BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7632
         (734 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|H96573|H96573 protein F12M16.29 [imported] - Arabidopsis tha...   182   4e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AP003142_1824876 Oryza sativa (japonica cultivar-group) genom...   181   2e-44   
gb:AC108499_1738471 Oryza sativa (japonica cultivar-group) chrom...   173   3e-42   
gb:AP005700_1856289 Oryza sativa (japonica cultivar-group) genom...   168   1e-40   
gb:AB012245_1511776 Arabidopsis thaliana genomic DNA, chromosome...   161   1e-38   
pir|C86305|C86305 hypothetical protein F6I1.3 - Arabidopsis thal...   152   8e-36   Arabidopsis thaliana [mouse-ear cress]
gb:BC076510_2559338 Danio rerio zgc:91797, mRNA (cDNA clone MGC:...   103   3e-21   
gb:BC074677_2558171 Xenopus tropicalis ubiquitin domain containi...   102   9e-21   
gb:BC082473_2562708 Xenopus laevis MGC84411 protein, mRNA (cDNA ...   101   1e-20   
gb:AL669844_2072488 Mouse DNA sequence from clone RP23-395O6 on ...   101   1e-20   
gb:BT020626_1435984 Bos taurus dendritic cell-derived ubiquitin-...   101   1e-20   
gb:AK076953_1171585 Mus musculus adult male testis cDNA, RIKEN f...   101   1e-20   
gb:AE014297_1137965 Drosophila melanogaster chromosome 3R, compl...    98   2e-19   
gb:BC079260_2107385 Rattus norvegicus cDNA clone MGC:94363 IMAGE...    97   2e-19   
gb:AX878759_1477549 Sequence 13664 from Patent EP1074617.>gb:AK0...    97   2e-19   
gb:AK078479_1172349 Mus musculus 12 days embryo female mullerian...    97   2e-19   
gb:BC019910_1976936 Homo sapiens dendritic cell-derived ubiquiti...    94   3e-18   
sp|Q9HDW4|YFW7_SCHPO|YFW7_SCHPO Hypothetical protein PB2B4.07 in chromosome...    58   2e-07   Schizosaccharomyces pombe
gb:BX908809_1644563 Neurospora crassa DNA linkage group IV Cosmi...    34   2.4     
sp|P29332|CGB2_CHICK|CGB2_CHICK G2/mitotic-specific cyclin B2.>pir|S23596|S...    34   2.4     Gallus gallus [bantam]
sp|O77689|CGB2_BOVIN|CGB2_BOVIN G2/mitotic-specific cyclin B2.>gb:AF080219_...    34   3.1     Bos taurus [bovine]
pir|B86339|B86339 protein F2D10.10 [imported] - Arabidopsis thal...    33   5.3     Arabidopsis thaliana [mouse-ear cress]
gb:AX647833_1472544 Sequence 2025 from Patent EP1270724.               33   7.0     
gb:AY679117_1345848 Plasmodium falciparum isolate 732 erythrocyt...    32   9.1     


>pir|H96573|H96573 protein F12M16.29 [imported] - Arabidopsis
           thaliana>gb:AE005173_893242 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC008007_1536423 Genomic sequence for
           Arabidopsis thaliana BAC F12M16 from chromosome I,
           complete sequence.>gb:AY059126_1564490 Arabidopsis
           thaliana unknown protein (At1g53400) mRNA, complete
           cds.>gb:AF370164_1792052 Arabidopsis thaliana unknown
           protein (At1g53400) mRNA, complete cds.
          Length = 114

 Score =  182 bits (463), Expect = 4e-45
 Identities = 84/104 (80%), Positives = 97/104 (93%)
 Frame = +3

Query: 423 KGDETVKKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEADISL 602
           + D +VKKIRKPKPWKH++ IT+A+L+++R+EFWDTAPHYGGRKEIWDALRAAAEADISL
Sbjct: 10  QADGSVKKIRKPKPWKHTQPITKAELMKLREEFWDTAPHYGGRKEIWDALRAAAEADISL 69

