1624607 Calonectria ilicicola
           strain CBS 112214 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725684_1624608 Calonectria ilicicola
           strain CBS 112215 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725685_1624609 Calonectria ilicicola
           strain CBS 112216 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725686_1624610 Calonectria ilicicola
           strain CBS 112217 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725687_1624611 Calonectria ilicicola
           strain CBS 112218 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725688_1624612 Calonectria ilicicola
           strain CBS 112219 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725690_1624614 Calonectria ilicicola
           strain CBS 113783 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AY725692_1624616 Calonectria ilicicola
           strain CPC 4873 histone H3 gene, exons 1 through 3 and
           partial cds.>gb:AF291059_1783691 Fusarium proliferatum
           NRRL 31071 histone H3 gene, partial
           cds.>gb:AF291062_1783692 Fusarium proliferatum strain
           NRRL22944 histone H3 gene, partial
           cds.>gb:AF291063_1783693 Fusarium fujikuroi strain
           NRRL13566 histone H3 gene, partial
           cds.>gb:AF336914_1787606 Fusarium proliferatum MUCL
           31970 histone H3 gene, partial cds.
          Length = 126

 Score =  222 bits (565), Expect = 5e-57
 Identities = 110/126 (87%), Positives = 121/126 (96%)
 Frame = +3

Query: 93  TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLI 272
           TKQTAR+STGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLI
Sbjct: 1   TKQTARRSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLI 60

Query: 273 RKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPK 452
           RKLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ E+YLV LFEDTNLCAIHAKRVTI  K
Sbjct: 61  RKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSK 120

Query: 453 DMQLAR 470
           D+QLAR
Sbjct: 121 DIQLAR 126



>gb:ECA270203_1384149 Entodinium caudatum partial mRNA for histone
           H3, clone R.
          Length = 134

 Score =  222 bits (565), Expect = 5e-57
 Identities = 112/134 (83%), Positives = 123/134 (91%), Gaps = 2/134 (1%)
 Frame = +3

Query: 93  TKQTARKST--GGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           TKQTARK     GKAPRKQ+  KAARKSAP + G+KKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   TKQTARKQATPAGKAPRKQVGNKAARKSAPVSSGIKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVRE+AQ FK+DLRFQSSAV ALQEA+E+YLVGLFEDTNLCAIHAKRVTIM
Sbjct: 61  LIRKLPFQRLVREVAQQFKSDLRFQSSAVLALQEASESYLVGLFEDTNLCAIHAKRVTIM 120

Query: 447 PKDMQLARRIRGER 488
           PKD+QLARRIRGE+
Sbjct: 121 PKDIQLARRIRGEK 134



>gb:AY125236_1301689 Oreophoetes peruana histone 3 gene, partial
           cds.>gb:AY125247_1301700 Gratidia fritzchei histone 3
           gene, partial cds.>gb:AY125248_1301701 Baculini sp. WS22
           histone 3 gene, partial cds.
          Length = 118

 Score =  221 bits (564), Expect = 7e-57
 Identities = 113/118 (95%), Positives = 116/118 (98%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           A TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   AGTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 118



>gb:AY125260_1301713 Sungaya inexpectata histone 3 gene, partial
           cds.
          Length = 118

 Score =  221 bits (562), Expect = 1e-56
 Identities = 112/116 (96%), Positives = 115/116 (99%)
 Frame = +3

Query: 93  TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLI 272
           TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLI
Sbjct: 3   TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLI 62

Query: 273 RKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           RKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 63  RKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 118



>gb:AY125252_1301705 Neohirasea sp. WS29 histone 3 gene, partial
           cds.>gb:AY125256_1301709 Baculum extradentatum histone 3
           gene, partial cds.>gb:AY125262_1301715 Eurycnema goliath
           histone 3 gene, partial cds.
          Length = 116

 Score =  221 bits (562), Expect = 1e-56
 Identities = 112/116 (96%), Positives = 115/116 (99%)
 Frame = +3

Query: 93  TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLI 272
           TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLI
Sbjct: 1   TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLI 60

Query: 273 RKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           RKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  RKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 116



>gb:AY125242_1301695 Aretaon asperrimus histone 3 gene, partial
           cds.>gb:AY125253_1301706 Carausius morosus histone 3
           gene, partial cds.>gb:AY125257_1301710 Medaura sp. WS34
           histone 3 gene, partial cds.
          Length = 117

 Score =  221 bits (562), Expect = 1e-56
 Identities = 112/116 (96%), Positives = 115/116 (99%)
 Frame = +3

Query: 93  TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLI 272
           TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLI
Sbjct: 2   TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLI 61

Query: 273 RKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           RKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 62  RKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 117



>gb:NPHISTOH3_1691072 N.pseudonarcissus mRNA for histone H3.
          Length = 128

 Score =  220 bits (561), Expect = 2e-56
 Identities = 112/125 (89%), Positives = 116/125 (92%)
 Frame = +3

Query: 117 TGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRL 296
           TGGK  RKQ ATKAAR SAPATGGVKKPHRFRPGTVALREIR+YQKS ELLIRK PFQR 
Sbjct: 4   TGGKGXRKQXATKAARXSAPATGGVKKPHRFRPGTVALREIRRYQKSXELLIRKXPFQRX 63

Query: 297 VREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRI 476
           VREIAQDFKTDLRFQ SAV+ALQEAAE+YLVGLFEDTN CAIHAKRVTIMPKD+QLARRI
Sbjct: 64  VREIAQDFKTDLRFQXSAVAALQEAAESYLVGLFEDTNXCAIHAKRVTIMPKDIQLARRI 123

Query: 477 RGERA 491
           RGERA
Sbjct: 124 RGERA 128



>gb:HVU38420_1682699 Hordeum vulgare histone H3 gene, partial cds,
           clone B1.
          Length = 127

 Score =  220 bits (561), Expect = 2e-56
 Identities = 115/127 (90%), Positives = 118/127 (92%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAP KQLAT AARKSA  TG +KK HR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPHKQLATTAARKSARTTGRLKKLHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYL GLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLRGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQL 464
           MPKD+QL
Sbjct: 121 MPKDIQL 127



>gb:AB195238_1203106 Paramecium caudatum macronuclear H3 mRNA for
           histone H3, complete cds.
          Length = 140

 Score =  220 bits (561), Expect = 2e-56
 Identities = 117/139 (84%), Positives = 126/139 (90%), Gaps = 4/139 (2%)
 Frame = +3

Query: 84  MARTKQTARKSTGG-KAPRKQLATKAARKSAPATG---GVKKPHRFRPGTVALREIRKYQ 251
           MARTKQTARKST G K P K LATKAARK+APA G   G+KKPH+FRPGTVALREIRKYQ
Sbjct: 1   MARTKQTARKSTAGNKKPTKHLATKAARKTAPAVGAAGGLKKPHKFRPGTVALREIRKYQ 60

Query: 252 KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK 431
           KSTELLIRKLPFQRLVREIA +F+ +LRFQSSAV ALQEAAEAYLVGLFEDTNLCAIHA+
Sbjct: 61  KSTELLIRKLPFQRLVREIAHEFQKELRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAR 120

Query: 432 RVTIMPKDMQLARRIRGER 488
           RVTIM +D+QLARRIRGER
Sbjct: 121 RVTIMSRDIQLARRIRGER 139



>pir|T04411|T04411 histone H3 - barley (fragment)
          Length = 127

 Score =  220 bits (561), Expect = 2e-56
 Identities = 115/127 (90%), Positives = 118/127 (92%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAP KQLAT AARKSA  TG +KK HR+RPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPHKQLATTAARKSARTTGRLKKLHRYRPGTVALREIRKYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYL GLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLRGLFEDTNLCAIHAKRVTI 120

Query: 444 MPKDMQL 464
           MPKD+QL
Sbjct: 121 MPKDIQL 127



>gb:AY725691_1624615 Calonectria ilicicola strain CBS 113903 histone
           H3 gene, exons 1 through 3 and partial cds.
          Length = 125

 Score =  220 bits (560), Expect = 2e-56
 Identities = 109/125 (87%), Positives = 120/125 (96%)
 Frame = +3

Query: 96  KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIR 275
           KQTAR+STGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLIR
Sbjct: 1   KQTARRSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIR 60

Query: 276 KLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD 455
           KLPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ E+YLV LFEDTNLCAIHAKRVTI  KD
Sbjct: 61  KLPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKD 120

Query: 456 MQLAR 470
           +QLAR
Sbjct: 121 IQLAR 125



>gb:AY338614_1320798 Machilis sp. AR01 histone 3 gene, partial
           cds.>gb:AY338615_1320799 Machilis sp. AR02 histone 3
           gene, partial cds.>gb:AY338616_1320800 Hypogastrura sp.
           CB02 histone 3 gene, partial cds.>gb:AY338617_1320801
           Notoligotoma sp. EB10 histone 3 gene, partial
           cds.>gb:AY338618_1320802 Drunella coloradensis histone 3
           gene, partial cds.>gb:AY338619_1320803 Baetis sp. Eph11
           histone 3 gene, partial cds.>gb:AY338620_1320804
           Analetris eximia histone 3 gene, partial
           cds.>gb:AY338621_1320805 Metretopus borealis histone 3
           gene, partial cds.>gb:AY338622_1320806 Ametropus neavei
           histone 3 gene, partial cds.>gb:AY338623_1320807
           Lachlania saskatchewanensis histone 3 gene, partial
           cds.>gb:AY338626_1320809 Coloburiscus humeralis histone
           3 gene, partial cds.>gb:AY338627_1320810 Baetisca sp.
           Eph16 histone 3 gene, partial cds.>gb:AY338628_1320811
           Isonychia sp. Eph17 histone 3 gene, partial
           cds.>gb:AY338629_1320812 Heptagenia sp. Eph18 histone 3
           gene, partial cds.>gb:AY338632_1320815 Ameletus sp.
           Eph23 histone 3 gene, partial cds.>gb:AY338633_1320816
           Paramaletus columbiae histone 3 gene, partial
           cds.>gb:AY338634_1320817 Leptohyphes apache histone 3
           gene, partial cds.>gb:AY338636_1320819 Calopteryx
           aequabilis histone 3 gene, partial
           cds.>gb:AY338637_1320820 Libellula saturata histone 3
           gene, partial cds.>gb:AY338638_1320821 Hetaerina
           americana histone 3 gene, partial
           cds.>gb:AY338639_1320822 Anax junius histone 3 gene,
           partial cds.>gb:AY338640_1320823 Paratettix cucullatus
           histone 3 gene, partial cds.>gb:AY338641_1320824 Ellipes
           minutus histone 3 gene, partial cds.>gb:AY338642_1320825
           Malenka californica histone 3 gene, partial
           cds.>gb:AY338643_1320826 Cerconychia sp. P114 histone 3
           gene, partial cds.>gb:AY338644_1320827 Thermobia sp.
           ZG01 histone 3 gene, partial cds.>gb:AY338645_1320828
           Battigrassiella sp. ZG02 histone 3 gene, partial cds.
          Length = 115

 Score =  219 bits (558), Expect = 3e-56
 Identities = 111/115 (96%), Positives = 114/115 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMP 449
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMP
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMP 115



>pir|A02630|A02630 histone H3 - fruit fly (Drosophila melanogaster)
           (fragments)
          Length = 121

 Score =  218 bits (556), Expect = 6e-56
 Identities = 116/135 (85%), Positives = 119/135 (88%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           ARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTEL
Sbjct: 1   ARTKQTARKSTGGKAPRKQLATKAARKSAPPTGGVKKPHRYRPGTVALREIRRYQKSTEL 60

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LIRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK     
Sbjct: 61  LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK----- 115

Query: 447 PKDMQLARRIRGERA 491
                    IRGERA
Sbjct: 116 ---------IRGERA 121



>gb:AY725689_1624613 Calonectria ilicicola strain CBS 112223 histone
           H3 gene, exons 1 through 3 and partial cds.
          Length = 124

 Score =  218 bits (555), Expect = 8e-56
 Identities = 108/124 (87%), Positives = 119/124 (95%)
 Frame = +3

