BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7561
         (1069 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q8L4F8|RPO3_NICSY|RPO3_NICSY DNA-directed RNA polymerase 3, chloroplast ...   320   4e-86   Nicotiana sylvestris
gb:NTA416570_1691395 Nicotiana tabacum mRNA for chloroplast RNA ...   313   4e-84   
sp|O24600|RPOT_ARATH|RPOT_ARATH DNA-directed RNA polymerase, chloroplast pr...   227   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb:NSY416568_1691230 Nicotiana sylvestris mRNA for mitochondrial...   191   2e-47   
gb:NSY302018_1691223 Nicotiana tabacum mRNA for phage-type RNA p...   190   5e-47   
sp|Q93Y94|RPO1_NICSY|RPO1_NICSY DNA-directed RNA polymerase 1, mitochondria...   190   5e-47   Nicotiana sylvestris
gb:AP005550_1853932 Oryza sativa (japonica cultivar-group) genom...   187   4e-46   
gb:AB096014_1525442 Oryza sativa (japonica cultivar-group) rpoT1...   187   4e-46   
gb:NTA416569_1691394 Nicotiana tabacum mRNA for mitochondrial an...   186   7e-46   
gb:AB058954_1521739 Nicotiana sylvestris NsRpoT-A mRNA for T7 ba...   186   7e-46   
gb:NSY302019_1691224 Nicotiana sylvestris mRNA for phage-type RN...   185   1e-45   
sp|Q8VWF8|RPO2_NICSY|RPO2_NICSY DNA-directed RNA polymerase 2, chloroplast/...   185   1e-45   Nicotiana sylvestris
gb:AJ586899_1811851 Hordeum vulgare partial mitochondrial mRNA f...   184   2e-45   
gb:AF091838_1767461 Triticum aestivum single-subunit RNA polymer...   181   2e-44   
gb:ATRNAPOL_1554072 Arabidopsis thaliana DNA-directed RNA polyme...   181   3e-44   
pir|T51399|T51399 DNA-directed RNA polymerase, mitochondrial - A...   181   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AF127021_1770499 Zea mays T7-like RNA polymerase (rpoT1) mRNA...   175   1e-42   
gb:AF127022_1770500 Zea mays T7-like RNA polymerase (rpoT2) mRNA...   171   2e-41   
gb:AB096015_1525443 Oryza sativa (japonica cultivar-group) rpoT2...   171   2e-41   
pir|T02751|T02751 DNA-directed RNA polymerase (EC 2.7.7.6) - mai...   171   2e-41   Zea mays [maize]
gb:ATY08137_1557458 Arabidopsis thaliana mRNA for mitochondrial ...   171   2e-41   
sp|P92969|RPOM_ARATH|RPOM_ARATH DNA-directed RNA polymerase, mitochondrial ...   171   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb:CARNAPOLY_1645457 C.album mRNA for mitochondrial single-subun...   171   3e-41   
gb:HVU507396_1682788 Hordeum vulgare subsp. vulgare mRNA for DNA...   169   7e-41   
gb:HVU507395_1682787 Hordeum vulgare subsp. vulgare rpoT gene fo...   169   7e-41   
gb:TAU34402_1724707 Triticum aestivum single-subunit RNA polymer...   162   1e-38   
gb:ATDDRNPOL_1548056 Arabidopsis thaliana gene encoding DNA-dire...   150   5e-35   
gb:AP005453_1852087 Oryza sativa (japonica cultivar-group) genom...   146   8e-34   
gb:PPA416855_1701221 Physcomitrella patens rpoT2 gene for RNA po...   141   2e-32   
gb:AB055215_1521434 Physcomitrella patens rpoT2 mRNA for single-...   141   2e-32   
gb:PPA416854_1701220 Physcomitrella patens rpoT1 gene for RNA po...   130   6e-29   
gb:AB055214_1521433 Physcomitrella patens rpoT1 mRNA for single-...   130   6e-29   
gb:AY081704_1568964 Arabidopsis thaliana At1g68990/T6L1_17 mRNA,...   121   3e-26   
gb:NTA416571_1691396 Nicotiana tabacum partial nictaRpoT1-tom ge...    82   2e-14   
gb:NTA416573_1691398 Nicotiana tabacum partial nictaRpoT2-tom ge...    80   9e-14   
gb:CR382124_1656557 Kluyveromyces lactis strain NRRL Y-1140 chro...    46   0.001   
sp|P13433|RPOM_YEAST|RPOM_YEAST DNA-directed RNA polymerase, mitochondrial ...    44   0.004   Saccharomyces cerevisiae [brewer's yeast]
pir|S56218|S56218 DNA-directed RNA polymerase (EC 2.7.7.6), mito...    44   0.007   Saccharomyces cerevisiae [brewer's yeast]
gb:AE016816_1746914 Ashbya gossypii (= Eremothecium gossypii) AT...    43   0.009   
gb:CR380957_1653054 Candida glabrata strain CBS138 chromosome K ...    43   0.009   
gb:BC076032_2558915 Danio rerio cDNA clone IMAGE:7046195, partia...    40   0.061   
gb:CR382127_1660000 Yarrowia lipolytica chromosome A of strain C...    37   0.67    
gb:AE016817_1747020 Ashbya gossypii (= Eremothecium gossypii) AT...    35   2.0     
gb:AE013209_290236 Thermoanaerobacter tengcongensis MB4, section...    34   4.4     
gb:CR382122_1655200 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   7.4     
gb:AY246697_1592580 Alternaria brassicae nonribosomal peptide sy...    33   9.7     
pir|B97504|B97504 RNA polymerase [imported] - Agrobacterium tume...    33   9.7     Agrobacterium fabrum str. C58


>sp|Q8L4F8|RPO3_NICSY DNA-directed RNA polymerase 3, chloroplast
            precursor (EC 2.7.7.6) (T7 bacteriophage-type single
            subunit RNA polymerase 3) (NsRpoT-C).>gb:AB084950_1524398
            Nicotiana sylvestris NsRpoT-C gene for T7
            bacteriophage-type single subunit RNA polymerase,
            complete cds.>gb:AB084951_1524399 Nicotiana sylvestris
            NsRpoT-C mRNA for T7 bacteriophage-type single subunit
            RNA polymerase, complete cds.>gb:NSY302020_1691225
            Nicotiana sylvestris mRNA for phage-type RNA polymerase
            (rpoT3 gene).>gb:NTA416576_1691401 Nicotiana tabacum
            nictaRpoT3-syl gene for plastid RNA polymerase, exons
            1-20.
          Length = 977

 Score =  320 bits (819), Expect = 4e-86
 Identities = 182/362 (50%), Positives = 242/362 (66%), Gaps = 11/362 (3%)
 Frame = +3

Query: 15   MASTAYSLYSIPHFSATRRLPQ-------NPRANPKPETTEPLAVSQSPQLLKIHTLKRA 173
            MASTA    S      T++LP+       + +   K   +  L  S  P+ LK+  ++  
Sbjct: 1    MASTASYSPSPTSQWRTQKLPKRFNFYVIHNQEFGKLSQSSSLPTSSFPKTLKLPVIQMP 60

Query: 174  KPLVLYA---VSVSKDEILTQTQEDISNSHKISNGSLAILPEESTRRVFVQDPPWISSLF 344
                + +   V VS DE L    E++ N  KI+NG   +L +ES +RVF+QDPPW+SSLF
Sbjct: 61   INNNIQSQTTVCVSTDENL----EELVNLQKIANG---VLTKESNKRVFIQDPPWVSSLF 113

Query: 345  LSNNLFVRAREIERAKLRIRETNRNK-YRLLKRRQXXXXXXXXXXXXXXYRELHREMCEK 521
            + N+LFVRA++++  +   RE  R + Y +L+RRQ              YREL REMCEK
Sbjct: 114  M-NSLFVRAKQVQGVRREFREIERRRRYAMLRRRQIKAETEAWEQMVEEYRELEREMCEK 172

Query: 522  KLAPNLPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXX 701
            KLAPNLPYVKKL LGWFEPLR AIEKEQ  + T K+RAA++P+IDSLPADKM+VIV    
Sbjct: 173  KLAPNLPYVKKLLLGWFEPLRQAIEKEQNAETTVKHRAAFAPHIDSLPADKMAVIVMHKL 232

Query: 702  XXXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDP 881
                   G E + VQV+QAA+QIG A+ENEVRIH+FLEKTK+L+        QED+SR+ 
Sbjct: 233  MGLLMMGGKEERCVQVVQAAVQIGMAVENEVRIHNFLEKTKKLQKHMTGAQSQEDMSRET 292

Query: 882  IWLRKRIQWLIKKNRLVQVQKLLKNEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQS 1061
            + LRKR++ LIK+NR+V+V+KL+K+EE E WG++ +AKLGCRL+ELLTETAYVQP ++QS
Sbjct: 293  MILRKRVKSLIKRNRVVEVRKLMKSEEPESWGRDTQAKLGCRLLELLTETAYVQPPVDQS 352

Query: 1062 AD 1067
            AD
Sbjct: 353  AD 354



>gb:NTA416570_1691395 Nicotiana tabacum mRNA for chloroplast RNA
            polymerase, rpoT3-tom gene.
          Length = 977

 Score =  313 bits (802), Expect = 4e-84
 Identities = 180/361 (49%), Positives = 238/361 (65%), Gaps = 10/361 (2%)
 Frame = +3

Query: 15   MASTAYSLYSIPHFSATRRLPQ-------NPRANPKPETTEPLAVSQSPQLLKIHTLKRA 173
            MASTA    S      T++LP+       + +   K   +  L+ S  P+ LK+  +   
Sbjct: 1    MASTASYSPSPTSQWRTQKLPKRFNFYVIHNQEFGKLSQSSSLSTSSFPKTLKLPVIHMP 60

Query: 174  KPLVLY--AVSVSKDEILTQTQEDISNSHKISNGSLAILPEESTRRVFVQDPPWISSLFL 347
               +     V VS DE L    E++ N  KI NG    L +ES +RVF+QDPPW+SSLF+
Sbjct: 61   INNIQSQTTVCVSTDENL----EELVNLQKIPNG---FLNKESNKRVFIQDPPWVSSLFM 113