Query: 603 AQAIVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           AQAIVDSAG+IVQ +DLT+CYDERGAKYELPKYV SEPTNL  E
Sbjct: 70  AQAIVDSAGVIVQNTDLTVCYDERGAKYELPKYVLSEPTNLEEE 113



>gb:AP003142_1824876 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0435H01.
          Length = 113

 Score =  181 bits (458), Expect = 2e-44
 Identities = 84/104 (80%), Positives = 94/104 (90%)
 Frame = +3

Query: 423 KGDETVKKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEADISL 602
           K D+  KK++KPKPWKH++AIT  QL QMRDEFWDTAPHYGG+KEIWDALRAAAEA++SL
Sbjct: 9   KTDDNSKKLKKPKPWKHNQAITTTQLKQMRDEFWDTAPHYGGQKEIWDALRAAAEAELSL 68

Query: 603 AQAIVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           AQ IVDSAGIIV  SD+TICYDERGAKYELPKYV SEPTNL+RE
Sbjct: 69  AQTIVDSAGIIVSNSDMTICYDERGAKYELPKYVLSEPTNLIRE 112



>gb:AC108499_1738471 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1187_E11, complete
           sequence.>gb:AC111015_1738804 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1131_E09, complete
           sequence.
          Length = 113

 Score =  173 bits (438), Expect = 3e-42
 Identities = 79/104 (75%), Positives = 93/104 (89%)
 Frame = +3

Query: 423 KGDETVKKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEADISL 602
           K DE  KK++KPKPWKH++AIT  QL +MR+EFWDTAPHYGG+KEIWDALRAAAEA++ L
Sbjct: 9   KVDENSKKLKKPKPWKHTQAITPTQLSKMREEFWDTAPHYGGQKEIWDALRAAAEAELPL 68

Query: 603 AQAIVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           AQ IV+SAGI+V  SD+T+CYDERGAKYELPKYV SEPTNL+RE
Sbjct: 69  AQTIVNSAGIVVSNSDMTLCYDERGAKYELPKYVLSEPTNLIRE 112



>gb:AP005700_1856289 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBb0085I16.
          Length = 116

 Score =  168 bits (425), Expect = 1e-40
 Identities = 76/101 (75%), Positives = 89/101 (88%)
 Frame = +3

Query: 432 ETVKKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEADISLAQA 611
           +  KKIRKPKPWKH + IT  QL +MR+EFWDTAPHYGGRKEIWDALR AAE+++SLAQA
Sbjct: 15  DATKKIRKPKPWKHPQPITMVQLTKMREEFWDTAPHYGGRKEIWDALRVAAESEVSLAQA 74

Query: 612 IVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           IV+SA IIV  +DLT+CYDERGAKYELPKYV SEPTNL+++
Sbjct: 75  IVESAAIIVSNTDLTLCYDERGAKYELPKYVLSEPTNLIQD 115



>gb:AB012245_1511776 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRA19.
          Length = 98

 Score =  161 bits (408), Expect = 1e-38
 Identities = 72/94 (76%), Positives = 85/94 (90%)
 Frame = +3

Query: 453 KPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEADISLAQAIVDSAGI 632
           KPKPW H+E ITRAQL  MR+EFWDT+PHYGG++EIW+ALRAAAEAD+ LAQ IVDSAG+
Sbjct: 2   KPKPWAHTEPITRAQLTNMREEFWDTSPHYGGQREIWEALRAAAEADLKLAQTIVDSAGV 61

Query: 633 IVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           IVQ  DLT+C+DERGA+YELP+YV SEPTNL+RE
Sbjct: 62  IVQNRDLTLCWDERGARYELPRYVLSEPTNLIRE 95