Query: 99  QTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRK 278
           QTAR+STGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLIRK
Sbjct: 1   QTARRSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRK 60

Query: 279 LPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDM 458
           LPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ E+YLV LFEDTNLCAIHAKRVTI  KD+
Sbjct: 61  LPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKDI 120

Query: 459 QLAR 470
           QLAR
Sbjct: 121 QLAR 124



>gb:AY338631_1320814 Anthopotamus sp. Eph22 histone 3 gene, partial
           cds.
          Length = 115

 Score =  218 bits (555), Expect = 8e-56
 Identities = 110/115 (95%), Positives = 114/115 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMP 449
           FQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKRVTIMP
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKRVTIMP 115



>gb:AY338630_1320813 Caenis sp. Eph19 histone 3 gene, partial cds.
          Length = 115

 Score =  217 bits (552), Expect = 2e-55
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMP 449
           FQRLVREIAQD KTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMP
Sbjct: 61  FQRLVREIAQDLKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMP 115



>gb:AGHISTH3_1281990 A.gambiae H3 gene, partial.
          Length = 115

 Score =  217 bits (552), Expect = 2e-55
 Identities = 110/115 (95%), Positives = 113/115 (98%)
 Frame = +3

Query: 90  RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELL 269
           RTKQTARKSTGGKAPRKQLA KAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELL
Sbjct: 1   RTKQTARKSTGGKAPRKQLARKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL 60

Query: 270 IRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           IRKLPFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  IRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 115



>gb:AY725693_1624617 Calonectria ilicicola strain CPC 10450 histone
           H3 gene, exons 1 through 3 and partial cds.
          Length = 124

 Score =  216 bits (551), Expect = 2e-55
 Identities = 107/124 (86%), Positives = 119/124 (95%)
 Frame = +3

Query: 99  QTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRK 278
           QTAR+S+GGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLIRK
Sbjct: 1   QTARRSSGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRK 60

Query: 279 LPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDM 458
           LPFQRLVREIAQDFK+DLRFQSSA+ ALQE+ E+YLV LFEDTNLCAIHAKRVTI  KD+
Sbjct: 61  LPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKDI 120

Query: 459 QLAR 470
           QLAR
Sbjct: 121 QLAR 124



>gb:TVH3141_1401229 T.vaginalis DNA for histone H3-1 and histone
           H4-1, partial.
          Length = 138

 Score =  216 bits (551), Expect = 2e-55
 Identities = 112/137 (81%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPA--TGGVKKPHRFRPGTVALREIRKYQKS 257
           MARTKQTARKSTGGK PRK L  KAARKS P   + G KK HRFRPGTVALREIRKYQKS
Sbjct: 1   MARTKQTARKSTGGKTPRKSLGAKAARKSTPTIDSQGAKKQHRFRPGTVALREIRKYQKS 60

Query: 258 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRV 437
           T+LLIRKLPFQRLVREIA  F+ DLRFQSSA++ALQEA+EAYLVGLFEDTNLCAIHA RV
Sbjct: 61  TDLLIRKLPFQRLVREIASGFRGDLRFQSSAIAALQEASEAYLVGLFEDTNLCAIHANRV 120

Query: 438 TIMPKDMQLARRIRGER 488
           TIM +D+QLA+RIRGER
Sbjct: 121 TIMERDVQLAQRIRGER 137



>gb:AJ849501_1284686 Paraphanostoma macroposthium partial H3 gene
           for histone H3.>gb:AJ849504_1284689 Childia groenlandica
           partial H3 gene for histone H3.>gb:AJ849506_1284691
           Paraphanostoma submaculatum partial H3 gene for histone
           H3.>gb:AJ849507_1284692 Paraphanostoma trianguliferum
           partial H3 gene for histone H3.>gb:AJ849508_1284693
           Paraphanostoma cycloposthium partial H3 gene for histone
           H3.
          Length = 117

 Score =  216 bits (551), Expect = 2e-55
 Identities = 108/117 (92%), Positives = 115/117 (98%)
 Frame = +3

Query: 90  RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELL 269
           RTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTELL
Sbjct: 1   RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELL 60

Query: 270 IRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           IRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+E+YLV LFEDTNLCAIHAKRVT
Sbjct: 61  IRKLPFQRLVREIAQDFKTDLRFQSTAIMALQEASESYLVSLFEDTNLCAIHAKRVT 117



>gb:CR382132_1666023 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 139

 Score =  216 bits (550), Expect = 3e-55
 Identities = 113/139 (81%), Positives = 123/139 (88%), Gaps = 5/139 (3%)
 Frame = +3

Query: 84  MARTKQT--ARKSTGGKAPRKQLATKAARKSAP---ATGGVKKPHRFRPGTVALREIRKY 248
           MARTK T  ARK TGGKAPRKQ+ +KAARKSA     +GGVKKPHR++PGTVALREIR+Y
Sbjct: 1   MARTKSTVIARKVTGGKAPRKQIGSKAARKSAAPSNTSGGVKKPHRYKPGTVALREIRRY 60

Query: 249 QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHA 428
           QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHA
Sbjct: 61  QKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHA 120

Query: 429 KRVTIMPKDMQLARRIRGE 485
           KRVTI  KD+ LARR+RGE
Sbjct: 121 KRVTIQKKDIHLARRLRGE 139



>gb:AF093108_1767587 Tortula ruralis histone H3 (rnp49) mRNA,
           partial cds.
          Length = 117

 Score =  215 bits (548), Expect = 5e-55
 Identities = 110/115 (95%), Positives = 112/115 (97%)
 Frame = +3

Query: 147 ATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKT 326
           ATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKT
Sbjct: 3   ATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKT 62

Query: 327 DLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA 491
           DLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct: 63  DLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 117



>gb:AF466826_1273586 Euplotes octocarinatus histone H3p gene,
           complete cds.
          Length = 143

 Score =  214 bits (544), Expect = 1e-54
 Identities = 113/142 (79%), Positives = 123/142 (86%), Gaps = 7/142 (4%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLA----TKAARKSAP---ATGGVKKPHRFRPGTVALREIR 242
           MARTKQTARK+TG KAPRKQ+     TKAARK+ P   A   +KKPHRFRPGTVALREIR
Sbjct: 1   MARTKQTARKNTGTKAPRKQIGGKTTTKAARKNTPSIIAKQAIKKPHRFRPGTVALREIR 60

Query: 243 KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAI 422
           K+QKSTELLIRKLPFQRLVREIA ++K+DLRFQS AV ALQEA EAY+V LFEDTNLCAI
Sbjct: 61  KFQKSTELLIRKLPFQRLVREIATEYKSDLRFQSQAVLALQEATEAYMVSLFEDTNLCAI 120

Query: 423 HAKRVTIMPKDMQLARRIRGER 488
           HAKRVTIMPKD+ LARRIRGER
Sbjct: 121 HAKRVTIMPKDIHLARRIRGER 142



>gb:AJ849510_1284695 Eumecynostomum altitudi partial H3 gene for
           histone H3.
          Length = 117

 Score =  213 bits (543), Expect = 2e-54
 Identities = 106/117 (90%), Positives = 114/117 (97%)
 Frame = +3

Query: 90  RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELL 269
           RTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQKSTE+L
Sbjct: 1   RTKQTARKSTGGKAPRKQLATKAARKSAPQTGGVKKPHRYRPGTVALREIRRYQKSTEML 60

Query: 270 IRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           IRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+E+YLV LFED+NLCAIHAKRVT
Sbjct: 61  IRKLPFQRLVREIAQDFKTDLRFQSTAIMALQEASESYLVNLFEDSNLCAIHAKRVT 117



>pir|T20426|T20426 hypothetical protein E03A3.3 - Caenorhabditis
           elegans>gb:CEE03A3_1361881 Caenorhabditis elegans cosmid
           E03A3, complete sequence.
          Length = 127

 Score =  213 bits (543), Expect = 2e-54
 Identities = 107/123 (86%), Positives = 115/123 (93%)
 Frame = +3

Query: 120 GGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLV 299
           GGKAPRKQLATKAARK+A   G VKKPHRFRPGTVALREIR+YQKST+LL+RKLPFQRLV
Sbjct: 4   GGKAPRKQLATKAARKNAIVVGAVKKPHRFRPGTVALREIRRYQKSTDLLLRKLPFQRLV 63

Query: 300 REIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIR 479
           REIAQD K DLRFQS+A+ ALQEA+E +LVGLFEDTNLCAIHAKRVTIMPKDMQLARRIR
Sbjct: 64  REIAQDVKQDLRFQSAAIQALQEASEYFLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIR 123

Query: 480 GER 488
           GER
Sbjct: 124 GER 126



>gb:AY125250_1301703 Gratidia hispidula histone 3 gene, partial cds.
          Length = 112

 Score =  213 bits (542), Expect = 2e-54
 Identities = 108/112 (96%), Positives = 111/112 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 112



>gb:AY744849_1349168 Aetalion reticulatum histone 3 (H3) gene,
           partial cds.>gb:AY744855_1349174 Aphrophora alni histone
           3 (H3) gene, partial cds.>gb:AY744861_1349180 Prosapia
           bicincta histone 3 (H3) gene, partial
           cds.>gb:AY744863_1349182 Zulia vilior histone 3 (H3)
           gene, partial cds.>gb:AY744865_1349184 Philaenus
           maghresignus histone 3 (H3) gene, partial
           cds.>gb:AY744867_1349186 Epipyga n. sp. JRC-2004-a
           histone 3 (H3) gene, partial cds.>gb:AY744870_1349189
           Mahanarva costaricensis histone 3 (H3) gene, partial
           cds.>gb:AY744871_1349190 Cephisus siccifolius histone 3
           (H3) gene, partial cds.>gb:AY744872_1349191
           Froggattoides typicus histone 3 (H3) gene, partial
           cds.>gb:AY744873_1349192 Pauropsalta corticinus histone
           3 (H3) gene, partial cds.>gb:AY744879_1349198 Deiroderes
           inermis histone 3 (H3) gene, partial
           cds.>gb:AY744881_1349200 Gerridius fowleri histone 3
           (H3) gene, partial cds.>gb:AY744882_1349201 Guayaquila
           gracilicornis histone 3 (H3) gene, partial
           cds.>gb:AY744883_1349202 Flexamia areolata histone 3
           (H3) gene, partial cds.>gb:AY744884_1349203 Lophyraspis
           sp. JRC-2004 histone 3 (H3) gene, partial cds.
          Length = 111

 Score =  211 bits (538), Expect = 7e-54
 Identities = 107/111 (96%), Positives = 110/111 (99%)
 Frame = +3

Query: 102 TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKL 281
           TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKL
Sbjct: 1   TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL 60

Query: 282 PFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           PFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 111



>gb:AY125267_1301720 Phobaeticus heusii histone 3 gene, partial cds.
          Length = 111

 Score =  211 bits (538), Expect = 7e-54
 Identities = 107/111 (96%), Positives = 110/111 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 111