Query: 348  SNNLFVRAREIERAKLRIRETNRNK-YRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKK 524
             N+LFVRA++++  +   RE  R + Y +L+RRQ              YREL REMCEKK
Sbjct: 114  -NSLFVRAKQVQGVRREFREIERRRRYAMLRRRQIKAETEAWEQMVEEYRELEREMCEKK 172

Query: 525  LAPNLPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXX 704
            LAPNLPYVKKL LGWFEPLR AIEKEQ  + T K+RAA++P+IDSLPADKM+VIV     
Sbjct: 173  LAPNLPYVKKLLLGWFEPLRQAIEKEQNAETTVKHRAAFAPHIDSLPADKMAVIVMHKLM 232

Query: 705  XXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPI 884
                  G E + VQV+QAA+QIG A+ENEVRIH+FLEKTK+L+        QED+S++ +
Sbjct: 233  GLLMMGGKEERCVQVVQAAVQIGMAVENEVRIHNFLEKTKKLQKHMTGAQSQEDMSKETM 292

Query: 885  WLRKRIQWLIKKNRLVQVQKLLKNEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSA 1064
             LRKR++ LIK+NR+V+V+KL+K+EE E WG++ +AKLGCRL+ELLTETAYVQ  ++QSA
Sbjct: 293  ILRKRVKSLIKRNRVVEVRKLMKSEEPESWGRDTQAKLGCRLLELLTETAYVQRPVDQSA 352

Query: 1065 D 1067
            D
Sbjct: 353  D 353



>sp|O24600|RPOT_ARATH DNA-directed RNA polymerase, chloroplast
            precursor (EC 2.7.7.6).>pir|G84632|G84632 hypothetical
            protein At2g24120 [imported] - Arabidopsis
            thaliana>gb:AC005967_1533266 Arabidopsis thaliana
            chromosome 2 clone F27D4 map CIC06C07, complete
            sequence.>gb:ATDDDRP_1548055 Arabidopsis thaliana rpoPt
            gene.>gb:ATMDDRP_1553728 Arabidopsis thaliana mRNA for
            chloroplast single-subunit DNA-dependent RNA polymerase.
          Length = 993

 Score =  227 bits (579), Expect = 3e-58
 Identities = 124/260 (47%), Positives = 174/260 (66%), Gaps = 4/260 (1%)
 Frame = +3

Query: 300  RRVFVQDPPWISSLFLS--NNLFVRAREIERAKLRIRETNRNKYRLLKRRQXXXXXXXXX 473
            RR+F+QDPPWIS+LFL   + +  +  +IER     ++ ++ K+  L+RRQ         
Sbjct: 121  RRLFMQDPPWISALFLKGLSKMVDQTLKIER-----KDIDKRKFDSLRRRQVKEETEAWE 175

Query: 474  XXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEKEQKTQ--RTKKNRAAYSP 647
                 YR+L +EMCEK LAPNLPYVK +FLGWF+PL+D IE+EQK Q  ++KK RAAY+P
Sbjct: 176  RMVDEYRDLEKEMCEKNLAPNLPYVKHMFLGWFQPLKDVIEREQKLQKNKSKKVRAAYAP 235

Query: 648  YIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQ 827
            +I+ LPADKM+VIV           G+E+  +QV+QAA+ IG AIE EVRIH+FL++T+ 
Sbjct: 236  HIELLPADKMAVIVMHKMMGLVMS-GHEDGCIQVVQAAVSIGIAIEQEVRIHNFLKRTR- 293

Query: 828  LKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLLKNEEFEPWGQEIRAKLGCR 1007
               + N    QE+L    + LRKR+  LI++ R++   K++K+E  +PWG+  +AKLG R
Sbjct: 294  ---KNNAGDSQEELKEKQL-LRKRVNSLIRRKRIIDALKVVKSEGTKPWGRATQAKLGSR 349

Query: 1008 LIELLTETAYVQPTINQSAD 1067
            L+ELL E AYVQP + QS D
Sbjct: 350  LLELLIEAAYVQPPLTQSGD 369



>gb:NSY416568_1691230 Nicotiana sylvestris mRNA for mitochondrial RNA
            polymerase (rpoT1 gene).
          Length = 1002

 Score =  191 bits (485), Expect = 2e-47
 Identities = 106/220 (48%), Positives = 139/220 (63%), Gaps = 4/220 (1%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            KY LL+RRQ              Y+EL  +MCE+KLAPNLPY+K LFLGWFEPLRDAI  
Sbjct: 165  KYNLLRRRQIKVETEAWEEAAKEYQELLMDMCEQKLAPNLPYMKSLFLGWFEPLRDAIAA 224

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            EQK     KNR AY+P+ D LPA+ M+VI            G      +V+QAA  IG A
Sbjct: 225  EQKLCDEGKNRGAYAPFFDQLPAEMMAVITMHKLMGLLMTGGGTGS-ARVVQAASHIGEA 283

Query: 780  IENEVRIHSFLEKTKQ---LKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLL 950
            IE+E RIH FLEKTK+   L     +TP   D+ ++   LRK+++ L+KK +L QV+K++
Sbjct: 284  IEHEARIHRFLEKTKKSNALSGDLEDTP--GDIMKERERLRKKVKILMKKQKLQQVRKIV 341

Query: 951  KNEEFE-PWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            K ++ E PWGQ+   K+GCRLI++L ETAY+QP  +Q  D
Sbjct: 342  KQQDDEKPWGQDNLVKVGCRLIQILMETAYIQPPNDQLDD 381



>gb:NSY302018_1691223 Nicotiana tabacum mRNA for phage-type RNA
            polymerase (rpoT1-tom gene).
          Length = 1002

 Score =  190 bits (482), Expect = 5e-47
 Identities = 106/220 (48%), Positives = 138/220 (62%), Gaps = 4/220 (1%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            KY  L+RRQ              Y+EL  +MCE+KLAPNLPY+K LFLGWFEPLRDAI  
Sbjct: 165  KYNFLRRRQIKVETEAWEEAAKEYQELLMDMCEQKLAPNLPYMKSLFLGWFEPLRDAIAA 224

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            EQK     KNR AY+P+ D LPA+ M+VI            G      +V+QAA  IG A
Sbjct: 225  EQKLCDEGKNRGAYAPFFDQLPAEMMAVITMHKLMGLLMTGGGTGS-ARVVQAASYIGEA 283

Query: 780  IENEVRIHSFLEKTKQ---LKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLL 950
            IE+E RIH FLEKTK+   L     ETP   D+ ++   LRK+++ L+KK +L QV+K++
Sbjct: 284  IEHEARIHRFLEKTKKSNALSGDLEETP--GDMMKERERLRKKVKILMKKQKLRQVRKIV 341

Query: 951  KNEEFE-PWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            K ++ E PWGQ+   K+GCRLI++L ETAY+QP  +Q  D
Sbjct: 342  KQQDDEKPWGQDNLVKVGCRLIQILMETAYIQPPNDQLDD 381



>sp|Q93Y94|RPO1_NICSY DNA-directed RNA polymerase 1, mitochondrial
            precursor (EC 2.7.7.6) (T7 bacteriophage-type single
            subunit RNA polymerase 1)
            (NsRpoT-A).>gb:AB058955S2_1521740 Nicotiana sylvestris
            NsRpoT-A gene for T7 bacteriophage-type single subunit
            RNA polymerase, exon 2 to exon 19 and complete cds.
          Length = 1002

 Score =  190 bits (482), Expect = 5e-47
 Identities = 105/220 (47%), Positives = 139/220 (63%), Gaps = 4/220 (1%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            KY LL+RRQ              Y+EL  +MCE+KLAPNLPY+K LFLGWFEPLRDAI  
Sbjct: 165  KYNLLRRRQIKVETEAWEEAAKEYQELLMDMCEQKLAPNLPYMKSLFLGWFEPLRDAIAA 224

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            EQK     KNR AY+P+ D LPA+ M+VI            G      +V+QAA  IG A
Sbjct: 225  EQKLCDEGKNRGAYAPFFDQLPAEMMAVITMHKLMGLLMTGGGTGS-ARVVQAASHIGEA 283

Query: 780  IENEVRIHSFLEKTKQ---LKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLL 950
            IE+E RIH FLEKTK+   L     +TP   D+ ++   +RK+++ L+KK +L QV+K++
Sbjct: 284  IEHEARIHRFLEKTKKSNALSGDLEDTP--GDIMKERERVRKKVKILMKKQKLQQVRKIV 341

Query: 951  KNEEFE-PWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            K ++ E PWGQ+   K+GCRLI++L ETAY+QP  +Q  D
Sbjct: 342  KQQDDEKPWGQDNLVKVGCRLIQILMETAYIQPPNDQLDD 381



>gb:AP005550_1853932 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OJ1058_F03.>gb:AP005729_1856727 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OSJNBa0069P02.
          Length = 951

 Score =  187 bits (474), Expect = 4e-46
 Identities = 101/221 (45%), Positives = 145/221 (65%), Gaps = 4/221 (1%)
 Frame = +3

Query: 417  NKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIE 596
            +KY +L+RRQ              YREL  +MC++KLAPNLPYVK LFLGWFEPLRD I 
Sbjct: 175  HKYAMLRRRQIQIETEAWEQAAEEYRELLADMCQQKLAPNLPYVKSLFLGWFEPLRDQII 234

Query: 597  KEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGT 776
             EQ+    +  RA+++ Y + LPAD M+VI            G+ +  V+V+QAA QIG 
Sbjct: 235  AEQELVGERGARASHARYFNMLPADMMAVITMHKLMGLLMT-GSGDGSVRVIQAACQIGE 293

