BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7412
         (527 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY389648_1178272 Hyacinthus orientalis histone H4 mRNA, compl...   162   3e-39   
pir|A24967|HSWT41 histone H4 (TH091) - wheat>gb:WHTH4091_1727656...   162   3e-39   
pir|S60475|HSPM4 histone H4 - garden pea>pir|A25642|HSZM4 histon...   162   3e-39   
sp|P59259|H4_ARATH|H4_ARATH Histone H4.>sp|P59258|H4_WHEAT Histone H4.>pi...   162   3e-39   Arabidopsis thaliana [mouse-ear cress]
sp|P82888|H4_OLILU|H4_OLILU Histone H4.                                        162   4e-39   Olisthodiscus luteus
gb:SRH41_1722402 S.rostrata mRNA coding for Histone H4 homologue.     161   6e-39   
pir|S32769|S32769 histone H4 - tomato>gb:AY346459_1601037 Solanu...   161   6e-39   Solanum lycopersicum
sp|P35057|H4_LYCES|H4_LYCES Histone H4.                                        161   6e-39   Solanum lycopersicum
gb:BC058529_2103302 Mus musculus histone 1, H4h, mRNA (cDNA clon...   160   8e-39   
gb:BC028550_2096260 Mus musculus histone 1, H4h, mRNA (cDNA clon...   160   8e-39   
gb:BC019757_2093088 Mus musculus histone 1, H4i, mRNA (cDNA clon...   160   8e-39   
gb:AY267751_1314544 Mytilus chilensis histone H4 (H4) gene, comp...   160   8e-39   
gb:AF140034_1244287 Phreatamoeba balamuthi histone H4 mRNA, comp...   160   8e-39   
pir|D40335|HSHU4 histone H4 [validated] - human>pir|A91265|HSRT4...   160   8e-39   
pir|S10098|HSFF4 histone H4 - fruit fly (Drosophila melanogaster...   160   8e-39   
sp|Q9U7D0|H4_MASBA|H4_MASBA Histone H4.                                        160   8e-39   Mastigamoeba balamuthi
sp|P02304|H4_HUMAN|H4_HUMAN Histone H4.>pir|A24552|HSTR4 histone H4 - rai...   160   8e-39   Homo sapiens [man]
sp|P02307|H4_DROME|H4_DROME Histone H4.                                        160   8e-39   Drosophila melanogaster
gb:AB183301_1529281 Lactuca sativa LetH4 mRNA for histone H4, pa...   160   1e-38   
gb:ACPH342BA_1208274 Acropora formosa histone H3 (H3), histone H...   160   1e-38   
sp|P35059|H4_ACRFO|H4_ACRFO Histone H4.                                        160   1e-38   Acropora formosa
gb:ZMHIS4DNA_1731882 Z.mays histone H4 gene.                          160   1e-38   
gb:LTMRHISH4_1685418 L.temulentum mRNA for histone H4.                160   1e-38   
gb:AB050889_1521043 Citrus jambhiri mRNA for histone H4, partial...   160   1e-38   
gb:BT015217_1358294 Drosophila melanogaster RE42129 full insert ...   160   1e-38   
gb:PSHISTH4_1702175 P.salina histone H4 gene.                         159   2e-38   
gb:ODI494855_1391118 Oikopleura dioica partial mRNA for histone ...   159   2e-38   
pir|JN0688|JN0688 histone H4 - sea squirt (Styela plicata)>gb:AJ...   159   2e-38   Styela plicata
gb:BC067496_1987396 Homo sapiens cDNA clone MGC:79352 IMAGE:7002...   159   2e-38   
gb:AK011560_1156475 Mus musculus 10 days embryo whole body cDNA,...   159   2e-38   
gb:AK010085_1155526 Mus musculus adult male tongue cDNA, RIKEN f...   159   2e-38   
gb:CR542189_1994415 Homo sapiens full open reading frame cDNA cl...   159   3e-38   
pir|S03427|S03427 histone H4 (clone 53) - mouse>gb:MMHIS453_2115...   159   3e-38   Mus musculus [mouse]
gb:AY450353_1430246 Bos grunniens histone H4.1 mRNA, partial cds.     158   4e-38   
gb:PLY16587_1395393 Paracentrotus lividus histone H4 gene, partial.   158   4e-38   
pir|T27741|T27741 hypothetical protein ZK131.4 - Caenorhabditis ...   158   4e-38   Caenorhabditis elegans [roundworm]
pir|S20666|S20666 histone H4 - starfish (Pisaster brevispinus)>p...   158   4e-38   Pisaster brevispinus
pir|T29230|T29230 hypothetical protein F55G1.11 - Caenorhabditis...   158   4e-38   Caenorhabditis elegans [roundworm]
sp|P02306|H4_CAEEL|H4_CAEEL Histone H4.>pir|D93719|HSUR4 histone H4 - sea...   158   4e-38   Caenorhabditis elegans [roundworm]
gb:DPINH41_1381409 D.pini mRNA for histone H4, isoforme 1.            158   5e-38   
gb:GGU37576_2573628 Gallus gallus histone H4-VIII gene, complete...   157   7e-38   
gb:AY064471_1293727 Aplysia californica histone H4 (His.H4) gene...   157   7e-38   
gb:AB105183_1199621 Drosophila sechellia H4, H2A, H2B, H1 genes ...   157   7e-38   
gb:DPULH4_1381535 D.pulchellus mRNA for histone H4.                   157   9e-38   
pir|S20677|S20677 histone H4 - starfish (Solaster stimpsoni)>gb:...   157   9e-38   Solaster stimpsoni
sp|P27996|H4_SOLST|H4_SOLST Histone H4.                                        157   9e-38   Solaster stimpsoni
gb:HSHIH4_2013798 Human H4 histone gene.                              156   2e-37   
gb:DPINH4_1381408 D.pini mRNA for histone H4.                         156   2e-37   
gb:AY650011_1620150 Petunia x hybrida histone H4 (H4) mRNA, comp...   156   2e-37   
pir|S59586|S59586 histone H4 (clones CH-I, CH-II, and CH-III) - ...   156   2e-37   Chlamydomonas reinhardtii
pir|A27859|A27859 histone H4.1 - slime mold (Physarum polycephal...   156   2e-37   Physarum polycephalum
sp|P04915|H4_PHYPO|H4_PHYPO Histone H4.                                        156   2e-37   Physarum polycephalum
sp|P50566|H4_CHLRE|H4_CHLRE Histone H4.                                        156   2e-37   Chlamydomonas reinhardtii
gb:MAL249812_1685568 Mortierella alpina H3.1 and H4.1 genes for ...   155   3e-37   
gb:AE017343_1755397 Cryptococcus neoformans var. neoformans JEC2...   155   4e-37   
gb:AF361948_1265574 Eimeria tenella histone 4 (H4) gene, complet...   155   4e-37   
pir|S00939|S00939 histone H4 - Volvox carteri>gb:VCHIS34_1727019...   155   4e-37   Volvox carteri
pir|S10076|S10076 histone H4.2 - slime mold (Physarum polycephal...   155   4e-37   Physarum polycephalum
sp|P08436|H4_VOLCA|H4_VOLCA Histone H4.                                        155   4e-37   Volvox carteri
gb:CR382133_1666749 Debaryomyces hansenii chromosome A of strain...   154   6e-37   
gb:ALHISH4X1_1285074 A.lumbricoides histone H4 gene (exon 1).         154   8e-37   
pir|S25638|S25638 histone H4 - basidiomycete (Phanerochaete chry...   154   8e-37   Phanerochaete chrysosporium
sp|P35058|H4_PHACH|H4_PHACH Histone H4.                                        154   8e-37   Phanerochaete chrysosporium
sp|Q27443|H4_ASCSU|H4_ASCSU Histone H4.                                        154   8e-37   Ascaris suum
gb:AF297469_1259956 Schistosoma mansoni strain LE histone H4 gen...   154   1e-36   
gb:AMH4_1285248 A.mellifera mRNA for histone H4.                      153   1e-36   
gb:TCH4_1399688 T.caceociae mRNA for histone H4.                      153   2e-36   
gb:AJ646896_1813368 Ustilago maydis h4 gene for histone 4, exons...   151   5e-36   
gb:DPINH42_1381410 D.pini mRNA for histone H4, isoforme 2.            151   5e-36   
gb:AE014186_938029 Plasmodium falciparum 3D7 chromosome 11 compl...   151   5e-36   
pir|JS0314|JS0314 histone H4 - Caenorhabditis elegans                 151   5e-36   Caenorhabditis elegans [roundworm]
gb:PFU314854_1699948 Penicillium funiculosum H4.2 gene for histo...   151   7e-36   
pir|S07913|S07913 histone H4 - Neurospora crassa>gb:AY062172_156...   151   7e-36   Neurospora crassa
pir|S11939|S11939 histone H4.1 - Emericella nidulans>gb:AB033943...   151   7e-36   Aspergillus nidulans
pir|S11940|S11940 histone H4.2 - Emericella nidulans>gb:ENU12631...   151   7e-36   Aspergillus nidulans
sp|P04914|H4_NEUCR|H4_NEUCR Histone H4.                                        151   7e-36   
sp|P23751|H42_EMENI|H42_EMENI Histone H4.2.                                     151   7e-36   
sp|P23750|H41_EMENI|H41_EMENI Histone H4.1.                                     151   7e-36   
gb:AY850324_1180294 Magnaporthe grisea histone H4-like protein m...   150   9e-36   
pir|D27399|HSZP4 histone H4 [similarity] - fission yeast (Schizo...   150   9e-36   
sp|P09322|H4_SCHPO|H4_SCHPO Histone H4.                                        150   9e-36   Schizosaccharomyces pombe
gb:CR382125_1658006 Kluyveromyces lactis strain NRRL Y-1140 chro...   150   1e-35   
gb:CR382125_1657602 Kluyveromyces lactis strain NRRL Y-1140 chro...   150   1e-35   
gb:AF517877_1807679 Griffithsia japonica isolate Gj458 histone H...   150   1e-35   
gb:CR380949_1649587 Candida glabrata strain CBS138 chromosome C ...   150   1e-35   
gb:AAD535732_1508167 Arxula adeninivorans ahsb4 gene for histone...   150   1e-35   
pir|F90085|F90085 Histone H4 [imported] - Guillardia theta nucle...   149   2e-35   Guillardia theta
gb:AE016817_1747183 Ashbya gossypii (= Eremothecium gossypii) AT...   149   3e-35   
pir|A02647|HSBY4 histone H4 - yeast (Saccharomyces cerevisiae)>g...   149   3e-35   
sp|P02309|H4_YEAST|H4_YEAST Histone H4.                                        149   3e-35   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382129_1661785 Yarrowia lipolytica chromosome C of strain C...   147   1e-34   
gb:TVH3242_1401231 T.vaginalis DNA for histone H4-2 and histone ...   144   8e-34   
gb:AE016818_1748160 Ashbya gossypii (= Eremothecium gossypii) AT...   143   1e-33   
gb:AF506076_1277880 Stylonychia mytilus macronuclear histone H4 ...   142   3e-33   
pir|S14185|S14185 histone H4 (clone H4g) - Stylonychia lemnae         142   3e-33   Stylonychia lemnae
pir|S14184|S14184 histone H4 (clone H4K) - Stylonychia lemnae>pi...   142   3e-33   Stylonychia lemnae
sp|P18836|H4_OXYNO|H4_OXYNO Histone H4.                                        142   3e-33   Sterkiella nova
gb:AF506071_1277875 Euplotes aediculatus macronuclear histone H4...   141   7e-33   
gb:PFU65675_1395098 Plasmodium falciparum histone H4 gene, parti...   139   2e-32   
gb:ECU75430_1384244 Euplotes crassus macronuclear linear DNA, co...   139   3e-32   
sp|P80739|H4_EUPCR|H4_EUPCR Histone H4.                                        139   3e-32   Moneuplotes crassus
pir|A25875|A25875 histone H4 - Tetrahymena thermophila>gb:TTHI01...   138   4e-32   Tetrahymena thermophila
sp|P02311|H42_TETPY|H42_TETPY Histone H4, minor.>pir|A02649|HSTE42 histone...   138   4e-32   Tetrahymena pyriformis
sp|P02310|H41_TETPY|H41_TETPY Histone H4, major.>pir|A02648|HSTE41 histone...   138   4e-32   Tetrahymena pyriformis
gb:AJ632310_2278613 Cotesia congregata virus complete genome, se...   136   2e-31   
gb:AB070962_1197354 Paramecium caudatum gene for histone H4, com...   133   1e-30   
gb:BJH41_1355323 B.japonicum H4 gene fragment, clone BjMH4-1.         131   5e-30   
sp|P80737|H41_BLEJA|H41_BLEJA Histone H4-1 (Fragment).                          131   5e-30   Blepharisma japonicum
sp|P40287|H4_ENTHI|H4_ENTHI Histone H4.>pir|S52264|S52262 histone H4 - En...   131   7e-30   Entamoeba histolytica
gb:AGHISTH4_1281991 A.gambiae H4 gene, partial.                       129   3e-29   
gb:DCA505019_1675630 Daucus carota partial h4 gene for histone H4.    129   4e-29   
gb:ALHISH4_1285073 Arbacia lixula H4 gene.                            128   6e-29   
gb:AC116977_1206958 Dictyostelium discoideum chromosome 2 map 55...   127   1e-28   
gb:AF139876_1244271 Giardia intestinalis histone H4 gene, comple...   125   3e-28   
gb:AY226559_1591031 Eschscholzia californica subsp. californica ...   125   4e-28   
sp|P90516|H42_BLEJA|H42_BLEJA Histone H4 (Fragment).>gb:BJH42_1355324 B.ja...   124   9e-28   Blepharisma japonicum
gb:CR382127_1659993 Yarrowia lipolytica chromosome A of strain C...   124   1e-27   
gb:BSJ004703_1356008 Blepharisma sp. DNA for histone H4 gene.>gb...   118   5e-26   
gb:AY128660_1936751 Homo sapiens clone HIST1H4G histone H4 gene,...   117   8e-26   
gb:BUJ004705_1358689 Blepharisma undulans DNA for histone H4 gene.    117   1e-25   
gb:ACHISTOH4_1745354 A.cepa mRNA for histone H4.                      117   1e-25   
gb:BUJ004704_1358688 Blepharisma undulans DNA for histone H4 gene.    115   3e-25   
gb:PSJ004709_1395775 Protocruzia sp. DNA for histone H4 gene.>gb...   115   4e-25   
gb:CAC314729_1644765 Colletotrichum acutatum partial H4 gene, ex...   114   1e-24   
gb:AE017150_1029757 Trypanosoma brucei chromosome 2, complete se...   114   1e-24   
gb:MMHISH4S_2115302 Mouse histone H4 gene 3' region with signals...   110   1e-23   
pir|I48404|I48404 histone H4 (55AA) (1 is 3rd base in codon) - m...   110   1e-23   Mus musculus [mouse]
gb:EEJ004711_1384269 Euplotes eurystomus DNA for histone H4 gene.     109   2e-23   
gb:EEJ004712_1384270 Euplotes eurystomus DNA for histone H4 gene.     108   6e-23   
gb:EVJ004707_1385013 Euplotes vannus DNA for histone H4 gene.         107   8e-23   
gb:EMJ004708_1384633 Euplotes minuta DNA for histone H4 gene.         107   8e-23   
gb:LMFL7845_1388388 Leishmania major Friedlin chromosome 35 cosm...   106   2e-22   
gb:CSP314736_1674061 Colletotrichum sp. partial H4 gene, exons 1...   105   3e-22   
gb:LIH42HIST_1387522 Leishmania infantum cDNA for H4 histone gene.    105   3e-22   
gb:LIH41HIST_1387521 Leishmania infantum cDNA for H4 Histone gene.    105   3e-22   
gb:AF175386_1247681 Leishmania tarentolae histone H4 mRNA, compl...   105   3e-22   
gb:AX886577_1482030 Sequence 2440 from Patent EP1033401.               96   4e-19   
gb:CR382132_1664942 Yarrowia lipolytica chromosome F of strain C...    95   6e-19   
gb:AY233060_1311489 Blepharisma americanum paralog 3 histone H4 ...    93   3e-18   
gb:AY559145_1335325 Succinea putris isolate 33 histone H3 and hi...    92   4e-18   
gb:AF344869_1264197 Heterodera glycines histone Hgg-28 mRNA, par...    92   5e-18   
gb:AJ698352_1283769 Euplotes vannus macronuclear gene for histon...    91   8e-18   
gb:AY233059_1311488 Blepharisma americanum paralog 2 histone H4 ...    91   1e-17   
gb:AY233062_1311491 Blepharisma americanum paralog 5 histone H4 ...    91   1e-17   
gb:BUJ004689_1358683 Blepharisma undulans DNA for histone H3 and...    90   2e-17   
gb:AY233064_1311493 Stentor sp. LLK-2003 histone H4 gene, partia...    90   2e-17   
gb:AY233050_1311479 Nyctotherus ovalis paralog 1 histone H4 gene...    88   7e-17   
gb:AY233048_1311477 Sterkiella historiomuscorum paralog 1 histon...    88   9e-17   
gb:CGL314726_1646397 Colletotrichum gloeosporioides partial H4 g...    87   1e-16   
gb:AY233079_1311508 Pleuronema sp. LLK-2003 paralog 1 clone 1 hi...    87   1e-16   
gb:AY233055_1311484 Nyctotherus ovalis paralog 5 histone H4 gene...    87   1e-16   
gb:CAC314723_1644764 Colletotrichum acutatum partial H4 gene, ex...    87   2e-16   
gb:AY233073_1311502 Halteria grandinella paralog 1 clone 1 histo...    86   3e-16   
gb:AY233057_1311486 Moneuplotes crassus paralog 2 histone H4 gen...    86   3e-16   
gb:AY233053_1311482 Nyctotherus ovalis paralog 3 histone H4 gene...    86   3e-16   
gb:PMHIS8_1395448 Sea urchin (P. miliaris) gene for histones H1,...    86   4e-16   
gb:AY675294_1345556 Deroceras reticulatum histone H4 gene, parti...    86   4e-16   
gb:AY233081_1311510 Pleuronema sp. LLK-2003 paralog 2 histone H4...    86   4e-16   
gb:AY233047_1311476 Strombidium sp. LLK-2003 histone H4 gene, pa...    86   4e-16   
gb:AY233056_1311485 Moneuplotes crassus paralog 1 histone H4 gen...    84   1e-15   
gb:AY675292_1958692 Callithrix geoffroyi histone H4 gene, partia...    84   2e-15   
gb:AY675276_1345554 Planorbis corneus histone H4 gene, partial cds.    84   2e-15   
gb:AY233082_1311511 Pleuronema sp. LLK-2003 paralog 3 histone H4...    84   2e-15   
gb:AY675277_1958691 Saguinus oedipus histone H4 gene, partial cds.     82   4e-15   
gb:AY675279_1432300 Suricata suricatta histone H4 gene, partial ...    82   4e-15   
gb:AY675278_1345555 Spodoptera frugiperda histone H4 gene, parti...    82   5e-15   
gb:AY233054_1311483 Nyctotherus ovalis paralog 4 histone H4 gene...    82   6e-15   
gb:AF527985_1279431 Chilodonella uncinata clone 5 histone H4 (H4...    82   6e-15   
gb:AY233076_1311505 Halteria grandinella paralog 2 clone 2 histo...    80   1e-14   
gb:AY233052_1311481 Nyctotherus ovalis paralog 2 clone 2 histone...    80   1e-14   
gb:AY233051_1311480 Nyctotherus ovalis paralog 2 clone 1 histone...    80   1e-14   
gb:PTJ004713_1395966 Prorodon teres DNA for histone H3 and H4 ge...    80   2e-14   
gb:PSJ004701_1395774 Protocruzia sp. DNA for histone H4 gene.          79   4e-14   
gb:AY675281_1432301 Mammuthus primigenius histone H4 gene, parti...    79   5e-14   
gb:PTJ004714_1395968 Prorodon teres DNA for histone H3 and H4 ge...    78   7e-14   
gb:OGJ004696_1391217 Obertrumia georgiana DNA for histone H3 and...    77   2e-13   
gb:CCJ004692_1359455 Colpidium campylum DNA for histone H3 and H...    76   3e-13   
gb:AY233083_1311512 Tokophrya lemnarum clone 1 histone H4 gene, ...    76   3e-13   
gb:AF527981_1279427 Chilodonella uncinata clone 1 histone H4 (H4...    76   3e-13   
gb:OGJ004695_1391215 Obertrumia georgiana DNA for histone H3 and...    75   5e-13   
gb:CCJ004698_1359461 Colpoda cucullus DNA for histone H3 and H4 ...    75   5e-13   
gb:AY233084_1311513 Tokophrya lemnarum clone 2 histone H4 gene, ...    75   5e-13   
gb:OGJ004697_1391219 Obertrumia georgiana DNA for histone H3 and...    75   6e-13   
gb:AY233058_1311487 Blepharisma americanum paralog 1 histone H4 ...    75   6e-13   
gb:AY233085_1311514 Tokophrya lemnarum clone 3 histone H4 gene, ...    75   8e-13   
gb:AY233072_1311501 Heliophrya erhardi paralog 3 histone H4 gene...    74   1e-12   
gb:AY233070_1311499 Heliophrya erhardi paralog 1 clone 3 histone...    74   1e-12   
gb:AY233067_1311496 Bursaria truncatella paralog 2 clone 2 histo...    74   1e-12   
gb:AF527983_1279429 Chilodonella uncinata clone 3 histone H4 (H4...    74   2e-12   
gb:AY233075_1311504 Halteria grandinella paralog 2 clone 1 histo...    73   2e-12   
gb:AF008301_2468434 Ambystoma mexicanum histone H4 (H4) mRNA, pa...    73   3e-12   
gb:AY233068_1311497 Heliophrya erhardi paralog 1 clone 1 histone...    72   4e-12   
gb:AY233071_1311500 Heliophrya erhardi paralog 2 histone H4 gene...    72   7e-12   
gb:AY233069_1311498 Heliophrya erhardi paralog 1 clone 2 histone...    71   9e-12   
gb:PMHIS7_1395441 Sea urchin (P. miliaris) gene for histones H4,...    70   3e-11   
gb:CNS07EGI_1374432 chromosome IX of strain GB-M1 of Encephalito...    67   2e-10   
gb:AY233066_1311495 Bursaria truncatella paralog 2 clone 1 histo...    67   2e-10   
gb:AY233065_1311494 Bursaria truncatella paralog 1 histone H4 ge...    64   1e-09   
gb:HSHISH4_2013819 Human histone H4 gene.                              62   3e-09   
pir|A02650|A02650 histone H4 - Tetrahymena thermophila (fragments)     60   3e-08   Tetrahymena thermophila
gb:CGR314728_1646433 Colletotrichum graminicola partial H4 gene,...    59   3e-08   
gb:PBJ004702_1391718 Paramecium bursaria DNA for histone H4 gene.      57   2e-07   
gb:PTJ004700_1395964 Paramecium tetraurelia DNA for histone H4 g...    56   4e-07   
gb:PTJ004699_1395963 Paramecium tetraurelia DNA for histone H4 g...    54   2e-06   
gb:CSP314732_1674057 Colletotrichum sp. partial H4 gene, exon 1,...    53   3e-06   
gb:DVU82930_1384014 Drosophila virilis histone H4 (H4) gene, par...    52   5e-06   
gb:SPBC800_1720436 S.pombe chromosome II cosmid SPU41410.              48   8e-05   
sp|P80738|H4Y_BLEJA|H4Y_BLEJA Histone H4 (Fragment).                             48   1e-04   Blepharisma japonicum
gb:AF451898_2258022 Heliothis zea virus 1, complete genome.            45   7e-04   
gb:AF216837_1251830 Drosophila virilis clone p3.6-33 histone H4 ...    43   0.003   
pir|C30309|C30309 histone H4 - Euplotes crassus (fragment)             40   0.021   Moneuplotes crassus
sp|O28779|HAF2_ARCFU|HAF2_ARCFU Probable archaeal histone A1-2.>pir|D69436|...    40   0.028   Archaeoglobus fulgidus
sp|P50485|HARA_PYRSG|HARA_PYRSG Archaeal histone A (Archaeal histone A1).>g...    38   0.082   Pyrococcus sp.
pir|G69093|G69093 histone HMtA2 - Methanobacterium thermoautotro...    37   0.18    Methanothermobacter thermautotrophicus str. Delta H
sp|O27731|HMT2_METTH|HMT2_METTH DNA binding protein HMt-1.2 (Archaeal histo...    37   0.18    Methanothermobacter thermautotrophicus
sp|P48784|HFOB_METFO|HFOB_METFO Archaeal histone B.>gb:MFU12929_143398 Meth...    37   0.18    Methanobacterium formicicum
pir|G69209|G69209 histone-related protein HMtA1 - Methanobacteri...    36   0.31    Methanothermobacter thermautotrophicus str. Delta H
sp|P50483|HMT1_METTH|HMT1_METTH DNA binding protein HMt-1.1 (Archaeal histo...    36   0.31    Methanothermobacter thermautotrophicus
sp|Q9Y8I1|HARA_PYRKO|HARA_PYRKO Archaeal histone A (Archaeal histone A1).>g...    36   0.31    
sp|P61881|HARA_PYRAB|HARA_PYRAB Archaeal histone A (Archaeal histone A1).>s...    36   0.31    Pyrococcus abyssi
gb:AE000812_27956 Methanobacterium thermoautotrophicum from base...    36   0.41    
pir|F71188|F71188 probable archaeal histon - Pyrococcus horikosh...    36   0.41    Pyrococcus horikoshii
sp|P50484|HMTB_METTH|HMTB_METTH DNA binding protein HMt-2 (Archaeal histone...    36   0.41    Methanothermobacter thermautotrophicus
sp|Q57632|HJA1_METJA|HJA1_METJA Probable archaeal histone 1.>pir|A64321|A64...    36   0.41    Methanocaldococcus jannaschii
sp|Q9Y8I2|HARB_PYRKO|HARB_PYRKO Archaeal histone B (Archaeal histone A2).>g...    36   0.41    
sp|O74098|HARA_PYRHO|HARA_PYRHO Archaeal histone A (Archaeal histone A1).         36   0.41    Pyrococcus horikoshii
sp|Q58342|HJA2_METJA|HJA2_METJA Probable archaeal histone 2.>pir|D64416|D64...    35   0.53    Methanocaldococcus jannaschii
gb:MFU12930_143399 Methanobacterium formicicum archaeal histone ...    35   0.69    
sp|P48782|HFO1_METFO|HFO1_METFO Archaeal histone A1.                              35   0.69    Methanobacterium formicicum
gb:CR382127_1660239 Yarrowia lipolytica chromosome A of strain C...    35   0.90    
sp|Q60264|HJA4_METJA|HJA4_METJA Probable archaeal histone 4.>pir|D64513|D64...    34   1.2     Methanocaldococcus jannaschii
pir|S71485|S71485 histone-like protein HAN1 chain A1 - Thermococ...    34   1.5     Thermococcus zilligii
sp|P95669|HANA_THEZI|HANA_THEZI Archaeal histone HAN1 subunit A.                  34   1.5     Thermococcus zilligii
gb:PSU08838_161788 Pyrococcus GB-3a archaeal histone gene clones...    33   2.0     
gb:MFU12931_143400 Methanobacterium formicicum archaeal histone ...    33   2.0     
gb:CP000032_88288 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...    33   2.0     
sp|P48783|HFO2_METFO|HFO2_METFO Archaeal histone A2.                              33   2.0     Methanobacterium formicicum
sp|P50486|HARB_PYRSG|HARB_PYRSG Archaeal histone B (Archaeal histone A2).         33   2.0     Pyrococcus sp.
gb:XELHIS4A2_2581882 X.laevis histone H4-1 gene, 3' end.               33   2.6     
gb:BC083370_2563198 Danio rerio zgc:103421, mRNA (cDNA clone MGC...    33   2.6     
gb:AE017199_403114 Nanoarchaeum equitans Kin4-M, complete genome.      33   2.6     
gb:AE013419_292155 Methanosarcina mazei strain Goe1, section 201...    33   2.6     
gb:AE010728_266048 Methanosarcina acetivorans str. C2A, section ...    33   2.6     
gb:AB013081_2130 Pyrococcus furiosus gene for archaeal histone, ...    33   2.6     
pir|I51432|I51432 histone H4-1 precursor - African clawed frog (...    33   2.6     Xenopus laevis [clawed frog]
sp|O59627|HARB_PYRFU|HARB_PYRFU Archaeal histone B (Archaeal histone A2).>g...    33   2.6     Pyrococcus furiosus
gb:AJ632079_528840 Methanococcus voltae hstA gene for histone HstA.    33   3.4     
pir|A47036|A47036 histone-related protein HMf1 - Methanothermus ...    32   4.5     Methanothermus fervidus
sp|P48781|HMFA_METFE|HMFA_METFE DNA binding protein HMf-1 (Archaeal histone...    32   4.5     Methanothermus fervidus
sp|P19267|HMFB_METFE|HMFB_METFE DNA binding protein HMf-2 (Archaeal histone...    32   5.9     Methanothermus fervidus
gb:BX957222_844600 Methanococcus maripaludis S2 complete genome;...    32   7.6     
pir|H71177|H71177 probable archaeal histon - Pyrococcus horikosh...    32   7.6     Pyrococcus horikoshii
sp|Q58655|HJA3_METJA|HJA3_METJA Probable archaeal histone 3.>pir|A64457|A64...    32   7.6     Methanocaldococcus jannaschii
sp|O74092|HARB_PYRHO|HARB_PYRHO Archaeal histone B (Archaeal histone A2).         32   7.6     Pyrococcus horikoshii
sp|O29910|HAF1_ARCFU|HAF1_ARCFU Probable archaeal histone A1-1.>pir|A69292|...    32   7.6     Archaeoglobus fulgidus
gb:AE016818_1748156 Ashbya gossypii (= Eremothecium gossypii) AT...    31   10.0    
gb:POH4G_1395533 Sea star histone H4 gene 5'region.                    31   10.0    
pir|A29663|A29663 histone H4 - starfish (Pisaster ochraceus) (fr...    31   10.0    Pisaster ochraceus [ochre sea star]


