BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7448
         (714 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB022216_1515051 Arabidopsis thaliana genomic DNA, chromosome...   131   1e-47   
gb:BC052479_2550492 Danio rerio chromosome segregation 1-like (S...    38   0.16    
gb:BC084944_2564179 Xenopus laevis hypothetical LOC495494, mRNA ...    37   0.35    
gb:AF059614_2471292 Xenopus laevis transportin mRNA, partial cds.      37   0.35    
gb:AF500107_2266716 Diachasmimorpha longicaudata entomopoxvirus ...    37   0.35    
gb:CR382123_1655754 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.35    
gb:DME238857_1378936 Drosophila melanogaster partial mRNA for CA...    37   0.46    
gb:AE014134_1129468 Drosophila melanogaster chromosome 2L, compl...    37   0.46    
sp|Q9XZU1|CSE1_DROME|CSE1_DROME Importin-alpha re-exporter (Cellular apopto...    37   0.46    Drosophila melanogaster
gb:NCB16M17_1689394 Neurospora crassa DNA linkage group V BAC cl...    36   0.60    
gb:AC024792_1204622 Caenorhabditis elegans cosmid Y48G1A, comple...    36   0.60    
pir|B81679|B81679 conserved hypothetical protein TC0663 [importe...    36   0.60    Chlamydia muridarum [agent of mouse pneumonitis]
gb:BC084097_2563503 Xenopus laevis hypothetical LOC495010, mRNA ...    36   0.78    
pir|S69679|S69679 hypothetical protein YDR395w - yeast (Saccharo...    36   0.78    Saccharomyces cerevisiae [brewer's yeast]
gb:HSU72395_2025881 Homo sapiens MIP mRNA, complete cds.               35   1.7     
gb:HSU70322_2025799 Human transportin (TRN) mRNA, complete cds.        35   1.7     
gb:AK029953_1161739 Mus musculus adult male testis cDNA, RIKEN f...    35   1.7     
sp|Q8BFY9|TNP1_MOUSE|TNP1_MOUSE Transportin 1 (Importin beta-2) (Karyopheri...    35   1.7     Mus musculus [mouse]
sp|Q92973|TNP1_HUMAN|TNP1_HUMAN Transportin 1 (Importin beta-)2 (Karyopheri...    35   1.7     Homo sapiens [man]
gb:BC084978_2564211 Xenopus laevis hypothetical LOC495499, mRNA ...    34   3.0     
gb:AF547173_2500446 Oreochromis niloticus cellular apoptosis sus...    33   3.9     
gb:CP000021_873043 Vibrio fischeri ES114 chromosome II, complete...    33   3.9     
gb:AE015940_320502 Clostridium tetani E88, section 5 of 10 of th...    33   5.0     
sp|O83771|Y793_TREPA|Y793_TREPA Hypothetical protein TP0793.>pir|H71280|H71...    33   6.6     Treponema pallidum
gb:BC073735_2557552 Xenopus laevis MGC84554 protein, mRNA (cDNA ...    32   8.6     
gb:BC072420_1988989 Homo sapiens transportin 2 (importin 3, kary...    32   8.6     
gb:AF019039_1876831 Homo sapiens transportin2 mRNA, complete cds.      32   8.6     
gb:YSCCSE1A_1728638 Saccharomyces cerevisia chromosome segregati...    32   8.6     
gb:AY740029_1626158 Saccharomyces kudriavzevii IFO 1802 GAL7, GA...    32   8.6     
gb:BX950851_838962 Erwinia carotovora subsp. atroseptica SCRI104...    32   8.6     
sp|Q99LG2|TNP2_MOUSE|TNP2_MOUSE Transportin 2 (Karyopherin beta-2b).>gb:BC0...    32   8.6     Mus musculus [mouse]
sp|O14787|TNP2_HUMAN|TNP2_HUMAN Transportin 2 (Karyopherin beta-2b).              32   8.6     Homo sapiens [man]
sp|P33307|CSE1_YEAST|CSE1_YEAST Importin alpha re-exporter (Chromosome segr...    32   8.6     Saccharomyces cerevisiae [brewer's yeast]