Query: 777  AIENEVRIHSFLEKTKQLKSQTNETPKQ---EDLSRDPIWLRKRIQWLIKKNRLVQVQKL 947
            AIE+EVRIH FLEKTK+  ++  +  ++    D++++   LRK++  L+KK ++ QV+ +
Sbjct: 294  AIEHEVRIHKFLEKTKKKSNKEMDNEEEGGDSDIAKEQERLRKKVTDLMKKQKIRQVRNI 353

Query: 948  LKNEE-FEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            +K ++  +PWGQ+  AK+G RLIEL+ ETAY+QP  +QSAD
Sbjct: 354  VKKQDNSKPWGQDAHAKVGSRLIELMIETAYIQPPASQSAD 394



>gb:AB096014_1525442 Oryza sativa (japonica cultivar-group) rpoT1 mRNA
            for RpoT1, complete cds.>gb:AB120431_1527962 Oryza sativa
            (japonica cultivar-group) mitochondrial rpoT1 mRNA for T7
            bacteriophage-type single subunit RNA polymerase,
            complete cds.
          Length = 1017

 Score =  187 bits (474), Expect = 4e-46
 Identities = 101/221 (45%), Positives = 145/221 (65%), Gaps = 4/221 (1%)
 Frame = +3

Query: 417  NKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIE 596
            +KY +L+RRQ              YREL  +MC++KLAPNLPYVK LFLGWFEPLRD I 
Sbjct: 175  HKYAMLRRRQIQIETEAWEQAAEEYRELLADMCQQKLAPNLPYVKSLFLGWFEPLRDQII 234

Query: 597  KEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGT 776
             EQ+    +  RA+++ Y + LPAD M+VI            G+ +  V+V+QAA QIG 
Sbjct: 235  AEQELVGERGARASHARYFNMLPADMMAVITMHKLMGLLMT-GSGDGSVRVIQAACQIGE 293

Query: 777  AIENEVRIHSFLEKTKQLKSQTNETPKQ---EDLSRDPIWLRKRIQWLIKKNRLVQVQKL 947
            AIE+EVRIH FLEKTK+  ++  +  ++    D++++   LRK++  L+KK ++ QV+ +
Sbjct: 294  AIEHEVRIHKFLEKTKKKSNKEMDNEEEGGDSDIAKEQERLRKKVTDLMKKQKIRQVRNI 353

Query: 948  LKNEE-FEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            +K ++  +PWGQ+  AK+G RLIEL+ ETAY+QP  +QSAD
Sbjct: 354  VKKQDNSKPWGQDAHAKVGSRLIELMIETAYIQPPASQSAD 394



>gb:NTA416569_1691394 Nicotiana tabacum mRNA for mitochondrial and
            chloroplast RNA polymerase (rpoT2-tom gene).
          Length = 1021

 Score =  186 bits (472), Expect = 7e-46
 Identities = 102/217 (47%), Positives = 144/217 (66%), Gaps = 2/217 (0%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            KY+ LKRRQ              Y+EL  +MCE+KLAPNLPYVK LFLGWFEPLRD I +
Sbjct: 182  KYQTLKRRQVKVETEAWEQAAKEYKELLFDMCEQKLAPNLPYVKSLFLGWFEPLRDKIAE 241

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            EQ+     K++AAY+ Y+  LPAD M+VI            G ++   +V+QAAL IG A
Sbjct: 242  EQELCSQGKSKAAYAKYLYQLPADMMAVITMHKLMGLLMT-GGDHGTARVVQAALVIGDA 300

Query: 780  IENEVRIHSFLEKTKQLKSQTNETPKQ-EDLSRDPIWLRKRIQWLIKKNRLVQVQKLL-K 953
            IE EVRIH+FLEKTK+ K++ ++  +  E ++++   LRK++  L+KK +L  V +++ +
Sbjct: 301  IEQEVRIHNFLEKTKKQKAEKDKQKEDGEHVTQEQEKLRKKVTNLMKKQKLRAVGQIVRR 360

Query: 954  NEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSA 1064
             ++ +PWGQ+ +AK+G RLIELL +TAY+QP  NQ A
Sbjct: 361  QDDSKPWGQDAKAKVGSRLIELLLQTAYIQPPANQLA 397



>gb:AB058954_1521739 Nicotiana sylvestris NsRpoT-A mRNA for T7
            bacteriophage-type single subunit RNA polymerase,
            complete cds.
          Length = 1002

 Score =  186 bits (472), Expect = 7e-46
 Identities = 104/220 (47%), Positives = 138/220 (62%), Gaps = 4/220 (1%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            KY LL+RRQ              Y+EL  +MCE+KLAPNLPY+K LFLGWFEPLRDAI  
Sbjct: 165  KYNLLRRRQIKVETEAWEEAAKEYQELLMDMCEQKLAPNLPYMKSLFLGWFEPLRDAIAA 224

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            EQK     KNR A +P+ D LPA+ M+VI            G      +V+QAA  IG A
Sbjct: 225  EQKLCDEGKNRGACAPFFDQLPAEMMAVITMHKLMGWLMTGGGTGS-ARVVQAASHIGEA 283

Query: 780  IENEVRIHSFLEKTKQ---LKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLL 950
            IE+E RIH FLEKTK+   L     +TP   D+ ++   +RK+++ L+KK +L QV+K++
Sbjct: 284  IEHEARIHRFLEKTKKSNALSGDLEDTP--GDIMKERERVRKKVKILMKKQKLQQVRKIV 341

Query: 951  KNEEFE-PWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            K ++ E PWGQ+   K+GCRLI++L ETAY+QP  +Q  D
Sbjct: 342  KQQDDEKPWGQDNLVKVGCRLIQILMETAYIQPPNDQLDD 381



>gb:NSY302019_1691224 Nicotiana sylvestris mRNA for phage-type RNA
            polymerase (rpoT2 gene).
          Length = 1020

 Score =  185 bits (470), Expect = 1e-45
 Identities = 102/217 (47%), Positives = 143/217 (65%), Gaps = 2/217 (0%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            KY+ LKRRQ              Y+EL  +MCE+KLAPNLPYVK LFLGWFEPLRD I +
Sbjct: 181  KYQTLKRRQVKVETEAWEQAAKEYKELLFDMCEQKLAPNLPYVKSLFLGWFEPLRDKIAE 240

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            EQ+     K++AAY+ Y   LPAD M+VI            G ++   +V+QAAL IG A
Sbjct: 241  EQELCSQGKSKAAYAKYFYQLPADMMAVITMHKLMGLLMT-GGDHGTARVVQAALVIGDA 299

Query: 780  IENEVRIHSFLEKTKQLKSQTNETPKQ-EDLSRDPIWLRKRIQWLIKKNRLVQVQKLL-K 953
            IE EVRIH+FLEKTK+ K++ ++  +  E ++++   LRK++  L+KK +L  V +++ +
Sbjct: 300  IEQEVRIHNFLEKTKKQKAEKDKQKEDGEHVTQEQEKLRKKVTNLMKKQKLRAVGQIVRR 359

Query: 954  NEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSA 1064
             ++ +PWGQ+ RAK+G RLI+LL +TAY+QP  NQ A
Sbjct: 360  QDDSKPWGQDARAKVGSRLIDLLLQTAYIQPPANQLA 396



>sp|Q8VWF8|RPO2_NICSY DNA-directed RNA polymerase 2,
            chloroplast/mitochondrial precursor (EC 2.7.7.6) (T7
            bacteriophage-type single subunit RNA polymerase 2)
            (NsRpoT-B).>gb:AB058957_1521741 Nicotiana sylvestris
            NsRpoT-B mRNA for T7 bacteriophage-type single subunit
            RNA polymerase, complete cds.>gb:AB058958_1521742
            Nicotiana sylvestris NsRpoT-B gene for T7
            bacteriophage-type single subunit RNA polymerase,
            complete cds.
          Length = 1020

 Score =  185 bits (470), Expect = 1e-45
 Identities = 102/217 (47%), Positives = 143/217 (65%), Gaps = 2/217 (0%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            KY+ LKRRQ              Y+EL  +MCE+KLAPNLPYVK LFLGWFEPLRD I +
Sbjct: 181  KYQTLKRRQVKVETEAWEQAAKEYKELLFDMCEQKLAPNLPYVKSLFLGWFEPLRDKIAE 240

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            EQ+     K++AAY+ Y   LPAD M+VI            G ++   +V+QAAL IG A
Sbjct: 241  EQELCSQGKSKAAYAKYFYQLPADMMAVITMHKLMGLLMT-GGDHGTARVVQAALVIGDA 299

Query: 780  IENEVRIHSFLEKTKQLKSQTNETPKQ-EDLSRDPIWLRKRIQWLIKKNRLVQVQKLL-K 953
            IE EVRIH+FLEKTK+ K++ ++  +  E ++++   LRK++  L+KK +L  V +++ +
Sbjct: 300  IEQEVRIHNFLEKTKKQKAEKDKQKEDGEHVTQEQEKLRKKVTNLMKKQKLRAVGQIVRR 359

Query: 954  NEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSA 1064
             ++ +PWGQ+ RAK+G RLI+LL +TAY+QP  NQ A
Sbjct: 360  QDDSKPWGQDARAKVGSRLIDLLLQTAYIQPPANQLA 396



>gb:AJ586899_1811851 Hordeum vulgare partial mitochondrial mRNA for
            RNA polymerase (rpoTm gene).
          Length = 862

 Score =  184 bits (468), Expect = 2e-45
 Identities = 104/223 (46%), Positives = 139/223 (62%), Gaps = 6/223 (2%)
 Frame = +3

Query: 417  NKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIE 596
            +KY  L++RQ              YREL  +MCE KLAPNLPYVK LFLGWFEPLRD I 
Sbjct: 22   SKYVSLRQRQIRIETEAWEQAAKEYRELLADMCEHKLAPNLPYVKSLFLGWFEPLRDQII 81

Query: 597  KEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGT 776
             EQ+    +  RA+++PY + LPAD M+VI            G+ +  V+V+QAA QIG 
Sbjct: 82   AEQELVGERGTRASHAPYFNMLPADMMAVITMHKLMGLLMT-GSGDGSVRVIQAACQIGE 140