>gb:AY389648_1178272 Hyacinthus orientalis histone H4 mRNA, complete
           cds.
          Length = 103

 Score =  162 bits (410), Expect = 3e-39
 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|A24967|HSWT41 histone H4 (TH091) - wheat>gb:WHTH4091_1727656
           Wheat histone H4 TH091 gene, complete cds.
          Length = 103

 Score =  162 bits (410), Expect = 3e-39
 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|S60475|HSPM4 histone H4 - garden pea>pir|A25642|HSZM4 histone
           H4 - maize>pir|E84688|E84688 histone H4 - Arabidopsis
           thaliana>pir|S06904|S06904 histone H4 - Arabidopsis
           thaliana>gb:AE005172_889775 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AE005172_889792 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AE016959_1023653 Oryza sativa (japonica
           cultivar-group) chromosome 10, complete
           sequence.>gb:AB006705_1510000 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MTH12.>gb:AB015475_1512589 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MMN10.>gb:AB018245_1513927 Solanum melongena EEF38
           mRNA for histone H4-like protein, complete
           cds.>gb:AB102686_1526332 Silene latifolia SlH4 mRNA for
           histone H4, complete cds.>gb:AB197150_1529704 Fragaria x
           ananassa mRNA for histone H4, partial
           cds.>gb:AC005727_1532965 Arabidopsis thaliana chromosome
           2 clone F8N16 map mi54, complete
           sequence.>gb:AC007184_1535490 Arabidopsis thaliana
           chromosome 2 clone T11P11 map mi54, complete
           sequence.>gb:AC073166_1540970 Oryza sativa chromosome 10
           BAC OSJNBb0064P21 genomic sequence, complete
           sequence.>gb:ATF16L2_1548830 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F16L2.>gb:ATF18L15_1549160
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           F18L15.>gb:ATF5K20_1550777 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F5K20.>gb:ATHH4GA_1553223
           A.thaliana histone H4 gene, complete
           cds.>gb:ATHH4GB_1553224 A.thaliana histone H4 gene,
           complete cds.>gb:AY057609_1564022 Arabidopsis thaliana
           AT5g59690/mth12_90 mRNA, complete
           cds.>gb:AY062717_1565373 Arabidopsis thaliana histone
           H4-like protein (At3g46320; F18L15.40) mRNA, complete
           cds.>gb:AY063857_1565805 Arabidopsis thaliana putative
           histone H4 protein (At2g28740) mRNA, complete
           cds.>gb:AY085175_1570254 Arabidopsis thaliana clone
           13571 mRNA, complete sequence.>gb:AY085495_1570564
           Arabidopsis thaliana clone 15418 mRNA, complete
           sequence.>gb:AY085965_1571026 Arabidopsis thaliana clone
           20260 mRNA, complete sequence.>gb:AY086185_1571240
           Arabidopsis thaliana clone 22146 mRNA, complete
           sequence.>gb:AY086789_1571832 Arabidopsis thaliana clone
           27686 mRNA, complete sequence.>gb:AY087061_1572097
           Arabidopsis thaliana clone 31173 mRNA, complete
           sequence.>gb:AY087188_1572222 Arabidopsis thaliana clone
           32642 mRNA, complete sequence.>gb:AY093353_1575307
           Arabidopsis thaliana histone H4-like protein (At3g46320)
           mRNA, complete cds.>gb:AY099675_1576700 Arabidopsis
           thaliana histone H4-like protein (At3g53730) mRNA,
           complete cds.>gb:AY124836_1580201 Arabidopsis thaliana
           AT5g59690/mth12_90 mRNA, complete
           cds.>gb:AY128855_1580935 Arabidopsis thaliana histone
           H4-like protein (At3g53730) mRNA, complete
           cds.>gb:AY142651_1583067 Arabidopsis thaliana putative
           histone H4 protein (At2g28740) mRNA, complete
           cds.>gb:AY263810_1593795 Eucalyptus globulus histone H4
           mRNA, complete cds.>gb:AY594659_1616704 Chelidonium
           majus histone H4 (H4) mRNA, complete
           cds.>gb:BT003931_1637056 Arabidopsis thaliana clone
           RAFL15-21-O07 (R20714) putative histone H4 protein
           (At5g59970) mRNA, complete cds.>gb:BT004744_1637778
           Arabidopsis thaliana At1g07820 gene, complete
           cds.>gb:BT004970_1637916 Arabidopsis thaliana clone
           U20714 putative histone H4 protein (At5g59970) mRNA,
           complete cds.>gb:F24B9_1677964 Arabidopsis thaliana
           chromosome 1 BAC F24B9 sequence, complete
           sequence.>gb:F24B9_1677981 Arabidopsis thaliana
           chromosome 1 BAC F24B9 sequence, complete
           sequence.>gb:FTR18575_1679467 Flaveria trinervia mRNA
           for histone H4, clone FtHH4.>gb:MZEH4A_1687926 Corn
           histone H4 (H4C13) gene, complete
           cds.>gb:MZEH4C14_1687927 Maize (Zea mays) histone H4
           gene (H4C14), complete cds.>gb:MZEH4C7_1687928 Maize
           (Zea mays) histone H4 gene (H4C7), complete
           cds.>gb:OSJN00188_1696442 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0088A01, complete
           sequence.>gb:PSU10042_1702455 Pisum sativum histone H4
           homolog mRNA, complete cds.>gb:SRH42_1722403 S.rostrata
           mRNA coding for histone H4 homologue.>gb:TAHI01_1724565
           Wheat histone H4 gene.>gb:AC096782_1736346 Oryza sativa
           chromosome 10 BAC OSJNBa0025B05 genomic sequence,
           complete sequence.>gb:AC108500_1738475 Oryza sativa
           (japonica cultivar-group) chromosome 5 clone OJ1280_A04,
           complete sequence.>gb:AC108503_1738531 Oryza sativa
           (japonica cultivar-group) chromosome 5 clone OJ1387_F08,
           complete sequence.>gb:AC108876_1738633 Oryza sativa
           (japonica cultivar-group) chromosome 5 clone OJ1525_A02,
           complete sequence.>gb:AC118980_1739572 Oryza sativa
           (japonica cultivar-group) chromosome 3 clone OJ1263H11,
           complete sequence.>gb:AC121361_1740124 Oryza sativa
           (japonica cultivar-group) chromosome 5 clone
           OSJNBa0009E21, complete sequence.>gb:AE017116_1753472
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 70 of 77 of the complete
           sequence.>gb:AF325058_1786512 Arabidopsis thaliana
           AT5g59690 (AT5g59690/mth12_90) mRNA, complete
           cds.>gb:AF334729_1787469 Arabidopsis thaliana clone
           C00146 (f) putative histone H4 protein (At1g07660) mRNA,
           complete cds.>gb:AK175513_1817501 Arabidopsis thaliana
           mRNA for histone H4, complete cds, clone:
           RAFL21-93-L22.>gb:AK175843_1817831 Arabidopsis thaliana
           mRNA for histone H4, complete cds, clone:
           RAFL22-45-K19.>gb:AK176147_1818135 Arabidopsis thaliana
           mRNA for histone H4, complete cds, clone:
           RAFL22-96-L13.>gb:AP003271_1826901 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0506B12.>gb:AP004071_1837255 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1717_A09.>gb:AP004255_1839197 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1212_A08.>gb:AP004401_1841238 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0534A03.>gb:AP005551_1853945 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1081_G10.
          Length = 103

 Score =  162 bits (410), Expect = 3e-39
 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>sp|P59259|H4_ARATH Histone H4.>sp|P59258|H4_WHEAT Histone
           H4.>pir|A02645|HSWT4 histone H4 - wheat
          Length = 102

 Score =  162 bits (410), Expect = 3e-39
 Identities = 82/82 (100%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>sp|P82888|H4_OLILU Histone H4.
          Length = 102

 Score =  162 bits (409), Expect = 4e-39
 Identities = 81/82 (98%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHARRKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHARRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>gb:SRH41_1722402 S.rostrata mRNA coding for Histone H4 homologue.
          Length = 103

 Score =  161 bits (407), Expect = 6e-39
 Identities = 81/82 (98%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLA+RGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLAKRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|S32769|S32769 histone H4 - tomato>gb:AY346459_1601037 Solanum
           chacoense histone H4 mRNA, complete
           cds.>gb:LEHH4AA_1684334 L.esculentum mRNA for histone H4
           (520 bp).>gb:LEHH4AB_1684335 L.esculentum mRNA for
           histone H4 (458 bp).>gb:AF038387_1763272 Capsicum annuum
           histone H4 mRNA, complete cds.
          Length = 103

 Score =  161 bits (407), Expect = 6e-39
 Identities = 81/82 (98%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD+VTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>sp|P35057|H4_LYCES Histone H4.
          Length = 102

 Score =  161 bits (407), Expect = 6e-39
 Identities = 81/82 (98%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD+VTYTEHARRKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHARRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>gb:BC058529_2103302 Mus musculus histone 1, H4h, mRNA (cDNA clone
           IMAGE:6817839), partial cds.
          Length = 105

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 24  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 83

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 84  VTAMDVVYALKRQGRTLYGFGG 105



>gb:BC028550_2096260 Mus musculus histone 1, H4h, mRNA (cDNA clone
           IMAGE:1398106), partial cds.
          Length = 107

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 26  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 85

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 86  VTAMDVVYALKRQGRTLYGFGG 107



>gb:BC019757_2093088 Mus musculus histone 1, H4i, mRNA (cDNA clone
           IMAGE:4205460), partial cds.
          Length = 112

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 31  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 90

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 91  VTAMDVVYALKRQGRTLYGFGG 112



>gb:AY267751_1314544 Mytilus chilensis histone H4 (H4) gene,
           complete cds.
          Length = 103

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:AF140034_1244287 Phreatamoeba balamuthi histone H4 mRNA,
           complete cds.
          Length = 108

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRD+VTYTEHARRKT
Sbjct: 27  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEHARRKT 86

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 87  VTAMDVVYALKRQGRTLYGFGG 108