>pir|C86305|C86305 hypothetical protein F6I1.3 - Arabidopsis
           thaliana>gb:AE005172_890672 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC051629_1540071 Arabidopsis thaliana
           chromosome I BAC F6I1 genomic sequence, complete
           sequence.>gb:BT014794_1641784 Arabidopsis thaliana
           At1g16960 gene, complete cds.>gb:BT015016_1641986
           Arabidopsis thaliana At1g16960 mRNA, complete cds.
          Length = 114

 Score =  152 bits (383), Expect = 8e-36
 Identities = 69/97 (71%), Positives = 86/97 (88%), Gaps = 1/97 (1%)
 Frame = +3

Query: 441 KKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA-DISLAQAIV 617
           +KIR+PK WKH + I+R +L QMR+EFWDTAPHYGG+KEIWDALRAAAE  D+SLAQ I+
Sbjct: 15  EKIRRPKTWKHPQPISRDELTQMREEFWDTAPHYGGKKEIWDALRAAAEEDDLSLAQTIL 74

Query: 618 DSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLM 728
           +SAG+IVQ +DLTICYDE+G+KYELPKYV  +P+NL+
Sbjct: 75  ESAGVIVQNTDLTICYDEKGSKYELPKYVLRDPSNLI 111



>gb:BC076510_2559338 Danio rerio zgc:91797, mRNA (cDNA clone
           MGC:91797 IMAGE:6996921), complete cds.
          Length = 240

 Score =  103 bits (257), Expect = 3e-21
 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 4/101 (3%)
 Frame = +3

Query: 444 KIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQA 611
           K  KPK WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA+A    D  LAQA
Sbjct: 33  KREKPK-WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAQAFESNDHELAQA 91

Query: 612 IVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           I+D A I +    LT CYDE G +Y+LP Y  S P N++ E
Sbjct: 92  IIDGASITLPHGALTECYDELGNRYQLPVYCLSPPVNMIEE 132



>gb:BC074677_2558171 Xenopus tropicalis ubiquitin domain containing
           1, mRNA (cDNA clone MGC:69397 IMAGE:5335363), complete
           cds.
          Length = 240

 Score =  102 bits (253), Expect = 9e-21
 Identities = 54/101 (53%), Positives = 65/101 (64%), Gaps = 5/101 (4%)
 Frame = +3

Query: 447 IRKPKP-WKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQA 611
           ++K +P WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D  LAQA
Sbjct: 33  LKKERPRWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAFAVEANDHELAQA 92

Query: 612 IVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           IVD A I +    LT CYDE G +Y+LP Y  + P NL+ E
Sbjct: 93  IVDGASITLPHGSLTECYDELGTRYQLPVYCLAPPVNLIME 133



>gb:BC082473_2562708 Xenopus laevis MGC84411 protein, mRNA (cDNA
           clone MGC:84411 IMAGE:7019151), complete cds.
          Length = 234

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 5/101 (4%)
 Frame = +3

Query: 447 IRKPKP-WKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQA 611
           ++K KP WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D  LAQA
Sbjct: 32  LKKDKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA 91

Query: 612 IVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           I+D A I +    LT CYDE G +Y+LP Y  + P N++ E
Sbjct: 92  IIDGASITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE 132



>gb:AL669844_2072488 Mouse DNA sequence from clone RP23-395O6 on
           chromosome 11 Contains the 3' end of a novel gene, a
           novel gene, the Stk10 gene for serine/threonine kinase
           10, the 5' end of the Fbxw1b gene for F-box and WD-40
           domain protein 1B and two CpG islands, complete
           sequence.>gb:BC057026_2102546 Mus musculus RIKEN cDNA
           9630054F20 gene, mRNA (cDNA clone MGC:67186
           IMAGE:6825513), complete cds.
          Length = 234

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 5/101 (4%)
 Frame = +3

Query: 447 IRKPKP-WKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQA 611
           ++K KP WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D  LAQA
Sbjct: 32  LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA 91