Query: 777  AIENEVRIHSFLEKTKQLKSQTNET-----PKQEDLSRDPIWLRKRIQWLIKKNRLVQVQ 941
            A+E+EVRIH FLEKTK  K  T E      P   D++++   LRK++  L+KK ++ QV+
Sbjct: 141  AVEHEVRIHKFLEKTK--KKNTKEVDKVVEPGDSDIAKEQQLLRKKVTDLMKKQKIRQVR 198

Query: 942  KLLKNEE-FEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
             L+K ++   PWGQ+  AK+G RLIEL  ETA++QP  +QS D
Sbjct: 199  HLVKKQDSTRPWGQDAHAKVGSRLIELFIETAHIQPPASQSGD 241



>gb:AF091838_1767461 Triticum aestivum single-subunit RNA polymerase G
            mRNA, complete cds; mitochondrial gene for mitochondrial
            product.
          Length = 1005

 Score =  181 bits (460), Expect = 2e-44
 Identities = 103/223 (46%), Positives = 138/223 (61%), Gaps = 6/223 (2%)
 Frame = +3

Query: 417  NKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIE 596
            +KY  L++RQ              YREL  +MCE KLAPNLPYVK LFL WFEPLRD I 
Sbjct: 164  SKYVSLRQRQIRIETEAWEQAAKEYRELLADMCEHKLAPNLPYVKSLFLSWFEPLRDQII 223

Query: 597  KEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGT 776
             EQ+    +  RA+++PY + LPAD M+VI            G+ +  V+V+QAA QIG 
Sbjct: 224  AEQELVSERGTRASHAPYFNMLPADMMAVITMHKLMGLLMT-GSGDGSVRVIQAACQIGE 282

Query: 777  AIENEVRIHSFLEKTKQLKSQTNETPK-----QEDLSRDPIWLRKRIQWLIKKNRLVQVQ 941
            A+E+EVRIH FLEKTK  K  T E  K       D++++   LRK++  L+KK ++ QV+
Sbjct: 283  AVEHEVRIHKFLEKTK--KKNTKEVDKVVEAVDADIAKEQERLRKKVTDLMKKQKIRQVR 340

Query: 942  KLLKNEE-FEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
             L+K ++   PWGQ+  AK+G RLIEL  ETA++QP  +QS D
Sbjct: 341  HLVKKQDSTRPWGQDAHAKVGSRLIELFIETAHIQPPASQSGD 383



>gb:ATRNAPOL_1554072 Arabidopsis thaliana DNA-directed RNA polymerase
            gene.
          Length = 1011

 Score =  181 bits (458), Expect = 3e-44
 Identities = 115/288 (39%), Positives = 164/288 (56%), Gaps = 12/288 (4%)
 Frame = +3

Query: 231  QEDISNSHKISNGSLA----ILPEESTRRVFVQDPPWISSLFLSNNLFVRAREIERAKLR 398
            +E+ S S +  +G+LA     + EE      V++ P +  L L      + RE  R+   
Sbjct: 103  REEFSKSERCLSGTLARGYTSVAEEEVLSTDVEEEPEVDEL-LKEMKKEKKRESHRSWRM 161

Query: 399  IRETN----RNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLG 566
             ++      R K++ L RRQ              Y EL  +MCE+KLAPNLPYVK LFLG
Sbjct: 162  KKQDQFGMGRTKFQNLWRRQVKIETEEWERAAAEYMELLTDMCEQKLAPNLPYVKSLFLG 221

Query: 567  WFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQ 746
            WFEPLRDAI K+Q+  R  K++A Y+ Y+D LPADK+SVI            G +N  V+
Sbjct: 222  WFEPLRDAIAKDQELYRLGKSKATYAHYLDQLPADKISVITMHKLMGHLMT-GGDNGCVK 280

Query: 747  VLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETP---KQEDLSRDPIWLRKRIQWLIK 917
            V+ AA  +G AIE E+RI +FL+K K  K   NE     + E   ++   LRK++  LIK
Sbjct: 281  VVHAACTVGDAIEQEIRICTFLDKKK--KGDDNEESGGVENETSMKEQDKLRKKVNELIK 338

Query: 918  KNRLVQVQKLLKNEEF-EPWGQEIRAKLGCRLIELLTETAYVQPTINQ 1058
            K +L  V+K+L++ ++ +PW  ++RAK+G RLIELL  TAY+Q   +Q
Sbjct: 339  KQKLSAVRKILQSHDYTKPWIADVRAKVGSRLIELLVRTAYIQSPADQ 386



>pir|T51399|T51399 DNA-directed RNA polymerase, mitochondrial -
            Arabidopsis thaliana>gb:ATF14F8_1548560 Arabidopsis
            thaliana DNA chromosome 5, BAC clone F14F8 (ESSA
            project).>gb:ATH278248_1552256 Arabidopsis thaliana mRNA
            for phage-type RNA polymerase (rpoT2 gene).
          Length = 1011

 Score =  181 bits (458), Expect = 3e-44
 Identities = 115/288 (39%), Positives = 164/288 (56%), Gaps = 12/288 (4%)
 Frame = +3

Query: 231  QEDISNSHKISNGSLA----ILPEESTRRVFVQDPPWISSLFLSNNLFVRAREIERAKLR 398
            +E+ S S +  +G+LA     + EE      V++ P +  L L      + RE  R+   
Sbjct: 103  REEFSKSERCLSGTLARGYTSVAEEEVLSTDVEEEPEVDEL-LKEMKKEKKRESHRSWRM 161

Query: 399  IRETN----RNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLG 566
             ++      R K++ L RRQ              Y EL  +MCE+KLAPNLPYVK LFLG
Sbjct: 162  KKQDQFGMGRTKFQNLWRRQVKIETEEWERAAAEYMELLTDMCEQKLAPNLPYVKSLFLG 221

Query: 567  WFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQ 746
            WFEPLRDAI K+Q+  R  K++A Y+ Y+D LPADK+SVI            G +N  V+
Sbjct: 222  WFEPLRDAIAKDQELYRLGKSKATYAHYLDQLPADKISVITMHKLMGHLMT-GGDNGCVK 280

Query: 747  VLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETP---KQEDLSRDPIWLRKRIQWLIK 917
            V+ AA  +G AIE E+RI +FL+K K  K   NE     + E   ++   LRK++  LIK
Sbjct: 281  VVHAACTVGDAIEQEIRICTFLDKKK--KGDDNEESGGVENETSMKEQDKLRKKVNELIK 338

Query: 918  KNRLVQVQKLLKNEEF-EPWGQEIRAKLGCRLIELLTETAYVQPTINQ 1058
            K +L  V+K+L++ ++ +PW  ++RAK+G RLIELL  TAY+Q   +Q
Sbjct: 339  KQKLSAVRKILQSHDYTKPWIADVRAKVGSRLIELLVRTAYIQSPADQ 386



>gb:AF127021_1770499 Zea mays T7-like RNA polymerase (rpoT1) mRNA,
            nuclear gene encoding mitochondrial protein, complete
            cds.
          Length = 975

 Score =  175 bits (444), Expect = 1e-42
 Identities = 97/221 (43%), Positives = 140/221 (63%), Gaps = 4/221 (1%)
 Frame = +3

Query: 417  NKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIE 596
            ++Y  L+RRQ              YREL  +MCE+KLAPNLPYVK LFLGWFEPLRD I 
Sbjct: 133  HRYTSLRRRQIRIETEAWEQAANEYRELLADMCEQKLAPNLPYVKSLFLGWFEPLRDQIA 192

Query: 597  KEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGT 776
             EQ+      +RA++ P+   LPAD M+VI            G+ +  V+V+QAA QIG 
Sbjct: 193  TEQELVADPGSRASHGPFFSMLPADMMAVITMHKLMGLLMT-GSGDGSVRVIQAACQIGE 251

Query: 777  AIENEVRIHSFLEKTKQLKSQTNETPKQ---EDLSRDPIWLRKRIQWLIKKNRLVQVQKL 947
            AIE+EVRI+ FLEKT++  ++  E  ++    +++ +   LRK++  L+KK +L QV+ +
Sbjct: 252  AIEHEVRINRFLEKTRKKNNKEMENEEEAGDTNIAVEQQRLRKKVTDLMKKQKLRQVRNI 311

Query: 948  LKNEE-FEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            +KN++   PWGQ+  AK+G RLI+L   TA++QP  +QS+D
Sbjct: 312  VKNQDKSRPWGQDAHAKVGSRLIDLFIGTAHIQPPASQSSD 352



>gb:AF127022_1770500 Zea mays T7-like RNA polymerase (rpoT2) mRNA,
            nuclear gene encoding chloroplast protein, complete cds.
          Length = 952

 Score =  171 bits (434), Expect = 2e-41
 Identities = 95/232 (40%), Positives = 141/232 (60%), Gaps = 1/232 (0%)
 Frame = +3

Query: 375  EIERAKLRIRETNRNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKK 554
            E+ER + R R   R + R L++RQ              YRE+ REM +++LAP LPYVK 
Sbjct: 104  EVERQRGRAR---RAQLRRLRQRQVKAETEAWARAAEEYREIEREMLDRRLAPALPYVKA 160

Query: 555  LFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNEN 734
            LF+GWFEPLRDAI ++Q  QR K+ +  Y+ Y+  LPADK++VIV            +  
Sbjct: 161  LFVGWFEPLRDAIARDQDVQRRKRVKHVYAKYLLLLPADKVAVIVMHKMMGLLMSSKDGT 220

Query: 735  KYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLI 914
              V+V+QAA  IG A+E E ++ SF +K+++ K Q    P    L ++    RKR++ L+
Sbjct: 221  GSVRVVQAAHCIGEAVEREFKVQSFFQKSRKKKIQGENDPA---LEKEQAKCRKRVKSLV 277

Query: 915  KKNRLVQVQKLLKNE-EFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            K+ ++ + Q+L++ E E E WG E + KLG RLIELL ++A+VQP  +Q+ D
Sbjct: 278  KRRKMSEAQRLVQQELELEEWGTEAQVKLGSRLIELLLDSAFVQPPADQTPD 329