>pir|D40335|HSHU4 histone H4 [validated] - human>pir|A91265|HSRT4
           histone H4 - rat>pir|A02641|HSXL4 histone H4 - African
           clawed frog>pir|S11312|S11312 histone H4 - polychaete
           (Platynereis dumerilii)>pir|D56618|D56618 histone H4 -
           spoonworm (Urechis caupo)>pir|S21367|S21367 histone H4 -
           Nile tilapia>pir|JH0507|JH0507 histone H4.III and H4.IV
           - chicken>pir|I51433|I51433 histone H4 - Kenyan clawed
           frog>pir|I50459|I50459 H4 histone - muscovy
           duck>pir|S03426|S03426 histone H4 -
           mouse>gb:AK007642_1154105 Mus musculus 10 day old male
           pancreas cDNA, RIKEN full-length enriched library,
           clone:1810029H14 product:histone 4 protein, full insert
           sequence.>gb:CR858191_1182378 Pongo pygmaeus mRNA; cDNA
           DKFZp469B0137 (from clone
           DKFZp469B0137).>gb:AY267739_1314528 Mytilus
           galloprovincialis histone H4 (H4), histone H2B (H2B),
           histone H2A (H2A), histone H3 (H3), and histone H1 (H1)
           genes, complete cds; and 5S ribosomal RNA and 5S
           ribosomal RNA genes, complete
           sequence.>gb:AY267750_1314543 Mytilus galloprovincialis
           histone H4 (H4) gene, complete cds.>gb:AY267752_1314545
           Mytilus californianus histone H4 (H4) gene, complete
           cds.>gb:AY267753_1314546 Mytilus trossulus histone H4
           (H4) gene, complete cds.>gb:AY267754_1314547 Mytilus
           edulis histone H4 (H4) gene, complete
           cds.>gb:CVHIST2_1376006 Chaetopterus variopedatus
           histone H4 and histone H2A genes, complete
           cds.>gb:MED492923_1389574 Mytilus edulis h4 gene, h2B
           gene, h2A gene and h3 gene, cluster
           UW06.>gb:MED492924_1389578 Mytilus edulis h4 gene, h2B
           gene, h2A gene and h3 gene, cluster
           UW15.>gb:MED492925_1389582 Mytilus edulis h4 gene for
           histone H4 and h3 gene for histone H3, cluster
           UW27.>gb:PDHISTCL_1391869 P.dumerilii histone gene
           cluster for core histones H2A, H2B, H3 and
           H4.>gb:UCHISTO_1407308 U.caupo gene for H2A, H2B, H3,
           and H4 histones.>gb:AF001288_1411184 Bos taurus histone
           H4.1 mRNA, complete cds.>gb:AB000905_1863539 Homo
           sapiens DNA for H4 histone, complete
           cds.>gb:AF525682_1905999 Homo sapiens histone H4
           (HIST2H4) gene, complete cds.>gb:AL353759_1923074 Human
           DNA sequence from clone RP1-221C16 on chromosome 6
           Contains the 3' part of the HFE gene for
           haemochromatosis protein, two genes for novel histone 4
           family members, two genes for novel histone 1 family
           members, three genes for novel histone 2B family
           members, a gene for a novel histone 2A family member, a
           novel pseudogene, STSs, GSSs, ESTs and CpG islands,
           complete sequence.>gb:AL591493_1930087 Human DNA
           sequence from clone RP11-196G18 on chromosome 1 Contains
           a ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog,
           yeast) (UBE2D1) pseudogene, the FCGR1A gene for Fc
           fragment of IgG, high affinity Ia, receptor for (CD64),
           a novel gene similar to histone 2, H2be (HIST2H2BE), a
           novel gene similar to histone 2, H3c (HIST2H3C), the
           HIST2H4 gene for histone 2, H4, the HIST2H3C gene for
           histone 2, H3c, the HIST2H2AA gene for histone 2, H2aa,
           a histone 2, H2bd pseudogene (HIST2H2BD), a histone 2,
           H2bc pseudogene (HIST2H2BC), a novel gene similar to
           histone 2, H2aa (HIST2H2AA), a novel gene similar to
           histone 2, H3c (HIST2H3C), a novel gene similar to
           histone 1, H4 (HIST2H4), the HIST2H2BE gene for histone
           2, H2be, the HIST2H2AC gene for histone 2, H2ac, the
           HIST2H2AB gene for histone 2, H2ab, a novel protein
           similar to histone 2, a novel gene, the SV2A gene for
           synaptic vesicle glycoprotein 2A, the 3' end of the
           SF3B4 gene for splicing factor 3b, subunit 4, 49kDa and
           five CpG islands, complete sequence.>gb:AL591493_1930094
           Human DNA sequence from clone RP11-196G18 on chromosome
           1 Contains a ubiquitin-conjugating enzyme E2D 1 (UBC4/5
           homolog, yeast) (UBE2D1) pseudogene, the FCGR1A gene for
           Fc fragment of IgG, high affinity Ia, receptor for
           (CD64), a novel gene similar to histone 2, H2be
           (HIST2H2BE), a novel gene similar to histone 2, H3c
           (HIST2H3C), the HIST2H4 gene for histone 2, H4, the
           HIST2H3C gene for histone 2, H3c, the HIST2H2AA gene for
           histone 2, H2aa, a histone 2, H2bd pseudogene
           (HIST2H2BD), a histone 2, H2bc pseudogene (HIST2H2BC), a
           novel gene similar to histone 2, H2aa (HIST2H2AA), a
           novel gene similar to histone 2, H3c (HIST2H3C), a novel
           gene similar to histone 1, H4 (HIST2H4), the HIST2H2BE
           gene for histone 2, H2be, the HIST2H2AC gene for histone
           2, H2ac, the HIST2H2AB gene for histone 2, H2ab, a novel
           protein similar to histone 2, a novel gene, the SV2A
           gene for synaptic vesicle glycoprotein 2A, the 3' end of
           the SF3B4 gene for splicing factor 3b, subunit 4, 49kDa
           and five CpG islands, complete
           sequence.>gb:AY128653_1936744 Homo sapiens clone HIST4H4
           histone H4 gene, complete cds.>gb:AY128654_1936745 Homo
           sapiens clone HIST1H4A histone H4 gene, complete
           cds.>gb:AY128655_1936746 Homo sapiens clone HIST1H4B
           histone H4 gene, complete cds.>gb:AY128656_1936747 Homo
           sapiens clone HIST1H4C histone H4 gene, complete
           cds.>gb:AY128657_1936748 Homo sapiens clone HIST1H4D
           histone H4 gene, complete cds.>gb:AY128658_1936749 Homo
           sapiens clone HIST1H4E histone H4 gene, complete
           cds.>gb:AY128659_1936750 Homo sapiens clone HIST1H4F
           histone H4 gene, complete cds.>gb:AY128661_1936752 Homo
           sapiens clone HIST1H4H histone H4 gene, complete
           cds.>gb:AY128662_1936753 Homo sapiens clone HIST1H4I
           histone H4 gene, complete cds.>gb:AY128663_1936754 Homo
           sapiens clone HIST1H4J histone H4 gene, complete
           cds.>gb:AY128664_1936755 Homo sapiens clone HIST1H4K
           histone H4 gene, complete cds.>gb:AY128665_1936756 Homo
           sapiens clone HIST1H4L histone H4 gene, complete
           cds.>gb:AY648850_1958224 Homo sapiens histone H4/o gene,
           complete cds.>gb:BC010926_1972846 Homo sapiens histone
           1, H4h, mRNA (cDNA clone MGC:13512 IMAGE:4273904),
           complete cds.>gb:BC012587_1973691 Homo sapiens histone
           1, H4e, mRNA (cDNA clone MGC:13511 IMAGE:4272520),
           complete cds.>gb:BC016336_1975549 Homo sapiens histone
           1, H4i, mRNA (cDNA clone MGC:24014 IMAGE:4101102),
           complete cds.>gb:BC017361_1976068 Homo sapiens cDNA
           clone MGC:29783 IMAGE:4647914, complete
           cds.>gb:BC020884_1977270 Homo sapiens histone 4, H4,
           mRNA (cDNA clone MGC:24116 IMAGE:4619662), complete
           cds.>gb:BC050615_1984433 Homo sapiens histone 1, H4e,
           mRNA (cDNA clone MGC:60077 IMAGE:5223627), complete
           cds.>gb:BC054014_1985137 Homo sapiens cDNA clone
           MGC:61831 IMAGE:6499185, complete
           cds.>gb:BC066248_1986999 Homo sapiens histone 1, H4a,
           mRNA (cDNA clone MGC:79349 IMAGE:7002088), complete
           cds.>gb:BC066249_1987000 Homo sapiens histone 1, H4a,
           mRNA (cDNA clone MGC:79350 IMAGE:7002089), complete
           cds.>gb:BC066250_1987001 Homo sapiens cDNA clone
           MGC:79353 IMAGE:7002105, complete
           cds.>gb:BC067495_1987395 Homo sapiens cDNA clone
           MGC:79351 IMAGE:7002090, complete
           cds.>gb:BC067497_1987397 Homo sapiens cDNA clone
           MGC:79354 IMAGE:7002106, complete
           cds.>gb:BC069288_1987902 Homo sapiens histone 1, H4f,
           mRNA (cDNA clone MGC:97393 IMAGE:7262669), complete
           cds.>gb:BC069392_1988000 Homo sapiens cDNA clone
           MGC:97405 IMAGE:7262681, complete
           cds.>gb:BC069467_1988071 Homo sapiens cDNA clone
           MGC:97440 IMAGE:7262716, complete
           cds.>gb:BC069654_1988252 Homo sapiens cDNA clone
           MGC:97476 IMAGE:7262752, complete
           cds.>gb:BC075806_1989610 Homo sapiens cDNA clone
           MGC:87855 IMAGE:5225467, complete
           cds.>gb:CR542169_1994395 Homo sapiens full open reading
           frame cDNA clone RZPDo834D0724D for gene HIST1H4H,
           histone 1, H4h; complete cds, incl.
           stopcodon.>gb:CR542172_1994398 Homo sapiens full open
           reading frame cDNA clone RZPDo834C0824D for gene
           HIST2H4, histone 2, H4; complete cds, incl.
           stopcodon.>gb:CR542180_1994406 Homo sapiens full open
           reading frame cDNA clone RZPDo834B1224D for gene
           HIST1H4F, histone 1, H4f; complete cds, incl.
           stopcodon.>gb:CR542187_1994413 Homo sapiens full open
           reading frame cDNA clone RZPDo834H0424D for gene
           HIST1H4H, histone 1, H4h; complete cds, without
           stopcodon.>gb:HS193B12_1997388 Human DNA sequence from
           clone RP1-193B12 on chromosome 6p21.3-22.3 Contains the
           H2AFD, H2BFD, H2AFI, H1F5, H3FF, H4FK, H3FJ, H2AFN, and
           H2BFN histone genes, the OR2B2 gene for olfactory
           receptor 2B2, histone H2B family member I pseudogene
           H2BFIP, a hypothetical protein pseudogene, ESTs, STSs,
           GSSs and CpG islands, complete
           sequence.>gb:HS34B20_1998232 Human DNA sequence from
           clone RP1-34B20 on chromosome 6p21.31-22.2 Contains
           seventeen histone (pseudo)genes and gene RPS10P1 (40S
           Ribosomal protein S10 pseudogene 1), three CpG islands,
           ESTs, STSs and GSSs, complete
           sequence.>gb:HS34B20_1998238 Human DNA sequence from
           clone RP1-34B20 on chromosome 6p21.31-22.2 Contains
           seventeen histone (pseudo)genes and gene RPS10P1 (40S
           Ribosomal protein S10 pseudogene 1), three CpG islands,
           ESTs, STSs and GSSs, complete
           sequence.>gb:HS45P21_1998749 Human DNA sequence from
           clone RP1-45P21 on chromosome 6p21.3-22.2 Contains the
           H4FA gene for H4 histone family member A, a histone H3
           pseudogene, the BTN3A2, BTN2A2, BTN3A1, BTN2A3 and
           BTN3A3 genes for butyrophilins 3A1, 2 and 3 and 2A2 and
           3. Contains ESTs, STSs, GSSs and CpG islands, complete
           sequence.>gb:HS86C11_1999632 Human DNA sequence from
           clone RP1-86C11 on chromosome 6p21.31-22.1 Contains a
           vomeronasal olfactory 1 receptor chromosome 6-2
           (VN1R6-2P) pseudogene, histone genes H2BFN and H2AFA,
           the gene for a novel protein identical to H2B histone
           family member A (H2BFA), the gene for a novel protein
           identical to H2A histone family member I (H2AFI), a
           novel histone gene similar to H4F2 and three CpG
           islands, complete sequence.>gb:HSH4AHIS_2013666
           H.sapiens H4/a gene for H4 histone.>gb:HSH4BHIS_2013667
           H.sapiens H4/b gene for H4 histone.>gb:HSH4DHIS_2013668
           H.sapiens H4/d gene for H4 histone.>gb:HSH4EHIS_2013670
           H.sapiens H4/e gene for H4 histone.>gb:HSH4GHIS_2013672
           H.sapiens H4/g gene for H4 histone.>gb:HSH4HHIS_2013673
           H.sapiens H4/h gene for H4 histone.>gb:HSH4HIST_2013674
           H.sapiens histone H4 gene.>gb:HSH4J_2013675 H.sapiens
           H4/j gene.>gb:HSHISTN4_2013825 H.sapiens gene for
           histone H4.>gb:HSJ160A22_2015791 Human DNA sequence from
           clone RP1-160A22 on chromosome 6p21.2-22.2 Contains
           histone genes H2AFE, H2BFE, H4FE and H4FD, ESTs, STSs,
           GSSs and three CpG islands, complete
           sequence.>gb:HSJ160A22_2015792 Human DNA sequence from
           clone RP1-160A22 on chromosome 6p21.2-22.2 Contains
           histone genes H2AFE, H2BFE, H4FE and H4FD, ESTs, STSs,
           GSSs and three CpG islands, complete
           sequence.>gb:HUMHIS4_2031939 Human histone H4 gene,
           complete cds, clone FO108.>gb:HUMHISAD_2031943 Human
           histone H4 (H4) gene, complete cds.>gb:AL589651_2070358
           Mouse DNA sequence from clone RP23-138F20 on chromosome
           13 Contains five genes for olfactory receptors, a novel
           gene, the H1f5 gene for H1 histone family member 5,
           three genes and one pseudogene for H2a histone family
           members, four genes for H2b, two genes for H4, and two
           genes for H3 histone family members and seven CpG
           islands, complete sequence.>gb:AL589651_2070359 Mouse
           DNA sequence from clone RP23-138F20 on chromosome 13
           Contains five genes for olfactory receptors, a novel
           gene, the H1f5 gene for H1 histone family member 5,
           three genes and one pseudogene for H2a histone family
           members, four genes for H2b, two genes for H4, and two
           genes for H3 histone family members and seven CpG
           islands, complete sequence.>gb:AL589879_2070409 Mouse
           DNA sequence from clone RP23-38E20 on chromosome 13
           Contains the genes for H2b histone family member A, two
           H2a, two H4 and an H2b histone family member, a
           serine/threonine protein kinase pseudogene, a novel
           pseudogene, a novel gene (4930500C15Rik), the gene for a
           novel KRAB box and C2H2 Zinc Finger containing protein,
           a ribosomal protein L21 (RPL21) pseudogene, a TU
           mitochondrial translation elongation factor (tufa)
           pseudogene, the 5' end of the gene for a novel protein
           similar to nuclear envelope pore membrane protein POM121
           and four CpG islands, complete
           sequence.>gb:AL589879_2070410 Mouse DNA sequence from
           clone RP23-38E20 on chromosome 13 Contains the genes for
           H2b histone family member A, two H2a, two H4 and an H2b
           histone family member, a serine/threonine protein kinase
           pseudogene, a novel pseudogene, a novel gene
           (4930500C15Rik), the gene for a novel KRAB box and C2H2
           Zinc Finger containing protein, a ribosomal protein L21
           (RPL21) pseudogene, a TU mitochondrial translation
           elongation factor (tufa) pseudogene, the 5' end of the
           gene for a novel protein similar to nuclear envelope
           pore membrane protein POM121 and four CpG islands,
           complete sequence.>gb:AL590388_2070429 Mouse DNA
           sequence from clone RP23-480B19 on chromosome 13
           Contains the Slc17a1 gene for solute carrier family 17
           (vesicular glutamate transporter) member 1, two genes
           for novel solute carrier family 17 (Slc17) members, two
           novel genes, the gene for a novel C3HC4 type zinc finger
           (ring finger) protein, the gene for an H2a, an H2b, two
           genes for H3 and two genes for H4 histone family
           members, a H2a histone family pseudogene, the H1f1 and
           H1f2 genes for H1 histone family members 1 and 2, the
           H3f2 gene for H3 histone family, member 2 (H3.2), a
           novel pseudogene, the Hfe gene for hemochromatosis
           protein (Mr2) and two CpG islands, complete
           sequence.>gb:AL590388_2070430 Mouse DNA sequence from
           clone RP23-480B19 on chromosome 13 Contains the Slc17a1
           gene for solute carrier family 17 (vesicular glutamate
           transporter) member 1, two genes for novel solute
           carrier family 17 (Slc17) members, two novel genes, the
           gene for a novel C3HC4 type zinc finger (ring finger)
           protein, the gene for an H2a, an H2b, two genes for H3
           and two genes for H4 histone family members, a H2a
           histone family pseudogene, the H1f1 and H1f2 genes for
           H1 histone family members 1 and 2, the H3f2 gene for H3
           histone family, member 2 (H3.2), a novel pseudogene, the
           Hfe gene for hemochromatosis protein (Mr2) and two CpG
           islands, complete sequence.>gb:AL590614_2070454 Mouse
           DNA sequence from clone RP23-9O16 on chromosome 13
           Contains the 3' end of the gene for a novel protein
           similar to nuclear envelope pore membrane protein
           POM121, the Prss16 gene for thymus serine protease16,
           three novel genes, the genes for two H2a, two H2b and
           one H4 histone family members, a ribosomal protein L37A
           (Rpl37a) pseudogene, a novel pseudogene, three genes for
           novel vomeronasal 1 receptor H (V1rh) family members,
           the gene for a novel vomeronasal 1 receptor I (V1ri)
           family member, six V1ri pseudogenes, a V1rh pseudogene
           and six CpG islands, complete
           sequence.>gb:AL592149_2070664 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AL592149_2070669 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AL592149_2070677 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AL592149_2070684 Mouse DNA sequence from
           clone RP23-283N14 on chromosome 13 Contains a novel
           gene, the genes for three H1, four H2a, five H2b, four
           H3 and four H4 histone family members, the 3' end of a
           variant of the Hfe gene for hemochromatosis protein
           (Mr2) and ten CpG islands, complete
           sequence.>gb:AY158956_2077140 Mus musculus histone
           protein Hist1h4j gene, complete cds.>gb:AY158957_2077141
           Mus musculus histone protein Hist1h4k gene, complete
           cds.>gb:AY158958_2077142 Mus musculus histone protein
           Hist1h4m gene, complete cds.>gb:AY158959_2077143 Mus
           musculus histone protein Hist1h4i gene, complete
           cds.>gb:AY158960_2077144 Mus musculus histone protein
           Hist1h4h gene, complete cds.>gb:AY158961_2077145 Mus
           musculus histone protein Hist1h4f gene, complete
           cds.>gb:AY158962_2077146 Mus musculus histone protein
           Hist1h4d gene, complete cds.>gb:AY158963_2077147 Mus
           musculus histone protein Hist1h4c gene, complete
           cds.>gb:AY158964_2077148 Mus musculus histone protein
           Hist1h4b gene, complete cds.>gb:AY158965_2077149 Mus
           musculus histone protein Hist1h4a gene, complete
           cds.>gb:AY158966_2077150 Mus musculus histone protein
           Hist2h4 gene, complete cds.>gb:AY158967_2077151 Mus
           musculus histone protein Hist4h4 gene, complete
           cds.>gb:BC052219_2101018 Mus musculus histone 1, H4i,
           mRNA (cDNA clone MGC:60536 IMAGE:30017176), complete
           cds.>gb:BC087952_2110278 Mus musculus cDNA clone
           MGC:107599 IMAGE:6787571, complete
           cds.>gb:MMHI01_2115270 Mouse gene encoding the mouse
           histone H4.>gb:MMHIS412_2115296 Mouse histone H4 gene
           (clone 12).>gb:MMHIST431_2115306 M.musculus genes
           encoding histone H4, histone H3 and histone
           H1.1.>gb:MMU62672_2122824 Mus musculus histone H3.1-D
           (H3-D) and histone H4-D (H4-D) genes, complete
           cds.>gb:RATH1TH4T_2132438 Rat testis-specific histone
           H1t and histone H4t, complete cds.>gb:RATHIS4G_2132482
           Rattus norvegicus histone H4 gene, complete
           cds.>gb:RNH4G_2134987 Rat H4 gene for somatic histone
           H4.>gb:XLA556873_2153927 Expression vector pET3-H4 H4
           gene for Xenopus laevis-like histone
           H4.>gb:BC078038_2560677 Xenopus laevis histone 1, H4l,
           mRNA (cDNA clone MGC:82777 IMAGE:5161621), complete
           cds.>gb:CHKHIST4A_2569106 Chicken histone H4 protein
           gene, complete cds.>gb:CHKHIST4B_2569107 Chicken histone
           H4 protein gene, complete cds.>gb:CMHIST34_2569887 Duck
           H3 and H4 histone genes.>gb:CMHIST34_2569890 Duck H3 and
           H4 histone genes.>gb:GGHIS1_2573188 Chicken duplicated
           genes for histone H2A, H4 and a histone H3
           gene.>gb:GGHIS1_2573192 Chicken duplicated genes for
           histone H2A, H4 and a histone H3
           gene.>gb:GGU37575_2573625 Gallus gallus histones H4-VI,
           H2B-VII and H4-VII genes, complete
           cds.>gb:GGU37575_2573627 Gallus gallus histones H4-VI,
           H2B-VII and H4-VII genes, complete
           cds.>gb:SGH4H2B_2579886 Rainbow trout histone H4 and H2B
           genes.>gb:TNHISTH4_2580729 T.nilotica gene for histone
           H4.>gb:XELHIS4B_2581883 Xenopus borealis h4 histone
           mRNA.>gb:XELHX1H1_2581915 X.laevis histone H1B, H2A,
           H2B, and H4 genes, complete cds, and histone H3 gene, 3'
           end, gene cluster Xlhl.>gb:XELHX1H1_2581920 X.laevis
           histone H1B, H2A, H2B, and H4 genes, complete cds, and
           histone H3 gene, 3' end, gene cluster
           Xlhl.>gb:XELHX1H3_2581925 X.laevis histone H1B, H2A,
           H2B, and H4 genes, complete cds, and histone H3 gene, 3'
           end, gene cluster X1h3.>gb:XLHIS4_2582859 Xenopus laevis
           H4 histone gene and flanking regions.>gb:XLHISH1_2582861
           Xenopus laevis histone gene cluster Xlh1 with genes H3,
           H4, H2B, H2A and H1B.>gb:XLHISH1_2582866 Xenopus laevis
           histone gene cluster Xlh1 with genes H3, H4, H2B, H2A
           and H1B.>gb:XLHISH3A_2582871 Xenopus laevis histone gene
           cluster XlH3-A with genes H1A, H2B, H3 and H4.
          Length = 103