>gb:AB022216_1515051 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MGD8.
          Length = 222

 Score =  131 bits (330), Expect(2) = 1e-47
 Identities = 62/111 (55%), Positives = 86/111 (77%)
 Frame = +3

Query: 357 LLQTEPAILRVLNEAFRSIVAVEFVKSSSWPEIVPELRSVIQNSNMISNKGSSEWKTINS 536
           LLQ EPA+L+VL E    +V  EFV+ ++WP++VPELRS I+ S++IS+  SS W T+N+
Sbjct: 97  LLQAEPAVLKVLLELLHIVVVSEFVRKNAWPKLVPELRSAIEKSSLISSSNSS-WSTVNA 155

Query: 537 LTVLQSLIRPFKYFLNPTLAKEPVPPQLELIAKEILVPLLAVFHHFVDNVL 689
           L VL ++++PF+YFL P LAKEPVP QLE IA+EILVPL++V H  +D V+
Sbjct: 156 LMVLLTVVKPFQYFLQPKLAKEPVPQQLESIAREILVPLVSVLHRLIDKVI 206



 Score = 81.3 bits (199), Expect(2) = 1e-47
 Identities = 47/85 (55%), Positives = 60/85 (70%), Gaps = 2/85 (2%)
 Frame = +2

Query: 101 QIAQLLNQTLSS-DGNVVNLATDALDRLSM-LPDFPFYLLSIATGGENEGQKIAAATYLK 274
           QI +LL+QTL+S DG  V  AT+ALD LS  LP FP+ LLSIA+G EN   K+AAATYLK
Sbjct: 10  QIVRLLDQTLTSIDGVSVREATEALDLLSTKLPHFPYRLLSIASGSENPSLKVAAATYLK 69

Query: 275 NFIRRNIDANDANQKLSKEFRDALV 349
           NF R++        ++SKEF+D L+
Sbjct: 70  NFTRKSTGTEGTISEVSKEFKDQLL 94



>gb:BC052479_2550492 Danio rerio chromosome segregation 1-like (S.
           cerevisiae), mRNA (cDNA clone MGC:55932 IMAGE:3819210),
           complete cds.>gb:BC066737_2554574 Danio rerio chromosome
           segregation 1-like (S. cerevisiae), mRNA (cDNA clone
           MGC:76918 IMAGE:6524362), complete cds.
          Length = 971

 Score = 38.1 bits (87), Expect = 0.16
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = +2

Query: 104 IAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENEGQKIAAATYLKNFI 283
           + + L +TLS+D  V   A   L+ +    ++P  LL++    +NE  ++ +A   KN+I
Sbjct: 11  LTEYLQKTLSADPAVRRPAEKFLESVEGNQNYPILLLTVLEKSQNEVIRVCSAVTFKNYI 70

Query: 284 RRNID-ANDANQKLSKEFRDAL 346
           +RN     D   K+S   R A+
Sbjct: 71  KRNWRIVEDEPNKISDPDRTAI 92



>gb:BC084944_2564179 Xenopus laevis hypothetical LOC495494, mRNA
           (cDNA clone MGC:82259 IMAGE:4032070), complete cds.
          Length = 890

 Score = 37.0 bits (84), Expect = 0.35
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           QI QLL ++ S D N        L++L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 14  QILQLLKESQSPDNNTQRAVQQKLEQLNQFPDFNNYLIFVLTKLKSEDEPTRSLSGLILK 73

Query: 275 NFIR 286
           N ++
Sbjct: 74  NNVK 77



>gb:AF059614_2471292 Xenopus laevis transportin mRNA, partial cds.
          Length = 885

 Score = 37.0 bits (84), Expect = 0.35
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           QI QLL ++ S D N        L++L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 8   QILQLLKESQSPDNNTQRAVQQKLEQLNQFPDFNNYLIFVLTKLKSEDEPTRSLSGLILK 67