>gb:AB096015_1525443 Oryza sativa (japonica cultivar-group) rpoT2 mRNA
            for RpoT2, complete cds.>gb:AB120430_1527961 Oryza sativa
            (japonica cultivar-group) chloroplast rpoT2 mRNA for T7
            bacteriophage-type single subunit RNA polymerase,
            complete cds.
          Length = 953

 Score =  171 bits (434), Expect = 2e-41
 Identities = 95/236 (40%), Positives = 146/236 (61%), Gaps = 2/236 (0%)
 Frame = +3

Query: 366  RAREIERAKLRIRETNRN-KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLP 542
            R RE ER + R RE  R  ++R L++RQ              YREL REM +++LAP LP
Sbjct: 99   RERERERERERERERARKAEHRRLRQRQVKAETEAWARAADEYRELEREMLDRRLAPALP 158

Query: 543  YVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXC 722
            YVK LFLGWFEPLRDAI ++Q+ QR K+ +  Y+ Y+  LPADK++VIV           
Sbjct: 159  YVKSLFLGWFEPLRDAIARDQEVQRRKRVKHVYAKYLLLLPADKVAVIVMHKMMGLLMSS 218

Query: 723  GNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRI 902
             +    V+V+QAA  IG A+E E ++ +F +KT++  +  N+   +++ ++     RKR+
Sbjct: 219  KDGVASVRVVQAAHCIGEAVEREFKVQTFFQKTRKKSAGENDLALEKEQAK----CRKRV 274

Query: 903  QWLIKKNRLVQVQKLLKNE-EFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            + L+++ +L + QK+++ E E E WG E + KLG RLIELL ++A+VQ   +Q+ +
Sbjct: 275  KSLVRRRKLTEAQKIVQQEIELEEWGTESQVKLGTRLIELLLDSAFVQSPADQTPE 330



>pir|T02751|T02751 DNA-directed RNA polymerase (EC 2.7.7.6) -
            maize>gb:ZMA005343_1731416 Zea mays Ama gene encoding
            single-subunit RNA polymerase.
          Length = 952

 Score =  171 bits (434), Expect = 2e-41
 Identities = 95/232 (40%), Positives = 141/232 (60%), Gaps = 1/232 (0%)
 Frame = +3

Query: 375  EIERAKLRIRETNRNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKK 554
            E+ER + R R   R + R L++RQ              YRE+ REM +++LAP LPYVK 
Sbjct: 104  EVERQRGRAR---RAQLRRLRQRQVKAETEAWARAAEEYREIEREMLDRRLAPALPYVKA 160

Query: 555  LFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNEN 734
            LF+GWFEPLRDAI ++Q  QR K+ +  Y+ Y+  LPADK++VIV            +  
Sbjct: 161  LFVGWFEPLRDAIARDQDVQRRKRVKHVYAKYLLLLPADKVAVIVMHKMMGLLMSSKDGT 220

Query: 735  KYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLI 914
              V+V+QAA  IG A+E E ++ SF +K+++ K Q    P    L ++    RKR++ L+
Sbjct: 221  GSVRVVQAAHCIGEAVEREFKVQSFFQKSRKKKIQGENDPA---LEKEQAKCRKRVKSLV 277

Query: 915  KKNRLVQVQKLLKNE-EFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            K+ ++ + Q+L++ E E E WG E + KLG RLIELL ++A+VQP  +Q+ D
Sbjct: 278  KRRKMSEAQRLVQQELELEEWGTEAQVKLGSRLIELLLDSAFVQPPADQTPD 329



>gb:ATY08137_1557458 Arabidopsis thaliana mRNA for mitochondrial
            single-subunit DNA-dependent RNA polymerase.
          Length = 976

 Score =  171 bits (433), Expect = 2e-41
 Identities = 94/224 (41%), Positives = 140/224 (62%), Gaps = 8/224 (3%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            K+ +LK+RQ               RE+  +MCE+KLAPNLPY+K LFLGWFEP+R+AI+ 
Sbjct: 131  KFYMLKQRQVKMETEEWERAARECREILADMCEQKLAPNLPYMKSLFLGWFEPVRNAIQD 190

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            +  T + KK +  Y+P+++ LPADKM+VI                  V+++ AA QIG A
Sbjct: 191  DLDTFKIKKGKIPYAPFMEQLPADKMAVITMHKMMGLLMTNAEGVGIVKLVNAATQIGEA 250

Query: 780  IENEVRIHSFLEKTKQLKSQTNET-------PKQEDLSRDPIWLRKRIQWLIKKNRLVQV 938
            +E EVRI+SFL+K K  K+ T++T         +E ++++    RK++  L++KN+L QV
Sbjct: 251  VEQEVRINSFLQK-KNKKNATDKTINTEAENVSEEIVAKETEKARKQVTVLMEKNKLRQV 309

Query: 939  QKLL-KNEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            + L+ K++ F+PWGQE + K+G RLI+LL E AY+QP   Q  D
Sbjct: 310  KALVRKHDSFKPWGQEAQVKVGARLIQLLMENAYIQPPAEQFDD 353



>sp|P92969|RPOM_ARATH DNA-directed RNA polymerase, mitochondrial
            precursor (EC 2.7.7.6).>pir|D96714|D96714 DNA-directed
            RNA polymerase [imported] - Arabidopsis
            thaliana>gb:AE005173_894513 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC011665_1537346 Arabidopsis thaliana
            chromosome 1 BAC T6L1 genomic sequence, complete
            sequence.>gb:ATSSDDRPL_1554174 A.thaliana genes encoding
            mitochondrial DNA-directed RNA polymerase, tRNA-Met
            initiator and ORF with unknown
            function.>gb:ATT3T7POL_1555945 Arabidopsis thaliana rpoMt
            gene.
          Length = 976

 Score =  171 bits (433), Expect = 2e-41
 Identities = 94/224 (41%), Positives = 140/224 (62%), Gaps = 8/224 (3%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            K+ +LK+RQ               RE+  +MCE+KLAPNLPY+K LFLGWFEP+R+AI+ 
Sbjct: 131  KFYMLKQRQVKMETEEWERAARECREILADMCEQKLAPNLPYMKSLFLGWFEPVRNAIQD 190

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
            +  T + KK +  Y+P+++ LPADKM+VI                  V+++ AA QIG A
Sbjct: 191  DLDTFKIKKGKIPYAPFMEQLPADKMAVITMHKMMGLLMTNAEGVGIVKLVNAATQIGEA 250

Query: 780  IENEVRIHSFLEKTKQLKSQTNET-------PKQEDLSRDPIWLRKRIQWLIKKNRLVQV 938
            +E EVRI+SFL+K K  K+ T++T         +E ++++    RK++  L++KN+L QV
Sbjct: 251  VEQEVRINSFLQK-KNKKNATDKTINTEAENVSEEIVAKETEKARKQVTVLMEKNKLRQV 309

Query: 939  QKLL-KNEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            + L+ K++ F+PWGQE + K+G RLI+LL E AY+QP   Q  D
Sbjct: 310  KALVRKHDSFKPWGQEAQVKVGARLIQLLMENAYIQPPAEQFDD 353



>gb:CARNAPOLY_1645457 C.album mRNA for mitochondrial single-subunit
            DNA-dependent RNA polymerase.
          Length = 988

 Score =  171 bits (432), Expect = 3e-41
 Identities = 89/217 (41%), Positives = 134/217 (61%), Gaps = 1/217 (0%)
 Frame = +3

Query: 420  KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
            +Y +L++RQ              Y+EL  +MCE+KLAPNLPY+K LFLGWFEPL+DAI+ 
Sbjct: 150  RYNVLRKRQIKVETEAWNEAAREYQELLADMCEQKLAPNLPYMKSLFLGWFEPLKDAIKA 209

Query: 600  EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
             Q+  +  +NR  Y    D LPAD M+VI            G+ N    V+QAA QIG A
Sbjct: 210  HQEACKVGRNRPLYGECFDELPADMMAVITMHKLMGLLMT-GSGNGGTTVIQAATQIGEA 268

Query: 780  IENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLLK-N 956
            +E E +I  FLEK+K+  +  N    ++D ++    L K++  L+KK ++ QV+++++  
Sbjct: 269  VEQEAKIRKFLEKSKKKPATNNN--DEDDSAKAQQRLAKKVTTLMKKQKISQVREIVRGQ 326

Query: 957  EEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            ++ +PW Q+ + K+GC+LI+LL ETAY+QP  +Q AD
Sbjct: 327  DDSKPWSQDNQVKVGCKLIQLLAETAYIQPPADQLAD 363



>gb:HVU507396_1682788 Hordeum vulgare subsp. vulgare mRNA for
            DNA-directed RNA polymerase, chloroplast precursor (rpoT
            gene).
          Length = 948

 Score =  169 bits (429), Expect = 7e-41
 Identities = 92/231 (39%), Positives = 136/231 (58%), Gaps = 1/231 (0%)
 Frame = +3

Query: 378  IERAKLRIRETNRNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKL 557
            +ER K R R   R  +R L++RQ              YR+L REM ++ LAP LPYVK L
Sbjct: 96   LERGKERER-ARRAGHRRLRQRQVKAETEAWARAAEEYRQLEREMLDRNLAPQLPYVKSL 154

Query: 558  FLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENK 737
            FLGWFEPLRDA+ ++Q  QR K+ +  Y+ Y+  LP +K++VIV            +   
Sbjct: 155  FLGWFEPLRDAVARDQDVQRRKRVKHVYAKYLLLLPPEKVAVIVMHKMMGLLMSSKDGCG 214

Query: 738  YVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLIK 917
             V+V+QAA  IG A+E E ++ +F +KT++     NE+     L ++    RK ++ L++
Sbjct: 215  SVRVVQAAHSIGEAVEREYKVQAFFQKTRRKTRSKNESENDPALDKEQAKCRKLVKSLVR 274