Query: 612 IVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           I+D A I +    LT CYDE G +Y+LP Y  + P N++ E
Sbjct: 92  IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE 132



>gb:BT020626_1435984 Bos taurus dendritic cell-derived
           ubiquitin-like protein (DC-UbP), mRNA, complete cds.
          Length = 234

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 5/101 (4%)
 Frame = +3

Query: 447 IRKPKP-WKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQA 611
           ++K KP WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D  LAQA
Sbjct: 32  LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA 91

Query: 612 IVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           I+D A I +    LT CYDE G +Y+LP Y  + P N++ E
Sbjct: 92  IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE 132



>gb:AK076953_1171585 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930571L24
           product:unknown EST, full insert sequence.
          Length = 234

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 5/101 (4%)
 Frame = +3

Query: 447 IRKPKP-WKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQA 611
           ++K KP WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D  LAQA
Sbjct: 32  LKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQA 91

Query: 612 IVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
           I+D A I +    LT CYDE G +Y+LP Y  + P N++ E
Sbjct: 92  IIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE 132



>gb:AE014297_1137965 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003603_1217503 Drosophila melanogaster
           chromosome 3R, section 5 of 118 of the complete
           sequence.>gb:AY084174_1296830 Drosophila melanogaster
           RE42193 full insert cDNA.
          Length = 249

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 48/94 (51%), Positives = 60/94 (63%), Gaps = 4/94 (4%)
 Frame = +3

Query: 465 WKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQAIVDSAGI 632
           W+    +T  QL   RDEFWDTAP + GRKEIWDALRAA  A    D  +AQAI+D A +
Sbjct: 48  WRSDVPLTEGQLRSKRDEFWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANV 107

Query: 633 IVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
            V    LT CYDE G +Y++P Y  S P N+++E
Sbjct: 108 SVPNGYLTECYDELGTQYKVPIYCLSYPINIVKE 141



>gb:BC079260_2107385 Rattus norvegicus cDNA clone MGC:94363
           IMAGE:7133433, complete cds.
          Length = 227

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 55/106 (51%), Positives = 65/106 (61%), Gaps = 4/106 (3%)
 Frame = +3

Query: 429 DETVKKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DI 596
           +E +KK R    WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D 
Sbjct: 26  NEPLKKERLK--WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDH 83

Query: 597 SLAQAIVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
            LAQAI+D A I +    L  CYDE G +Y+LP Y  S P NL+ E
Sbjct: 84  ELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLE 129



>gb:AX878759_1477549 Sequence 13664 from Patent
           EP1074617.>gb:AK021869_1908988 Homo sapiens cDNA
           FLJ11807 fis, clone HEMBA1006284.>gb:AL359388_1925490
           Human DNA sequence from clone RP11-445I23 on chromosome
           10 Contains the 5' end of the MMS19L gene for MMS19-like
           (MET18 homolog, S. cerevisiae), the gene for a novel
           protein (FLJ11807), the 5' end of the ANKRD2 gene for
           ankyrin repeat domain 2 (stretch responsive muscle) and
           two CpG islands, complete sequence.>gb:BC007331_1970648
           Homo sapiens ubiquitin domain containing 1, mRNA (cDNA
           clone MGC:15051 IMAGE:3629185), complete cds.
          Length = 227

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 55/106 (51%), Positives = 65/106 (61%), Gaps = 4/106 (3%)
 Frame = +3

Query: 429 DETVKKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DI 596
           +E +KK R    WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D 
Sbjct: 26  NEPLKKERLK--WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDH 83

Query: 597 SLAQAIVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
            LAQAI+D A I +    L  CYDE G +Y+LP Y  S P NL+ E
Sbjct: 84  ELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLE 129