Query: 275 NFIR 286
           N ++
Sbjct: 68  NNVK 71



>gb:AF500107_2266716 Diachasmimorpha longicaudata entomopoxvirus
           DNA-dependent RNA polymerase (R1-36-1) gene, partial
           cds.
          Length = 772

 Score = 37.0 bits (84), Expect = 0.35
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 399 AFRSIVAVEFVKSSSWPEIVPELRSVI------QNSNMISNKGSSEWKTINS---LTVLQ 551
           AF+ I+  E  K S +  I P  +  +      +N+N I N G+++   +++     +LQ
Sbjct: 111 AFKKIL--EATKQSKFKCIAPNCQKQVSPLQYSKNNNFIYNSGTTKGIVLDNRHVFNILQ 168

Query: 552 SLIRPFKYFLNPTLAKEPVPPQLELIAKEILVP 650
           +L + FK  L P+ A + V P+    A  IL+P
Sbjct: 169 NLPQTFKLLLTPSNAHQIVSPENVFYANSILLP 201



>gb:CR382123_1655754 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 949

 Score = 37.0 bits (84), Expect = 0.35
 Identities = 27/88 (30%), Positives = 46/88 (52%), Gaps = 2/88 (2%)
 Frame = +2

Query: 89  MENHQIA-QLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENE-GQKIAAA 262
           M N Q+  QL +QT++SD   +  A   L  L   P F  +LL+     + E   +++ A
Sbjct: 1   MVNEQLTLQLFSQTMTSDARSIKAAEQQLFELQKEPGFLSFLLNTTNNAQLEIPIRMSCA 60

Query: 263 TYLKNFIRRNIDANDANQKLSKEFRDAL 346
            Y+KN I+R+ ++      +S E +DA+
Sbjct: 61  IYMKNMIQRSWNSR-KTVIISPEEKDAV 87



>gb:DME238857_1378936 Drosophila melanogaster partial mRNA for CAS
           protein.
          Length = 975

 Score = 36.6 bits (83), Expect = 0.46
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 104 IAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENE-GQKIAAATYLKNF 280
           +A  L QTLS+D NV   A   L+   +  ++P  LL++    + +   ++A A   KN+
Sbjct: 11  LAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAIAFKNY 70

Query: 281 IRRN 292
           I+RN
Sbjct: 71  IKRN 74



>gb:AE014134_1129468 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003652_1219575 Drosophila melanogaster
           chromosome 2L, section 61 of 83 of the complete
           sequence.
          Length = 975

 Score = 36.6 bits (83), Expect = 0.46
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 104 IAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENE-GQKIAAATYLKNF 280
           +A  L QTLS+D NV   A   L+   +  ++P  LL++    + +   ++A A   KN+
Sbjct: 11  LAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAIAFKNY 70

Query: 281 IRRN 292
           I+RN
Sbjct: 71  IKRN 74



>sp|Q9XZU1|CSE1_DROME Importin-alpha re-exporter (Cellular apoptosis
           susceptibility protein homolog).>gb:AF132562_1243647
           Drosophila melanogaster LD14270 full insert cDNA.
          Length = 975

 Score = 36.6 bits (83), Expect = 0.46
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 104 IAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENE-GQKIAAATYLKNF 280
           +A  L QTLS+D NV   A   L+   +  ++P  LL++    + +   ++A A   KN+
Sbjct: 11  LAGYLQQTLSADPNVRRPAEKLLESTELQQNYPILLLNLIDKAQMDMTTRVAGAIAFKNY 70

Query: 281 IRRN 292
           I+RN
Sbjct: 71  IKRN 74



>gb:NCB16M17_1689394 Neurospora crassa DNA linkage group V BAC clone
           B16M17.
          Length = 959

 Score = 36.2 bits (82), Expect = 0.60
 Identities = 29/81 (35%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +2

Query: 83  LAMENHQIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSI-ATGGENEGQKIAA 259
           +A     +AQLL  TL  D      A  AL   +  P +   LLSI A   +    ++AA
Sbjct: 1   MAANLDHLAQLLQATL--DARHHRKAETALKEEAKKPKYSLSLLSIVANDAQPSNIRLAA 58