Query: 918  KNRLVQVQKLLKNE-EFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            + +L + QKL++ E E E WG E + KLG RLIELL ++A+VQ   NQ+ D
Sbjct: 275  RRKLTEAQKLVQQEIELEEWGAEAQVKLGTRLIELLLDSAFVQSPANQTPD 325



>gb:HVU507395_1682787 Hordeum vulgare subsp. vulgare rpoT gene for
            DNA-directed RNA polymerase, chloroplast precursor, exons
            1-19.
          Length = 948

 Score =  169 bits (429), Expect = 7e-41
 Identities = 92/231 (39%), Positives = 136/231 (58%), Gaps = 1/231 (0%)
 Frame = +3

Query: 378  IERAKLRIRETNRNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKL 557
            +ER K R R   R  +R L++RQ              YR+L REM ++ LAP LPYVK L
Sbjct: 96   LERGKERER-ARRAGHRRLRQRQVKAETEAWARAAEEYRQLEREMLDRNLAPQLPYVKSL 154

Query: 558  FLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENK 737
            FLGWFEPLRDA+ ++Q  QR K+ +  Y+ Y+  LP +K++VIV            +   
Sbjct: 155  FLGWFEPLRDAVARDQDVQRRKRVKHVYAKYLLLLPPEKVAVIVMHKMMGLLMSSKDGCG 214

Query: 738  YVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLIK 917
             V+V+QAA  IG A+E E ++ +F +KT++     NE+     L ++    RK ++ L++
Sbjct: 215  SVRVVQAAHSIGEAVEREYKVQAFFQKTRRKTRSKNESENDPALDKEQAKCRKLVKSLVR 274

Query: 918  KNRLVQVQKLLKNE-EFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            + +L + QKL++ E E E WG E + KLG RLIELL ++A+VQ   NQ+ D
Sbjct: 275  RRKLTEAQKLVQQEIELEEWGAEAQVKLGTRLIELLLDSAFVQSPANQTPD 325



>gb:TAU34402_1724707 Triticum aestivum single-subunit RNA polymerase C
            mRNA, complete cds.
          Length = 949

 Score =  162 bits (409), Expect = 1e-38
 Identities = 89/231 (38%), Positives = 134/231 (58%), Gaps = 1/231 (0%)
 Frame = +3

Query: 378  IERAKLRIRETNRNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKL 557
            +ER K R R   R  +R L++RQ              YR+L  EM ++ LAP LPYVK L
Sbjct: 97   LEREKDRER-ARRADHRRLRQRQVKAETEAWARAAEEYRQLEGEMLDRHLAPQLPYVKSL 155

Query: 558  FLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENK 737
            FLGWFEPLRDA+ ++Q  QR K+ +  Y+ Y+  LPA+K++VIV            +   
Sbjct: 156  FLGWFEPLRDAVARDQDVQRRKRVKHVYAKYLLLLPAEKVAVIVMHKMMGLLMSSKDGCG 215

Query: 738  YVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLIK 917
             V+V+QAA  IG A+E E ++ +F +KT++      E+     L ++    RK ++ L++
Sbjct: 216  SVRVVQAAHSIGEAVEREYKVQAFFQKTRRKTRSKTESENDPGLDKEQAKCRKLVKSLVR 275

Query: 918  KNRLVQVQKLLKNE-EFEPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            + +  + QKL++ E E E WG E + KLG RLIELL ++A+VQ   +Q+ D
Sbjct: 276  RRKSTEAQKLVQQEIELEEWGTEAQVKLGTRLIELLLDSAFVQSPADQTPD 326



>gb:ATDDRNPOL_1548056 Arabidopsis thaliana gene encoding
           DNA-directed RNA polymerase, exon 1.
          Length = 282

 Score =  150 bits (378), Expect = 5e-35
 Identities = 82/168 (48%), Positives = 112/168 (66%), Gaps = 4/168 (2%)
 Frame = +3

Query: 300 RRVFVQDPPWISSLFLS--NNLFVRAREIERAKLRIRETNRNKYRLLKRRQXXXXXXXXX 473
           RR+F+QDPPWIS+LFL   + +  +  +IER     ++ ++ K+  L+RRQ         
Sbjct: 121 RRLFMQDPPWISALFLKGLSKMVDQTLKIER-----KDIDKRKFDSLRRRQVKEETEAWE 175

Query: 474 XXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEKEQKTQ--RTKKNRAAYSP 647
                YR+L +EMCEK LAPNLPYVK +FLGWF+PL+D IE+EQK Q  ++KK RAAY+P
Sbjct: 176 RMVDEYRDLEKEMCEKNLAPNLPYVKHMFLGWFQPLKDVIEREQKLQKNKSKKVRAAYAP 235

Query: 648 YIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTAIENE 791
           +I+ LPADKM+VIV           G+E+  +QV+QAA+ IG AIE E
Sbjct: 236 HIELLPADKMAVIVMHKMMGLVMS-GHEDGCIQVVQAAVSIGIAIEQE 282



>gb:AP005453_1852087 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0453H04.
          Length = 806

 Score =  146 bits (368), Expect = 8e-34
 Identities = 76/187 (40%), Positives = 122/187 (65%), Gaps = 1/187 (0%)
 Frame = +3

Query: 510  MCEKKLAPNLPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIV 689
            M +++LAP LPYVK LFLGWFEPLRDAI ++Q+ QR K+ +  Y+ Y+  LPADK++VIV
Sbjct: 1    MLDRRLAPALPYVKSLFLGWFEPLRDAIARDQEVQRRKRVKHVYAKYLLLLPADKVAVIV 60

Query: 690  XXXXXXXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDL 869
                        +    V+V+QAA  IG A+E E ++ +F +KT++  +  N+   +++ 
Sbjct: 61   MHKMMGLLMSSKDGVASVRVVQAAHCIGEAVEREFKVQTFFQKTRKKSAGENDLALEKEQ 120

Query: 870  SRDPIWLRKRIQWLIKKNRLVQVQKLLKNE-EFEPWGQEIRAKLGCRLIELLTETAYVQP 1046
            ++     RKR++ L+++ +L + QK+++ E E E WG E + KLG RLIELL ++A+VQ 
Sbjct: 121  AK----CRKRVKSLVRRRKLTEAQKIVQQEIELEEWGTESQVKLGTRLIELLLDSAFVQS 176

Query: 1047 TINQSAD 1067
              +Q+ +
Sbjct: 177  PADQTPE 183



>gb:PPA416855_1701221 Physcomitrella patens rpoT2 gene for RNA
            polymerase, exons 1-20.
          Length = 1065

 Score =  141 bits (356), Expect = 2e-32
 Identities = 86/240 (35%), Positives = 130/240 (54%), Gaps = 18/240 (7%)
 Frame = +3

Query: 402  RETNRNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPL 581
            +++ + K R L +RQ              YREL  EMC K LAPNLP+ + L L WFEPL
Sbjct: 203  QKSRKRKARELHKRQVKIETEAWQQAATEYRELMTEMCRKSLAPNLPFAQSLLLSWFEPL 262

Query: 582  RDAIEKEQK---TQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVL 752
            RD I +EQ+    +  +++R+ Y PY+  LPAD ++VI           C  E+  V+V+
Sbjct: 263  RDGILEEQRAYGNREHREHRSMYGPYMCQLPADMLAVI-TMHRLMGLLMCDQEHGCVKVI 321

Query: 753  QAALQIGTAIENEVRIHSFL---EKTKQLKSQTN-----------ETPKQEDLSRDPIWL 890
             AA+ IG A+E EVRI   +   +K+K  +  TN           E  ++ DL    + +
Sbjct: 322  HAAVVIGEAVEQEVRIFQLMNSQKKSKDAEGNTNSLGDVANNEELEATRKADLKSKKV-V 380

Query: 891  RKRIQWLIKKNRLVQVQKLLKNEEF-EPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            R +++ L+K+N+L +V  +LK+    EPW   I  KLG RL+EL+ ET++V+    Q  D
Sbjct: 381  RDKVKKLVKQNKLRRVDSILKHASTDEPWSTVIHVKLGSRLLELMLETSFVRAPACQDGD 440



>gb:AB055215_1521434 Physcomitrella patens rpoT2 mRNA for
            single-subunit RNA polymerase, complete cds.
          Length = 1065

 Score =  141 bits (356), Expect = 2e-32
 Identities = 86/240 (35%), Positives = 130/240 (54%), Gaps = 18/240 (7%)
 Frame = +3

Query: 402  RETNRNKYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPL 581
            +++ + K R L +RQ              YREL  EMC K LAPNLP+ + L L WFEPL
Sbjct: 203  QKSRKRKARELHKRQVKIETEAWQQAATEYRELMTEMCRKSLAPNLPFAQSLLLSWFEPL 262

Query: 582  RDAIEKEQK---TQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVL 752
            RD I +EQ+    +  +++R+ Y PY+  LPAD ++VI           C  E+  V+V+
Sbjct: 263  RDGILEEQRAYGNREHREHRSMYGPYMCQLPADMLAVI-TMHRLMGLLMCDQEHGCVKVI 321

Query: 753  QAALQIGTAIENEVRIHSFL---EKTKQLKSQTN-----------ETPKQEDLSRDPIWL 890
             AA+ IG A+E EVRI   +   +K+K  +  TN           E  ++ DL    + +
Sbjct: 322  HAAVVIGEAVEQEVRIFQLMNSQKKSKDAEGNTNSLGDVANNEELEATRKADLKSKKV-V 380

Query: 891  RKRIQWLIKKNRLVQVQKLLKNEEF-EPWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            R +++ L+K+N+L +V  +LK+    EPW   I  KLG RL+EL+ ET++V+    Q  D
Sbjct: 381  RDKVKKLVKQNKLRRVDSILKHASTDEPWSTVIHVKLGSRLLELMLETSFVRAPACQDGD 440



>gb:PPA416854_1701220 Physcomitrella patens rpoT1 gene for RNA
            polymerase, exons 1-19.
          Length = 1087

 Score =  130 bits (326), Expect = 6e-29
 Identities = 89/281 (31%), Positives = 145/281 (51%), Gaps = 22/281 (7%)
 Frame = +3