>gb:AF404591_1796748 Alternaria arborescens isolate CR2 histone
           gene, partial cds.>gb:AF404592_1796749 Alternaria
           alternata s.l. STE-U4331 isolate MA8 histone gene,
           partial cds.>gb:AF404593_1796750 Alternaria alternata
           s.l. STE-U4334 isolate MA11 histone gene, partial
           cds.>gb:AF404594_1796751 Alternaria alternata s.l.
           STE-U4343 isolate MA20 histone gene, partial
           cds.>gb:AF404595_1796752 Alternaria alternata s.l.
           STE-U4347 isolate MA24 histone gene, partial
           cds.>gb:AF404596_1796753 Alternaria alternata s.l.
           STE-U4330 isolate MA7 histone gene, partial
           cds.>gb:AF404597_1796754 Alternaria alternata s.l.
           STE-U4333 isolate MA10 histone gene, partial
           cds.>gb:AF404598_1796755 Alternaria alternata s.l.
           STE-U4335 isolate MA12 histone gene, partial
           cds.>gb:AF404599_1796756 Alternaria alternata s.l.
           STE-U4346 isolate MA23 histone gene, partial
           cds.>gb:AF404600_1796757 Alternaria alternata s.l.
           STE-U4332 isolate MA9 histone gene, partial
           cds.>gb:AF404601_1796758 Alternaria alternata s.l.
           STE-U4336 isolate MA13 histone gene, partial
           cds.>gb:AF404602_1796759 Alternaria alternata s.l.
           STE-U4337 isolate MA14 histone gene, partial
           cds.>gb:AF404603_1796760 Alternaria alternata s.l.
           STE-U4338 isolate MA15 histone gene, partial
           cds.>gb:AF404604_1796761 Alternaria alternata s.l.
           STE-U4339 isolate MA16 histone gene, partial
           cds.>gb:AF404605_1796762 Alternaria alternata s.l.
           STE-U4340 isolate MA17 histone gene, partial
           cds.>gb:AF404606_1796763 Alternaria alternata s.l.
           STE-U4341 isolate MA18 histone gene, partial
           cds.>gb:AF404607_1796764 Alternaria alternata s.l.
           STE-U4342 isolate MA19 histone gene, partial
           cds.>gb:AF404608_1796765 Alternaria alternata s.l.
           STE-U4344 isolate MA21 histone gene, partial
           cds.>gb:AF404609_1796766 Alternaria alternata s.l.
           STE-U4348 isolate MA25 histone gene, partial
           cds.>gb:AF404610_1796767 Alternaria alternata s.l.
           STE-U4325 isolate MA2 histone gene, partial
           cds.>gb:AF404611_1796768 Alternaria alternata s.l.
           STE-U4326 isolate MA3 histone gene, partial
           cds.>gb:AF404612_1796769 Alternaria alternata s.l.
           STE-U4327 isolate MA4 histone gene, partial
           cds.>gb:AF404613_1796770 Alternaria alternata s.l.
           STE-U4328 isolate MA5 histone gene, partial
           cds.>gb:AF404614_1796771 Alternaria alternata s.l.
           STE-U4349 isolate MA26 histone gene, partial
           cds.>gb:AF404615_1796772 Alternaria alternata s.l.
           STE-U4261 isolate CR20 histone gene, partial
           cds.>gb:AF404616_1796773 Alternaria alternata s.l.
           STE-U4260 isolate CR19 histone gene, partial
           cds.>gb:AF404617_1796774 Alternaria alternata s.l.
           STE-U4248 isolate CR7 histone gene, partial
           cds.>gb:AF404618_1796775 Alternaria sp. STE-U4247
           isolate CR6 histone gene, partial
           cds.>gb:AF404619_1796776 Alternaria sp. STE-U4264
           isolate CR23 histone gene, partial
           cds.>gb:AF404620_1796777 Alternaria alternata s.l.
           STE-U4242 isolate CR1 histone gene, partial
           cds.>gb:AF404621_1796778 Alternaria sp. STE-U4255
           isolate CR14 histone gene, partial
           cds.>gb:AF404622_1796779 Alternaria tenuissima isolate
           CR27 histone gene, partial cds.>gb:AF404623_1796780
           Lewia infectoria isolate CR15 histone gene, partial
           cds.>gb:AF404624_1796781 Alternaria alternata s.l.
           STE-U4265 isolate CR24 histone gene, partial
           cds.>gb:AF404625_1796782 Alternaria alternata s.l.
           STE-U4259 isolate CR18 histone gene, partial
           cds.>gb:AF404626_1796783 Alternaria alternata s.l.
           STE-U4249 isolate CR8 histone gene, partial
           cds.>gb:AF404627_1796784 Alternaria alternata s.l.
           STE-U4263 isolate CR22 histone gene, partial
           cds.>gb:AF404628_1796785 Alternaria alternata s.l.
           STE-U4266 isolate CR25 histone gene, partial
           cds.>gb:AF404630_1796787 Alternaria arborescens isolate
           CR5 histone gene, partial cds.>gb:AF404631_1796788 Lewia
           infectoria isolate CR31 histone gene, partial
           cds.>gb:AF404632_1796789 Alternaria alternata s.l.
           STE-U4262 isolate CR21 histone gene, partial
           cds.>gb:AF404633_1796790 Alternaria tenuissima isolate
           MA1 histone gene, partial cds.>gb:AF404634_1796791
           Alternaria tenuissima isolate MA6 histone gene, partial
           cds.>gb:AF404635_1796792 Alternaria arborescens isolate
           MA22 histone gene, partial cds.>gb:AF404637_1796794
           Alternaria alternata s.l. STE-U4258 isolate CR17 histone
           gene, partial cds.>gb:AF404638_1796795 Alternaria
           alternata s.l. STE-U4257 isolate CR16 histone gene,
           partial cds.>gb:AF404639_1796796 Alternaria arborescens
           isolate CR3 histone gene, partial
           cds.>gb:AF404640_1796797 Alternaria alternata s.l.
           STE-U4267 isolate CR26 histone gene, partial
           cds.>gb:AF404641_1796798 Lewia infectoria isolate CR28
           histone gene, partial cds.
          Length = 119

 Score =  211 bits (537), Expect = 9e-54
 Identities = 105/119 (88%), Positives = 114/119 (95%)
 Frame = +3

Query: 114 STGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQR 293
           STGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLIRKLPFQR
Sbjct: 1   STGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQR 60

Query: 294 LVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLAR 470
           LVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAKRVTI  KD+QLAR
Sbjct: 61  LVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLAR 119



>gb:AF112370_2474546 Squalus acanthias histone H3.3 mRNA, partial
           cds.
          Length = 112

 Score =  211 bits (536), Expect = 1e-53
 Identities = 105/112 (93%), Positives = 111/112 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           FQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  FQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVT 112



>gb:PMU84116_1395492 Psammechinus miliaris cleavage stage histone H3
           (CS H3) mRNA, partial cds.
          Length = 111

 Score =  210 bits (534), Expect = 2e-53
 Identities = 106/111 (95%), Positives = 110/111 (99%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRRYQKSTE 60

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLC 416
           LLIRKLPFQRL+REIAQDFKT+LRFQSSAV ALQEA+EAYLVGLFEDTNLC
Sbjct: 61  LLIRKLPFQRLIREIAQDFKTELRFQSSAVLALQEASEAYLVGLFEDTNLC 111



>gb:AY744850_1349169 Pectinariophyes reticulata histone 3 (H3) gene,
           partial cds.>gb:AY744851_1349170 Philaenus spumarius
           histone 3 (H3) gene, partial cds.>gb:AY744857_1349176
           Aphrophora cribrata histone 3 (H3) gene, partial cds.
          Length = 110

 Score =  209 bits (533), Expect = 3e-53
 Identities = 106/110 (96%), Positives = 109/110 (99%)
 Frame = +3

Query: 102 TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKL 281
           TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKL
Sbjct: 1   TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL 60

Query: 282 PFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK 431
           PFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct: 61  PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK 110