Query: 260 ATYLKNFIRRNIDANDANQKL 322
           A   KNFIR N    + N KL
Sbjct: 59  ALAFKNFIRHNYVDEEGNYKL 79



>gb:AC024792_1204622 Caenorhabditis elegans cosmid Y48G1A, complete
           sequence.
          Length = 938

 Score = 36.2 bits (82), Expect = 0.60
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 6/89 (6%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENEGQ---KIAAATYL 271
           QI   L QTL  D  +     +AL  L   P +   +L +    + +     +IAAA  L
Sbjct: 3   QIGAALQQTLEPDAAIRKRGEEALRSLQSNPGYIIQILQLVVNEQQQIAPQIRIAAAVAL 62

Query: 272 KNFIRRN---IDANDANQKLSKEFRDALV 349
           KNF++RN       +  Q+  ++FR  L+
Sbjct: 63  KNFVKRNWGPAPEVEMGQEDEEQFRSMLL 91



>pir|B81679|B81679 conserved hypothetical protein TC0663 [imported]
           - Chlamydia muridarum (strain Nigg)>gb:AE002334_45247
           Chlamydia muridarum Nigg section 63 of 85 of the
           complete genome.>gb:AE002160_1149387 Chlamydia muridarum
           Nigg, complete genome.
          Length = 526

 Score = 36.2 bits (82), Expect = 0.60
 Identities = 30/122 (24%), Positives = 55/122 (45%)
 Frame = +3

Query: 177 ASLCFQIFHSISSLLPREVKMKVKR*LLLPILRTSSGEILMLMMQIRNSARSSEML*CTF 356
           +SL  ++   +S  L R+ ++     ++L  L   S  +  + +Q+     S  +L    
Sbjct: 78  SSLTVRVVTILSVGLARDYRLVP---IVLQALSDDSDVVREIALQVATMYGSGSLLRAVS 134

Query: 357 LLQTEPAILRVLNEAFRSIVAVEFVKSSSWPEIVPELRSVIQNSNMISNKGSSEWKTINS 536
            L      ++V   A+R+ V +E        ++ P LRSVIQN+ +   +    WK + S
Sbjct: 135 NLAKNDPSIQVRVAAYRAAVLLEI------KDLTPYLRSVIQNTQLDGTERREAWKALCS 188

Query: 537 LT 542
           LT
Sbjct: 189 LT 190



>gb:BC084097_2563503 Xenopus laevis hypothetical LOC495010, mRNA
           (cDNA clone MGC:83476 IMAGE:3404517), complete cds.
          Length = 889

 Score = 35.8 bits (81), Expect = 0.78
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           Q+ QLL  + S D  +  +  D L +L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 12  QVLQLLKDSQSPDTGIQRIVQDKLKQLNQYPDFNNYLIFVLTRLKSEDEPTRSLSGLILK 71

Query: 275 NFIR 286
           N ++
Sbjct: 72  NNVK 75



>pir|S69679|S69679 hypothetical protein YDR395w - yeast
           (Saccharomyces cerevisiae)>gb:SCD9509_1707575
           Saccharomyces cerevisiae chromosome IV cosmids 9481,
           9509, 9926, 9461, and lambda 3641.
          Length = 944

 Score = 35.8 bits (81), Expect = 0.78
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 6/103 (5%)
 Frame = +2

Query: 89  MENHQIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENE-GQKIAAAT 265
           ++   I   + QT+ +D  ++  A   L      P F  +LL+I +        ++++A 
Sbjct: 2   VQEQAILSCIEQTMVADAKIIKEAEQQLFEFQKQPGFTSFLLNIVSDDNFALNVRLSSAI 61

Query: 266 YLKNFIRRNIDAN-----DANQKLSKEFRDALVHVFASN*TSN 379
           YLKN I R+ D        A++KLS   ++ L+     N  +N
Sbjct: 62  YLKNKIHRSWDTKREDGIKADEKLS--IKERLIETLVKNCENN 102