>gb:AK078479_1172349 Mus musculus 12 days embryo female mullerian
           duct includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6820406J02 product:hypothetical
           Ubiquitin domain containing protein, full insert
           sequence.>gb:BC016129_2092200 Mus musculus ubiquitin
           domain containing 1, mRNA (cDNA clone MGC:28905
           IMAGE:4920477), complete cds.
          Length = 227

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 55/106 (51%), Positives = 65/106 (61%), Gaps = 4/106 (3%)
 Frame = +3

Query: 429 DETVKKIRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DI 596
           +E +KK R    WK    +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D 
Sbjct: 26  NEPLKKERLK--WKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDH 83

Query: 597 SLAQAIVDSAGIIVQASDLTICYDERGAKYELPKYVXSEPTNLMRE 734
            LAQAI+D A I +    L  CYDE G +Y+LP Y  S P NL+ E
Sbjct: 84  ELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLE 129



>gb:BC019910_1976936 Homo sapiens dendritic cell-derived
           ubiquitin-like protein, mRNA (cDNA clone MGC:30022
           IMAGE:4402070), complete cds.
          Length = 190

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 48/88 (54%), Positives = 58/88 (65%), Gaps = 4/88 (4%)
 Frame = +3

Query: 483 ITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEA----DISLAQAIVDSAGIIVQASD 650
           +T  QL   RDEFWDTAP + GRKEIWDAL+AAA A    D  LAQAI+D A I +    
Sbjct: 1   MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGANITLPHGA 60

Query: 651 LTICYDERGAKYELPKYVXSEPTNLMRE 734
           LT CYDE G +Y+LP Y  + P N++ E
Sbjct: 61  LTECYDELGNRYQLPVYCLAPPINMIEE 88



>sp|Q9HDW4|YFW7_SCHPO Hypothetical protein PB2B4.07 in chromosome
           I.>gb:SPAPB2B4_1718696 S.pombe chromosome I BAC pB2B4.
          Length = 239

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 8/98 (8%)
 Frame = +3

Query: 447 IRKPKPWKHSEAITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEADISLAQAIVDSA 626
           +R PK +  +  +T+ ++   R+EFW+T   YGG KEIWD L         L +   ++A
Sbjct: 27  LRLPKLYTPNPLLTKEEVEVRRNEFWETCWAYGGSKEIWDVLHKVVTL---LYEGNAEAA 83

Query: 627 GIIVQASDLTI--------CYDERGAKYELPKYVXSEP 716
             +  A+DLTI         YD +G  YE+PK V   P
Sbjct: 84  TEMALAADLTIPENDISKGVYDSKGTFYEIPKIVARIP 121



>gb:BX908809_1644563 Neurospora crassa DNA linkage group IV Cosmid
           contig 29E8.
          Length = 466

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 37/151 (24%), Positives = 57/151 (37%), Gaps = 55/151 (36%)
 Frame = +3

Query: 438 VKKIRKPKPWKHSEAI-TRAQLVQMRDEFWDTAPHYGGRKEIW----------------D 566
           + K  K   W     + TRA L + R EF+DT     GR+E+W                D
Sbjct: 146 INKPLKRHEWTSDGTVWTRAALDRERVEFFDT--RVTGRQEVWLAIHAALEILWHQEQVD 203

Query: 567 ALRAAAEADISLA-----------------------------QAIVDSAGIIVQASDLTI 659
           A  AA   D +LA                             +  + +A  I+ A+++T+
Sbjct: 204 AAAAAQHGDGTLAAPSDYEGEEGQGEGHSSGVEEDDDDDNGREVALATAQTILNAAEITL 263

Query: 660 ---------CYDERGAKYELPKYVXSEPTNL 725
                     YD  G  Y LP+++ S+PTN+
Sbjct: 264 PTGNLAQGGAYDLLGNHYSLPEHIVSDPTNI 294



>sp|P29332|CGB2_CHICK G2/mitotic-specific cyclin
           B2.>pir|S23596|S23596 cyclin B2 -
           chicken>gb:GGCYCB2M_2573081 G.gallus mRNA for cyclin B2.
          Length = 399