>gb:AAN436950_1192465 Amphiporus angulatus partial H3 gene for
           histone H3.>gb:AFO436951_1281725 Amphiporus formidabilis
           partial H3 gene for histone H3.>gb:AIM436952_1282099
           Amphiporus imparispinosus partial H3 gene for histone
           H3.>gb:AY744854_1349173 Lepyronia coleoptrata histone 3
           (H3) gene, partial cds.>gb:AY744869_1349188 Evexus n.
           sp. JRC-2004-e histone 3 (H3) gene, partial
           cds.>gb:AY744875_1349194 Tettigarcta tomentosa histone 3
           (H3) gene, partial cds.>gb:AY744877_1349196 Nothodelphax
           gillettei histone 3 (H3) gene, partial
           cds.>gb:AY744878_1349197 Scolops sp. JRC-2004 histone 3
           (H3) gene, partial cds.>gb:AY744886_1349205 Tangia
           viridis histone 3 (H3) gene, partial
           cds.>gb:CMA436978_1372504 Cerebratulus marginatus
           partial H3 gene for histone H3.>gb:CMU436985_1372571
           Carinoma mutabilis partial H3 gene for histone
           H3.>gb:CTR436986_1375901 Carinoma tremaphoros partial H3
           gene for histone H3.>gb:EBU436954_1384138 Emplectonema
           buergeri partial H3 gene for histone
           H3.>gb:EGR436955_1384359 Emplectonema gracile partial H3
           gene for histone H3.>gb:GLI436956_1385370 Gurjanovella
           littoralis partial H3 gene for histone
           H3.>gb:LAL436979_1387091 Lineus alborostratus partial H3
           gene for histone H3.>gb:LBI436980_1387117 Lineus bicolor
           partial H3 gene for histone H3.>gb:MAL436981_1389355
           Micrura alaskensis partial H3 gene for histone
           H3.>gb:MGR436957_1389662 Malacodbella grossa partial H3
           gene for histone H3.>gb:NBI436960_1390700 Nemertopsis
           bivittata partial H3 gene for histone
           H3.>gb:NBI436961_1390701 Nipponemertes bimaculatus
           partial H3 gene for histone H3.>gb:PMU436974_1395472
           Phallonemertes murrayi partial H3 gene for histone
           H3.>gb:PSA436965_1395744 Paranemertes sanjuanensis
           partial H3 gene for histone H3.>gb:PSI436988_1395773
           Procephalothrix simulus partial H3 gene for histone
           H3.>gb:PSP436958_1395806 Poseidonemertes sp. 349 partial
           H3 gene for histone H3.>gb:PSP436962_1395807
           Pantinonemertes sp. 115 partial H3 gene for histone
           H3.>gb:PSP436989_1395811 Procephalotrix spiralis partial
           H3 gene for histone H3.>gb:RNE436976_1396427 Reptant
           nemertean sp. 281 partial H3 gene for histone
           H3.>gb:RNE436977_1396428 Reptant nemertean sp. 481
           partial H3 gene for histone H3.>gb:TRH436990_1400940
           Tubulanus rhabdotus partial H3 gene for histone
           H3.>gb:TSE436991_1400983 Tubulanus sexlineatus partial
           H3 gene for histone H3.>gb:ZSI436970_1407450
           Zygonemertes simonae partial H3 gene for histone
           H3.>gb:ZVI436971_1407458 Zygonemertes virescens partial
           H3 gene for histone H3.>gb:AY539177_2536730 Hoplostethus
           mediterraneus histone H3 gene, partial
           cds.>gb:AY539178_2536731 Menidia menidia histone H3
           gene, partial cds.>gb:AY539181_2536734 Pegasus volitans
           histone H3 gene, partial cds.>gb:AY539255_2536804 Morone
           saxatilis histone H3 gene, partial
           cds.>gb:AY539263_2536811 Etheostoma blennioides histone
           H3 gene, partial cds.>gb:AY539264_2536812 Perca
           flavescens histone H3 gene, partial
           cds.>gb:AY539265_2536813 Hoplolatilus purpureus histone
           H3 gene, partial cds.>gb:AY539266_2536814 Haemulon
           plumieri histone H3 gene, partial
           cds.>gb:AY539267_2536815 Kuhlia rupestris histone H3
           gene, partial cds.>gb:AY655547_2542350 Bedotia geayi
           histone H3a gene, partial cds.>gb:AY655548_2542351
           Bedotia longianalis isolate 1 histone H3a gene, partial
           cds.>gb:AY655549_2542352 Bedotia longianalis isolate 2
           histone H3a gene, partial cds.>gb:AY655550_2542353
           Bedotia madagascariensis histone H3a gene, partial
           cds.>gb:AY655551_2542354 Bedotia marojejy histone H3a
           gene, partial cds.>gb:AY655552_2542355 Bedotia masoala
           histone H3a gene, partial cds.>gb:AY655553_2542356
           Bedotia tricolor histone H3a gene, partial
           cds.>gb:AY655554_2542357 Rheocles alaotrensis histone
           H3a gene, partial cds.>gb:AY655556_2542359 Rheocles
           lateralis histone H3a gene, partial
           cds.>gb:AY655557_2542360 Rheocles vatosoa histone H3a
           gene, partial cds.>gb:AY655558_2542361 Rheocles wrightae
           histone H3a gene, partial cds.>gb:AY655559_2542362
           Bedotia sp. 'Antalaha' histone H3a gene, partial
           cds.>gb:AY655560_2542363 Bedotia sp. 'Beforana' histone
           H3a gene, partial cds.>gb:AY655561_2542364 Bedotia sp.
           Bemarivo histone H3a gene, partial
           cds.>gb:AY655562_2542365 Bedotia sp. 'Betampona' histone
           H3a gene, partial cds.>gb:AY655563_2542366 Bedotia sp.
           'Ivoloina' histone H3a gene, partial
           cds.>gb:AY655564_2542367 Bedotia sp. 'Mahanara' histone
           H3a gene, partial cds.>gb:AY655565_2542368 Bedotia sp.
           Makira histone H3a gene, partial
           cds.>gb:AY655566_2542369 Bedotia sp. 'Manombo' histone
           H3a gene, partial cds.>gb:AY655567_2542370 Bedotia sp.
           'Ranomafana' histone H3a gene, partial
           cds.>gb:AY655568_2542371 Bedotia sp. 'Sambava' histone
           H3a gene, partial cds.>gb:AY655569_2542372 Bedotia sp.
           'Vevembe' histone H3a gene, partial
           cds.>gb:AY655571_2542374 Iriatherina werneri histone H3a
           gene, partial cds.>gb:AY655573_2542376 Melanotaenia
           praecox histone H3a gene, partial
           cds.>gb:AY655574_2542377 Cairnsichthys rhombosomoides
           histone H3a gene, partial cds.>gb:AY655575_2542378
           Rhadinocentrus ornatus histone H3a gene, partial
           cds.>gb:AY655577_2542380 Pseudomugil gertrudae histone
           H3a gene, partial cds.>gb:AY655578_2542381 Pseudomugil
           signifer histone H3a gene, partial
           cds.>gb:AY655579_2542382 Atherina hepsetus histone H3a
           gene, partial cds.>gb:AY655581_2542384 Atherinosoma
           microstoma histone H3a gene, partial
           cds.>gb:AY655583_2542386 Teramulus waterloti histone H3a
           gene, partial cds.>gb:AY655586_2542389 Atherinops
           affinis histone H3a gene, partial
           cds.>gb:AY655588_2542391 Menidia menidia histone H3a
           gene, partial cds.>gb:AY655590_2542393 Atherion elymus
           histone H3a gene, partial cds.>gb:AY655596_2542398
           Atherinomorus sp. Karianga histone H3a gene, partial
           cds.>gb:AY662877_2542770 Calloplesiops altivelis histone
           H3a gene, partial cds.>gb:AY662878_2542771 Ctenopoma
           acutirostre histone H3a gene, partial
           cds.>gb:AY662883_2542776 Cetoscarus bicolor histone H3a
           gene, partial cds.>gb:AY662886_2542779 Tautoga onitis
           histone H3a gene, partial cds.>gb:AY662887_2542780
           Cymatogaster aggregata histone H3a gene, partial
           cds.>gb:AY662888_2542781 Embiotoca jacksoni histone H3a
           gene, partial cds.>gb:AY662889_2542782 Amphiprion
           polymnus histone H3a gene, partial
           cds.>gb:AY662890_2542783 Etroplus canarensis histone H3a
           gene, partial cds.>gb:AY662892_2542785 Etroplus
           maculatus histone H3a gene, partial
           cds.>gb:AY662894_2542787 Paretroplus damii histone H3a
           gene, partial cds.>gb:AY662897_2542789 Paretroplus cf.
           kieneri 'Ravelobe' histone H3a gene, partial
           cds.>gb:AY662902_2542793 Paretroplus nourissati histone
           H3a gene, partial cds.>gb:AY662904_2542795 Paretroplus
           tsimoly histone H3a gene, partial
           cds.>gb:AY662905_2542796 Paretroplus sp. 'Kamoro'
           histone H3a gene, partial cds.>gb:AY662907_2542798
           Oxylapia polli histone H3a gene, partial
           cds.>gb:AY662908_2542799 Paratilapia cf. bleekeri
           JSS-2004 histone H3a gene, partial
           cds.>gb:AY662911_2542802 Paratilapia sp. 'East' histone
           H3a gene, partial cds.>gb:AY662912_2542803 Paratilapia
           sp. 'Ifasy' histone H3a gene, partial
           cds.>gb:AY662914_2542805 Ptychochromoides vondrozo
           histone H3a gene, partial cds.>gb:AY662915_2542806
           Ptychochromoides katria histone H3a gene, partial
           cds.>gb:AY662916_2542807 Ptychochromis grandidieri
           histone H3a gene, partial cds.>gb:AY662917_2542808
           Ptychochromis inornatus histone H3a gene, partial
           cds.>gb:AY662918_2542809 Ptychochromis oligacanthus
           'Nosy Be' histone H3a gene, partial
           cds.>gb:AY662919_2542810 Ptychochromis oligacanthus
           'Northwest' histone H3a gene, partial
           cds.>gb:AY662920_2542811 Ptychochromis sp. 'Garaka'
           histone H3a gene, partial cds.>gb:AY662922_2542813
           Ptychochromis sp. 'Sofia' histone H3a gene, partial
           cds.>gb:AY662924_2542815 Acaronia nassa histone H3a
           gene, partial cds.>gb:AY662932_2542823 Nandopsis
           ramsdeni histone H3a gene, partial
           cds.>gb:AY662943_2542833 Gaurochromis simpsoni histone
           H3a gene, partial cds.>gb:AY662944_2542834 Haplochromis
           sp. 'silver bullet' histone H3a gene, partial
           cds.>gb:AY662946_2542836 Neolamprologus brichardi
           histone H3a gene, partial cds.>gb:AY662950_2542840
           Pelvicachromis pulcher histone H3a gene, partial
           cds.>gb:AY662951_2542841 Metriaclima zebra histone H3a
           gene, partial cds.
          Length = 110

 Score =  209 bits (533), Expect = 3e-53
 Identities = 106/110 (96%), Positives = 109/110 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:MMHIH3_2115288 Mouse gene coding for embryonic H3 histone.
          Length = 135

 Score =  209 bits (531), Expect = 5e-53
 Identities = 110/136 (80%), Positives = 120/136 (88%)
 Frame = +3

Query: 84  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 263
           MA TKQTARKST GKAPRKQLATKAA KSAP+TGGVKK HR+RP TVAL EIR+Y  STE
Sbjct: 1   MAHTKQTARKSTCGKAPRKQLATKAAXKSAPSTGGVKKSHRYRPDTVALLEIRRYH-STE 59

Query: 264 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 443
           LLI KLPFQRLV+EIAQDFKTDLRFQS+A+ ALQEA+EA  VGLFEDTNLCAIHAK VT+
Sbjct: 60  LLIHKLPFQRLVQEIAQDFKTDLRFQSAAIGALQEASEANRVGLFEDTNLCAIHAKCVTV 119

Query: 444 MPKDMQLARRIRGERA 491
           +PKD+QLA  I GERA
Sbjct: 120 IPKDIQLAHSILGERA 135



>gb:AF404636_1796793 Lewia infectoria isolate CR12 histone gene,
           partial cds.
          Length = 119

 Score =  209 bits (531), Expect = 5e-53
 Identities = 104/119 (87%), Positives = 113/119 (94%)
 Frame = +3

Query: 114 STGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQR 293
           STGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLIRKLPFQR
Sbjct: 1   STGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQR 60

Query: 294 LVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLAR 470
           LVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDT LCAIHAKRVTI  KD+QLAR
Sbjct: 61  LVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTKLCAIHAKRVTIQSKDIQLAR 119



>gb:AF314469_1785311 Fusarium cerealis strain MRC3926 histone H3
           gene, partial cds.>gb:AF314470_1785312 Fusarium cerealis
           strain MRC4643 histone H3 gene, partial
           cds.>gb:AF314471_1785313 Fusarium cerealis strain
           MRC2878 histone H3 gene, partial
           cds.>gb:AF314472_1785314 Gibberella zeae strain MRC4927
           histone H3 gene, partial cds.>gb:AF314473_1785315
           Gibberella zeae strain MRC5049 histone H3 gene, partial
           cds.>gb:AF314474_1785316 Gibberella zeae strain CMW4490
           histone H3 gene, partial cds.>gb:AF314475_1785317
           Gibberella zeae strain CMW4375 histone H3 gene, partial
           cds.>gb:AF314476_1785318 Gibberella zeae strain CMW4492
           histone H3 gene, partial cds.>gb:AF314477_1785319
           Gibberella zeae strain MRC1106 histone H3 gene, partial
           cds.>gb:AF314478_1785320 Gibberella zeae strain CMW961
           histone H3 gene, partial cds.>gb:AF314479_1785321
           Gibberella zeae strain CMW962 histone H3 gene, partial
           cds.>gb:AF314483_1785325 Fusarium pseudograminearum
           strain MRC4977 histone H3 gene, partial
           cds.>gb:AF314484_1785326 Fusarium pseudograminearum
           strain MRC4517 histone H3 gene, partial cds.
          Length = 118

 Score =  209 bits (531), Expect = 5e-53
 Identities = 103/118 (87%), Positives = 113/118 (95%)
 Frame = +3

Query: 102 TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKL 281
           TAR+STGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLIRKL
Sbjct: 1   TARRSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKL 60

Query: 282 PFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD 455
           PFQRLVREIAQDFK+DLRFQSSA+ ALQE+ E+YLV LFEDTNLCAIHAKRVTI  KD
Sbjct: 61  PFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKD 118



>gb:AY662942_2542832 Gobiocichla ethelwynnae histone H3a gene,
           partial cds.
          Length = 110

 Score =  208 bits (530), Expect = 6e-53
 Identities = 105/110 (95%), Positives = 109/110 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK+
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKK 110



>gb:AY662901_2542792 Paretroplus menarambo histone H3a gene, partial
           cds.
          Length = 110

 Score =  208 bits (530), Expect = 6e-53
 Identities = 105/110 (95%), Positives = 109/110 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539179_2536732 Aulorhynchus flavidus histone H3 gene, partial
           cds.>gb:AY539180_2536733 Apeltes quadracus histone H3
           gene, partial cds.>gb:AY539185_2536738 Sebastes
           elongatus histone H3 gene, partial
           cds.>gb:AY539186_2536739 Sebastes matsubarae histone H3
           gene, partial cds.>gb:AY539187_2536740 Maxillicosta
           whitleyi histone H3 gene, partial
           cds.>gb:AY539188_2536741 Sebastolobus macrochir histone
           H3 gene, partial cds.>gb:AY539193_2536744 Scorpaena
           guttata histone H3 gene, partial
           cds.>gb:AY539195_2536746 Scorpaenodes scaber histone H3
           gene, partial cds.>gb:AY539198_2536748 Thysanichthys sp.
           WLS-2004 histone H3 gene, partial
           cds.>gb:AY539199_2536749 Dendrochirus brachypterus
           histone H3 gene, partial cds.>gb:AY539201_2536751
           Setarches guentheri histone H3 gene, partial
           cds.>gb:AY539202_2536752 Ablabys taenionotus histone H3
           gene, partial cds.>gb:AY539207_2536757 Congiopodus
           peruvianus histone H3 gene, partial
           cds.>gb:AY539208_2536758 Zanclorhynchus spinifer histone
           H3 gene, partial cds.>gb:AY539209_2536759 Caracanthus
           maculatus histone H3 gene, partial
           cds.>gb:AY539213_2536763 Peristedion miniatum histone H3
           gene, partial cds.>gb:AY539214_2536764 Plectrogenium
           nanum histone H3 gene, partial cds.>gb:AY539217_2536767
           Platycephalus bassensis histone H3 gene, partial
           cds.>gb:AY539218_2536768 Hoplichthys citrinus histone H3
           gene, partial cds.>gb:AY539219_2536769 Anoplopoma
           fimbria histone H3 gene, partial
           cds.>gb:AY539220_2536770 Hexagrammos decagrammus histone
           H3 gene, partial cds.>gb:AY539221_2536771 Pleurogrammus
           azonus histone H3 gene, partial cds.>gb:AY539224_2536774
           Rhamphocottus richardsoni histone H3 gene, partial
           cds.>gb:AY539226_2536776 Artedius fenestralis histone H3
           gene, partial cds.>gb:AY539230_2536780 Hemilepidotus
           jordani histone H3 gene, partial
           cds.>gb:AY539231_2536781 Hemilepidotus zapus histone H3
           gene, partial cds.>gb:AY539232_2536782 Icelinus
           filamentosus histone H3 gene, partial
           cds.>gb:AY539233_2536783 Jordania zonope histone H3
           gene, partial cds.>gb:AY539234_2536784 Leptocottus
           armatus histone H3 gene, partial
           cds.>gb:AY539240_2536790 Batrachocottus baicalensis
           histone H3 gene, partial cds.>gb:AY539241_2536791
           Comephorus baicalensis histone H3 gene, partial
           cds.>gb:AY539243_2536793 Hemitripterus americanus
           histone H3 gene, partial cds.>gb:AY539247_2536797
           Xeneretmus latifrons histone H3 gene, partial
           cds.>gb:AY539249_2536799 Dasycottus setiger histone H3
           gene, partial cds.>gb:AY539251_2536801 Aptocyclus
           ventricosus histone H3 gene, partial
           cds.>gb:AY539257_2536805 Diplectrum formosum histone H3
           gene, partial cds.>gb:AY539258_2536806 Epinephelus
           adscensionis histone H3 gene, partial
           cds.>gb:AY539269_2536817 Cheilodactylus variegatus
           histone H3 gene, partial cds.>gb:AY539274_2536822
           Champsodon atridorsalis histone H3 gene, partial
           cds.>gb:AY539275_2536823 Trichodon trichodon histone H3
           gene, partial cds.>gb:AY655589_2542392 Neostethus
           bicornis histone H3a gene, partial
           cds.>gb:AY662876_2542769 Calamus penna histone H3a gene,
           partial cds.>gb:AY662884_2542777 Haletta semifasciata
           histone H3a gene, partial cds.
          Length = 110