>gb:HSU72395_2025881 Homo sapiens MIP mRNA, complete cds.
          Length = 890

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           QI QLL ++ S D  +       L++L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 14  QILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILK 73

Query: 275 NFIR 286
           N ++
Sbjct: 74  NNVK 77



>gb:HSU70322_2025799 Human transportin (TRN) mRNA, complete cds.
          Length = 890

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           QI QLL ++ S D  +       L++L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 14  QILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILK 73

Query: 275 NFIR 286
           N ++
Sbjct: 74  NNVK 77



>gb:AK029953_1161739 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4932410I22
           product:IMPORTIN BETA-2 SUBUNIT (KARYOPHERIN BETA-2
           SUBUNIT) (TRANSPORTIN) (M9 REGION INTERACTION PROTEIN)
           (MIP) homolog [Homo sapiens], full insert sequence.
          Length = 890

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           QI QLL ++ S D  +       L++L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 14  QILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILK 73

Query: 275 NFIR 286
           N ++
Sbjct: 74  NNVK 77



>sp|Q8BFY9|TNP1_MOUSE Transportin 1 (Importin beta-2) (Karyopherin
           beta-2).>gb:AK030580_1162072 Mus musculus adult male
           pituitary gland cDNA, RIKEN full-length enriched
           library, clone:5330434M13 product:IMPORTIN BETA-2
           SUBUNIT (KARYOPHERIN BETA-2 SUBUNIT) (TRANSPORTIN) (M9
           REGION INTERACTION PROTEIN) (MIP) homolog [Homo
           sapiens], full insert sequence.>gb:AK045132_1167282 Mus
           musculus 9.5 days embryo parthenogenote cDNA, RIKEN
           full-length enriched library, clone:B130039C18
           product:IMPORTIN BETA-2 SUBUNIT (KARYOPHERIN BETA-2
           SUBUNIT) (TRANSPORTIN) (M9 REGION INTERACTION PROTEIN)
           (MIP) homolog [Homo sapiens], full insert
           sequence.>gb:BC055372_2102020 Mus musculus transportin
           1, mRNA (cDNA clone MGC:60869 IMAGE:30059046), complete
           cds.
          Length = 890

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           QI QLL ++ S D  +       L++L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 14  QILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILK 73

Query: 275 NFIR 286
           N ++
Sbjct: 74  NNVK 77



>sp|Q92973|TNP1_HUMAN Transportin 1 (Importin beta-)2 (Karyopherin
           beta-2) (M9 region interaction protein)
           (MIP).>gb:BC040340_1982786 Homo sapiens transportin 1,
           transcript variant 1, mRNA (cDNA clone MGC:17116
           IMAGE:4178989), complete cds.>gb:HSU72069_2025870 Human
           karyopherin beta2 mRNA, complete cds.
          Length = 890

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           QI QLL ++ S D  +       L++L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 14  QILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILK 73

Query: 275 NFIR 286
           N ++
Sbjct: 74  NNVK 77



>gb:BC084978_2564211 Xenopus laevis hypothetical LOC495499, mRNA
           (cDNA clone MGC:86390 IMAGE:7011265), complete cds.
          Length = 890

 Score = 33.9 bits (76), Expect = 3.0
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           Q+ QLL  + S D     +  D L +L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 12  QVLQLLKDSQSPDTATQRIVQDKLKQLNQYPDFNNYLIFVLTRLKSEDEPTRSLSGLILK 71

Query: 275 NFIR 286
           N ++
Sbjct: 72  NNVK 75



>gb:AF547173_2500446 Oreochromis niloticus cellular apoptosis
           susceptibility protein mRNA, complete cds.
          Length = 971

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 1/82 (1%)
 Frame = +2

Query: 104 IAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENEGQKIAAATYLKNFI 283
           + + L +TL  D  V   A   L+ +    ++P  LL++    ++   ++ AA   KN+I
Sbjct: 11  LTEFLRKTLDPDPTVRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIRVCAAVTFKNYI 70

Query: 284 RRNID-ANDANQKLSKEFRDAL 346
           +RN     D   K+S   R A+
Sbjct: 71  KRNWRIVEDEPNKISDPDRTAV 92



>gb:CP000021_873043 Vibrio fischeri ES114 chromosome II, complete
           sequence.
          Length = 364

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 17/37 (45%), Positives = 24/37 (64%)
 Frame = +3

Query: 597 KEPVPPQLELIAKEILVPLLAVFHHFVDNVLHVQDNV 707
           K  V P LE +AKEI +P+L V  H +D +L + DN+
Sbjct: 164 KHEVMPYLERLAKEIKIPILYV-SHSLDEILRLADNM 199



>gb:AE015940_320502 Clostridium tetani E88, section 5 of 10 of the
           complete genome.>gb:AE015927_963291 Clostridium tetani
           E88, complete genome.
          Length = 378

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 381 LRVLNEAFRSIVAVEFVKSSSWPEIVPELRSVIQNSNMISNKGSSEWKTINSLTVLQSLI 560
           ++++NE+   +  +E +K  SW  ++  LR +I   N++SN  ++    IN + ++  LI
Sbjct: 268 IKIVNESNTKLKFIELIKRYSWLIVISVLR-IIFGLNLLSNFHTTVISIINIIYLIIILI 326

Query: 561 RPFKYF 578
             FK F
Sbjct: 327 IGFKLF 332



>sp|O83771|Y793_TREPA Hypothetical protein TP0793.>pir|H71280|H71280
           hypothetical protein TP0793 - syphilis
           spirochete>gb:AE001250_33616 Treponema pallidum subsp.
           pallidum str. Nichols section 66 of 87 of the complete
           genome.>gb:AE000520_1049844 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 539

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = -2

Query: 683 IIHKVMEHCKQGYKYLLCNKL*LRRNWLLCKCWIQEVLERSNQ 555
           I+H V+ H   GY Y +   L L+RNW   K  + E  E  +Q
Sbjct: 279 ILHLVLAHVASGYYYSISGDLYLQRNWHWLKARLVERAEHHHQ 321



>gb:BC073735_2557552 Xenopus laevis MGC84554 protein, mRNA (cDNA
           clone MGC:84554 IMAGE:5085490), complete cds.
          Length = 971

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 17/63 (26%), Positives = 32/63 (50%)
 Frame = +2

Query: 104 IAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENEGQKIAAATYLKNFI 283
           + + L +TL  D  V   A   L+ +    ++P  LL++    ++   K+ +A   KN+I
Sbjct: 11  LTEYLKKTLDPDPAVRRPAEKYLESVEGNQNYPLLLLTLVERSQDNVIKVCSAVTFKNYI 70

Query: 284 RRN 292
           +RN
Sbjct: 71  KRN 73



>gb:BC072420_1988989 Homo sapiens transportin 2 (importin 3,
           karyopherin beta 2b), mRNA (cDNA clone MGC:90166
           IMAGE:6184325), complete cds.
          Length = 887

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           Q+ QLL  + S +     +  D L +L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 12  QVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIFVLTRLKSEDEPTRSLSGLILK 71

Query: 275 NFIR 286
           N ++
Sbjct: 72  NNVK 75



>gb:AF019039_1876831 Homo sapiens transportin2 mRNA, complete cds.
          Length = 896

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           Q+ QLL  + S +     +  D L +L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 12  QVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIFVLTRLKSEDEPTRSLSGLILK 71

Query: 275 NFIR 286
           N ++
Sbjct: 72  NNVK 75



>gb:YSCCSE1A_1728638 Saccharomyces cerevisia chromosome segregation
           (CSE1) gene, complete cds.
          Length = 960

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 26/108 (24%), Positives = 49/108 (45%)
 Frame = +3

Query: 390 LNEAFRSIVAVEFVKSSSWPEIVPELRSVIQNSNMISNKGSSEWKTINSLTVLQSLIRPF 569
           + EA  SI   +F     WP ++ +L S + N +M++NKG         LTV  S+ + +
Sbjct: 105 IGEAISSIADSDF--PDRWPTLLSDLASRLSNDDMVTNKG--------VLTVAHSIFKRW 154