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|S10098|HSFF4 histone H4 - fruit fly (Drosophila
           melanogaster)>pir|B56580|B56580 histone H4 - midge
           (Chironomus thummi thummi)>pir|S09656|S09656 histone H4
           - fruit fly (Drosophila hydei)>pir|B56654|B56654 histone
           H4 - Tigriopus californicus>gb:AE014134_1130044
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014297_1139565 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE014297_1139566
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1139567 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AAH4_1192452
           A.assectella mRNA for histone H4.>gb:AAQ238321_1192477
           Asellus aquaticus 5S rRNA gene, histone H2B, histone
           H2A, histone H3 and histone H4.>gb:AB055959_1196750
           Drosophila simulans H4, H2A, H2B, H1 genes for histone
           4, histone 2A, histone 2B, histone 1, complete
           cds.>gb:AB073634_1197476 Drosophila erecta H4, H2A, H2B,
           H1 genes for histone 4, histone 2A, histone 2B, histone
           1, complete cds.>gb:AB073635_1197480 Drosophila yakuba
           H4, H2A, H2B, H1 genes for histone 4, histone 2A,
           histone 2B, histone 1, complete cds,
           clone:Yak6.>gb:AB105179_1199605 Drosophila yakuba H4,
           H2A, H2B, H1 genes for histone 4, histone 2A, histone
           2B, histone 1, complete and partial cds,
           clone:yak8.>gb:AB105180_1199609 Drosophila teissieri H4,
           H2A, H2B, H1 genes for histone 4, histone 2A, histone
           2B, histone 1, complete and partial
           cds.>gb:AB105181_1199613 Drosophila orena H4, H2A, H2B,
           H1 genes for histone 4, histone 2A, histone 2B, histone
           1, complete cds.>gb:AB105182_1199617 Drosophila
           mauritiana H4, H2A, H2B, H1 genes for histone 4, histone
           2A, histone 2B, histone 1, complete
           cds.>gb:AB105184_1199625 Drosophila sechellia H4, H2A,
           H2B, H1 genes for histone 4, histone 2A, histone 2B,
           histone 1, complete and partial cds,
           clone:sech12.>gb:AB105185_1199629 Drosophila sechellia
           H4, H2A, H2B, H1 genes for histone 4, histone 2A,
           histone 2B, histone 1, complete cds,
           clone:sech27.>gb:AE003670_1220151 Drosophila
           melanogaster chromosome 2L, section 79 of 83 of the
           complete sequence.>gb:AE003705_1221558 Drosophila
           melanogaster chromosome 3R, section 43 of 118 of the
           complete sequence.>gb:AE003705_1221559 Drosophila
           melanogaster chromosome 3R, section 43 of 118 of the
           complete sequence.>gb:AE003705_1221560 Drosophila
           melanogaster chromosome 3R, section 43 of 118 of the
           complete sequence.>gb:AF378198_1266764 Rhynchosciara
           americana histone H1 (rah1), histone H3 (rah3), histone
           H4 (rah4), histone H2A (rah2a), and histone H2B (rah2b)
           genes, complete cds.>gb:BT001842_1356615 Drosophila
           melanogaster RH52884 full insert cDNA.>gb:CTHIS_1375868
           C.thummi genes for histones H1, H2A, H3 and
           H4.>gb:CTHIST_1375871 Chironomus thummi histone H1, H2A,
           H2B, H3, H4 genes with TFB1 insertion (foldback
           transposable element).>gb:DHHISH4_1377656 D.hydei mRNA
           for histone H4.>gb:DHHIST_1377659 D. HYDEI HISTONE
           GENES.>gb:DHHISTON_1377664 Drosophila hydei histone DNA
           repeat unit with genes for histones H1, H3, H4, H2A and
           H2B.>gb:DMH4R_1379579 D.melanogaster H4r
           gene.>gb:DMHISH4_1379593 D.melanogaster mRNA for histone
           H4.>gb:DMHISTL_1379599 Drosophila histone gene cluster,
           L form of repeating unit (5 kB).>gb:MRH4_1390098
           M.ruginodis mRNA for histone H4.>gb:TCH3H4_1399687
           Tigriopus californicus DNA for histone H3 and histone
           H4.>gb:TIGH1234A_1400301 Tigriopus californicus histone
           H1 gene, complete cds; histone H3 gene, complete cds;
           histone H4 gene, complete cds; histone H2B-1 gene,
           complete cds; and histone H2A gene, complete cds.
          Length = 103

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>sp|Q9U7D0|H4_MASBA Histone H4.
          Length = 107

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRD+VTYTEHARRKT
Sbjct: 26  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDSVTYTEHARRKT 85

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 86  VTAMDVVYALKRQGRTLYGFGG 107



>sp|P02304|H4_HUMAN Histone H4.>pir|A24552|HSTR4 histone H4 -
           rainbow trout>pir|A92050|HSBO4 histone H4 -
           bovine>pir|A02640|HSCH4 histone H4 -
           chicken>pir|A02638|HSPG4 histone H4 - pig
          Length = 102

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>sp|P02307|H4_DROME Histone H4.
          Length = 102

 Score =  160 bits (406), Expect = 8e-39
 Identities = 80/82 (97%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>gb:AB183301_1529281 Lactuca sativa LetH4 mRNA for histone H4,
           partial cds.
          Length = 103

 Score =  160 bits (405), Expect = 1e-38
 Identities = 81/82 (98%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAV YTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVAYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:ACPH342BA_1208274 Acropora formosa histone H3 (H3), histone H2B
           (H2B), histone H2A (H2A), and histone H4 (H4) genes,
           complete cds.>gb:DKLY18815_1377791 Dendronephthya
           klunzingeri mRNA for histone 4.>gb:S67324_1396758
           histone gene cluster: histone H3...histone H4 [Acropora
           formosa=coral, sperms, Genomic, 4 genes, 3764 nt].
          Length = 103

 Score =  160 bits (405), Expect = 1e-38
 Identities = 79/82 (96%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>sp|P35059|H4_ACRFO Histone H4.
          Length = 102

 Score =  160 bits (405), Expect = 1e-38
 Identities = 79/82 (96%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 21  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>gb:ZMHIS4DNA_1731882 Z.mays histone H4 gene.
          Length = 103

 Score =  160 bits (404), Expect = 1e-38
 Identities = 81/82 (98%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV KIFLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVRKIFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:LTMRHISH4_1685418 L.temulentum mRNA for histone H4.
          Length = 103

 Score =  160 bits (404), Expect = 1e-38
 Identities = 81/82 (98%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHA RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHAXRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:AB050889_1521043 Citrus jambhiri mRNA for histone H4, partial
           cds.
          Length = 102

 Score =  160 bits (404), Expect = 1e-38
 Identities = 81/81 (100%), Positives = 81/81 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VTAMDVVYALKRQGRTLYGFG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFG 102



>gb:BT015217_1358294 Drosophila melanogaster RE42129 full insert
           cDNA.
          Length = 103

 Score =  160 bits (404), Expect = 1e-38
 Identities = 80/82 (97%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAERKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:PSHISTH4_1702175 P.salina histone H4 gene.
          Length = 103

 Score =  159 bits (403), Expect = 2e-38
 Identities = 80/82 (97%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK+FLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRSVLKVFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:ODI494855_1391118 Oikopleura dioica partial mRNA for histone h4
           (H4 gene).
          Length = 102

 Score =  159 bits (403), Expect = 2e-38
 Identities = 79/82 (96%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTA+DVVYALKRQGRTLYGFGG
Sbjct: 81  VTALDVVYALKRQGRTLYGFGG 102



>pir|JN0688|JN0688 histone H4 - sea squirt (Styela
           plicata)>gb:AJ626748_1283581 Oikopleura dioica mRNA for
           histone H4.2.>gb:AJ626749_1283582 Oikopleura dioica mRNA
           for histone H4.3.>gb:AJ626750_1283583 Oikopleura dioica
           mRNA for histone H4.4.>gb:AJ626751_1283584 Oikopleura
           dioica mRNA for histone H4.5.>gb:ODI494848_1391109
           Oikopleura dioica H3.1 gene, H4.1 gene, H1.1 gene, and
           H2A.1 gene.>gb:S64499_1396693 Styela plicata H3 histone
           and H4 histone genes, complete cds.
          Length = 103

 Score =  159 bits (403), Expect = 2e-38
 Identities = 79/82 (96%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTA+DVVYALKRQGRTLYGFGG
Sbjct: 82  VTALDVVYALKRQGRTLYGFGG 103



>gb:BC067496_1987396 Homo sapiens cDNA clone MGC:79352
           IMAGE:7002103, complete cds.
          Length = 103

 Score =  159 bits (402), Expect = 2e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDA TYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAATYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:AK011560_1156475 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610027B07
           product:histone 4 protein, full insert sequence.
          Length = 103

 Score =  159 bits (402), Expect = 2e-38
 Identities = 79/82 (96%), Positives = 82/82 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+R+T
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRET 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:AK010085_1155526 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310067E17
           product:histone 4 protein, full insert sequence.
          Length = 103

 Score =  159 bits (402), Expect = 2e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKP IRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPVIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:CR542189_1994415 Homo sapiens full open reading frame cDNA clone
           RZPDo834F0524D for gene HIST1H4F, histone 1, H4f;
           complete cds, without stopcodon.
          Length = 103

 Score =  159 bits (401), Expect = 3e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEH +RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHPKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|S03427|S03427 histone H4 (clone 53) - mouse>gb:MMHIS453_2115297
           Mouse histone H4 gene.
          Length = 103

 Score =  159 bits (401), Expect = 3e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVY LKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYRLKRQGRTLYGFGG 103



>gb:AY450353_1430246 Bos grunniens histone H4.1 mRNA, partial cds.
          Length = 104

 Score =  158 bits (400), Expect = 4e-38
 Identities = 79/81 (97%), Positives = 81/81 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VTAMDVVYALKRQGRTLYGFG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFG 102



>gb:PLY16587_1395393 Paracentrotus lividus histone H4 gene, partial.
          Length = 101

 Score =  158 bits (400), Expect = 4e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 20  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 79

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 80  VTAMDVVYALKRQGRTLYGFGG 101



>pir|T27741|T27741 hypothetical protein ZK131.4 - Caenorhabditis
           elegans
          Length = 103

 Score =  158 bits (400), Expect = 4e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|S20666|S20666 histone H4 - starfish (Pisaster
           brevispinus)>pir|S20670|S20670 histone H4 - starfish
           (Pisaster ochraceus)>pir|S20668|S20668 histone H4 -
           starfish (Pycnopodia helianthoides)>pir|S01618|S01618
           histone H4, embryonic (clones L1 and L2) - sea urchin
           (Strongylocentrotus purpuratus)>pir|S49485|S49485
           histone H4 - sea cucumber (Holothuria
           tubulosa)>pir|S04240|S04240 histone H4 - Caenorhabditis
           elegans>gb:AC024696_1204319 Caenorhabditis elegans
           cosmid F07B7, complete sequence.>gb:AF047656_1236451
           Caenorhabditis elegans cosmid F17E9, complete
           sequence.>gb:CEB0035_1359694 Caenorhabditis elegans
           cosmid B0035, complete sequence.>gb:CEC50F4_1361481
           Caenorhabditis elegans cosmid C50F4, complete
           sequence.>gb:CEF22B3_1362803 Caenorhabditis elegans
           cosmid F22B3, complete sequence.>gb:CEF54E12_1364450
           Caenorhabditis elegans cosmid F54E12, complete
           sequence.>gb:CEHIS10_1365095 C. elegans core histone
           genes H4(his-10) and H3(his-9).>gb:CET10C6_1367579
           Caenorhabditis elegans cosmid T10C6, complete
           sequence.>gb:CET23D8_1368036 Caenorhabditis elegans
           cosmid T23D8, complete sequence.>gb:CEZK131_1371496
           Caenorhabditis elegans cosmid ZK131, complete
           sequence.>gb:CEZK131_1371500 Caenorhabditis elegans
           cosmid ZK131, complete sequence.>gb:CEZK131_1371503
           Caenorhabditis elegans cosmid ZK131, complete
           sequence.>gb:HTHISH4_1386484 H.tubulosa gene encoding
           histone H4.>gb:LPH3H4_1388968 Lytechinus pictus H3 and
           H4 gene.>gb:PALH49A_1391545 P.lividus H4 histone, clone
           h19.>gb:PBH4H3_1391714 P.brevispinus histone genes H4
           and H3.>gb:PHH4H3_1395218 P.helianthoides histone genes
           H4 and H3.>gb:PLY16588_1395394 Paracentrotus lividus
           histone H4 gene, early subtype.>gb:PMHISH4_1395455
           Psammechinus miliaris gene for histone H4 (clone
           h19).>gb:PMU84117_1395493 Psammechinus miliaris cleavage
           stage histone H4 (CS H4) mRNA, complete
           cds.>gb:POH4H3_1395534 P.ochraceus histone genes H4 and
           H3.>gb:SPH4L1_1397964 Strongylocentrotus purpuratus late
           histone gene L1 H4.>gb:SPH4L2_1397965 Strongylocentrotus
           purpuratus late histone gene L2 H4.>gb:SPHIH4_1397968
           Sea urchin gene for histone H4.>gb:SPHISH34_1397972 Sea
           urchin (S. purpuratus) late embryonic H3 and H4 histone
           genes.>gb:SULHISL34_1398179 Sea urchin (L.pictus)
           late-stage histone H3 and H4 genes.>gb:SUPHISB1_1398202
           P.miliaris histone H4 gene, clone h19, complete
           cds.>gb:U41625_1404202 Caenorhabditis elegans cosmid
           K03A1, complete sequence.>gb:U64843_1405735
           Caenorhabditis elegans cosmid K06C4, complete
           sequence.>gb:U64843_1405742 Caenorhabditis elegans
           cosmid K06C4, complete sequence.>gb:U64845_1405771
           Caenorhabditis elegans cosmid F45F2, complete sequence.
          Length = 103

 Score =  158 bits (400), Expect = 4e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|T29230|T29230 hypothetical protein F55G1.11 - Caenorhabditis
           elegans>gb:U58750_1405322 Caenorhabditis elegans cosmid
           F55G1, complete sequence.
          Length = 118

 Score =  158 bits (400), Expect = 4e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 37  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 96

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 97  VTAMDVVYALKRQGRTLYGFGG 118



>sp|P02306|H4_CAEEL Histone H4.>pir|D93719|HSUR4 histone H4 - sea
           urchin (Psammechinus miliaris)>pir|A02643|HSUR4P histone
           H4, embryonic - sea urchin (Strongylocentrotus
           purpuratus)>pir|S68537|S68537 histone H4 - starfish
           (Asterina pectinifera)>gb:SUSH4AA_1398245 S.purpuratus
           H4 histone mRNA, complete cds.
          Length = 102

 Score =  158 bits (400), Expect = 4e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>gb:DPINH41_1381409 D.pini mRNA for histone H4, isoforme 1.
          Length = 103

 Score =  158 bits (399), Expect = 5e-38
 Identities = 78/81 (96%), Positives = 81/81 (100%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           +RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTV
Sbjct: 23  VRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTV 82

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TAMDVVYALKRQGRTLYGFGG
Sbjct: 83  TAMDVVYALKRQGRTLYGFGG 103



>gb:GGU37576_2573628 Gallus gallus histone H4-VIII gene, complete
           cds.
          Length = 103

 Score =  157 bits (398), Expect = 7e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQ RTLYGFGG
Sbjct: 82  VTAMDVVYALKRQERTLYGFGG 103



>gb:AY064471_1293727 Aplysia californica histone H4 (His.H4) gene,
           complete cds.
          Length = 103

 Score =  157 bits (398), Expect = 7e-38
 Identities = 79/82 (96%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+ KT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKCKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:AB105183_1199621 Drosophila sechellia H4, H2A, H2B, H1 genes for
           histone 4, histone 2A, histone 2B, histone 1, complete
           cds, clone:sech6.
          Length = 103

 Score =  157 bits (398), Expect = 7e-38
 Identities = 78/81 (96%), Positives = 81/81 (100%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTV
Sbjct: 23  LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTV 82

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQGRTLYGFGG
Sbjct: 83  TAVDVVYALKRQGRTLYGFGG 103



>gb:DPULH4_1381535 D.pulchellus mRNA for histone H4.
          Length = 103

 Score =  157 bits (397), Expect = 9e-38
 Identities = 78/82 (95%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+F +NVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFWQNVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|S20677|S20677 histone H4 - starfish (Solaster
           stimpsoni)>gb:SSH4H3_1398075 S.stimpsoni histone genes
           H4 and H3.
          Length = 103

 Score =  157 bits (397), Expect = 9e-38
 Identities = 78/82 (95%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT+MDVVYALKRQGRTLYGFGG
Sbjct: 82  VTSMDVVYALKRQGRTLYGFGG 103



>sp|P27996|H4_SOLST Histone H4.
          Length = 102

 Score =  157 bits (397), Expect = 9e-38
 Identities = 78/82 (95%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT+MDVVYALKRQGRTLYGFGG
Sbjct: 81  VTSMDVVYALKRQGRTLYGFGG 102



>gb:HSHIH4_2013798 Human H4 histone gene.
          Length = 103

 Score =  156 bits (395), Expect = 2e-37
 Identities = 78/82 (95%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRR ARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRXARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQG TLYGFGG
Sbjct: 82  VTAMDVVYALKRQGXTLYGFGG 103



>gb:DPINH4_1381408 D.pini mRNA for histone H4.
          Length = 103

 Score =  156 bits (395), Expect = 2e-37
 Identities = 78/82 (95%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLEN IRDAVTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENAIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDV YALKRQGRTLYGFGG
Sbjct: 82  VTAMDVRYALKRQGRTLYGFGG 103



>gb:AY650011_1620150 Petunia x hybrida histone H4 (H4) mRNA,
           complete cds.
          Length = 103

 Score =  156 bits (394), Expect = 2e-37
 Identities = 79/82 (96%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRL RRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEH RRKT
Sbjct: 22  VLRDNIQGITKPAIRRLVRRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHPRRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
            TAMDVVYALKRQGRTLYGFGG
Sbjct: 82  GTAMDVVYALKRQGRTLYGFGG 103



>pir|S59586|S59586 histone H4 (clones CH-I, CH-II, and CH-III) -
           Chlamydomonas reinhardtii>gb:CREHIH3G_1673375
           Chlamydomonas reinhardtii histone H3, histone H4,
           histone H2B, and histone H2A genes, complete
           cds.>gb:CRU16724_1673619 Chlamydomonas reinhardtii
           histone H3 (ch3-II), histone H4 (ch4-II), histone H2B
           (ch2b-II) and histone H2A (ch2a-II) genes, complete
           cds.>gb:CRU16725_1673623 Chlamydomonas reinhardtii
           histone H3 (ch3-III), histone H4 (ch4-III), histone H2B
           (ch2b-III) and histone H2A (ch2a-III) genes, complete
           cds.>gb:CRU16825_1673630 Chlamydomonas reinhardtii
           histone H3 (ch3-I) and histone H4 (ch4-I) genes,
           complete cds.
          Length = 103

 Score =  156 bits (394), Expect = 2e-37
 Identities = 79/82 (96%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK FLENVIRD+VTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRTVLKTFLENVIRDSVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|A27859|A27859 histone H4.1 - slime mold (Physarum
           polycephalum)>gb:PPHI01_1395570 Physarum polycephalum
           histone H4 gene.>gb:PPHISH41_1395572 Physarum
           polycephalum H41 gene for histone
           protein.>gb:PPHISH42_1395573 Physarum histone H4 gene
           (H42).
          Length = 103

 Score =  156 bits (394), Expect = 2e-37
 Identities = 79/82 (96%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRIS  IYEETRGVLK FLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISNTIYEETRGVLKTFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>sp|P04915|H4_PHYPO Histone H4.
          Length = 102

 Score =  156 bits (394), Expect = 2e-37
 Identities = 79/82 (96%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRIS  IYEETRGVLK FLENVIRDAVTYTEHARRKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISNTIYEETRGVLKTFLENVIRDAVTYTEHARRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>sp|P50566|H4_CHLRE Histone H4.
          Length = 102

 Score =  156 bits (394), Expect = 2e-37
 Identities = 79/82 (96%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK FLENVIRD+VTYTEHARRKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRTVLKTFLENVIRDSVTYTEHARRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>gb:MAL249812_1685568 Mortierella alpina H3.1 and H4.1 genes for
           histone H3 and histone H4.>gb:MAL249813_1685570
           Mortierella alpina histone H3.2 and H4.2 genes for
           histone H3 and for histone H4.
          Length = 103

 Score =  155 bits (393), Expect = 3e-37
 Identities = 76/82 (92%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRSVLKVFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>gb:AE017343_1755397 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.>gb:AE017352_1759813
           Cryptococcus neoformans var. neoformans JEC21 chromosome
           12, complete sequence.
          Length = 103

 Score =  155 bits (392), Expect = 4e-37
 Identities = 77/81 (95%), Positives = 81/81 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD+VTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VT++DVVYALKRQGRTLYGFG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFG 102



>gb:AF361948_1265574 Eimeria tenella histone 4 (H4) gene, complete
           cds.
          Length = 103

 Score =  155 bits (392), Expect = 4e-37
 Identities = 75/82 (91%), Positives = 81/82 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEE RGVLK+FLEN+I+D+VTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEEIRGVLKVFLENIIKDSVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMD+VY+LKRQGRTLYGFGG
Sbjct: 82  VTAMDIVYSLKRQGRTLYGFGG 103



>pir|S00939|S00939 histone H4 - Volvox carteri>gb:VCHIS34_1727019
           Volvox carteri H3-I and H4-I genes for histones H3 and
           H4.>gb:VCHIS34A_1727021 Volvox carteri H3-II and H4-II
           genes for histones H3 and H4.
          Length = 103

 Score =  155 bits (392), Expect = 4e-37
 Identities = 79/82 (96%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK FLENVIRD+VTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRTVLKNFLENVIRDSVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>pir|S10076|S10076 histone H4.2 - slime mold (Physarum
           polycephalum)>gb:PPHIS42_1395571 P.polycephalum H42 gene
           for a histone protein.
          Length = 103

 Score =  155 bits (392), Expect = 4e-37
 Identities = 79/82 (96%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRIS  IYEETRGVLK FLENVIRDAVTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISKTIYEETRGVLKTFLENVIRDAVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>sp|P08436|H4_VOLCA Histone H4.
          Length = 102

 Score =  155 bits (392), Expect = 4e-37
 Identities = 79/82 (96%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK FLENVIRD+VTYTEHARRKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRTVLKNFLENVIRDSVTYTEHARRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 81  VTAMDVVYALKRQGRTLYGFGG 102



>gb:CR382133_1666749 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.>gb:CR382136_1669184
           Debaryomyces hansenii chromosome D of strain CBS767 of
           Debaryomyces hansenii.
          Length = 103

 Score =  154 bits (390), Expect = 6e-37
 Identities = 76/82 (92%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE RGVLK FLENVIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRGVLKTFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>gb:ALHISH4X1_1285074 A.lumbricoides histone H4 gene (exon 1).
          Length = 103