 Score =  208 bits (530), Expect = 6e-53
 Identities = 105/110 (95%), Positives = 109/110 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKR 110



>gb:AY655594_2542396 Oryzias latipes histone H3a gene, partial cds.
          Length = 110

 Score =  208 bits (529), Expect = 8e-53
 Identities = 105/109 (96%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 2   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 61

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 62  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539211_2536761 Pseudogramma thaumasium histone H3 gene,
           partial cds.
          Length = 110

 Score =  208 bits (529), Expect = 8e-53
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQE +EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEXSEAYLVGLFEDTNLCAIHAKR 110



>gb:PSP436966_1395809 Poseidonemertes sp. 508 partial H3 gene for
           histone H3.>gb:AY662934_2542825 Retroculus xinguensis
           histone H3a gene, partial cds.
          Length = 110

 Score =  208 bits (529), Expect = 8e-53
 Identities = 105/109 (96%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 2   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 61

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 62  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:NYA436959_1391010 Nemertellina yamaokai partial H3 gene for
           histone H3.>gb:PCO436967_1391811 Poseidonemertes
           collaris partial H3 gene for histone H3.
          Length = 110

 Score =  208 bits (529), Expect = 8e-53
 Identities = 105/109 (96%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 2   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 61

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 62  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:HDU436987_1385864 Hubrechtella dubia partial H3 gene for histone
           H3.
          Length = 110

 Score =  208 bits (529), Expect = 8e-53
 Identities = 105/110 (95%), Positives = 109/110 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK+
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKQ 110