Query: 288  EESTRRVFVQDPPWISSLFLSNNLFVRAREIERAKLRIRETNRNKYRLLKRRQXXXXXXX 467
            +ES      ++PP   S+  +     + R  E  K R +E      + L+ RQ       
Sbjct: 189  DESEEECAPEEPP--QSVDFNKAKTAKERAAESRKARWKE------KALRMRQFKIETEA 240

Query: 468  XXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEKEQK---TQRTKKNRAA 638
                   Y+EL  EMC+K LAPNLP  + L LGWFEPLRDAI +EQK    +  +++RA 
Sbjct: 241  WHQAAAEYKELVAEMCKKNLAPNLPATRSLLLGWFEPLRDAIAQEQKDYEERNFREHRAI 300

Query: 639  YSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEK 818
            Y P++  LPAD ++VI              E+  V+V+ AALQIG A+E EV I+  L  
Sbjct: 301  YGPFLAKLPADMLAVITMHRLMSLLMS-DQEHGCVKVVHAALQIGEAVEQEVGIYKLLRS 359

Query: 819  ----TKQLKSQTN-------ETPKQEDLSRDPI-------WLRKRIQWLIKKNRLVQVQK 944
                 K++K++ +       +T   + ++   +         +++++ L+K+ +L  V K
Sbjct: 360  KRKVAKKVKNKVSGDALDDLDTNTDDSIANSVLDSDLKLKLAKEKVKKLVKQQKLRLVGK 419

Query: 945  LLKNEE-FEPWGQEIRAKLGCRLIELLTETAYVQPTINQSA 1064
            +++     EPWG  I+ K+G RL+EL+ ET+ ++   +Q+A
Sbjct: 420  VVQQANGDEPWGPAIQVKVGSRLLELMLETSVMRSPADQNA 460



>gb:AB055214_1521433 Physcomitrella patens rpoT1 mRNA for
            single-subunit RNA polymerase, complete cds.
          Length = 1087

 Score =  130 bits (326), Expect = 6e-29
 Identities = 89/281 (31%), Positives = 145/281 (51%), Gaps = 22/281 (7%)
 Frame = +3

Query: 288  EESTRRVFVQDPPWISSLFLSNNLFVRAREIERAKLRIRETNRNKYRLLKRRQXXXXXXX 467
            +ES      ++PP   S+  +     + R  E  K R +E      + L+ RQ       
Sbjct: 189  DESEEECAPEEPP--QSVDFNKAKTAKERAAESRKARWKE------KALRMRQFKIETEA 240

Query: 468  XXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEKEQK---TQRTKKNRAA 638
                   Y+EL  EMC+K LAPNLP  + L LGWFEPLRDAI +EQK    +  +++RA 
Sbjct: 241  WHQAAAEYKELVAEMCKKNLAPNLPATRSLLLGWFEPLRDAIAQEQKDYEERNFREHRAI 300

Query: 639  YSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEK 818
            Y P++  LPAD ++VI              E+  V+V+ AALQIG A+E EV I+  L  
Sbjct: 301  YGPFLAKLPADMLAVITMHRLMSLLMS-DQEHGCVKVVHAALQIGEAVEQEVGIYKLLRS 359

Query: 819  ----TKQLKSQTN-------ETPKQEDLSRDPI-------WLRKRIQWLIKKNRLVQVQK 944
                 K++K++ +       +T   + ++   +         +++++ L+K+ +L  V K
Sbjct: 360  KRKVAKKVKNKVSGDALDDLDTNTDDSIANSVLDSDLKLKLAKEKVKKLVKQQKLRLVGK 419

Query: 945  LLKNEE-FEPWGQEIRAKLGCRLIELLTETAYVQPTINQSA 1064
            +++     EPWG  I+ K+G RL+EL+ ET+ ++   +Q+A
Sbjct: 420  VVQQANGDEPWGPAIQVKVGSRLLELMLETSVMRSPADQNA 460



>gb:AY081704_1568964 Arabidopsis thaliana At1g68990/T6L1_17 mRNA,
           complete cds.
          Length = 305

 Score =  121 bits (303), Expect = 3e-26
 Identities = 68/174 (39%), Positives = 104/174 (59%), Gaps = 7/174 (4%)
 Frame = +3

Query: 420 KYRLLKRRQXXXXXXXXXXXXXXYRELHREMCEKKLAPNLPYVKKLFLGWFEPLRDAIEK 599
           K+ +LK+RQ               RE+  +MCE+KLAPNLPY+K LFLGWFEP+R+AI+ 
Sbjct: 131 KFYMLKQRQVKMETEEWERAARECREILADMCEQKLAPNLPYMKSLFLGWFEPVRNAIQD 190

Query: 600 EQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTA 779
           +  T + KK +  Y+P+++ LPADKM+VI                  V+++ AA QIG A
Sbjct: 191 DLDTFKIKKGKIPYAPFMEQLPADKMAVITMHKMMGLLMTNAEGVGIVKLVNAATQIGEA 250

Query: 780 IENEVRIHSFLEKTKQLKSQTNET-------PKQEDLSRDPIWLRKRIQWLIKK 920
           +E EVRI+SFL+K K  K+ T++T         +E ++++    RK++  L++K
Sbjct: 251 VEQEVRINSFLQK-KNKKNATDKTINTEAENVSEEIVAKETEKARKQVTVLMEK 303



>gb:NTA416571_1691396 Nicotiana tabacum partial nictaRpoT1-tom gene
            for mitochondrial RNA polymerase, exons 2-19.
          Length = 715

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 45/95 (47%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = +3

Query: 795  RIHSFLEKTKQ---LKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLLKNEEF 965
            RIH FLEKTK+   L     ETP   D+ ++   LRK+++ L+KK +L QV+K++K ++ 
Sbjct: 2    RIHRFLEKTKKSNALSGDLEETPG--DMMKERERLRKKVKILMKKQKLRQVRKIVKQQDD 59

Query: 966  E-PWGQEIRAKLGCRLIELLTETAYVQPTINQSAD 1067
            E PWGQ+   K+GCRLI++L ETAY+QP  +Q  D
Sbjct: 60   EKPWGQDNLVKVGCRLIQILMETAYIQPPNDQLDD 94



>gb:NTA416573_1691398 Nicotiana tabacum partial nictaRpoT2-tom gene
            for mitochondrial and plastid RNA polymerase, exons 2-14.
          Length = 562

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 41/93 (44%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = +3

Query: 792  VRIHSFLEKTKQLKSQTNETPKQ-EDLSRDPIWLRKRIQWLIKKNRLVQVQKLLKNEE-F 965
            VRIH+FLEKTK+ K++ ++  +  E ++++   LRK++  L+KK +L  V ++++ ++  
Sbjct: 1    VRIHNFLEKTKKQKAEKDKQKEDGEHVTQEQEKLRKKVTNLMKKQKLRAVGQIVRRQDDS 60

Query: 966  EPWGQEIRAKLGCRLIELLTETAYVQPTINQSA 1064
            +PWGQ+ +AK+G RLIELL +TAY+QP  NQ A
Sbjct: 61   KPWGQDAKAKVGSRLIELLLQTAYIQPPANQLA 93



>gb:CR382124_1656557 Kluyveromyces lactis strain NRRL Y-1140
            chromosome D of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1263

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 35/154 (22%), Positives = 63/154 (40%), Gaps = 1/154 (0%)
 Frame = +3

Query: 582  RDAIEKEQKT-QRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQA 758
            +D +EKEQK   +   +R  Y PY+  +  +KM VI            G   + ++  +A
Sbjct: 390  QDLLEKEQKAPNKQNSDRLKYGPYLLLVEPEKMCVITILELLKLQSS-GGVTEGMRTARA 448

Query: 759  ALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQV 938
             L +G +IE E R    L    ++  + N+              R     +  +N    +
Sbjct: 449  VLSVGRSIEMEFRSEKLLRSENKMFKEVNK--------------RSHEFKMFVQNAKTAL 494

Query: 939  QKLLKNEEFEPWGQEIRAKLGCRLIELLTETAYV 1040
            + +   E    W  +++AK+G  LI +L   + V
Sbjct: 495  RNMHVEENMIQWPSDVKAKIGSILISMLIHVSKV 528



>sp|P13433|RPOM_YEAST DNA-directed RNA polymerase, mitochondrial
            precursor (EC 2.7.7.6).>gb:YSCRPLA_1730506 Yeast
            (S.cerevisiae) mitochondrion RNA polymerase gene,
            complete cds.
          Length = 1351

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 42/170 (24%), Positives = 68/170 (40%), Gaps = 2/170 (1%)
 Frame = +3

Query: 537  LPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXX 716
            LP VK+        L + +  ++   +   NR  Y PY+  +   KM VI          
Sbjct: 462  LPLVKEEINHCRSLLSEKLSDKKSLNKVDTNRLGYGPYLTLIDPGKMCVITILELLKLNS 521

Query: 717  XCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRK 896
              G   + ++  +A + +G AIE E R    L+   Q     N+   +          +K
Sbjct: 522  T-GGVIEGMRTARAVISVGKAIEMEFRSEQVLKSESQAFRDVNKKSPE---------FKK 571

Query: 897  RIQWLIKKNRLVQVQ--KLLKNEEFEPWGQEIRAKLGCRLIELLTETAYV 1040
             +Q      R  Q++  K+L       W Q IRA++G  LI +L + A V
Sbjct: 572  LVQNAKSVFRSSQIEQSKIL-------WPQSIRARIGSVLISMLIQVAKV 614



>pir|S56218|S56218 DNA-directed RNA polymerase (EC 2.7.7.6),
            mitochondrial - yeast (Saccharomyces
            cerevisiae)>gb:YSCCHRVIN_1728473 Saccharomyces cerevisiae
            chromosome VI complete DNA sequence.
          Length = 1351

 Score = 43.5 bits (101), Expect = 0.007
 Identities = 42/170 (24%), Positives = 68/170 (40%), Gaps = 2/170 (1%)
 Frame = +3