 Score =  154 bits (389), Expect = 8e-37
 Identities = 77/82 (93%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK+FLENVIRDAVTY EHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRSVLKVFLENVIRDAVTYCEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALK QGRTLYGFGG
Sbjct: 82  VTAMDVVYALKHQGRTLYGFGG 103



>pir|S25638|S25638 histone H4 - basidiomycete (Phanerochaete
           chrysosporium)>gb:ABHHFA_1529860 A.bisporus mRNA for
           histone H4.>gb:PCHISH41_1699237 P.chrysosporium gene for
           histone H4.1.>gb:PCHISH42_1699238 P.chrysosporium gene
           for histone H4.2.
          Length = 103

 Score =  154 bits (389), Expect = 8e-37
 Identities = 76/81 (93%), Positives = 80/81 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD+VTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VTA+DVVYALKR GRTLYGFG
Sbjct: 82  VTALDVVYALKRSGRTLYGFG 102



>sp|P35058|H4_PHACH Histone H4.
          Length = 102

 Score =  154 bits (389), Expect = 8e-37
 Identities = 76/81 (93%), Positives = 80/81 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD+VTYTEHA+RKT
Sbjct: 21  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDSVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VTA+DVVYALKR GRTLYGFG
Sbjct: 81  VTALDVVYALKRSGRTLYGFG 101



>sp|Q27443|H4_ASCSU Histone H4.
          Length = 102

 Score =  154 bits (389), Expect = 8e-37
 Identities = 77/82 (93%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK+FLENVIRDAVTY EHA+RKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRSVLKVFLENVIRDAVTYCEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALK QGRTLYGFGG
Sbjct: 81  VTAMDVVYALKHQGRTLYGFGG 102



>gb:AF297469_1259956 Schistosoma mansoni strain LE histone H4 gene,
           partial cds.
          Length = 98

 Score =  154 bits (388), Expect = 1e-36
 Identities = 77/79 (97%), Positives = 79/79 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 20  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT 79

Query: 305 VTAMDVVYALKRQGRTLYG 361
           VTAMDVVYALKRQGRTLYG
Sbjct: 80  VTAMDVVYALKRQGRTLYG 98



>gb:AMH4_1285248 A.mellifera mRNA for histone H4.
          Length = 103

 Score =  153 bits (387), Expect = 1e-36
 Identities = 77/82 (93%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VL DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYTEH +RKT
Sbjct: 22  VLGDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHTKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALK QGRTLYGFGG
Sbjct: 82  VTAMDVVYALKIQGRTLYGFGG 103



>gb:TCH4_1399688 T.caceociae mRNA for histone H4.
          Length = 103

 Score =  153 bits (386), Expect = 2e-36
 Identities = 77/82 (93%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRIS LIYEETRGVLK+FLENVIRDAVTYTEHA+  T
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISSLIYEETRGVLKVFLENVIRDAVTYTEHAKIPT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 82  VTAMDVVYALKRQGRTLYGFGG 103



>gb:AJ646896_1813368 Ustilago maydis h4 gene for histone 4, exons
           1-2.
          Length = 103

 Score =  151 bits (382), Expect = 5e-36
 Identities = 74/81 (91%), Positives = 81/81 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIY+ETRGVLK+FLE+VIRD+VTYTEHA+RKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYDETRGVLKLFLESVIRDSVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VT++DVVYALKRQGRTLYGFG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFG 102



>gb:DPINH42_1381410 D.pini mRNA for histone H4, isoforme 2.
          Length = 102

 Score =  151 bits (382), Expect = 5e-36
 Identities = 77/82 (93%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYT HA+RKT
Sbjct: 21  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTGHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDV  ALKRQGRTLYGFGG
Sbjct: 81  VTAMDVGDALKRQGRTLYGFGG 102



>gb:AE014186_938029 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014836_1228763 Plasmodium falciparum 3D7
           chromosome 11 section 1 of 8 of the complete
           sequence.>gb:AY230256_1311216 Plasmodium berghei histone
           H4 gene, partial cds.>gb:AY230257_1311217 Plasmodium
           yoelii histone H4 gene, partial cds.>gb:AY230258_1311218
           Plasmodium falciparum histone H4 gene, partial cds.
          Length = 103

 Score =  151 bits (382), Expect = 5e-36
 Identities = 72/82 (87%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE RGVLK+FLENVI+D++ YTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEIRGVLKVFLENVIKDSIMYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMD+VY+LKRQGRTLYGFGG
Sbjct: 82  VTAMDIVYSLKRQGRTLYGFGG 103



>pir|JS0314|JS0314 histone H4 - Caenorhabditis elegans
          Length = 101

 Score =  151 bits (382), Expect = 5e-36
 Identities = 78/82 (95%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQ ITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKT
Sbjct: 21  VLRDNIQ-ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKT 79

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VTAMDVVYALKRQGRTLYGFGG
Sbjct: 80  VTAMDVVYALKRQGRTLYGFGG 101



>gb:PFU314854_1699948 Penicillium funiculosum H4.2 gene for histone
           H4.
          Length = 103

 Score =  151 bits (381), Expect = 7e-36
 Identities = 74/82 (90%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKSFLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>pir|S07913|S07913 histone H4 - Neurospora
           crassa>gb:AY062172_1564991 Neurospora crassa histone H4
           (hh4-2) gene, complete cds.>gb:AY062173_1564993
           Neurospora crassa histone H3 (hh3) and histone H4
           (hh4-1) genes, complete cds.>gb:BX649607_1643507
           Aspergillus fumigatus BAC pilot project supercontig;
           segment 3/3.>gb:NCB7K22_1690196 Neurospora crassa DNA
           linkage group II BAC clone B7K22.>gb:NCHISH4_1690570
           Neurospora crassa DNA for histone
           H4.>gb:PFU314855_1699950 Penicillium funiculosum H4.1
           gene and H3 gene.
          Length = 103

 Score =  151 bits (381), Expect = 7e-36
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>pir|S11939|S11939 histone H4.1 - Emericella
           nidulans>gb:AB033943_1518850 Aspergillus oryzae mRNA for
           histone H4, complete cds.>gb:ENU12630_1676748 Emericella
           nidulans R153 core histone H3 (H3) gene and H4.1 (H4.1)
           gene, complete cds.>gb:ANH4GENE_1819424 A.nidulans gene
           for core histone H4.1.
          Length = 103

 Score =  151 bits (381), Expect = 7e-36
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>pir|S11940|S11940 histone H4.2 - Emericella
           nidulans>gb:ENU12631_1676750 Emericella nidulans R153
           core histone H4.2 (H4.1) gene, complete
           cds.>gb:ANH4GE_1819423 A.nidulans gene for core histone
           H4.2.
          Length = 103

 Score =  151 bits (381), Expect = 7e-36
 Identities = 74/82 (90%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKSFLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>sp|P04914|H4_NEUCR Histone H4.
          Length = 102

 Score =  151 bits (381), Expect = 7e-36
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RKT
Sbjct: 21  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 81  VTSLDVVYALKRQGRTLYGFGG 102



>sp|P23751|H42_EMENI Histone H4.2.
          Length = 102

 Score =  151 bits (381), Expect = 7e-36
 Identities = 74/82 (90%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 21  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKSFLESVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 81  VTSLDVVYALKRQGRTLYGFGG 102



>sp|P23750|H41_EMENI Histone H4.1.
          Length = 102

 Score =  151 bits (381), Expect = 7e-36
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RKT
Sbjct: 21  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 81  VTSLDVVYALKRQGRTLYGFGG 102



>gb:AY850324_1180294 Magnaporthe grisea histone H4-like protein
           mRNA, complete cds.
          Length = 103

 Score =  150 bits (380), Expect = 9e-36
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKSFLEGVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>pir|D27399|HSZP4 histone H4 [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:AB004538_1509140
           Schizosaccharomyces pombe 39 kb genomic DNA, clone
           c568.>gb:SPAC1834_1716818 S.pombe chromosome I cosmid
           c1834.>gb:SPBC1105_1718776 S.pombe chromosome II cosmid
           c1105.>gb:SPBC8D2_1720500 S.pombe chromosome II cosmid
           c8D2.>gb:SPHIS32_1721816 Fission yeast histone H3.2 and
           H4.2 genes.>gb:SPHIS33_1721818 Fission yeast histone
           genes H3.3 and H4.3.>gb:SPHIS41_1721819 Fission yeast
           genes for histone H4.1 and H3.1.
          Length = 103

 Score =  150 bits (380), Expect = 9e-36
 Identities = 72/82 (87%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS L+YEETR VLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISALVYEETRAVLKLFLENVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVY+LKRQGRT+YGFGG
Sbjct: 82  VTSLDVVYSLKRQGRTIYGFGG 103



>sp|P09322|H4_SCHPO Histone H4.
          Length = 102

 Score =  150 bits (380), Expect = 9e-36
 Identities = 72/82 (87%), Positives = 80/82 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS L+YEETR VLK+FLENVIRDAVTYTEHA+RKT
Sbjct: 21  ILRDNIQGITKPAIRRLARRGGVKRISALVYEETRAVLKLFLENVIRDAVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVY+LKRQGRT+YGFGG
Sbjct: 81  VTSLDVVYSLKRQGRTIYGFGG 102



>gb:CR382125_1658006 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 103

 Score =  150 bits (379), Expect = 1e-35
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>gb:CR382125_1657602 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 115

 Score =  150 bits (379), Expect = 1e-35
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 34  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLKTFLESVIRDAVTYTEHAKRKT 93

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 94  VTSLDVVYALKRQGRTLYGFGG 115



>gb:AF517877_1807679 Griffithsia japonica isolate Gj458 histone H4
           protein mRNA, complete cds.
          Length = 103

 Score =  150 bits (378), Expect = 1e-35
 Identities = 74/81 (91%), Positives = 79/81 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETR VLK+FLE+VI+D+VTYTEHARRKT
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRNVLKVFLESVIKDSVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           V +MDVVYALKRQGRTLYGFG
Sbjct: 82  VVSMDVVYALKRQGRTLYGFG 102



>gb:CR380949_1649587 Candida glabrata strain CBS138 chromosome C
           complete sequence.>gb:CR380954_1651484 Candida glabrata
           strain CBS138 chromosome H complete
           sequence.>gb:CR380959_1653940 Candida glabrata strain
           CBS138 chromosome M complete
           sequence.>gb:AF520060_1807838 Candida glabrata YBR005Wp
           (YBR005W), UGA5p (UGA5), YBR007Cp (YBR007C), HHF1p
           (HHF1), HHT1p (HHT1), and TRP1p (TRP1) genes, complete
           cds; tRNA-Thr gene, complete sequence; MNT3Ap (MNT3A)
           gene, complete cds; and MNT3Bp (MNT3B) gene, partial
           cds.>gb:AF520061_1807844 Candida glabrata SOK1p (SOK1)
           gene, partial cds; HHF2p (HHF2) and HHT2p (HHT2) genes,
           complete cds; and IPP1p (IPP1) gene, partial cds.
          Length = 103

 Score =  150 bits (378), Expect = 1e-35
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>gb:AAD535732_1508167 Arxula adeninivorans ahsb4 gene for histone
           H4, exons 1-2.
          Length = 103

 Score =  150 bits (378), Expect = 1e-35
 Identities = 74/82 (90%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS LIYEETR VLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISALIYEETRSVLKTFLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>pir|F90085|F90085 Histone H4 [imported] - Guillardia theta
           nucleomorph>gb:AF165818_1773767 Guillardia theta
           nucleomorph chromosome 1, complete sequence.
          Length = 104

 Score =  149 bits (377), Expect = 2e-35
 Identities = 73/81 (90%), Positives = 80/81 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRD+IQGITKPAIRRLARRGGVKRISGLIYEET+ VLK+FLENV++DAVTYTEHARRKT
Sbjct: 23  VLRDSIQGITKPAIRRLARRGGVKRISGLIYEETKIVLKLFLENVVKDAVTYTEHARRKT 82

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VTAMDV+YALKRQGRT+YGFG
Sbjct: 83  VTAMDVIYALKRQGRTIYGFG 103



>gb:AE016817_1747183 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 103

 Score =  149 bits (375), Expect = 3e-35
 Identities = 73/82 (89%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYE+ R VLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEDVRAVLKSFLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>pir|A02647|HSBY4 histone H4 - yeast (Saccharomyces
           cerevisiae)>gb:AY692960_1623007 Saccharomyces cerevisiae
           clone FLH115333.01X YBR009C gene, complete
           cds.>gb:SCH3H401_1708421 Yeast genes for histone H3 and
           H4 (copy-I genes from PMS191).>gb:SCH3H402_1708423 Yeast
           genes for histone H3 and H4 (copy-II genes from plasmids
           PMS201 and PMS202).>gb:SCYBR009C_1711222 S.cerevisiae
           chromosome II reading frame ORF
           YBR009c.>gb:SCYNL030W_1713616 S.cerevisiae chromosome
           XIV reading frame ORF YNL030w.>gb:YSCH4_1728995 Yeast
           (S.carlsbergensis) histone H4 gene.
          Length = 103

 Score =  149 bits (375), Expect = 3e-35
 Identities = 73/82 (89%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE+VIRD+VTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>sp|P02309|H4_YEAST Histone H4.
          Length = 102

 Score =  149 bits (375), Expect = 3e-35
 Identities = 73/82 (89%), Positives = 79/82 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE+VIRD+VTYTEHA+RKT
Sbjct: 21  ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKT 80

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 81  VTSLDVVYALKRQGRTLYGFGG 102



>gb:CR382129_1661785 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.>gb:CR382132_1666022
           Yarrowia lipolytica chromosome F of strain CLIB99 of
           Yarrowia lipolytica.
          Length = 103

 Score =  147 bits (371), Expect = 1e-34
 Identities = 73/82 (89%), Positives = 78/82 (95%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRIS  IYEETR VLK FLE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAIRRLARRGGVKRISAQIYEETRNVLKSFLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>gb:TVH3242_1401231 T.vaginalis DNA for histone H4-2 and histone
           H3-2, partial.>gb:TVH43_1401232 T.vaginalis DNA for
           histone H4-3.
          Length = 101

 Score =  144 bits (363), Expect = 8e-34
 Identities = 72/80 (90%), Positives = 77/80 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           V+R+NIQGITKPAIRRLARRGGVKRISG IYEE RGVL+ FLENVIRD+VTYTEHARRKT
Sbjct: 22  VMRENIQGITKPAIRRLARRGGVKRISGDIYEEVRGVLRHFLENVIRDSVTYTEHARRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGF 364
           VTAMDVVYALKRQG+TLYGF
Sbjct: 82  VTAMDVVYALKRQGKTLYGF 101



>gb:AE016818_1748160 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 103

 Score =  143 bits (361), Expect = 1e-33
 Identities = 71/82 (86%), Positives = 77/82 (93%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAI RLARRGGVKRISGLIYE+ R VLK  LE+VIRDAVTYTEHA+RKT
Sbjct: 22  ILRDNIQGITKPAILRLARRGGVKRISGLIYEDVRAVLKSVLESVIRDAVTYTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
           VT++DVVYALKRQGRTLYGFGG
Sbjct: 82  VTSLDVVYALKRQGRTLYGFGG 103



>gb:AF506076_1277880 Stylonychia mytilus macronuclear histone H4
           gene, complete cds.
          Length = 104

 Score =  142 bits (358), Expect = 3e-33
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           L++ I GITKPAIRRLARRGGVKRIS LIYEETR VL+ FLENVIRD+VTYTEHA+RKTV
Sbjct: 24  LKETIMGITKPAIRRLARRGGVKRISSLIYEETRNVLRSFLENVIRDSVTYTEHAKRKTV 83

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQGRTLYGFGG
Sbjct: 84  TALDVVYALKRQGRTLYGFGG 104



>pir|S14185|S14185 histone H4 (clone H4g) - Stylonychia lemnae
          Length = 145

 Score =  142 bits (358), Expect = 3e-33
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           L++ I GITKPAIRRLARRGGVKRIS LIYEETR VL+ FLENVIRD+VTYTEHA+RKTV
Sbjct: 65  LKETIMGITKPAIRRLARRGGVKRISSLIYEETRNVLRSFLENVIRDSVTYTEHAKRKTV 124

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQGRTLYGFGG
Sbjct: 125 TALDVVYALKRQGRTLYGFGG 145



>pir|S14184|S14184 histone H4 (clone H4K) - Stylonychia
           lemnae>pir|JS0154|JS0154 histone H4 - Oxytricha
           nova>gb:AF192970_1249691 Oxytricha trifallax histone H4
           gene, complete cds.>gb:AF506072_1277876 Sterkiella nova
           macronuclear histone H4 gene, complete
           cds.>gb:AF506073_1277877 Sterkiella histriomuscorum
           macronuclear histone H4 gene, complete
           cds.>gb:AF506074_1277878 Pleurotricha lanceolata
           macronuclear histone H4 gene, complete
           cds.>gb:AF506075_1277879 Stylonychia lemnae macronuclear
           histone H4 gene, complete cds.>gb:OFAH4AA_1391140 O.nova
           macronuclear H4 histone. DNA molecule.>gb:SLH4K_1397692
           Stylonychia lemnae histone H4 gene (clone
           H4K).>gb:SLPH4G_1397743 S.lemnae histone H4 gene (clone
           H4g).
          Length = 104

 Score =  142 bits (358), Expect = 3e-33
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           L++ I GITKPAIRRLARRGGVKRIS LIYEETR VL+ FLENVIRD+VTYTEHA+RKTV
Sbjct: 24  LKETIMGITKPAIRRLARRGGVKRISSLIYEETRNVLRSFLENVIRDSVTYTEHAKRKTV 83

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQGRTLYGFGG
Sbjct: 84  TALDVVYALKRQGRTLYGFGG 104



>sp|P18836|H4_OXYNO Histone H4.
          Length = 103

 Score =  142 bits (358), Expect = 3e-33
 Identities = 70/81 (86%), Positives = 76/81 (93%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           L++ I GITKPAIRRLARRGGVKRIS LIYEETR VL+ FLENVIRD+VTYTEHA+RKTV
Sbjct: 23  LKETIMGITKPAIRRLARRGGVKRISSLIYEETRNVLRSFLENVIRDSVTYTEHAKRKTV 82

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQGRTLYGFGG
Sbjct: 83  TALDVVYALKRQGRTLYGFGG 103



>gb:AF506071_1277875 Euplotes aediculatus macronuclear histone H4
           gene, complete cds.
          Length = 107

 Score =  141 bits (355), Expect = 7e-33
 Identities = 69/81 (85%), Positives = 76/81 (93%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LR+ I G+TKPAIRRLARRGGVKRIS L+YEETR VLK FLENVIRD+VTYTEHA+RKTV
Sbjct: 27  LRETILGVTKPAIRRLARRGGVKRISSLVYEETRAVLKGFLENVIRDSVTYTEHAKRKTV 86

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQG+TLYGFGG
Sbjct: 87  TALDVVYALKRQGKTLYGFGG 107



>gb:PFU65675_1395098 Plasmodium falciparum histone H4 gene, partial
           cds.
          Length = 79

 Score =  139 bits (351), Expect = 2e-32
 Identities = 67/77 (87%), Positives = 75/77 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE RGVLK+FLENVI+D++ YTEHA+RKT
Sbjct: 3   ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEIRGVLKVFLENVIKDSIMYTEHAKRKT 62

Query: 305 VTAMDVVYALKRQGRTL 355
           VTAMD+VY+LKRQGRTL
Sbjct: 63  VTAMDIVYSLKRQGRTL 79



>gb:ECU75430_1384244 Euplotes crassus macronuclear linear DNA,
           complete sequence, with histone H4 gene, complete cds.
          Length = 107

 Score =  139 bits (350), Expect = 3e-32
 Identities = 68/81 (83%), Positives = 76/81 (93%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LR+ I G+TKPAIRRLARRGGVKRIS L+YEETR VLK FLE+VIRD+VTYTEHA+RKTV
Sbjct: 27  LRETILGVTKPAIRRLARRGGVKRISSLVYEETRAVLKGFLESVIRDSVTYTEHAKRKTV 86

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQG+TLYGFGG
Sbjct: 87  TALDVVYALKRQGKTLYGFGG 107



>sp|P80739|H4_EUPCR Histone H4.
          Length = 106

 Score =  139 bits (350), Expect = 3e-32
 Identities = 68/81 (83%), Positives = 76/81 (93%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LR+ I G+TKPAIRRLARRGGVKRIS L+YEETR VLK FLE+VIRD+VTYTEHA+RKTV
Sbjct: 26  LRETILGVTKPAIRRLARRGGVKRISSLVYEETRAVLKGFLESVIRDSVTYTEHAKRKTV 85

Query: 308 TAMDVVYALKRQGRTLYGFGG 370
           TA+DVVYALKRQG+TLYGFGG
Sbjct: 86  TALDVVYALKRQGKTLYGFGG 106



>pir|A25875|A25875 histone H4 - Tetrahymena
           thermophila>gb:TTHI01_1401148 Tetrahymena H4-I gene and
           flanking regions.>gb:TTHIS4II_1401149 Tetrahymena DNA
           for histone H4-II.
          Length = 103

 Score =  138 bits (348), Expect = 4e-32
 Identities = 68/78 (87%), Positives = 74/78 (94%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           +I+GITKPAIRRLARRGGVKRIS  IY+++R VLK FLENV+RDAVTYTEHARRKTVTAM
Sbjct: 26  SIEGITKPAIRRLARRGGVKRISSFIYDDSRQVLKSFLENVVRDAVTYTEHARRKTVTAM 85