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 14/37 (37%), Positives = 27/37 (72%)
 Frame = -1

Query: 362 LIQESIYINISTADIYIYTHRVERKRLQEMNLSVLVL 252
           L+QE++Y+ ++  D ++ +H V RKRLQ + ++ L+L
Sbjct: 186 LLQETLYMCVAVMDRFLQSHPVPRKRLQLVGVTALLL 222



>sp|O77689|CGB2_BOVIN G2/mitotic-specific cyclin
           B2.>gb:AF080219_1413608 Bos taurus cyclin B2 (CYCB2)
           mRNA, complete cds.
          Length = 398

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 14/37 (37%), Positives = 25/37 (67%)
 Frame = -1

Query: 362 LIQESIYINISTADIYIYTHRVERKRLQEMNLSVLVL 252
           L+QE++Y+ ++  D Y+    V RK+LQ + ++ LVL
Sbjct: 182 LLQETLYMCVAVMDRYLQVQPVSRKKLQAVGITALVL 218



>pir|B86339|B86339 protein F2D10.10 [imported] - Arabidopsis
           thaliana>gb:AE005172_891017 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC027665_1539897 Genomic sequence for
           Arabidopsis thaliana BAC F5M15 from chromosome I,
           complete sequence.>gb:AC069251_1540721 Genomic sequence
           for Arabidopsis thaliana BAC F2D10 from chromosome I,
           complete sequence.
          Length = 460

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 12/37 (32%), Positives = 27/37 (72%)
 Frame = -1

Query: 362 LIQESIYINISTADIYIYTHRVERKRLQEMNLSVLVL 252
           L++E++Y+ I+  D ++  H++ RK+LQ + ++ L+L
Sbjct: 257 LMEETLYLTINVIDRFLAVHQIVRKKLQLVGVTALLL 293



>gb:AX647833_1472544 Sequence 2025 from Patent EP1270724.
          Length = 529

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = -3

Query: 351 IYIYKYIHGRYIYIHTQSREKEITGNEFIGTCFESFCVLATLSHSQLYTYTHTYM 187
           +YIY Y H  Y+YIH       I  +  I T   ++  + T +H  +YT+ HTY+
Sbjct: 447 MYIYTYTH-IYVYIH-------IYTHICIYTHIHTYMYIYTYTHICIYTHIHTYV 493



 Score = 32.7 bits (73), Expect = 7.0
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%)
 Frame = -3

Query: 351 IYIYKYIHGRYIYIHTQSREKEITGNEFIGTCFESFCVLATL-SHSQLYTYTHTYM 187
           +YIY YIH  Y+YIH                 +   C+   + +H  +YTY HTY+
Sbjct: 213 MYIYTYIH-TYVYIHI----------------YTHICIYTHIYTHMYIYTYIHTYV 251



>gb:AY679117_1345848 Plasmodium falciparum isolate 732 erythrocyte
            membrane protein 1 varPAM gene, partial cds.
          Length = 1893

 Score = 32.3 bits (72), Expect = 9.1
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 10/80 (12%)
 Frame = +3

Query: 480  AITRAQLVQMRDEFWDTAPHYGGRKEIWDALRAAAEADISLAQAI---------VDSAGI 632
            ++   +L Q R+++WD       RKE+W+A+   A  D  L + I         VDS   
Sbjct: 1534 SLKNMELTQFREKWWDA-----NRKEVWNAMTCVAPNDALLKKRINNPGDTSKPVDSQNS 1588

Query: 633  IVQASDLTIC-YDERGAKYE 689
              Q      C YD+    Y+
Sbjct: 1589 ETQTEQTKKCGYDKEPPDYD 1608


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 576,336,939
Number of Sequences: 1806583
Number of extensions: 9959813
Number of successful extensions: 25533
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 24666
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25464
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 44688536136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)