Query: 537  LPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXX 716
            LP VK+        L + +  ++   +   NR  Y PY+  +   KM VI          
Sbjct: 462  LPLVKEEINHCRSLLSEKLSDKKGLNKVDTNRLGYGPYLTLIDPGKMCVITILELLKLNS 521

Query: 717  XCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRK 896
              G   + ++  +A + +G AIE E R    L+   Q     N+   +          +K
Sbjct: 522  T-GGVIEGMRTARAVISVGKAIEMEFRSEQVLKSESQAFRDVNKKSPE---------FKK 571

Query: 897  RIQWLIKKNRLVQVQ--KLLKNEEFEPWGQEIRAKLGCRLIELLTETAYV 1040
             +Q      R  Q++  K+L       W Q IRA++G  LI +L + A V
Sbjct: 572  LVQNAKSVFRSSQIEQSKIL-------WPQSIRARIGSVLISMLIQVAKV 614



>gb:AE016816_1746914 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 1295

 Score = 43.1 bits (100), Expect = 0.009
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 4/143 (2%)
 Frame = +3

Query: 624  KNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNENKYVQVLQAALQIGTAIENEVRIH 803
            ++R  Y+PYI  +  +KM VI            G  ++ ++  +A L IG A+E E R  
Sbjct: 438  RSRLEYAPYITLVNPEKMCVITILELLSLNST-GGVSEGMRTTRAVLAIGKAVEMEYRSE 496

Query: 804  SFLEKT----KQLKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLLKNEEFEP 971
            + L+      K++++ +NE  K    ++              +N  ++  K+L       
Sbjct: 497  ALLKSEKSIFKEVRANSNEFKKLVQRAKTTF-----------RNTQIEESKVL------- 538

Query: 972  WGQEIRAKLGCRLIELLTETAYV 1040
            W   I+AK+G  LI +L   A V
Sbjct: 539  WPHNIKAKVGSLLISMLIHVAKV 561



>gb:CR380957_1653054 Candida glabrata strain CBS138 chromosome K
            complete sequence.
          Length = 1326

 Score = 43.1 bits (100), Expect = 0.009
 Identities = 43/168 (25%), Positives = 74/168 (44%)
 Frame = +3

Query: 537  LPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXX 716
            LP VKK      E L ++    + + R   +R+ Y+PY   +  +KM VI          
Sbjct: 442  LPLVKKEAKKCIEELNNS----KSSSRKLSSRSEYAPYFTLVNPEKMCVITILELLKLNS 497

Query: 717  XCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRK 896
              G     ++  +A + +  AIE E R       ++QL +  N+T K  D+++     ++
Sbjct: 498  T-GGVIDGMRTARAVISVSKAIELEFR-------SEQLLNSENQTFK--DINKKSHEFKR 547

Query: 897  RIQWLIKKNRLVQVQKLLKNEEFEPWGQEIRAKLGCRLIELLTETAYV 1040
             +Q   +  R ++++K         W Q +RAK+G  LI  L   A V
Sbjct: 548  YVQSAKRTFRSMEIEK-----SRIIWPQTVRAKIGSTLISFLIHVAKV 590



>gb:BC076032_2558915 Danio rerio cDNA clone IMAGE:7046195, partial
           cds.
          Length = 260

 Score = 40.4 bits (93), Expect = 0.061
 Identities = 46/164 (28%), Positives = 80/164 (48%)
 Frame = +3

Query: 507 EMCEKKLAPNLPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPADKMSVI 686
           E+  ++L  +L  V++      EP  D + K Q  QR ++ RAA +PY DSL ++ +   
Sbjct: 106 EVLRERLGQDLINVREKL----EPYADNM-KSQIQQRVEELRAAMAPYADSLDSETLKAT 160

Query: 687 VXXXXXXXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQED 866
           +           GN  + V+ LQA L+  TA E + ++   L+     + Q   +P  ED
Sbjct: 161 LLQKSEELR---GNLEQSVKELQAQLEPYTA-ELKEKVDQHLQ-----EFQKTVSPLAED 211

Query: 867 LSRDPIWLRKRIQWLIKKNRLVQVQKLLKNEEFEPWGQEIRAKL 998
           L    + +R+R Q  I +  L    + LK E+ +P+ Q ++ +L
Sbjct: 212 LQ---VQIRERAQ--IVQQSLTPYAEDLK-EKLDPYAQNLKDQL 249



>gb:CR382127_1660000 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1345

 Score = 37.0 bits (84), Expect = 0.67
 Identities = 37/167 (22%), Positives = 68/167 (40%), Gaps = 6/167 (3%)
 Frame = +3

Query: 567  WFEPLRDAIEKE-QKTQRTKKNRAAYSPYIDSLPADKMSVIVXXXXXXXXXXCGNE-NKY 740
            W E +   +++E +K   T+ N   Y PY+  +    MS++            G      
Sbjct: 456  WQEQMIPLVQEEIKKAGETEINTDLY-PYLKLMSPKTMSIVTIIEMMRLQTTVGRSVESG 514

Query: 741  VQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLIKK 920
            V+       +G A+E E R   + EK                L +   +L+K    L   
Sbjct: 515  VKTTNLVTSVGQALEIEYRCSQWSEK----------------LGKKRTFLKK----LTGL 554

Query: 921  NRLVQVQKLLKNEEFEP----WGQEIRAKLGCRLIELLTETAYVQPT 1049
             R ++V +++  E+ E     W  ++RAK+G  L+++L + A +  T
Sbjct: 555  KRRLKVMEMIHAEDLEDTVPAWAIDVRAKVGALLVDILIKVARMPVT 601



>gb:AE016817_1747020 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 504

 Score = 35.4 bits (80), Expect = 2.0
 Identities = 20/69 (28%), Positives = 37/69 (53%)
 Frame = +3

Query: 780 IENEVRIHSFLEKTKQLKSQTNETPKQEDLSRDPIWLRKRIQWLIKKNRLVQVQKLLKNE 959
           IEN +     +EK  + K  + E     DL +DP  L+KR Q++  +  L ++QK L++ 
Sbjct: 86  IENGMERFKSVEKIMKTKKFSTEALSNPDLIKDPRELKKRDQFIFVEECLEELQKQLESY 145

Query: 960 EFEPWGQEI 986
           E +   +++
Sbjct: 146 EAQELAEKV 154



>gb:AE013209_290236 Thermoanaerobacter tengcongensis MB4, section
           236 of 244 of the complete genome.>gb:AE008691_1112301
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 324

 Score = 34.3 bits (77), Expect = 4.4
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +3

Query: 507 EMCEKKL-APNLPYVKKLFLGWF-EPLRDAIEKEQKTQRTKKNRAAYSPY 650
           E C  KL  P+ PY+ ++ + WF E +R   + E K   +KK  AA S +
Sbjct: 241 EECIAKLNEPSFPYINRILINWFNEGIRSVEDLESKKSSSKKKTAATSAF 290



>gb:CR382122_1655200 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 590

 Score = 33.5 bits (75), Expect = 7.4
 Identities = 36/154 (23%), Positives = 61/154 (39%), Gaps = 1/154 (0%)
 Frame = +3

Query: 510 MCEKKLAPNLPYVKKLFLGWFEPLRDAIEKEQKTQRTKKNRAAYSPYIDSLPAD-KMSVI 686
           M ++KL   +  V K      E   D  EK Q T+   ++      Y + L +D K  + 
Sbjct: 1   MSQRKLQQEVDKVLKKVKEGLEEYEDIYEKFQNTESDNQS------YREKLESDLKREIK 54

Query: 687 VXXXXXXXXXXCGNENKYVQVLQAALQIGTAIENEVRIHSFLEKTKQLKSQTNETPKQED 866
                        +++         ++    IE+ +     +EK  + K  + E     D
Sbjct: 55  KLQKHREQIKNWLSKDDIKDRADVLMENRRLIESGMERFKSIEKIMKTKKFSTEALTNPD 114

Query: 867 LSRDPIWLRKRIQWLIKKNRLVQVQKLLKNEEFE 968
           L +DP  L+KR Q+L  +  L ++QK L   E E
Sbjct: 115 LIKDPRELKKRDQFLFVEECLEELQKQLDTFEVE 148



>gb:AY246697_1592580 Alternaria brassicae nonribosomal peptide
            synthase (NRPS1) gene, complete cds.
          Length = 7191

 Score = 33.1 bits (74), Expect = 9.7
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +3

Query: 288  EESTRRVFVQDPPWISSLFLSNNLFVRAR 374
            E  T + F+ DP W  ++F SNN F  AR
Sbjct: 3968 EVKTAKAFINDPAWAKTIFSSNNTFEAAR 3996



>pir|B97504|B97504 RNA polymerase [imported] - Agrobacterium
            tumefaciens  (strain C58, Cereon)>pir|AE2722|AE2722
            DNA-directed RNA polymerase [imported] - Agrobacterium
            tumefaciens (strain C58, Dupont)>gb:AE008047_232927
            Agrobacterium tumefaciens str. C58 circular chromosome,
            section 105 of 254 of the complete
            sequence.>gb:AE009081_248222 Agrobacterium tumefaciens
            str. C58 circular chromosome, section 107 of 256 of the
            complete sequence.>gb:AE007869_1082596 Agrobacterium
            tumefaciens str. C58 circular chromosome, complete
            sequence.>gb:AE008688_1086065 Agrobacterium tumefaciens
            str. C58 circular chromosome, complete sequence.
          Length = 863

 Score = 33.1 bits (74), Expect = 9.7
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +3

Query: 951  KNEEFEPWGQEIRAKLGCRLIELLTETAYVQPTINQS 1061
            K  E++ W Q+++AK+G +LIE+  E   +   + QS
Sbjct: 181  KGAEWQDWSQDVKAKVGLKLIEIAVEQTGLFEIVRQS 217


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 992,559,405
Number of Sequences: 1806583
Number of extensions: 18999396
Number of successful extensions: 52580
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 50189
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52478
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 81132070393
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)