Query: 317 DVVYALKRQGRTLYGFGG 370
           DVVYALKRQGRTLYGFGG
Sbjct: 86  DVVYALKRQGRTLYGFGG 103



>sp|P02311|H42_TETPY Histone H4, minor.>pir|A02649|HSTE42 histone
           H4, minor - Tetrahymena pyriformis
          Length = 102

 Score =  138 bits (348), Expect = 4e-32
 Identities = 68/78 (87%), Positives = 74/78 (94%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           +I+GITKPAIRRLARRGGVKRIS  IY+++R VLK FLENV+RDAVTYTEHARRKTVTAM
Sbjct: 25  SIEGITKPAIRRLARRGGVKRISSFIYDDSRQVLKSFLENVVRDAVTYTEHARRKTVTAM 84

Query: 317 DVVYALKRQGRTLYGFGG 370
           DVVYALKRQGRTLYGFGG
Sbjct: 85  DVVYALKRQGRTLYGFGG 102



>sp|P02310|H41_TETPY Histone H4, major.>pir|A02648|HSTE41 histone
           H4, major - Tetrahymena pyriformis
          Length = 102

 Score =  138 bits (348), Expect = 4e-32
 Identities = 68/78 (87%), Positives = 74/78 (94%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           +I+GITKPAIRRLARRGGVKRIS  IY+++R VLK FLENV+RDAVTYTEHARRKTVTAM
Sbjct: 25  SIEGITKPAIRRLARRGGVKRISSFIYDDSRQVLKSFLENVVRDAVTYTEHARRKTVTAM 84

Query: 317 DVVYALKRQGRTLYGFGG 370
           DVVYALKRQGRTLYGFGG
Sbjct: 85  DVVYALKRQGRTLYGFGG 102



>gb:AJ632310_2278613 Cotesia congregata virus complete genome,
           segment Circle7.
          Length = 155

 Score =  136 bits (343), Expect = 2e-31
 Identities = 66/80 (82%), Positives = 73/80 (91%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LRDNIQGITKPAIRRLARRGGVKR+SGL+YEE R VLKIFL+ VI DA  YTEHA+RKTV
Sbjct: 75  LRDNIQGITKPAIRRLARRGGVKRVSGLVYEEIRDVLKIFLKTVIHDAFHYTEHAKRKTV 134

Query: 308 TAMDVVYALKRQGRTLYGFG 367
           T+MD+VYALKRQGR +YGFG
Sbjct: 135 TSMDIVYALKRQGRKIYGFG 154



>gb:AB070962_1197354 Paramecium caudatum gene for histone H4,
           complete cds.>gb:AB085176_1198356 Paramecium caudatum
           gene for histone H4, complete cds.
          Length = 102

 Score =  133 bits (335), Expect = 1e-30
 Identities = 64/77 (83%), Positives = 72/77 (93%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           +I+GITKPAIRRLARRGGVKRIS  +Y+++R VLK FLENVIRDA+TYTEHARRKTVT M
Sbjct: 25  SIEGITKPAIRRLARRGGVKRISSFLYDDSRNVLKSFLENVIRDAITYTEHARRKTVTVM 84

Query: 317 DVVYALKRQGRTLYGFG 367
           DVVY+LKRQGRTLYGFG
Sbjct: 85  DVVYSLKRQGRTLYGFG 101



>gb:BJH41_1355323 B.japonicum H4 gene fragment, clone BjMH4-1.
          Length = 89

 Score =  131 bits (330), Expect = 5e-30
 Identities = 65/75 (86%), Positives = 73/75 (97%), Gaps = 1/75 (1%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKR-ISGLIYEETRGVLKIFLENVIRDAVTYTEHARRK 301
           V+R+NIQGITKPAIRRLARRGGVKR +SGL+Y+ETR VLK+FLENV+RDAVTYTEHARRK
Sbjct: 15  VIRENIQGITKPAIRRLARRGGVKRTLSGLVYDETRNVLKVFLENVVRDAVTYTEHARRK 74

Query: 302 TVTAMDVVYALKRQG 346
           TVTA+DVVYALKRQG
Sbjct: 75  TVTALDVVYALKRQG 89



>sp|P80737|H41_BLEJA Histone H4-1 (Fragment).
          Length = 97

 Score =  131 bits (330), Expect = 5e-30
 Identities = 65/75 (86%), Positives = 73/75 (97%), Gaps = 1/75 (1%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKR-ISGLIYEETRGVLKIFLENVIRDAVTYTEHARRK 301
           V+R+NIQGITKPAIRRLARRGGVKR +SGL+Y+ETR VLK+FLENV+RDAVTYTEHARRK
Sbjct: 23  VIRENIQGITKPAIRRLARRGGVKRTLSGLVYDETRNVLKVFLENVVRDAVTYTEHARRK 82

Query: 302 TVTAMDVVYALKRQG 346
           TVTA+DVVYALKRQG
Sbjct: 83  TVTALDVVYALKRQG 97



>sp|P40287|H4_ENTHI Histone H4.>pir|S52264|S52262 histone H4 -
           Entamoeba histolytica>gb:EHMRNAH4_1384506 E.histolytica
           mRNA for histone H4.>gb:ENHHIH4A_1384752 Entamoeba
           histolytica histone H4 mRNA, complete cds.
          Length = 118

 Score =  131 bits (329), Expect = 7e-30
 Identities = 63/78 (80%), Positives = 73/78 (93%)
 Frame = +2

Query: 131 RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVT 310
           +D ++GITKPAIRRLARRGGVKRI+G +Y+ETR VLK FLE VIRD+VTYTEHA+R+TVT
Sbjct: 40  QDALKGITKPAIRRLARRGGVKRINGAVYDETRNVLKQFLEQVIRDSVTYTEHAKRRTVT 99

Query: 311 AMDVVYALKRQGRTLYGF 364
           AMDVVYALKRQGRTLYG+
Sbjct: 100 AMDVVYALKRQGRTLYGY 117



>gb:AGHISTH4_1281991 A.gambiae H4 gene, partial.
          Length = 91

 Score =  129 bits (324), Expect = 3e-29
 Identities = 65/70 (92%), Positives = 67/70 (95%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQG TKPAIRRLARRGGVKRISGLIYEE RGVLK+FLENVIRDAV YTEHA+RKT
Sbjct: 22  VLRDNIQGTTKPAIRRLARRGGVKRISGLIYEERRGVLKVFLENVIRDAVAYTEHAKRKT 81

Query: 305 VTAMDVVYAL 334
           VTAMDVVYAL
Sbjct: 82  VTAMDVVYAL 91



>gb:DCA505019_1675630 Daucus carota partial h4 gene for histone H4.
          Length = 65

 Score =  129 bits (323), Expect = 4e-29
 Identities = 65/65 (100%), Positives = 65/65 (100%)
 Frame = +2

Query: 134 DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTA 313
           DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTA
Sbjct: 1   DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTA 60

Query: 314 MDVVY 328
           MDVVY
Sbjct: 61  MDVVY 65



>gb:ALHISH4_1285073 Arbacia lixula H4 gene.
          Length = 67

 Score =  128 bits (321), Expect = 6e-29
 Identities = 64/67 (95%), Positives = 66/67 (98%)
 Frame = +2

Query: 134 DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTA 313
           DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY EHA+RKTVTA
Sbjct: 1   DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTA 60

Query: 314 MDVVYAL 334
           MDVVYAL
Sbjct: 61  MDVVYAL 67



>gb:AC116977_1206958 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete
           sequence.>gb:AC117075_1207792 Dictyostelium discoideum
           chromosome 2 map 5201047-5455781 strain AX4, complete
           sequence.
          Length = 108

 Score =  127 bits (319), Expect = 1e-28
 Identities = 64/78 (82%), Positives = 70/78 (89%)
 Frame = +2

Query: 131 RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVT 310
           +++I GITKPAIRRLARRGGVKRIS  IYEETR VL+ FL NVIRD+V YTEHA R+TVT
Sbjct: 29  KEHINGITKPAIRRLARRGGVKRISFPIYEETRNVLRTFLTNVIRDSVAYTEHAGRRTVT 88

Query: 311 AMDVVYALKRQGRTLYGF 364
           AMDVVYALKRQGRTLYGF
Sbjct: 89  AMDVVYALKRQGRTLYGF 106



>gb:AF139876_1244271 Giardia intestinalis histone H4 gene, complete
           cds.
          Length = 99

 Score =  125 bits (315), Expect = 3e-28
 Identities = 61/79 (77%), Positives = 70/79 (88%)
 Frame = +2

Query: 131 RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVT 310
           +D + GITKPAIRRLARRGGVKRIS  IY++TR VLK FLE V+RD++TYTEH +RKTVT
Sbjct: 20  KDTLGGITKPAIRRLARRGGVKRISSTIYQQTREVLKAFLEVVLRDSLTYTEHGQRKTVT 79

Query: 311 AMDVVYALKRQGRTLYGFG 367
           + DVVYALKRQGRTLYGFG
Sbjct: 80  SQDVVYALKRQGRTLYGFG 98



>gb:AY226559_1591031 Eschscholzia californica subsp. californica
           histone H4 mRNA, partial cds.
          Length = 69

 Score =  125 bits (314), Expect = 4e-28
 Identities = 64/66 (96%), Positives = 65/66 (98%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VL +NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT
Sbjct: 4   VLXNNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 63

Query: 305 VTAMDV 322
           VTAMDV
Sbjct: 64  VTAMDV 69



>sp|P90516|H42_BLEJA Histone H4 (Fragment).>gb:BJH42_1355324
           B.japonicum H4 gene fragment, clone BjMH4-2.
          Length = 89

 Score =  124 bits (311), Expect = 9e-28
 Identities = 61/75 (81%), Positives = 72/75 (96%), Gaps = 1/75 (1%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKR-ISGLIYEETRGVLKIFLENVIRDAVTYTEHARRK 301
           V+R+N QGITKPAIRRLARRGGVKR +SGL+Y+ETR VLK+FLE+V+RDAVTYTEHA+R+
Sbjct: 15  VIRENNQGITKPAIRRLARRGGVKRTLSGLVYDETRNVLKVFLESVVRDAVTYTEHAKRE 74

Query: 302 TVTAMDVVYALKRQG 346
           TVTA+DVVYALKRQG
Sbjct: 75  TVTALDVVYALKRQG 89



>gb:CR382127_1659993 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 665

 Score =  124 bits (310), Expect = 1e-27
 Identities = 58/81 (71%), Positives = 73/81 (90%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           V++D IQG+TKP++RR+ARRGGVKRIS  IYEE R +LKIFLEN+I+DAV YTEHA+RKT
Sbjct: 582 VIKDVIQGVTKPSLRRIARRGGVKRISTQIYEEGRTMLKIFLENLIKDAVAYTEHAKRKT 641

Query: 305 VTAMDVVYALKRQGRTLYGFG 367
           VT++DVVYA KR+GR +YG+G
Sbjct: 642 VTSLDVVYAAKRRGRPIYGYG 662



>gb:BSJ004703_1356008 Blepharisma sp. DNA for histone H4
           gene.>gb:BUJ004706_1358690 Blepharisma undulans DNA for
           histone H4 gene.
          Length = 71

 Score =  118 bits (296), Expect = 5e-26
 Identities = 56/66 (84%), Positives = 64/66 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           V+R+NIQGITKPAIRRLARRGGVKR+SGL+Y+ETR VLK+FLE V+RDAVTYTEHARRKT
Sbjct: 6   VIRENIQGITKPAIRRLARRGGVKRLSGLVYDETRNVLKVFLEGVVRDAVTYTEHARRKT 65

Query: 305 VTAMDV 322
           VTA+DV
Sbjct: 66  VTALDV 71



>gb:AY128660_1936751 Homo sapiens clone HIST1H4G histone H4 gene,
           complete cds.>gb:HS34B20_1998239 Human DNA sequence from
           clone RP1-34B20 on chromosome 6p21.31-22.2 Contains
           seventeen histone (pseudo)genes and gene RPS10P1 (40S
           Ribosomal protein S10 pseudogene 1), three CpG islands,
           ESTs, STSs and GSSs, complete sequence.>gb:HSH4L_2013676
           H.sapiens H4/l gene.
          Length = 98

 Score =  117 bits (294), Expect = 8e-26
 Identities = 63/77 (81%), Positives = 65/77 (84%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VL DNIQGITK  IRRLAR GGVKRI GLIYEETR V K+FLENVI  AVT TEHA+RKT
Sbjct: 22  VLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLENVIWYAVTNTEHAKRKT 81

Query: 305 VTAMDVVYALKRQGRTL 355
           VTAM VVY LKRQGRTL
Sbjct: 82  VTAMAVVYVLKRQGRTL 98



>gb:BUJ004705_1358689 Blepharisma undulans DNA for histone H4 gene.
          Length = 71

 Score =  117 bits (293), Expect = 1e-25
 Identities = 55/66 (83%), Positives = 64/66 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           V+R+NIQGITKPAIRRLARRGGVKR+SGL+Y++TR VLK+FLE V+RDAVTYTEHARRKT
Sbjct: 6   VIRENIQGITKPAIRRLARRGGVKRLSGLVYDDTRNVLKVFLEGVVRDAVTYTEHARRKT 65

Query: 305 VTAMDV 322
           VTA+DV
Sbjct: 66  VTALDV 71



>gb:ACHISTOH4_1745354 A.cepa mRNA for histone H4.
          Length = 58

 Score =  117 bits (292), Expect = 1e-25
 Identities = 58/58 (100%), Positives = 58/58 (100%)
 Frame = +2

Query: 197 RISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 370
           RISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct: 1   RISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 58



>gb:BUJ004704_1358688 Blepharisma undulans DNA for histone H4 gene.
          Length = 71

 Score =  115 bits (289), Expect = 3e-25
 Identities = 55/66 (83%), Positives = 63/66 (95%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           V+R+NIQGITKPAIRRLARRGGVKR+SGL+Y+ETR VLK+FLE V+ DAVTYTEHARRKT
Sbjct: 6   VIRENIQGITKPAIRRLARRGGVKRLSGLVYDETRNVLKVFLEGVVGDAVTYTEHARRKT 65

Query: 305 VTAMDV 322
           VTA+DV
Sbjct: 66  VTALDV 71



>gb:PSJ004709_1395775 Protocruzia sp. DNA for histone H4
           gene.>gb:PSJ004710_1395776 Protocruzia sp. DNA for
           histone H4 gene.
          Length = 72

 Score =  115 bits (288), Expect = 4e-25
 Identities = 57/66 (86%), Positives = 63/66 (95%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLR++IQGITKPAIRRLARRGGVKRIS LIY+ETR VL+ FLENV+RDA+TYTEHARRKT
Sbjct: 7   VLRESIQGITKPAIRRLARRGGVKRISQLIYDETRNVLRSFLENVVRDAITYTEHARRKT 66

Query: 305 VTAMDV 322
           VTAMDV
Sbjct: 67  VTAMDV 72



>gb:CAC314729_1644765 Colletotrichum acutatum partial H4 gene, exons
           1-2, isolate 95.>gb:CAC314730_1644766 Colletotrichum
           acutatum partial H4 gene, exons 1-2, isolate
           92.>gb:CAC314731_1644767 Colletotrichum acutatum partial
           H4 gene, exons 1-2, isolate 99.>gb:CSP314724_1674054
           Colletotrichum sp. partial H4 gene, exons 1-2, isolate
           5.>gb:CSP314725_1674055 Colletotrichum sp. partial H4
           gene, exons 1-2, isolate 2.>gb:CSP314727_1674056
           Colletotrichum sp. partial H4 gene, exons 1-2, isolate
           3.>gb:CSP314733_1674058 Colletotrichum sp. partial H4
           gene, exons 1-2, isolate 46.>gb:CSP314734_1674059
           Colletotrichum sp. partial H4 gene, exons 1-2, isolate
           1.>gb:CSP314735_1674060 Colletotrichum sp. partial H4
           gene, exons 1-2, isolate 19.
          Length = 64

 Score =  114 bits (284), Expect = 1e-24
 Identities = 57/64 (89%), Positives = 61/64 (95%)
 Frame = +2

Query: 161 AIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           AIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RKTVT++DVVYALKR
Sbjct: 1   AIRRLARRGGVKRISAVIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKR 60

Query: 341 QGRT 352
           QGRT
Sbjct: 61  QGRT 64



>gb:AE017150_1029757 Trypanosoma brucei chromosome 2, complete
           sequence.>gb:AE017168_1229957 Trypanosoma brucei
           chromosome 2, section 2 of 4 of the complete sequence.
          Length = 100

 Score =  114 bits (284), Expect = 1e-24
 Identities = 52/80 (65%), Positives = 71/80 (88%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDN++GIT+ +IRRLARR GVKRISG+IY+E RGVLK F+E+++RDA  YTE++R+KT
Sbjct: 20  VLRDNVRGITRGSIRRLARRAGVKRISGVIYDEVRGVLKTFVESIVRDAGAYTEYSRKKT 79

Query: 305 VTAMDVVYALKRQGRTLYGF 364
           VTA  VV+AL+++G+ LYG+
Sbjct: 80  VTAAHVVFALRKRGKVLYGY 99



>gb:MMHISH4S_2115302 Mouse histone H4 gene 3' region with signals
           involved in mRNA processing.
          Length = 55

 Score =  110 bits (275), Expect = 1e-23
 Identities = 53/55 (96%), Positives = 55/55 (100%)
 Frame = +2

Query: 206 GLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 370
           GLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRTLYGFGG
Sbjct: 1   GLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 55



>pir|I48404|I48404 histone H4 (55AA) (1 is 3rd base in codon) -
           mouse  (fragment)
          Length = 55

 Score =  110 bits (275), Expect = 1e-23
 Identities = 53/55 (96%), Positives = 55/55 (100%)
 Frame = +2

Query: 206 GLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG 370
           GLIYEETRGVLK+FLENVIRDAVTYTEHA+RKTVTAMDVVYALKRQGRTLYGFGG
Sbjct: 1   GLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 55



>gb:EEJ004711_1384269 Euplotes eurystomus DNA for histone H4 gene.
          Length = 71

 Score =  109 bits (273), Expect = 2e-23
 Identities = 54/65 (83%), Positives = 60/65 (92%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LR+ I G+TKPAIRRLARRGGVKRIS L+YEETR VLK FLENVIRD+VTYTEHA+RKTV
Sbjct: 7   LRETILGVTKPAIRRLARRGGVKRISSLVYEETRAVLKGFLENVIRDSVTYTEHAKRKTV 66

Query: 308 TAMDV 322
           TA+DV
Sbjct: 67  TALDV 71



>gb:EEJ004712_1384270 Euplotes eurystomus DNA for histone H4 gene.
          Length = 71

 Score =  108 bits (269), Expect = 6e-23
 Identities = 53/64 (82%), Positives = 59/64 (92%)
 Frame = +2

Query: 131 RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVT 310
           R+ I G+TKPAIRRLARRGGVKRIS L+YEETR VLK FLENVIRD+VTYTEHA+RKTVT
Sbjct: 8   RETILGVTKPAIRRLARRGGVKRISSLVYEETRAVLKGFLENVIRDSVTYTEHAKRKTVT 67

Query: 311 AMDV 322
           A+DV
Sbjct: 68  ALDV 71



>gb:EVJ004707_1385013 Euplotes vannus DNA for histone H4 gene.
          Length = 71

 Score =  107 bits (268), Expect = 8e-23
 Identities = 53/65 (81%), Positives = 60/65 (92%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LR+ I G+TKPAIRRLARRGGVKRIS L+YEETR VLK FLE+VIRD+VTYTEHA+RKTV
Sbjct: 7   LRETILGVTKPAIRRLARRGGVKRISSLVYEETRAVLKGFLESVIRDSVTYTEHAKRKTV 66

Query: 308 TAMDV 322
           TA+DV
Sbjct: 67  TALDV 71



>gb:EMJ004708_1384633 Euplotes minuta DNA for histone H4 gene.
          Length = 71

 Score =  107 bits (268), Expect = 8e-23
 Identities = 53/65 (81%), Positives = 60/65 (92%)
 Frame = +2

Query: 128 LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTV 307
           LR+ I G+TKPAIRRLARRGGVKRIS L+YEETR VLK FLE+VIRD+VTYTEHA+RKTV
Sbjct: 7   LRETILGVTKPAIRRLARRGGVKRISSLVYEETRAVLKGFLESVIRDSVTYTEHAKRKTV 66

Query: 308 TAMDV 322
           TA+DV
Sbjct: 67  TALDV 71



>gb:LMFL7845_1388388 Leishmania major Friedlin chromosome 35 cosmid
           L7845.
          Length = 100

 Score =  106 bits (265), Expect = 2e-22
 Identities = 50/80 (62%), Positives = 66/80 (82%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNI+GIT+  +RR+ARRGGVKRIS  +YEE R VLK ++E+++R +  YTE+AR+KT
Sbjct: 20  VLRDNIRGITRGCVRRMARRGGVKRISSEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKT 79

Query: 305 VTAMDVVYALKRQGRTLYGF 364
           VTA DVV AL++QG  LYG+
Sbjct: 80  VTACDVVTALRKQGHILYGY 99



>gb:CSP314736_1674061 Colletotrichum sp. partial H4 gene, exons 1-2,
           isolate 30.
          Length = 60

 Score =  105 bits (263), Expect = 3e-22
 Identities = 53/60 (88%), Positives = 57/60 (95%)
 Frame = +2

Query: 161 AIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           AIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RKTVT++DVVYALKR
Sbjct: 1   AIRRLARRGGVKRISAVIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKR 60



>gb:LIH42HIST_1387522 Leishmania infantum cDNA for H4 histone gene.
          Length = 100