>gb:AF110849_1242030 Euperipatoides leuckartii histone H3 (H3) gene,
           partial cds.>gb:AF110856_1242037 Hanseniella sp. AM-1999
           histone H3 (H3) gene, partial cds.>gb:AF110864_1242045
           Allomachilis froggarti histone H3 (H3) gene, partial
           cds.>gb:AF110875_1242056 Equitius sp. histone H3 (H3)
           gene, partial cds.>gb:AF370813_1266380 Limulus
           polyphemus histone H3 gene, partial
           cds.>gb:AF370814_1266381 Carcinoscorpius rotundicauda
           histone H3 gene, partial cds.>gb:AF370817_1266384
           Locusta migratoria histone H3 gene, partial
           cds.>gb:AF370819_1266386 Homarus americanus histone H3
           gene, partial cds.>gb:AF519293_1278851 Argonemertes
           australiensis histone H3 gene, partial
           cds.>gb:AF519294_1278852 Amphiporus sp. AMNH1 histone H3
           gene, partial cds.>gb:AF519295_1278853 Sipunculus sp.
           GG-2002 isolate DNA100246 histone H3 gene, partial
           cds.>gb:AF519296_1278854 Siphonosoma cumanense isolate
           DNA100235 histone H3 gene, partial
           cds.>gb:AF519297_1278855 Phascolopsis gouldii isolate
           DNA100199 histone H3 gene, partial
           cds.>gb:AF519298_1278856 Golfingia elongata isolate
           DNA100466 histone H3 gene, partial
           cds.>gb:AF519299_1278857 Golfingia muricaudata isolate
           DNA100439 histone H3 gene, partial
           cds.>gb:AF519302_1278860 Themiste lageniformes isolate
           DNA100229 histone H3 gene, partial
           cds.>gb:AF519303_1278861 Themiste minor isolate
           DNA100210 histone H3 gene, partial
           cds.>gb:AF519305_1278863 Phascolosoma noduliferum
           isolate DNA100208 histone H3 gene, partial
           cds.>gb:AF519306_1278864 Phascolosoma perlucens isolate
           DNA100228 histone H3 gene, partial
           cds.>gb:AF519307_1278865 Phascolosoma stephensoni
           isolate DNA100209 histone H3 gene, partial
           cds.>gb:AF519308_1278866 Phascolosoma stephensoni
           isolate DNA100485 histone H3 gene, partial
           cds.>gb:AF519309_1278867 Phascolosoma scolops isolate
           DNA100373 histone H3 gene, partial
           cds.>gb:AF519310_1278868 Phascolosoma scolops isolate
           DNA100469 histone H3 gene, partial
           cds.>gb:AF519311_1278869 Antillesoma antillarum isolate
           DNA100390 histone H3 gene, partial
           cds.>gb:AF519312_1278870 Aspidosiphon misakiensis
           isolate DNA100205 histone H3 gene, partial
           cds.>gb:AF519313_1278871 Aspidosiphon laevis isolate
           DNA100467 histone H3 gene, partial
           cds.>gb:AF519314_1278872 Aspidosiphon parvulus isolate
           DNA100202 histone H3 gene, partial
           cds.>gb:AF519315_1278873 Aspidosiphon steenstrupii
           isolate DNA100232 histone H3 gene, partial
           cds.>gb:AY070146_1294609 Solemya velum histone H3 gene,
           partial cds.>gb:AY070147_1294610 Nucula sulcata histone
           H3 gene, partial cds.>gb:AY070148_1294611 Nuculana pella
           histone H3 gene, partial cds.>gb:AY070149_1294612 Yoldia
           limatula histone H3 gene, partial
           cds.>gb:AY070150_1294613 Mytilus edulis histone H3 gene,
           partial cds.>gb:AY070153_1294616 Pecten jacobaeus
           histone H3 gene, partial cds.>gb:AY070154_1294617
           Mimachlamys varia histone H3 gene, partial
           cds.>gb:AY070155_1294618 Neotrigonia margaritacea
           histone H3 gene, partial cds.>gb:AY070156_1294619
           Cardita calyculata histone H3 gene, partial
           cds.>gb:AY070157_1294620 Myrtea spinifera histone H3
           gene, partial cds.>gb:AY070158_1294621 Capsella
           variegata histone H3 gene, partial
           cds.>gb:AY070159_1294622 Ensis ensis histone H3 gene,
           partial cds.>gb:AY070160_1294623 Abra prismatica histone
           H3 gene, partial cds.>gb:AY070165_1294628 Dreissena
           polymorpha histone H3 gene, partial
           cds.>gb:AY078700_1296423 Bolyphantes alticeps
           specimen-voucher G50 histone H3 (H3) gene, partial
           cds.>gb:AY078701_1296424 Orsonwelles polites
           specimen-voucher G19 histone H3 (H3) gene, partial
           cds.>gb:AY078702_1296425 Linyphia triangularis
           specimen-voucher G48 histone H3 (H3) gene, partial
           cds.>gb:AY078703_1296426 Frontinella pyramitela
           specimen-voucher G51 histone H3 (H3) gene, partial
           cds.>gb:AY078706_1296429 Neriene variabilis
           specimen-voucher G17 histone H3 (H3) gene, partial
           cds.>gb:AY078707_1296430 Labulla thoracica
           specimen-voucher G49 histone H3 (H3) gene, partial
           cds.>gb:AY078708_1296431 Orsonwelles malus
           specimen-voucher G16 histone H3 (H3) gene, partial
           cds.>gb:AY078709_1296432 Neriene radiata
           specimen-voucher G6 histone H3 (H3) gene, partial
           cds.>gb:AY084074_1296741 Lepisma sp. GG2002 histone H3
           gene, partial cds.>gb:AY230981_1311221 Argiope argentata
           histone H3A (H3A) gene, partial cds.>gb:AY230982_1311222
           Alaranea merina histone H3A (H3A) gene, partial
           cds.>gb:AY230983_1311223 Mysmena sp. MS91 histone H3A
           (H3A) gene, partial cds.>gb:AY230984_1311224 Nesticus
           sp. X132 histone H3A (H3A) gene, partial
           cds.>gb:AY230985_1311225 Pimoa sp. X131 histone H3A
           (H3A) gene, partial cds.>gb:AY230986_1311226 Synotaxus
           sp. MS90 histone H3A (H3A) gene, partial
           cds.>gb:AY230987_1311227 Tetragnatha mandibulata histone
           H3A (H3A) gene, partial cds.>gb:AY230988_1311228
           Theridiosoma gemmosum histone H3A (H3A) gene, partial
           cds.>gb:AY230989_1311229 Achaearanea tepidariorum
           histone H3A (H3A) gene, partial cds.>gb:AY230990_1311230
           Ameridion sp. MS83 histone H3A (H3A) gene, partial
           cds.>gb:AY230991_1311231 Anelosimus eximius histone H3A
           (H3A) gene, partial cds.>gb:AY230992_1311232 Argyrodes
           argentatus histone H3A (H3A) gene, partial
           cds.>gb:AY230993_1311233 Ariamnes attenuata histone H3A
           (H3A) gene, partial cds.>gb:AY230994_1311234 Cerocida
           strigosa histone H3A (H3A) gene, partial
           cds.>gb:AY230995_1311235 Chrosiothes cf. jocosus MS109
           histone H3A (H3A) gene, partial cds.>gb:AY230996_1311236
           Chrysso sp. MS2 histone H3A (H3A) gene, partial
           cds.>gb:AY230997_1311237 Keijia mneon histone H3A (H3A)
           gene, partial cds.>gb:AY230998_1311238 Dipoena cf.
           hortoni MS94 histone H3A (H3A) gene, partial
           cds.>gb:AY230999_1311239 Trigonobothrys mustelinus
           histone H3A (H3A) gene, partial cds.>gb:AY231000_1311240
           Enoplognatha caricis histone H3A (H3A) gene, partial
           cds.>gb:AY231001_1311241 Episinus angulatus histone H3A
           (H3A) gene, partial cds.>gb:AY231002_1311242 Argyrodes
           chickeringi histone H3A (H3A) gene, partial
           cds.>gb:AY231003_1311243 Helvibis cf. longicauda MS98
           histone H3A (H3A) gene, partial cds.>gb:AY231004_1311244
           Latrodectus mactans histone H3A (H3A) gene, partial
           cds.>gb:AY231005_1311245 Neottiura bimaculata histone
           H3A (H3A) gene, partial cds.>gb:AY231006_1311246
           Argyrodes trigonum histone H3A (H3A) gene, partial
           cds.>gb:AY231007_1311247 Nesticodes rufipes histone H3A
           (H3A) gene, partial cds.>gb:AY231008_1311248 Pholcomma
           hirsutum histone H3A (H3A) gene, partial
           cds.>gb:AY231009_1311249 Rhomphaea metalissima histone
           H3A (H3A) gene, partial cds.>gb:AY231012_1311252
           Anelosimus sp. MS81 histone H3A (H3A) gene, partial
           cds.>gb:AY231013_1311253 Spintharus flavidus histone H3A
           (H3A) gene, partial cds.>gb:AY231016_1311256 Theridion
           grallator histone H3A (H3A) gene, partial
           cds.>gb:AY231017_1311257 Theridion varians histone H3A
           (H3A) gene, partial cds.>gb:AY231018_1311258 Thwaitesia
           sp. X80 histone H3A (H3A) gene, partial
           cds.>gb:AY231019_1311259 Thymoites unimaculatus histone
           H3A (H3A) gene, partial cds.>gb:AY377764_1324303
           Helicoradomenia sp. AO-2003 histone H3 gene, partial
           cds.>gb:AY377765_1324304 Epimenia sp. AO-2003 histone H3
           gene, partial cds.>gb:AY377766_1324305 Epimenia babai
           histone H3 gene, partial cds.>gb:AY377768_1324307 Yoldia
           limatula histone H3 gene, partial
           cds.>gb:AY377769_1324308 Mytilus edulis histone H3 gene,
           partial cds.>gb:AY377771_1324310 Antalis vulgaris
           histone H3 gene, partial cds.>gb:AY377773_1324312
           Sinezona confusa histone H3 gene, partial
           cds.>gb:AY377774_1324313 Entemnotrochus adansonianus
           histone H3 gene, partial cds.>gb:AY377775_1324314
           Haliotis tuberculata histone H3 gene, partial
           cds.>gb:AY377776_1324315 Diodora cayenensis histone H3
           gene, partial cds.>gb:AY377777_1324316 Cocculina
           messingi histone H3 gene, partial
           cds.>gb:AY377778_1324317 Crepidula fornicata histone H3
           gene, partial cds.>gb:AY377779_1324318 Viviparus
           georgianus histone H3 gene, partial
           cds.>gb:AY377780_1324319 Siphonaria pectinata histone H3
           gene, partial cds.>gb:AY377781_1324320 Octopus joubini
           histone H3 gene, partial cds.>gb:AY377782_1324321 Loligo
           pealei histone H3 gene, partial cds.>gb:AY377784_1324323
           Sepia elegans histone H3 gene, partial
           cds.>gb:AY428829_1326007 Liriope tetraphylla histone H3
           gene, partial cds.>gb:AY428830_1326008 Aurelia aurita
           histone H3 gene, partial cds.>gb:AY428831_1326009
           Branchiostoma lanceolatum histone H3 gene, partial
           cds.>gb:AY428833_1326011 Phoronopsis viridis histone H3
           gene, partial cds.>gb:AY428836_1326014 Pycnophyes
           greenlandicus histone H3 gene, partial
           cds.>gb:AY491324_1330480 Blattidae sp. B03 histone 3
           gene, partial cds.>gb:AY491325_1330481 Cryptocercus
           punctulatus isolate B04 histone 3 gene, partial
           cds.>gb:AY491327_1330483 Mantis religiosa isolate MN001
           histone 3 gene, partial cds.>gb:AY491329_1330485
           Acromantis sp. MN004 histone 3 gene, partial
           cds.>gb:AY491330_1330486 Chrysomantis sp. MN005 histone
           3 gene, partial cds.>gb:AY491331_1330487 Gongylus
           gongylodes isolate MN006 histone 3 gene, partial
           cds.>gb:AY491332_1330488 Paraoxypilus tasmaniensis
           isolate MN008 histone 3 gene, partial
           cds.>gb:AY491333_1330489 Mantoida schraderi isolate
           MN009 histone 3 gene, partial cds.>gb:AY491334_1330490
           Hymenopus coronatus isolate MN010 histone 3 gene,
           partial cds.>gb:AY491335_1330491 Phyllocrania paradoxa
           isolate MN011 histone 3 gene, partial
           cds.>gb:AY491337_1330493 Sphodromantis viridis isolate
           MN013 histone 3 gene, partial cds.>gb:AY491338_1330494
           Vates pectinacornis isolate MN014 histone 3 gene,
           partial cds.>gb:AY491339_1330495 Sphodromantis lineola
           isolate MN015 histone 3 gene, partial
           cds.>gb:AY491340_1330496 Choeradodis rhombicollis
           isolate MN016 histone 3 gene, partial
           cds.>gb:AY491341_1330497 Pseudocreobotra occellata
           isolate MN017 histone 3 gene, partial
           cds.>gb:AY491343_1330499 Hierodula sp. MN019 histone 3
           gene, partial cds.>gb:AY491344_1330500 Tamolanica
           tamolana isolate MN020 histone 3 gene, partial
           cds.>gb:AY491346_1330502 Paraoxypilus sp. MN022 histone
           3 gene, partial cds.>gb:AY491348_1330504 Stagmomantis
           vicina isolate MN024 histone 3 gene, partial
           cds.>gb:AY491349_1330505 Tenodera australasiae isolate
           MN025 histone 3 gene, partial cds.>gb:AY491350_1330506
           Phyllovates chlorophaea isolate MN026 histone 3 gene,
           partial cds.>gb:AY491351_1330507 Melliera brevipes
           isolate MN027 histone 3 gene, partial
           cds.>gb:AY491352_1330508 Anamiopteryx sp. MN028 histone
           3 gene, partial cds.>gb:AY491356_1330512 Tamolanica
           denticulata isolate MN032 histone 3 gene, partial
           cds.>gb:AY491357_1330513 Orthodera sp. MN033 histone 3
           gene, partial cds.>gb:AY491359_1330515 Hoplocorypha sp.
           MN035 histone 3 gene, partial cds.>gb:AY491360_1330516
           Ima fusca isolate MN037 histone 3 gene, partial
           cds.>gb:AY491362_1330518 Bolbe sp. MN039 histone 3 gene,
           partial cds.>gb:AY491363_1330519 Calofulcinia
           paraoxypila isolate MN040 histone 3 gene, partial
           cds.>gb:AY491364_1330520 Plistospilota sp. MN041 histone
           3 gene, partial cds.>gb:AY491365_1330521 Hoplocorypha
           sp. MN042 histone 3 gene, partial
           cds.>gb:AY491367_1330523 Hierodula schultzei isolate
           MN044 histone 3 gene, partial cds.>gb:AY491368_1330524
           Litaneutria minor isolate MN045 histone 3 gene, partial
           cds.>gb:AY491369_1330525 Bantia sp. MN046 histone 3
           gene, partial cds.>gb:AY491370_1330526 Fulcinia
           punctipes isolate MN047 histone 3 gene, partial
           cds.>gb:AY491373_1330529 Chloromantis rhombica isolate
           MN051 histone 3 gene, partial cds.>gb:AY491374_1330530
           Neomantis australis isolate MN052 histone 3 gene,
           partial cds.>gb:AY491375_1330531 Gyromantis sp. MN053
           histone 3 gene, partial cds.>gb:AY520692_1332770 Balanus
           crenatus histone H3 gene, partial
           cds.>gb:AY520693_1332771 Balanus glandula histone H3
           gene, partial cds.>gb:AY520694_1332772 Semibalanus
           balanoides histone H3 gene, partial
           cds.>gb:AY520695_1332773 Semibalanus cariosus histone H3
           gene, partial cds.>gb:AY520696_1332774 Balanus balanus
           histone H3 gene, partial cds.>gb:AY520697_1332775
           Balanus perforatus histone H3 gene, partial
           cds.>gb:AY520698_1332776 Menesiniella aquila histone H3
           gene, partial cds.>gb:AY520699_1332777 Megabalanus
           tintinnabulum histone H3 gene, partial
           cds.>gb:AY520700_1332778 Megabalanus californicus
           histone H3 gene, partial cds.>gb:AY520701_1332779
           Megabalanus spinosus histone H3 gene, partial
           cds.>gb:AY520702_1332780 Austromegabalanus psittacus
           histone H3 gene, partial cds.>gb:AY520703_1332781
           Elminius modestus histone H3 gene, partial
           cds.>gb:AY520704_1332782 Elminius kingii histone H3
           gene, partial cds.>gb:AY520705_1332783 Tetraclitella
           divisa histone H3 gene, partial cds.>gb:AY520706_1332784
           Tetraclitella purpurascens histone H3 gene, partial
           cds.>gb:AY520707_1332785 Tetraclita squamosa histone H3
           gene, partial cds.>gb:AY520708_1332786 Tetraclita
           japonica histone H3 gene, partial
           cds.>gb:AY520709_1332787 Chthamalus stellatus histone H3
           gene, partial cds.>gb:AY520710_1332788 Chthamalus
           montagui histone H3 gene, partial
           cds.>gb:AY520711_1332789 Chthamalus challengeri histone
           H3 gene, partial cds.>gb:AY520712_1332790 Chthamalus
           bisinuatus histone H3 gene, partial
           cds.>gb:AY520713_1332791 Jehlius cirratus histone H3
           gene, partial cds.>gb:AY520714_1332792 Notochthamalus
           scabrosus histone H3 gene, partial
           cds.>gb:AY520715_1332793 Chamaesipho tasmanica histone
           H3 gene, partial cds.>gb:AY520716_1332794 Catomerus
           polymerus histone H3 gene, partial
           cds.>gb:AY520718_1332796 Pollicipes pollicipes histone
           H3 gene, partial cds.>gb:AY520719_1332797 Pollicipes
           polymerus histone H3 gene, partial
           cds.>gb:AY520720_1332798 Capitulum mitella histone H3
           gene, partial cds.>gb:AY520721_1332799 Litoscalpellum
           regina histone H3 gene, partial cds.>gb:AY520723_1332801
           Ibla quadrivalvis histone H3 gene, partial
           cds.>gb:AY520724_1332802 Sacculina carcini histone H3
           gene, partial cds.>gb:AY520725_1332803 Heterosaccus
           californicus histone H3 gene, partial
           cds.>gb:AY557407_1335241 Opisthoteuthis sp. ARL-2004
           histone H3 gene, partial cds.>gb:AY557408_1335242
           Vampyroteuthis infernalis histone H3 gene, partial
           cds.>gb:AY557409_1335243 Haliphron atlanticus histone H3
           gene, partial cds.>gb:AY557411_1335244 Argonauta nodosa
           histone H3 gene, partial cds.>gb:AY557415_1335248 Sepia
           officinalis histone H3 gene, partial
           cds.>gb:AY557420_1335253 Spirula spirula histone H3
           gene, partial cds.>gb:AY557421_1335254 Idiosepius
           pygmaeus histone H3 gene, partial
           cds.>gb:AY557422_1335255 Loligo formosana histone H3
           gene, partial cds.>gb:AY557423_1335256 Loligo pealei
           histone H3 gene, partial cds.>gb:AY557429_1335262
           Brachioteuthis sp. ARL-2004 histone H3 gene, partial
           cds.>gb:AY557431_1335264 Leachia atlantica histone H3
           gene, partial cds.>gb:AY557432_1335265 Cycloteuthis
           sirventi histone H3 gene, partial
           cds.>gb:AY557434_1335267 Abraliopsis pfefferi histone H3
           gene, partial cds.>gb:AY557435_1335268 Enoploteuthis
           leptura histone H3 gene, partial
           cds.>gb:AY557436_1335269 Ornithoteuthis antillarum
           histone H3 gene, partial cds.>gb:AY557438_1335271
           Pyroteuthis margaritifera histone H3 gene, partial
           cds.>gb:AY557440_1335273 Gonatus fabricii histone H3
           gene, partial cds.>gb:AY557441_1335274 Histioteuthis
           corona histone H3 gene, partial cds.>gb:AY557442_1335275
           Histioteuthis hoylei histone H3 gene, partial
           cds.>gb:AY557443_1335276 Histioteuthis reversa histone
           H3 gene, partial cds.>gb:AY557444_1335277 Joubiniteuthis
           portieri histone H3 gene, partial
           cds.>gb:AY557446_1335279 Mastigoteuthis agassizi histone
           H3 gene, partial cds.>gb:AY557447_1335280 Mastigoteuthis
           magna histone H3 gene, partial cds.>gb:AY557450_1335283
           Illex coindeti histone H3 gene, partial
           cds.>gb:AY557453_1335286 Moroteuthis knipovitchi histone
           H3 gene, partial cds.>gb:AY579132_1338773 Anodonta sp.
           SWH-2004 histone H3 gene, partial
           cds.>gb:AY579133_1338774 Dahurinaia dahurica MCZ
           DNA100683 histone H3 gene, partial
           cds.>gb:AY579134_1338775 Margaritifera laevis MCZ
           DNA100685 histone H3 gene, partial
           cds.>gb:AY579135_1338776 Margaritifera laevis MCZ
           DNA100687 histone H3 gene, partial
           cds.>gb:AY579136_1338777 Margaritifera auricularia MCZ
           DNA100672 histone H3 gene, partial
           cds.>gb:AY579137_1338778 Margaritifera auricularia MCZ
           DNA100674 histone H3 gene, partial
           cds.>gb:AY579138_1338779 Margaritifera falcata MCZ
           DNA100670 histone H3 gene, partial
           cds.>gb:AY579140_1338781 Margaritifera falcata MCZ
           DNA100699 histone H3 gene, partial
           cds.>gb:AY579142_1338783 Margaritifera margaritifera MCZ
           DNA100694 histone H3 gene, partial
           cds.>gb:AY579143_1338784 Margaritifera margaritifera MCZ
           DNA100697 histone H3 gene, partial
           cds.>gb:AY579144_1338785 Cumberlandia monodonta MCZ
           DNA100863 histone H3 gene, partial
           cds.>gb:AY773002_1350571 Euconocephalus thunbergi
           histone 3 gene, partial cds.>gb:AY788897_1351608 Mnais
           nawai histone 3 gene, partial cds.>gb:AY850372_1353816
           Rhithrogena japonica histone H3 gene, partial
           cds.>gb:AY860841_1354216 Ephemera strigata histone H3
           gene, partial cds.>gb:AY866428_1354504 Tenodera
           angustipennis histone H3 gene, partial
           cds.>gb:AY870289_1354596 Epeorus ikanonis histone H3
           gene, partial cds.>gb:AY870291_1354598 Ameletus costalis
           histone H3 gene, partial cds.>gb:AY870292_1354599
           Pantala flavescens histone H3 gene, partial
           cds.>gb:PAS566013_1391645 Pimelia ascendens partial his3
           gene for histone H3.>gb:PAT566024_1391652 Pimelia
           atlantis frigioides partial his3 gene for histone
           H3.>gb:PAT566027_1391653 Pimelia atlantis atlantis
           partial his3 gene for histone H3.>gb:PBA566032_1391683
           Pimelia baetica partial his3 gene for histone
           H3.>gb:PBO566025_1391724 Pimelia boyeri partial his3
           gene for histone H3.>gb:PCA566014_1391769 Pimelia
           canariensis partial his3 gene for histone
           H3.>gb:PCO566035_1391815 Pimelia costata partial his3
           gene for histone H3.>gb:PCO566042_1391816 Pimelia
           cordata partial his3 gene for histone
           H3.>gb:PCR566030_1391822 Pimelia criba partial his3 gene
           for histone H3.>gb:PEC566041_1391921 Pimelia echidna
           partial his3 gene for histone H3.>gb:PEL566031_1391927
           Pimelia elevata partial his3 gene for histone
           H3.>gb:PES566019_1391942 Pimelia estevezi partial his3
           gene for histone H3.>gb:PFE566020_1394188 Pimelia
           fernandezlopezi partial his3 gene for histone
           H3.>gb:PFO566039_1394922 Pimelia fornicata partial his3
           gene for histone H3.>gb:PGR566018_1395204 Pimelia
           granulicollis partial his3 gene for histone
           H3.>gb:PIN566029_1395261 Pimelia interjecta partial his3
           gene for histone H3.>gb:PIN566034_1395262 Pimelia
           integra partial his3 gene for histone
           H3.>gb:PLA566021_1395302 Pimelia laevigata costipennis
           partial his3 gene for histone H3.>gb:PLA566022_1395303
           Pimelia laevigata laevigata partial his3 gene for
           histone H3.>gb:PLA566023_1395304 Pimelia laevigata
           validipes partial his3 gene for histone
           H3.>gb:PLU566010_1395387 Pimelia lutaria partial his3
           gene for histone H3.>gb:PMA566026_1395417 Pimelia
           mauritanica bletoni partial his3 gene for histone
           H3.>gb:PMA566028_1395418 Pimelia maura partial his3 gene
           for histone H3.>gb:PMO566036_1395459 Pimelia monticola
           partial his3 gene for histone H3.>gb:PRA566011_1395695
           Pimelia radula granulata partial his3 gene for histone
           H3.>gb:PRA566012_1395696 Pimelia radula radula partial
           his3 gene for histone H3.>gb:PRO566038_1395723 Pimelia
           rotundipennis partial his3 gene for histone
           H3.>gb:PRU566040_1395740 Pimelia rugosa partial his3
           gene for histone H3.>gb:PSC566037_1395750 Pimelia
           scabrosa partial his3 gene for histone
           H3.>gb:PSP566015_1395856 Pimelia sparsa sparsa partial
           his3 gene for histone H3.>gb:PSP566016_1395857 Pimelia
           sparsa albohumeralis partial his3 gene for histone
           H3.>gb:PSP566017_1395858 Pimelia sparsa serrimargo
           partial his3 gene for histone H3.>gb:PSP566043_1395859
           Pimelia sp. JP2003-1 partial his3 gene for histone
           H3.>gb:PSP566044_1395860 Pimelia sp. JP2003-2 partial
           his3 gene for histone H3.>gb:PVA566033_1396062 Pimelia
           variolosa partial his3 gene for histone H3.
          Length = 109