Query: 570 KYFLNPTLAKEPVPPQLELIAKEILVPLLAVFHHFVDNVLHVQDNVEA 713
           +    P    + +  +++L+      P L +    VD  +   +N +A
Sbjct: 155 R----PLFRSDELFLEIKLVLDVFTAPFLNLL-KTVDEQITANENNKA 197



>gb:AY740029_1626158 Saccharomyces kudriavzevii IFO 1802 GAL7,
           GAL10, and GAL1 pseudogene cluster, complete sequence;
           KAP104 and FUR4 genes, complete cds.
          Length = 913

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIATGGENE 241
           Q+A LL   +SS+  + N A +A++   + P+F  YL  I   GE++
Sbjct: 14  QLATLLQNCMSSNPEIRNNAMEAMENFQLQPEFFNYLCYILIEGESD 60



>gb:BX950851_838962 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 233

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 6/69 (8%)
 Frame = +2

Query: 125 TLSSDGNVVNLATDALDRLSMLPDFPF------YLLSIATGGENEGQKIAAATYLKNFIR 286
           TLS     V   TD + R+ +LP+ PF      YL+ +    +     +A+    KNFI 
Sbjct: 3   TLSCKVTSVEAITDTVYRVRLLPEAPFSFRAGQYLMVVMGDRDKRPFSLASTPMDKNFIE 62

Query: 287 RNIDANDAN 313
            +I A++ N
Sbjct: 63  LHIGASELN 71



>sp|Q99LG2|TNP2_MOUSE Transportin 2 (Karyopherin
           beta-2b).>gb:BC003275_2089129 Mus musculus transportin 2
           (importin 3, karyopherin beta 2b), mRNA (cDNA clone
           MGC:6380 IMAGE:3499838), complete cds.
          Length = 887

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           Q+ QLL  + S +     +  D L +L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 12  QVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIFVLTRLKSEDEPTRSLSGLILK 71

Query: 275 NFIR 286
           N ++
Sbjct: 72  NNVK 75



>sp|O14787|TNP2_HUMAN Transportin 2 (Karyopherin beta-2b).
          Length = 897

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = +2

Query: 101 QIAQLLNQTLSSDGNVVNLATDALDRLSMLPDFPFYLLSIAT--GGENEGQKIAAATYLK 274
           Q+ QLL  + S +     +  D L +L+  PDF  YL+ + T    E+E  +  +   LK
Sbjct: 12  QVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIFVLTRLKSEDEPTRSLSGLILK 71

Query: 275 NFIR 286
           N ++
Sbjct: 72  NNVK 75



>sp|P33307|CSE1_YEAST Importin alpha re-exporter (Chromosome
           segregation protein CSE1).>pir|A48083|A48083 chromosome
           segregation protein CSE1 - yeast (Saccharomyces
           cerevisiae)>gb:SCYGL239C_1712174 S.cerevisiae chromosome
           VII reading frame ORF YGL239c.
          Length = 960

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 26/108 (24%), Positives = 49/108 (45%)
 Frame = +3

Query: 390 LNEAFRSIVAVEFVKSSSWPEIVPELRSVIQNSNMISNKGSSEWKTINSLTVLQSLIRPF 569
           + EA  SI   +F     WP ++ +L S + N +M++NKG         LTV  S+ + +
Sbjct: 105 IGEAISSIADSDF--PDRWPTLLSDLASRLSNDDMVTNKG--------VLTVAHSIFKRW 154

Query: 570 KYFLNPTLAKEPVPPQLELIAKEILVPLLAVFHHFVDNVLHVQDNVEA 713
           +    P    + +  +++L+      P L +    VD  +   +N +A
Sbjct: 155 R----PLFRSDELFLEIKLVLDVFTAPFLNLL-KTVDEQITANENNKA 197


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 655,344,424
Number of Sequences: 1806583
Number of extensions: 11712803
Number of successful extensions: 29621
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 28898
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29615
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 42145286112
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)