 Score =  105 bits (263), Expect = 3e-22
 Identities = 50/80 (62%), Positives = 66/80 (82%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNI+GIT+  +RR+ARRGGVKRIS  +YEE R VLK ++E+++R +  YTE+AR+KT
Sbjct: 20  VLRDNIRGITRGCVRRMARRGGVKRISTEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKT 79

Query: 305 VTAMDVVYALKRQGRTLYGF 364
           VTA DVV AL++QG  LYG+
Sbjct: 80  VTASDVVTALRKQGHILYGY 99



>gb:LIH41HIST_1387521 Leishmania infantum cDNA for H4 Histone gene.
          Length = 100

 Score =  105 bits (263), Expect = 3e-22
 Identities = 50/80 (62%), Positives = 66/80 (82%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNI+GIT+  +RR+ARRGGVKRIS  +YEE R VLK ++E+++R +  YTE+AR+KT
Sbjct: 20  VLRDNIRGITRGCVRRMARRGGVKRISTEVYEEVRRVLKAYVEDIVRCSTAYTEYARKKT 79

Query: 305 VTAMDVVYALKRQGRTLYGF 364
           VTA DVV AL++QG  LYG+
Sbjct: 80  VTACDVVTALRKQGHILYGY 99



>gb:AF175386_1247681 Leishmania tarentolae histone H4 mRNA, complete
           cds.
          Length = 100

 Score =  105 bits (263), Expect = 3e-22
 Identities = 50/80 (62%), Positives = 67/80 (83%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNI+GIT+  +RR+ARRGGVKRIS  IYEE R VLK ++E+++R +  YTE+AR+KT
Sbjct: 20  VLRDNIRGITRGCVRRMARRGGVKRISSEIYEEVRRVLKAYVEDIVRCSTAYTEYARKKT 79

Query: 305 VTAMDVVYALKRQGRTLYGF 364
           VTA DVV AL+++G+ LYG+
Sbjct: 80  VTASDVVNALRKRGQILYGY 99



>gb:AX886577_1482030 Sequence 2440 from Patent EP1033401.
          Length = 73

 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 48/51 (94%), Positives = 49/51 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           VLRDNIQGITKPAIR LARRGG KRISGLIYEETRGVLK+FLENVIRDAVT
Sbjct: 22  VLRDNIQGITKPAIRXLARRGGXKRISGLIYEETRGVLKVFLENVIRDAVT 72



>gb:CR382132_1664942 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 84

 Score = 95.1 bits (235), Expect = 6e-19
 Identities = 47/74 (63%), Positives = 58/74 (78%)
 Frame = +2

Query: 143 QGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDV 322
           +GI KP IRRLARRGGVKRIS  I  ++R ++K  ++ V+ DA+ YT HARR TVT +DV
Sbjct: 9   KGINKPTIRRLARRGGVKRISSNIDPDSRDIVKDVIKQVLGDALFYTHHARRNTVTGVDV 68

Query: 323 VYALKRQGRTLYGF 364
           V+ALKRQGR LYGF
Sbjct: 69  VHALKRQGRPLYGF 82



>gb:AY233060_1311489 Blepharisma americanum paralog 3 histone H4
           gene, partial cds.
          Length = 50

 Score = 92.8 bits (229), Expect = 3e-18
 Identities = 43/50 (86%), Positives = 49/50 (98%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKR+SGL+Y+ETR VLK+FLENV+RDAVTYTEHARRKTVTA+
Sbjct: 1   RRLARRGGVKRLSGLVYDETRNVLKVFLENVVRDAVTYTEHARRKTVTAL 50



>gb:AY559145_1335325 Succinea putris isolate 33 histone H3 and
           histone H4 genes, partial cds.>gb:AY559146_1335327
           Succinea putris isolate 53 histone H3 and histone H4
           genes, partial cds.>gb:AY559147_1335329 Trichia villosa
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559148_1335331 Punctum pygmaeum histone H3 and
           histone H4 genes, partial cds.>gb:AY559149_1335333
           Cochlodina laminata histone H3 and histone H4 genes,
           partial cds.>gb:AY559150_1335335 Azeca goodalli histone
           H3 and histone H4 genes, partial
           cds.>gb:AY559151_1335337 Truncatellina cylindrica
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559152_1335339 Columella edentula isolate 1
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559153_1335341 Columella edentula isolate 48
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559154_1335343 Columella edentula isolate 15
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559155_1335345 Pupilla muscorum histone H3 and
           histone H4 genes, partial cds.>gb:AY559156_1335347
           Cochlicopa nitens histone H3 and histone H4 genes,
           partial cds.>gb:AY559157_1335349 Cochlicopa lubricella
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559158_1335351 Cochlicopa lubrica isolate 1
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559159_1335353 Cochlicopa lubrica isolate 2
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559160_1335355 Vertigo antivertigo isolate 1
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559161_1335357 Vertigo antivertigo isolate 6
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559162_1335359 Vertigo antivertigo isolate 5
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559163_1335361 Acanthinula aculeata histone H3
           and histone H4 genes, partial cds.>gb:AY559164_1335363
           Ena montana histone H3 and histone H4 genes, partial
           cds.>gb:AY559165_1335365 Vallonia costata histone H3 and
           histone H4 genes, partial cds.>gb:AY559166_1335367
           Vallonia enniensis histone H3 and histone H4 genes,
           partial cds.>gb:AY559167_1335369 Vallonia pulchella
           isolate 55 histone H3 and histone H4 genes, partial
           cds.>gb:AY559168_1335371 Vallonia pulchella isolate 9
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559169_1335373 Vallonia excentrica isolate 17
           histone H3 and histone H4 genes, partial
           cds.>gb:AY559170_1335375 Vallonia excentrica isolate 23
           histone H3 and histone H4 genes, partial cds.
          Length = 68

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 46/47 (97%), Positives = 47/47 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIR 265
           VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIR
Sbjct: 22  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIR 68



>gb:AF344869_1264197 Heterodera glycines histone Hgg-28 mRNA,
           partial cds.
          Length = 170

 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 43/80 (53%), Positives = 59/80 (73%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           +LRD+ + ITK +I RLARR GV RI+  +Y+E R  L+ +LE +IRDA  Y +H RRKT
Sbjct: 20  LLRDSAKKITKASILRLARRAGVARINARVYDEVRAALRSYLETIIRDAAIYCQHERRKT 79

Query: 305 VTAMDVVYALKRQGRTLYGF 364
           + + DVV+AL+RQG  +YGF
Sbjct: 80  MKSRDVVHALRRQGNLMYGF 99



>gb:AJ698352_1283769 Euplotes vannus macronuclear gene for histone
           H4, clone 01/09.1.
          Length = 125

 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 41/75 (54%), Positives = 58/75 (77%)
 Frame = +2

Query: 140 IQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMD 319
           + GI+  A++RLARRGG+KRIS  +YEE R +  +FLE ++ D+ +Y + A+RKT+  +D
Sbjct: 31  VSGISDGAMKRLARRGGIKRISADVYEELRKIYIVFLEKLVEDSYSYADCAKRKTIIPLD 90

Query: 320 VVYALKRQGRTLYGF 364
           VVYALKRQGR LYG+
Sbjct: 91  VVYALKRQGRNLYGY 105



>gb:AY233059_1311488 Blepharisma americanum paralog 2 histone H4
           gene, partial cds.>gb:AY233061_1311490 Blepharisma
           americanum paralog 4 histone H4 gene, partial cds.
          Length = 50

 Score = 90.9 bits (224), Expect = 1e-17
 Identities = 43/50 (86%), Positives = 48/50 (96%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKR+SGL+Y+ETR VLK FLENV+RDAVTYTEHARRKTVTA+
Sbjct: 1   RRLARRGGVKRLSGLVYDETRNVLKSFLENVVRDAVTYTEHARRKTVTAL 50



>gb:AY233062_1311491 Blepharisma americanum paralog 5 histone H4
           gene, partial cds.>gb:AY233063_1311492 Blepharisma
           americanum paralog 6 histone H4 gene, partial cds.
          Length = 50

 Score = 90.5 bits (223), Expect = 1e-17
 Identities = 42/50 (84%), Positives = 48/50 (96%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKR+SGL+Y+ETR VLK+FLE V+RDAVTYTEHARRKTVTA+
Sbjct: 1   RRLARRGGVKRLSGLVYDETRNVLKVFLEGVVRDAVTYTEHARRKTVTAL 50



>gb:BUJ004689_1358683 Blepharisma undulans DNA for histone H3 and H4
           genes.>gb:BUJ004690_1358685 Blepharisma undulans DNA for
           histone H3 and H4 genes.>gb:BUJ004691_1358687
           Blepharisma undulans DNA for histone H3 and H4 genes.
          Length = 74

 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 42/51 (82%), Positives = 49/51 (96%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           V+R+NIQGITKPAIRRLARRGGVKR+SGL+Y+ETR VLK+FLE V+RDAVT
Sbjct: 24  VIRENIQGITKPAIRRLARRGGVKRLSGLVYDETRNVLKVFLEGVVRDAVT 74



>gb:AY233064_1311493 Stentor sp. LLK-2003 histone H4 gene, partial
           cds.
          Length = 50

 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 43/50 (86%), Positives = 48/50 (96%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKR+SGLIY+ETR VLK FLENV+RD+VTYTEHARRKTVTA+
Sbjct: 1   RRLARRGGVKRLSGLIYDETRNVLKSFLENVVRDSVTYTEHARRKTVTAL 50



>gb:AY233050_1311479 Nyctotherus ovalis paralog 1 histone H4 gene,
           partial cds.
          Length = 50

 Score = 88.2 bits (217), Expect = 7e-17
 Identities = 41/50 (82%), Positives = 48/50 (96%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS L+Y++TR VLK+FLENVIRD+VTYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISALVYDDTRNVLKVFLENVIRDSVTYTEHAKRKTVTAL 50



>gb:AY233048_1311477 Sterkiella historiomuscorum paralog 1 histone
           H4 gene, partial cds.>gb:AY233049_1311478 Sterkiella
           historiomuscorum paralog 2 histone H4 gene, partial cds.
          Length = 50

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 43/50 (86%), Positives = 47/50 (94%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS LIYEETR VL+ FLENVIRD+VTYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISSLIYEETRNVLRSFLENVIRDSVTYTEHAKRKTVTAL 50



>gb:CGL314726_1646397 Colletotrichum gloeosporioides partial H4
           gene, exons 1-2, isolate 85.
          Length = 50

 Score = 87.4 bits (215), Expect = 1e-16
 Identities = 44/50 (88%), Positives = 46/50 (92%)
 Frame = +2

Query: 161 AIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVT 310
           AIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYTEHA+RK VT
Sbjct: 1   AIRRLARRGGVKRISAVIYEETRGVLKSFLEGVIRDAVTYTEHAKRKKVT 50



>gb:AY233079_1311508 Pleuronema sp. LLK-2003 paralog 1 clone 1
           histone H4 gene, partial cds.>gb:AY233080_1311509
           Pleuronema sp. LLK-2003 paralog 1 clone 2 histone H4
           gene, partial cds.
          Length = 50

 Score = 87.4 bits (215), Expect = 1e-16
 Identities = 41/50 (82%), Positives = 46/50 (92%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS  IY++TR VLK+FLEN++RDAVTY EHARRKTVTAM
Sbjct: 1   RRLARRGGVKRISSFIYDDTRSVLKVFLENIVRDAVTYCEHARRKTVTAM 50



>gb:AY233055_1311484 Nyctotherus ovalis paralog 5 histone H4 gene,
           partial cds.
          Length = 50

 Score = 87.4 bits (215), Expect = 1e-16
 Identities = 42/50 (84%), Positives = 47/50 (94%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS L+Y+ETR VLK FLENV+RDAVTYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISSLVYDETRNVLKGFLENVVRDAVTYTEHAKRKTVTAL 50



>gb:CAC314723_1644764 Colletotrichum acutatum partial H4 gene, exon
           1, isolate 90.
          Length = 48

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 42/48 (87%), Positives = 46/48 (95%)
 Frame = +2

Query: 209 LIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRT 352
           +IYEETRGVLK FLE VIRDAVTYTEHA+RKTVT++DVVYALKRQGRT
Sbjct: 1   VIYEETRGVLKSFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRT 48



>gb:AY233073_1311502 Halteria grandinella paralog 1 clone 1 histone
           H4 gene, partial cds.>gb:AY233074_1311503 Halteria
           grandinella paralog 1 clone 2 histone H4 gene, partial
           cds.
          Length = 50

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 41/50 (82%), Positives = 47/50 (94%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS LIYEETR VL+ FLENV+RD++TYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISALIYEETRNVLRGFLENVVRDSITYTEHAKRKTVTAL 50



>gb:AY233057_1311486 Moneuplotes crassus paralog 2 histone H4 gene,
           partial cds.
          Length = 50

 Score = 85.9 bits (211), Expect = 3e-16
 Identities = 42/50 (84%), Positives = 47/50 (94%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS L+YEETR VLK FLE+VIRD+VTYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISSLVYEETRAVLKGFLESVIRDSVTYTEHAKRKTVTAL 50



>gb:AY233053_1311482 Nyctotherus ovalis paralog 3 histone H4 gene,
           partial cds.
          Length = 50

 Score = 85.9 bits (211), Expect = 3e-16
 Identities = 41/50 (82%), Positives = 46/50 (92%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVK IS L+Y+ETR VLK FLENV+RDAVTYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKHISSLVYDETRTVLKTFLENVVRDAVTYTEHAKRKTVTAL 50



>gb:PMHIS8_1395448 Sea urchin (P. miliaris) gene for histones H1,
           H4, H2B, H3 and H2A (in that order, with many gaps).
           (see also  for allelic sequence.).
          Length = 66

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENV 259
           VLRDNIQGITKPAIRRLARRG VKRISGLIYEETRGVLK+FLENV
Sbjct: 22  VLRDNIQGITKPAIRRLARRGVVKRISGLIYEETRGVLKVFLENV 66



>gb:AY675294_1345556 Deroceras reticulatum histone H4 gene, partial
           cds.>gb:AY675296_1345557 Tegenaria domestica histone H4
           gene, partial cds.>gb:AY675263_1432296 Felis catus
           histone H4 gene, partial cds.>gb:AY675264_1432297 Vulpes
           zerda histone H4 gene, partial cds.>gb:AY675265_1432298
           Canis familiaris histone H4 gene, partial
           cds.>gb:AY675268_1432299 Bos indicus histone H4 gene,
           partial cds.>gb:AY675282_1432302 Mammuthus primigenius
           histone H4 gene, partial cds.>gb:AY675283_1432303
           Mammuthus primigenius histone H4 gene, partial
           cds.>gb:AY675285_1432305 Mammuthus primigenius histone
           H4 gene, partial cds.>gb:AY675286_1432306 Mammuthus
           primigenius histone H4 gene, partial
           cds.>gb:AY675288_1432308 Mammuthus primigenius histone
           H4 gene, partial cds.>gb:AY675289_1432309 Mammuthus
           primigenius histone H4 gene, partial
           cds.>gb:AY675262_1958686 Saimiri sciureus histone H4
           gene, partial cds.>gb:AY675266_1958687 Cercopithecus
           aethiops histone H4 gene, partial
           cds.>gb:AY675270_1958688 Pan troglodytes histone H4
           gene, partial cds.>gb:AY675271_1958689 Homo sapiens
           histone H4 gene, partial cds.>gb:AY675273_1958690 Macaca
           mulatta histone H4 gene, partial
           cds.>gb:AY675295_1958693 Homo sapiens histone H4 gene,
           partial cds.>gb:AY675269_2087602 Marmota monax histone
           H4 gene, partial cds.>gb:AY675272_2087603 Mus musculus
           histone H4 gene, partial cds.>gb:AY675260_2543410 Gallus
           gallus histone H4 gene, partial cds.>gb:AY675261_2543411
           Coturnix japonica histone H4 gene, partial
           cds.>gb:AY675267_2543412 Xenopus laevis histone H4 gene,
           partial cds.>gb:AY675274_2543413 Lonchura domestica
           histone H4 gene, partial cds.>gb:AY675275_2543414 Mabuya
           quinquetaeniata histone H4 gene, partial
           cds.>gb:AY675280_2543415 Tupinambis rufescens histone H4
           gene, partial cds.>gb:AY675290_2543416 Agama agama
           histone H4 gene, partial cds.>gb:AY675291_2543417 Bufo
           bufo histone H4 gene, partial cds.>gb:AY675293_2543418
           Carassius auratus histone H4 gene, partial cds.
          Length = 43

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 42/43 (97%), Positives = 43/43 (100%)
 Frame = +2

Query: 155 KPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYT 283
           KPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTYT
Sbjct: 1   KPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT 43



>gb:AY233081_1311510 Pleuronema sp. LLK-2003 paralog 2 histone H4
           gene, partial cds.
          Length = 50

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 40/50 (80%), Positives = 45/50 (90%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKR S  IY++TR VLK+FLEN++RDAVTY EHARRKTVTAM
Sbjct: 1   RRLARRGGVKRTSSFIYDDTRSVLKVFLENIVRDAVTYCEHARRKTVTAM 50



>gb:AY233047_1311476 Strombidium sp. LLK-2003 histone H4 gene,
           partial cds.
          Length = 50

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 42/50 (84%), Positives = 47/50 (94%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS LIY+ETR VL+ FLENVIRD+VTYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISSLIYDETRVVLRSFLENVIRDSVTYTEHAKRKTVTAL 50



>gb:AY233056_1311485 Moneuplotes crassus paralog 1 histone H4 gene,
           partial cds.
          Length = 50

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 41/50 (82%), Positives = 47/50 (94%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS L+YEE+R VLK FLE+VIRD+VTYTEHA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISSLVYEESRAVLKGFLESVIRDSVTYTEHAKRKTVTAL 50



>gb:AY675292_1958692 Callithrix geoffroyi histone H4 gene, partial
           cds.
          Length = 43

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 41/42 (97%), Positives = 42/42 (100%)
 Frame = +2

Query: 155 KPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTY 280
           KPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVTY
Sbjct: 1   KPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY 42



>gb:AY675276_1345554 Planorbis corneus histone H4 gene, partial cds.
          Length = 43

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 41/43 (95%), Positives = 43/43 (100%)
 Frame = +2

Query: 155 KPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYT 283
           KPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVT+T
Sbjct: 1   KPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTHT 43



>gb:AY233082_1311511 Pleuronema sp. LLK-2003 paralog 3 histone H4
           gene, partial cds.
          Length = 49

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 39/49 (79%), Positives = 44/49 (89%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTA 313
           RRLARRGGVKRIS  IY++TR VLK+FLEN++RDAV Y EHARRKTVTA
Sbjct: 1   RRLARRGGVKRISSFIYDDTRSVLKVFLENIVRDAVAYCEHARRKTVTA 49



>gb:AY675277_1958691 Saguinus oedipus histone H4 gene, partial cds.
          Length = 43

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 41/43 (95%), Positives = 42/43 (97%)
 Frame = +2

Query: 155 KPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYT 283
           KPAIRRLA RGGVKRISGLIYEETRGVLK+FLENVIRDAVTYT
Sbjct: 1   KPAIRRLACRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT 43



>gb:AY675279_1432300 Suricata suricatta histone H4 gene, partial
           cds.
          Length = 43

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 40/43 (93%), Positives = 43/43 (100%)
 Frame = +2

Query: 155 KPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYT 283
           KPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAV+Y+
Sbjct: 1   KPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVSYS 43



>gb:AY675278_1345555 Spodoptera frugiperda histone H4 gene, partial
           cds.
          Length = 43

 Score = 82.0 bits (201), Expect = 5e-15
 Identities = 41/43 (95%), Positives = 42/43 (97%)
 Frame = +2

Query: 155 KPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYT 283
           KPAIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDAVT T
Sbjct: 1   KPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTNT 43



>gb:AY233054_1311483 Nyctotherus ovalis paralog 4 histone H4 gene,
           partial cds.
          Length = 50

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 40/48 (83%), Positives = 42/48 (87%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVT 310
           RRLARRGGVKRIS LIY+ETR  LK FLENV+RDAVTYT HA RKTVT
Sbjct: 1   RRLARRGGVKRISSLIYDETRAALKTFLENVVRDAVTYTXHAXRKTVT 48



>gb:AF527985_1279431 Chilodonella uncinata clone 5 histone H4 (H4)
           gene, partial cds.>gb:AF527986_1279432 Chilodonella
           uncinata clone 6 histone H4 (H4) gene, partial
           cds.>gb:AF527987_1279433 Chilodonella uncinata clone 7
           histone H4 (H4) gene, partial cds.>gb:AF527988_1279434
           Chilodonella uncinata clone 8 histone H4 (H4) gene,
           partial cds.>gb:AF527989_1279435 Chilodonella uncinata
           clone 9 histone H4 (H4) gene, partial cds.
          Length = 50

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 41/50 (82%), Positives = 45/50 (90%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS LIYE +R +LK FLE VIRDA+TYTEHA+RKTVTAM
Sbjct: 1   RRLARRGGVKRISYLIYEYSREILKHFLEGVIRDAITYTEHAKRKTVTAM 50



>gb:AY233076_1311505 Halteria grandinella paralog 2 clone 2 histone
           H4 gene, partial cds.>gb:AY233077_1311506 Halteria
           grandinella paralog 3 histone H4 gene, partial
           cds.>gb:AY233078_1311507 Halteria grandinella paralog 4
           histone H4 gene, partial cds.
          Length = 50

 Score = 80.5 bits (197), Expect = 1e-14
 Identities = 39/50 (78%), Positives = 45/50 (90%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS LIYEE RGVLK FLE VI+D+VTY EH++RKTVT++
Sbjct: 1   RRLARRGGVKRISALIYEEARGVLKGFLETVIKDSVTYCEHSKRKTVTSL 50