 Score =  208 bits (529), Expect = 8e-53
 Identities = 105/109 (96%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AY662898_2542790 Paretroplus cf. kieneri 'Amboaboa' histone H3a
           gene, partial cds.
          Length = 110

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLA KAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLAXKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY655555_2542358 Rheocles derhami histone H3a gene, partial cds.
          Length = 110

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAA KSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAAHKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:TEL436968_1399991 Tetrastemma elegans partial H3 gene for
           histone H3.
          Length = 110

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVA REIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVAXREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:RSA436982_1396517 Ramphogordius sanguineus partial H3 gene for
           histone H3.
          Length = 110

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTN CAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNXCAIHAKR 110



>gb:AY744885_1349204 Ophiderma definita histone 3 (H3) gene, partial
           cds.
          Length = 109

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/109 (96%), Positives = 108/109 (99%)
 Frame = +3

Query: 102 TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKL 281
           TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKL
Sbjct: 1   TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL 60

Query: 282 PFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHA 428
           PFQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHA
Sbjct: 61  PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA 109



>gb:AY744858_1349177 Lepyronia quadrangularis histone 3 (H3) gene,
           partial cds.
          Length = 109

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/109 (96%), Positives = 108/109 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK 431
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK 109



>gb:AY520722_1332800 Poecilasma inaequilaterale histone H3 gene,
           partial cds.
          Length = 109

 Score =  207 bits (528), Expect = 1e-52
 Identities = 104/109 (95%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSA+ ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAIMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AY078705_1296428 Lepthyphantes minutus specimen-voucher G47
           histone H3 (H3) gene, partial cds.
          Length = 109

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/109 (96%), Positives = 107/109 (98%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEAXEAYLVGLFEDTNLCAIHAKR 109



>gb:AY070161_1294624 Corbicula fluminea histone H3 gene, partial
           cds.>gb:AY070163_1294626 Glossus humanus histone H3
           gene, partial cds.>gb:AY070164_1294627 Mya arenaria
           histone H3 gene, partial cds.>gb:AY070166_1294629
           Hiatella arctica histone H3 gene, partial
           cds.>gb:AY377770_1324309 Mya arenaria histone H3 gene,
           partial cds.
          Length = 109

 Score =  207 bits (528), Expect = 1e-52
 Identities = 105/109 (96%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AY662903_2542794 Paretroplus polyactis 'South' histone H3a gene,
           partial cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLV EIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVSEIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY662885_2542778 Lachnolaimus maximus histone H3a gene, partial
           cds.>gb:AY662925_2542816 Apistogramma sp. JSS-2004
           histone H3a gene, partial cds.>gb:AY662930_2542821
           Crenicichla alta histone H3a gene, partial
           cds.>gb:AY662941_2542831 Etia nguiti histone H3a gene,
           partial cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLV EIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVXEIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY662882_2542775 Pristolepis fasciata histone H3a gene, partial
           cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL EIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALXEIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY662881_2542774 Polycentropsis abbreviata histone H3a gene,
           partial cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDL FQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLXFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539278_2536826 Labrisomus multiporosus histone H3 gene,
           partial cds.>gb:AY655572_2542375 Glossolepis incisus
           histone H3a gene, partial cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAP KQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPXKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539262_2536810 Gramma loreto histone H3 gene, partial cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAA KSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAAXKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539176_2536729 Chilara taylori histone H3 gene, partial cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           A KSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   AXKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:PSP436964_1395808 Paranemertes sp. 249 partial H3 gene for
           histone H3.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 103/110 (93%), Positives = 109/110 (99%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:NMI436973_1390901 Nectonemertes mirabilis partial H3 gene for
           histone H3.>gb:AY662952_2542842 Steatocranus tinanti
           histone H3a gene, partial cds.
          Length = 110

 Score =  207 bits (527), Expect = 1e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           AR STGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARXSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY557448_1335281 Neoteuthis thielei histone H3 gene, partial
           cds.
          Length = 109

 Score =  207 bits (527), Expect = 1e-52
 Identities = 104/109 (95%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQ+ATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQMATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AY662948_2542838 Oreochromis mossambicus histone H3a gene,
           partial cds.
          Length = 110

 Score =  207 bits (526), Expect = 2e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKT LRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTXLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY662927_2542818 Chaetobranchopsis orbicularis histone H3a gene,
           partial cds.
          Length = 110

 Score =  207 bits (526), Expect = 2e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVAL EIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALLEIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY655587_2542390 Labidesthes sicculus histone H3a gene, partial
           cds.
          Length = 110

 Score =  207 bits (526), Expect = 2e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           A KSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   AGKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY557413_1335246 Graneledone verrucosa histone H3 gene, partial
           cds.>gb:AY557414_1335247 Thaumeledone gunteri histone H3
           gene, partial cds.>gb:AY557416_1335249 Heteroteuthis
           hawaiiensis histone H3 gene, partial
           cds.>gb:AY557417_1335250 Rossia palpebrosa histone H3
           gene, partial cds.>gb:AY557418_1335251 Sepiola affinis
           histone H3 gene, partial cds.>gb:AY557419_1335252
           Stoloteuthis leucoptera histone H3 gene, partial
           cds.>gb:AY557427_1335260 Bathyteuthis abyssicola histone
           H3 gene, partial cds.
          Length = 109

 Score =  207 bits (526), Expect = 2e-52
 Identities = 104/109 (95%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSS+V ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSSVMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AY070142_1294605 Lepidopleurus cajetanus histone H3 gene,
           partial cds.>gb:AY377734_1324273 Leptochiton asellus
           histone H3 gene, partial cds.>gb:AY377735_1324274
           Lepidopleurus cajetanus histone H3 gene, partial
           cds.>gb:AY377738_1324277 Tonicia lamellosa histone H3
           gene, partial cds.>gb:AY377739_1324278 Tonicella lineata
           histone H3 gene, partial cds.>gb:AY377740_1324279
           Chaetopleura angulata histone H3 gene, partial
           cds.>gb:AY377741_1324280 Chaetopleura apiculata histone
           H3 gene, partial cds.>gb:AY377743_1324282 Ischnochiton
           elongatus histone H3 gene, partial
           cds.>gb:AY377744_1324283 Ischnochiton comptus histone H3
           gene, partial cds.>gb:AY377745_1324284 Ischnochiton
           rissoi histone H3 gene, partial cds.>gb:AY377746_1324285
           Ischnochiton australis histone H3 gene, partial
           cds.>gb:AY377749_1324288 Callistochiton antiquus histone
           H3 gene, partial cds.>gb:AY377752_1324291 Mopalia
           muscosa histone H3 gene, partial
           cds.>gb:AY377754_1324293 Katharina tunicata histone H3
           gene, partial cds.>gb:AY377755_1324294 Chiton olivaceus
           histone H3 gene, partial cds.>gb:AY377756_1324295
           Liolophura japonica histone H3 gene, partial
           cds.>gb:AY377757_1324296 Sypharochiton pelliserpentis
           histone H3 gene, partial cds.>gb:AY377758_1324297
           Acanthopleura granulata histone H3 gene, partial
           cds.>gb:AY377763_1324302 Chaetoderma nitidulum histone
           H3 gene, partial cds.
          Length = 109

 Score =  207 bits (526), Expect = 2e-52
 Identities = 104/109 (95%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+E+YLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASESYLVGLFEDTNLCAIHAKR 109



>gb:AF519316_1278874 Cleosiphon aspergillus isolate DNA100393
           histone H3 gene, partial cds.
          Length = 109

 Score =  207 bits (526), Expect = 2e-52
 Identities = 104/109 (95%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQ+SAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQTSAVMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AF110870_1242051 Triops australiensis histone H3 (H3) gene,
           partial cds.>gb:AF110877_1242058 Atrax sp. EBU-1999
           histone H3 (H3) gene, partial cds.
          Length = 109

 Score =  207 bits (526), Expect = 2e-52
 Identities = 104/109 (95%), Positives = 108/109 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK+
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKK 109



>sp|P02301|H34_MOUSE Histone H3.4 (Embryonic).>pir|A02633|HSMS34
           histone H3.4 - mouse
          Length = 134

 Score =  207 bits (526), Expect = 2e-52
 Identities = 109/135 (80%), Positives = 119/135 (88%)
 Frame = +3

Query: 87  ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 266
           A TKQTARKST GKAPRKQLATKAA KSAP+TGGVKK HR+RP TVAL EIR+Y  STEL
Sbjct: 1   AHTKQTARKSTCGKAPRKQLATKAAXKSAPSTGGVKKSHRYRPDTVALLEIRRYH-STEL 59

Query: 267 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 446
           LI KLPFQRLV+EIAQDFKTDLRFQS+A+ ALQEA+EA  VGLFEDTNLCAIHAK VT++
Sbjct: 60  LIHKLPFQRLVQEIAQDFKTDLRFQSAAIGALQEASEANRVGLFEDTNLCAIHAKCVTVI 119

Query: 447 PKDMQLARRIRGERA 491
           PKD+QLA  I GERA
Sbjct: 120 PKDIQLAHSILGERA 134



>gb:AY662929_2542820 Cichlasoma bimaculatum histone H3a gene,
           partial cds.
          Length = 110

 Score =  206 bits (525), Expect = 2e-52
 Identities = 104/110 (94%), Positives = 107/110 (97%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLC IH KR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCXIHGKR 110



>gb:AF404629_1796786 Lewia infectoria isolate CR30 histone gene,
           partial cds.
          Length = 119

 Score =  206 bits (525), Expect = 2e-52
 Identities = 103/119 (86%), Positives = 112/119 (94%)
 Frame = +3

Query: 114 STGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQR 293
           STGGKAPRKQLA+KAARKSAP+TGGVKKPHR++PGTVALREIR+YQKSTELLIRKLPFQR
Sbjct: 1   STGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQR 60

Query: 294 LVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLAR 470
           LVREIAQDFK+DLRFQSSA+ ALQE+ EAYLV LFEDTNLCAIHAK VTI  KD+QL R
Sbjct: 61  LVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKPVTIQSKDIQLPR 119



>gb:TWI436969_1401308 Tetrastemma wilsoni partial H3 gene for
           histone H3.
          Length = 110

 Score =  206 bits (525), Expect = 2e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+ QKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRXQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:RPU436984_1396484 Riserius pugetensis partial H3 gene for
           histone H3.
          Length = 110

 Score =  206 bits (525), Expect = 2e-52
 Identities = 104/110 (94%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFED +LCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDXBLCAIHAKR 110



>gb:AY070152_1294615 Limaria hians histone H3 gene, partial cds.
          Length = 109

 Score =  206 bits (525), Expect = 2e-52
 Identities = 104/109 (95%), Positives = 107/109 (98%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGK PRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKXPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AJ849512_1284697 Philocelis karlingi partial H3 gene for histone
           H3.
          Length = 113

 Score =  206 bits (525), Expect = 2e-52
 Identities = 103/113 (91%), Positives = 110/113 (97%)
 Frame = +3

Query: 90  RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELL 269
           RTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHR+RPGTVALREIR+YQKSTELL
Sbjct: 1   RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELL 60

Query: 270 IRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHA 428
           IRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA+E+YLV LFEDTNLCA HA
Sbjct: 61  IRKLPFQRLVREIAQDFKTDLRFQSTAIMALQEASESYLVSLFEDTNLCANHA 113



>gb:AF110862_1242043 Archisotoma sp. histone H3 (H3) gene, partial
           cds.
          Length = 109

 Score =  206 bits (525), Expect = 2e-52
 Identities = 104/109 (95%), Positives = 107/109 (98%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTE LIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEFLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AY662910_2542801 Paratilapia polleni 'Ravelobe' histone H3a
           gene, partial cds.
          Length = 110

 Score =  206 bits (524), Expect = 3e-52
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+R GTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRXGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539273_2536821 Gymnodraco acuticeps histone H3 gene, partial
           cds.
          Length = 110

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/110 (94%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           AR STGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARXSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539272_2536820 Harpagifer kerguelensis histone H3 gene,
           partial cds.
          Length = 110

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/110 (94%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLV EIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVXEIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539253_2536803 Careproctus melanurus histone H3 gene, partial
           cds.
          Length = 110

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/110 (94%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAP KQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPXKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539236_2536786 Myoxocephalus polyacanthocephalus histone H3
           gene, partial cds.>gb:AY539271_2536819 Lycodes diapterus
           histone H3 gene, partial cds.
          Length = 110

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/110 (94%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLAT AARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATXAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKR 110



>gb:AY539191_2536743 Pontinus longispinis histone H3 gene, partial
           cds.
          Length = 110

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/110 (94%), Positives = 108/110 (98%)
 Frame = +3

Query: 105 ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLP 284
           ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQ STELLIRKLP
Sbjct: 1   ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQXSTELLIRKLP 60

Query: 285 FQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           FQRLVREIAQDFKTDLRFQSSAV ALQE++EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  FQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKR 110



>gb:AY491355_1330511 Stagmomantis limbata isolate MN031 histone 3
           gene, partial cds.
          Length = 109

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/109 (95%), Positives = 107/109 (98%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLAT AARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATNAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 109



>gb:AY491323_1330479 Blattidae sp. B02 histone 3 gene, partial
           cds.>gb:AY557437_1335270 Pterygioteuthis gemmata histone
           H3 gene, partial cds.>gb:AY744852_1349171 Neophilaenus
           lineatus histone 3 (H3) gene, partial cds.
          Length = 108

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/108 (96%), Positives = 107/108 (99%)
 Frame = +3

Query: 111 KSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQ 290
           KSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPFQ
Sbjct: 1   KSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQ 60

Query: 291 RLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           RLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 61  RLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 108



>gb:AY428834_1326012 Siro rubens histone H3 gene, partial cds.
          Length = 109

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/109 (95%), Positives = 107/109 (98%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYL GLFEDTNLCAIHAKR
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLXGLFEDTNLCAIHAKR 109



>gb:ALA436953_1285061 Amphiporus lactifloreus partial H3 gene for
           histone H3.
          Length = 110

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/109 (95%), Positives = 107/109 (98%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAP KQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 2   RKSTGGKAPSKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 61

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKR 434
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 62  QRLVREIAQDFKTDLRFQSSAVGALQEASEAYLVGLFEDTNLCAIHAKR 110



>gb:AF416841_1269324 Anadara grandis isolate grandis97 histone 3
           gene, partial cds.>gb:AF416842_1269325 Anadara
           tuberculosa isolate tuber91 histone 3 gene, partial
           cds.>gb:AF416843_1269326 Anadara similis isolate simil35
           histone 3 gene, partial cds.>gb:AF416844_1269327 Anadara
           ovalis isolate oval48 histone 3 gene, partial
           cds.>gb:AF416845_1269328 Anadara transversa isolate
           trans47 histone 3 gene, partial cds.>gb:AF416846_1269329
           Anadara nux isolate nux116 histone 3 gene, partial
           cds.>gb:AF416847_1269330 Anadara chemnitzii isolate
           chemBDT23 histone 3 gene, partial
           cds.>gb:AF416848_1269331 Anadara adamsi isolate adamsi1
           histone 3 gene, partial cds.>gb:AF416849_1269332
           Barbatia candida isolate candida76 histone 3 gene,
           partial cds.>gb:AF416850_1269333 Barbatia reeveana
           isolate reevIPG3 histone 3 gene, partial
           cds.>gb:AF416851_1269334 Arca imbricata isolate
           imbricata197 histone 3 gene, partial
           cds.>gb:AF416852_1269335 Arca mutabilis isolate
           mutabilis131 histone 3 gene, partial
           cds.>gb:AF416853_1269336 Arca pacifica isolate
           pacifica250 histone 3 gene, partial
           cds.>gb:AF416854_1269337 Arca ventricosa isolate
           ventTAH2 histone 3 gene, partial
           cds.>gb:AF416855_1269338 Barbatia domingensis isolate
           doming74 histone 3 gene, partial
           cds.>gb:AF416856_1269339 Barbatia plicata isolate
           plicataCV7 histone 3 gene, partial
           cds.>gb:AF416857_1269340 Barbatia gradata isolate
           gradTAB1 histone 3 gene, partial
           cds.>gb:AF416858_1269341 Arca ventricosa isolate
           ventTAH6 histone 3 gene, partial
           cds.>gb:AF416859_1269342 Noetia olssoni isolate
           olssoni317 histone 3 gene, partial
           cds.>gb:AF416860_1269343 Noetia ponderosa isolate
           ponder44MA histone 3 gene, partial
           cds.>gb:AF416861_1269344 Arcopsis adamsi isolate adamsi2
           histone 3 gene, partial cds.>gb:AF416862_1269345
           Arcopsis solida isolate solida1 histone 3 gene, partial
           cds.>gb:AF416863_1269346 Glycimeris sp. Marko-2001
           isolate GlycimPHI1 histone 3 gene, partial
           cds.>gb:AF416864_1269347 Arca zebra histone H3 gene,
           partial cds.
          Length = 108

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/108 (96%), Positives = 107/108 (99%)
 Frame = +3

Query: 117 TGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRL 296
           TGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPFQRL
Sbjct: 1   TGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRL 60

Query: 297 VREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 440
           VREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAKRVT
Sbjct: 61  VREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 108



>gb:AF110859_1242040 Unixenus mjobergi histone H3 (H3) gene, partial
           cds.
          Length = 109

 Score =  206 bits (524), Expect = 3e-52
 Identities = 104/108 (96%), Positives = 107/108 (99%)
 Frame = +3

Query: 108 RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPF 287
           RKSTGGKAPRKQLATKAARKSAPATGGVKKPHR+RPGTVALREIR+YQKSTELLIRKLPF
Sbjct: 1   RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 60

Query: 288 QRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK 431
           QRLVREIAQDFKTDLRFQSSAV ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct: 61  QRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK 108


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 730,910,003
Number of Sequences: 1806583
Number of extensions: 15929304
Number of successful extensions: 53838
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 50548
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53580
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 38703569590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)