>gb:AY233052_1311481 Nyctotherus ovalis paralog 2 clone 2 histone H4
           gene, partial cds.
          Length = 50

 Score = 80.5 bits (197), Expect = 1e-14
 Identities = 40/50 (80%), Positives = 44/50 (88%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RR+ARRGGV RI+GLIYEETR VLK FLE +IRD V YTEHARRKTVTA+
Sbjct: 1   RRIARRGGVLRINGLIYEETRYVLKDFLEKLIRDTVAYTEHARRKTVTAL 50



>gb:AY233051_1311480 Nyctotherus ovalis paralog 2 clone 1 histone H4
           gene, partial cds.
          Length = 50

 Score = 80.5 bits (197), Expect = 1e-14
 Identities = 40/50 (80%), Positives = 44/50 (88%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RR+ARRGGV RI+GLIYEETR VLK FLE +IRD V YTEHARRKTVTA+
Sbjct: 1   RRMARRGGVLRINGLIYEETRYVLKDFLEKLIRDTVAYTEHARRKTVTAL 50



>gb:PTJ004713_1395966 Prorodon teres DNA for histone H3 and H4
           genes.
          Length = 75

 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 38/49 (77%), Positives = 44/49 (89%)
 Frame = +2

Query: 131 RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           + NI+GITKPAIRRLARRGGVKRIS  IY++TR VLK FLENV+RD+VT
Sbjct: 27  KQNIEGITKPAIRRLARRGGVKRISSFIYDDTRAVLKSFLENVVRDSVT 75



>gb:PSJ004701_1395774 Protocruzia sp. DNA for histone H4 gene.
          Length = 53

 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 39/47 (82%), Positives = 44/47 (93%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIR 265
           VLR++IQGITKPAIRRLARRGGVKRIS LIY+ETR VL+ FLENV+R
Sbjct: 7   VLRESIQGITKPAIRRLARRGGVKRISQLIYDETRNVLRSFLENVVR 53



>gb:AY675281_1432301 Mammuthus primigenius histone H4 gene, partial
           cds.>gb:AY675284_1432304 Mammuthus primigenius histone
           H4 gene, partial cds.>gb:AY675287_1432307 Mammuthus
           primigenius histone H4 gene, partial cds.
          Length = 43

 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 39/43 (90%), Positives = 40/43 (93%)
 Frame = +2

Query: 155 KPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYT 283
           KPAIRRLARRGGVKRIS +IYEETRGVLK FLE VIRDAVTYT
Sbjct: 1   KPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYT 43



>gb:PTJ004714_1395968 Prorodon teres DNA for histone H3 and H4
           genes.
          Length = 73

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 37/49 (75%), Positives = 44/49 (89%)
 Frame = +2

Query: 131 RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           + +I+GITKPAIRRLARRGGVKRIS  IY++TR VLK FLENV+RD+VT
Sbjct: 25  KQSIEGITKPAIRRLARRGGVKRISSFIYDDTRAVLKSFLENVVRDSVT 73



>gb:OGJ004696_1391217 Obertrumia georgiana DNA for histone H3 and H4
           genes.
          Length = 73

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 37/47 (78%), Positives = 43/47 (91%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           +I+GITKPAIRRLARRGGVKRIS  IY++TR VLK FLENV++DAVT
Sbjct: 27  SIEGITKPAIRRLARRGGVKRISSFIYDDTRAVLKNFLENVVKDAVT 73



>gb:CCJ004692_1359455 Colpidium campylum DNA for histone H3 and H4
           genes.>gb:CCJ004693_1359457 Colpidium campylum DNA for
           histone H3 and H4 genes.>gb:CCJ004694_1359459 Colpidium
           campylum DNA for histone H3 and H4 genes.
          Length = 72

 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 37/47 (78%), Positives = 43/47 (91%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           +I+GITKPAIRRLARRGGVKRIS  IY+++R VLK FLENV+RDAVT
Sbjct: 26  SIEGITKPAIRRLARRGGVKRISSFIYDDSRQVLKSFLENVVRDAVT 72



>gb:AY233083_1311512 Tokophrya lemnarum clone 1 histone H4 gene,
           partial cds.
          Length = 50

 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 38/50 (76%), Positives = 44/50 (88%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS  IY+E R VL+ FL +V+RD++TYTEHARRKTVTAM
Sbjct: 1   RRLARRGGVKRISFNIYKEIRDVLQGFLRSVVRDSITYTEHARRKTVTAM 50



>gb:AF527981_1279427 Chilodonella uncinata clone 1 histone H4 (H4)
           gene, partial cds.>gb:AF527982_1279428 Chilodonella
           uncinata clone 2 histone H4 (H4) gene, partial
           cds.>gb:AF527984_1279430 Chilodonella uncinata clone 4
           histone H4 (H4) gene, partial cds.
          Length = 50

 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 37/50 (74%), Positives = 44/50 (88%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS  IY+ +R VLK FL+ V++DA+TYTEHA+RKTVTAM
Sbjct: 1   RRLARRGGVKRISYYIYDYSRDVLKGFLQGVVKDAITYTEHAKRKTVTAM 50



>gb:OGJ004695_1391215 Obertrumia georgiana DNA for histone H3 and H4
           genes.
          Length = 73

 Score = 75.5 bits (184), Expect = 5e-13
 Identities = 36/47 (76%), Positives = 43/47 (91%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           +I+GITKPAIRRLARRGGVKRIS  IY+++R VLK FLENV++DAVT
Sbjct: 27  SIEGITKPAIRRLARRGGVKRISSFIYDDSRAVLKNFLENVVKDAVT 73



>gb:CCJ004698_1359461 Colpoda cucullus DNA for histone H3 and H4
           genes.
          Length = 78

 Score = 75.5 bits (184), Expect = 5e-13
 Identities = 37/47 (78%), Positives = 42/47 (89%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           +I+GITKPAIRRLARRGGVKRIS  IY++TR VLK FLENV+RDA T
Sbjct: 32  SIEGITKPAIRRLARRGGVKRISTFIYDDTRAVLKGFLENVVRDATT 78



>gb:AY233084_1311513 Tokophrya lemnarum clone 2 histone H4 gene,
           partial cds.
          Length = 50

 Score = 75.5 bits (184), Expect = 5e-13
 Identities = 38/50 (76%), Positives = 43/50 (86%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS  IY+E R VL+ FL +V+RD +TYTEHARRKTVTAM
Sbjct: 1   RRLARRGGVKRISFNIYKEIRDVLQGFLRSVVRDPITYTEHARRKTVTAM 50



>gb:OGJ004697_1391219 Obertrumia georgiana DNA for histone H3 and H4
           genes.
          Length = 73

 Score = 75.1 bits (183), Expect = 6e-13
 Identities = 36/47 (76%), Positives = 42/47 (89%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           +I+GITKPAIRRLARRGGVKR S  IY++TR VLK FLENV++DAVT
Sbjct: 27  SIEGITKPAIRRLARRGGVKRTSSFIYDDTRAVLKNFLENVVKDAVT 73



>gb:AY233058_1311487 Blepharisma americanum paralog 1 histone H4
           gene, partial cds.
          Length = 50

 Score = 75.1 bits (183), Expect = 6e-13
 Identities = 36/50 (72%), Positives = 44/50 (88%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           +RLARRGGVKRIS L+Y+ TR V+K FL  VI+DAVTYT+HARR+TVTA+
Sbjct: 1   KRLARRGGVKRISSLVYDLTRDVIKEFLNCVIKDAVTYTDHARRRTVTAL 50



>gb:AY233085_1311514 Tokophrya lemnarum clone 3 histone H4 gene,
           partial cds.
          Length = 50

 Score = 74.7 bits (182), Expect = 8e-13
 Identities = 37/50 (74%), Positives = 44/50 (88%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGV+RIS  IY+E R VL+ FL +V+RD++TYTEHARRKTVTAM
Sbjct: 1   RRLARRGGVERISFNIYKEIRDVLQGFLRSVVRDSITYTEHARRKTVTAM 50



>gb:AY233072_1311501 Heliophrya erhardi paralog 3 histone H4 gene,
           partial cds.
          Length = 50

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 36/50 (72%), Positives = 43/50 (86%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS  IY++ R VL  FL NV+RDA+TYT+HA+RKTVTA+
Sbjct: 1   RRLARRGGVKRISFSIYKQVREVLAGFLRNVVRDAITYTDHAKRKTVTAL 50



>gb:AY233070_1311499 Heliophrya erhardi paralog 1 clone 3 histone H4
           gene, partial cds.
          Length = 50

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 35/50 (70%), Positives = 41/50 (82%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RR+ARRGGVKRIS  IYE  R V+  FL  V+RDA+TYT+HA+RKTVTAM
Sbjct: 1   RRMARRGGVKRISFSIYENVREVMNCFLRGVVRDAITYTDHAKRKTVTAM 50



>gb:AY233067_1311496 Bursaria truncatella paralog 2 clone 2 histone
           H4 gene, partial cds.
          Length = 44

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 35/44 (79%), Positives = 39/44 (88%)
 Frame = +2

Query: 185 GGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           GGVKRIS  IY++TR VLK FLENV+RDA TYTEHA+RKTVTAM
Sbjct: 1   GGVKRISTFIYDDTRAVLKSFLENVVRDATTYTEHAKRKTVTAM 44



>gb:AF527983_1279429 Chilodonella uncinata clone 3 histone H4 (H4)
           gene, partial cds.
          Length = 50

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 36/50 (72%), Positives = 43/50 (86%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS  IY+ +R VLK F + V++DA+TYTEHA+RKTVTAM
Sbjct: 1   RRLARRGGVKRISYYIYDYSRDVLKGFPQGVVKDAITYTEHAKRKTVTAM 50



>gb:AY233075_1311504 Halteria grandinella paralog 2 clone 1 histone
           H4 gene, partial cds.
          Length = 50

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 33/50 (66%), Positives = 45/50 (90%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLAR+GGVKRIS LIY ET+ +++ +L+++IRD +TYTEHA+RKTVTA+
Sbjct: 1   RRLARKGGVKRISSLIYCETKVIIQYYLQDLIRDIITYTEHAKRKTVTAL 50



>gb:AF008301_2468434 Ambystoma mexicanum histone H4 (H4) mRNA,
           partial cds.
          Length = 37

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 36/37 (97%), Positives = 37/37 (100%)
 Frame = +2

Query: 161 AIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDA 271
           AIRRLARRGGVKRISGLIYEETRGVLK+FLENVIRDA
Sbjct: 1   AIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA 37



>gb:AY233068_1311497 Heliophrya erhardi paralog 1 clone 1 histone H4
           gene, partial cds.
          Length = 50

 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 34/50 (68%), Positives = 41/50 (82%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RR+ARRGGVKRIS  IY+  R V+  FL  V+RDA+TYT+HA+RKTVTAM
Sbjct: 1   RRMARRGGVKRISFSIYKNVREVMNCFLRGVVRDAITYTDHAKRKTVTAM 50



>gb:AY233071_1311500 Heliophrya erhardi paralog 2 histone H4 gene,
           partial cds.
          Length = 50

 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 33/50 (66%), Positives = 44/50 (88%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           RRLARRGGVKRIS  IY++ R V+  FL++V++D++TY+EHA+RKTVTAM
Sbjct: 1   RRLARRGGVKRISFSIYKQVREVIACFLKSVVKDSITYSEHAKRKTVTAM 50



>gb:AY233069_1311498 Heliophrya erhardi paralog 1 clone 2 histone H4
           gene, partial cds.
          Length = 49

 Score = 71.2 bits (173), Expect = 9e-12
 Identities = 34/49 (69%), Positives = 40/49 (81%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTA 313
           RRLARRGGVKRIS  IY+  R V+  FL  V+RDA+TYT+HA+RKTVTA
Sbjct: 1   RRLARRGGVKRISFSIYKNVREVMNCFLRGVVRDAITYTDHAKRKTVTA 49



>gb:PMHIS7_1395441 Sea urchin (P. miliaris) gene for histones H4,
           H2B, H3, H2A and H1 (in that order, containing many
           sequence gaps). (see also  for allelic
           sequence.).>gb:SUPHISP01_1398207 Psammechinus miliaris
           histone H4 gene, complete cds.
          Length = 103

 Score = 69.7 bits (169), Expect = 3e-11
 Identities = 40/82 (48%), Positives = 40/82 (48%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKT 304
           VLRDNIQGITKPAIRRL        ISGLIYEETRGVLK                     
Sbjct: 22  VLRDNIQGITKPAIRRLXXXXXXXXISGLIYEETRGVLKXXXXXXXXXXXXXXXXXXXXX 81

Query: 305 VTAMDVVYALKRQGRTLYGFGG 370
                        GRTLYGFGG
Sbjct: 82  XXXXXXXXXXXXXGRTLYGFGG 103



>gb:CNS07EGI_1374432 chromosome IX of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 103

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 29/72 (40%), Positives = 47/72 (65%)
 Frame = +2

Query: 149 ITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVY 328
           I+KPAIRR+ARR GV+R+ G  ++E     + ++ + +  A  Y  HA+RKT+T  D+++
Sbjct: 32  ISKPAIRRIARRAGVRRVGGGCFKEINNAAREYIRDTLSIACIYATHAKRKTITCSDILH 91

Query: 329 ALKRQGRTLYGF 364
           +LKR G    G+
Sbjct: 92  SLKRMGIKYIGY 103



>gb:AY233066_1311495 Bursaria truncatella paralog 2 clone 1 histone
           H4 gene, partial cds.
          Length = 40

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 32/40 (80%), Positives = 35/40 (87%)
 Frame = +2

Query: 167 RRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTE 286
           RRLARRGGVKRIS  IY++TR VLK FLENV+RDA TYTE
Sbjct: 1   RRLARRGGVKRISTFIYDDTRAVLKSFLENVVRDATTYTE 40



>gb:AY233065_1311494 Bursaria truncatella paralog 1 histone H4 gene,
           partial cds.
          Length = 39

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 30/39 (76%), Positives = 34/39 (87%)
 Frame = +2

Query: 200 ISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           IS  IY++TR VLK FLENV+RDA TYTEHA+RKTVTAM
Sbjct: 1   ISTFIYDDTRAVLKSFLENVVRDATTYTEHAKRKTVTAM 39



>gb:HSHISH4_2013819 Human histone H4 gene.
          Length = 102

 Score = 62.4 bits (150), Expect(2) = 3e-09
 Identities = 31/58 (53%), Positives = 40/58 (68%)
 Frame = +1

Query: 193 EAYLRPHLRGDSRRPQDLPRERHPRRCYLH*ARSPEDGHRNGRRLCSQETGPHSVRIR 366
           EA+LRPHLRGDSR  + +  ER+P R  L+ AR  +DGHR+G  L +Q  GPH +R R
Sbjct: 44  EAHLRPHLRGDSRGAEGVLGERNPGRRNLYRARQAQDGHRHGCGLRAQAPGPHPLRFR 101



 Score = 20.8 bits (42), Expect(2) = 3e-09
 Identities = 10/35 (28%), Positives = 14/35 (40%)
 Frame = +3

Query: 63  CLGXXXXXXXXXXXXXNDTVRSSGTTSKASRSRPF 167
           CL              + TV+   T S AS ++PF
Sbjct: 1   CLAAAKAGRALAKAALSATVKYCATISMASPNQPF 35



>pir|A02650|A02650 histone H4 - Tetrahymena thermophila (fragments)
          Length = 66

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 36/72 (50%), Positives = 40/72 (55%)
 Frame = +2

Query: 137 NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
           +I+GITKPAIRRLARRGGVKRIS  IY++                              M
Sbjct: 25  SIEGITKPAIRRLARRGGVKRISSFIYDD------------------------------M 54

Query: 317 DVVYALKRQGRT 352
           DVVYALKRQGRT
Sbjct: 55  DVVYALKRQGRT 66



>gb:CGR314728_1646433 Colletotrichum graminicola partial H4 gene,
           exons 1-2, isolate 74.
          Length = 34

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 30/34 (88%), Positives = 31/34 (91%)
 Frame = +2

Query: 161 AIRRLARRGGVKRISGLIYEETRGVLKIFLENVI 262
           AIRRLARRGGVKRIS +IYEETRGVLK FLE VI
Sbjct: 1   AIRRLARRGGVKRISAVIYEETRGVLKSFLEGVI 34



>gb:PBJ004702_1391718 Paramecium bursaria DNA for histone H4 gene.
          Length = 35

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 173 LARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           LARRGGVKRIS  IY++TR VLK FLE+V+RDAVT
Sbjct: 1   LARRGGVKRISSFIYDDTRNVLKSFLESVVRDAVT 35



>gb:PTJ004700_1395964 Paramecium tetraurelia DNA for histone H4
           gene.
          Length = 35

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 25/35 (71%), Positives = 31/35 (88%)
 Frame = +2

Query: 173 LARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           LARRGGVKRIS  +Y+++R VLK FLENV+RDA+T
Sbjct: 1   LARRGGVKRISSFLYDDSRNVLKSFLENVVRDAIT 35



>gb:PTJ004699_1395963 Paramecium tetraurelia DNA for histone H4
           gene.
          Length = 35

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 24/35 (68%), Positives = 30/35 (85%)
 Frame = +2

Query: 173 LARRGGVKRISGLIYEETRGVLKIFLENVIRDAVT 277
           LARRGGVK IS  +Y+++R VLK FLENV+RDA+T
Sbjct: 1   LARRGGVKTISSFLYDDSRNVLKSFLENVVRDAIT 35



>gb:CSP314732_1674057 Colletotrichum sp. partial H4 gene, exon 1,
           isolate 21.
          Length = 28

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 25/28 (89%), Positives = 26/28 (92%)
 Frame = +2

Query: 209 LIYEETRGVLKIFLENVIRDAVTYTEHA 292
           +IYEETRGVLK FLE VIRDAVTYTEHA
Sbjct: 1   VIYEETRGVLKSFLEGVIRDAVTYTEHA 28



>gb:DVU82930_1384014 Drosophila virilis histone H4 (H4) gene,
           partial cds.
          Length = 24

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 24/24 (100%), Positives = 24/24 (100%)
 Frame = +2

Query: 299 KTVTAMDVVYALKRQGRTLYGFGG 370
           KTVTAMDVVYALKRQGRTLYGFGG
Sbjct: 1   KTVTAMDVVYALKRQGRTLYGFGG 24



>gb:SPBC800_1720436 S.pombe chromosome II cosmid SPU41410.
          Length = 479

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQ 343
           IR+LA     K+I+G + EE     ++F + +  D   + +HA RKT+   DVV  +KRQ
Sbjct: 391 IRKLANSYSQKKIAGSVIEELTTASELFFKQIANDLSAFADHAHRKTIDTQDVVLLMKRQ 450



>sp|P80738|H4Y_BLEJA Histone H4 (Fragment).
          Length = 47

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 22/24 (91%), Positives = 24/24 (100%)
 Frame = +2

Query: 125 VLRDNIQGITKPAIRRLARRGGVK 196
           V+R+NIQGITKPAIRRLARRGGVK
Sbjct: 24  VIRENIQGITKPAIRRLARRGGVK 47



>gb:AF451898_2258022 Heliothis zea virus 1, complete genome.
          Length = 1111

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 26/70 (37%), Positives = 36/70 (51%)
 Frame = +2

Query: 137  NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAM 316
            +I  I K  IRR A R G+ RIS  +Y E   +++ F++ V R      E  +RKTV   
Sbjct: 910  SINFINKNIIRRFAERLGIDRISKDVYPELSRIIEFFMKEVKRRVTLLVECGKRKTVEIR 969

Query: 317  DVVYALKRQG 346
            D+   LK  G
Sbjct: 970  DIKSILKSVG 979



>gb:AF216837_1251830 Drosophila virilis clone p3.6-33 histone H4 and
           histone H2A genes, partial cds.>gb:AF216838S1_1251832
           Drosophila virilis clone p5.2-33 histone H4 gene,
           partial cds.>gb:AF216840_1251834 Drosophila virilis
           clone p5.3-33 histone H4 and histone H2A genes, partial
           cds.>gb:AF216841_1251836 Drosophila virilis clone
           p5.9-12 histone H4 and histone H2A genes, partial
           cds.>gb:AF216842S1_1251838 Drosophila virilis clone
           p7.0-33 histone H4 gene, partial
           cds.>gb:AF216844S1_1251840 Drosophila virilis clone
           p7.5-4 histone H4 gene, partial
           cds.>gb:AF216846S1_1251842 Drosophila virilis clone
           p8.0-4 histone H4 gene, partial cds.
          Length = 19

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +2

Query: 314 MDVVYALKRQGRTLYGFGG 370
           MDVVYALKRQGRTLYGFGG
Sbjct: 1   MDVVYALKRQGRTLYGFGG 19



>pir|C30309|C30309 histone H4 - Euplotes crassus (fragment)
          Length = 18

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 17/18 (94%), Positives = 18/18 (100%)
 Frame = +2

Query: 317 DVVYALKRQGRTLYGFGG 370
           DVVYALKRQG+TLYGFGG
Sbjct: 1   DVVYALKRQGKTLYGFGG 18



>sp|O28779|HAF2_ARCFU Probable archaeal histone
           A1-2.>pir|D69436|D69436 archaeal histone A1 (hpyA1-2)
           homolog - Archaeoglobus fulgidus>gb:AE000999_30408
           Archaeoglobus fulgidus DSM 4304 section 108 of 172 of
           the complete genome.>gb:AE000782_975376 Archaeoglobus
           fulgidus DSM 4304 complete genome.
          Length = 67

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 22/57 (38%), Positives = 33/57 (57%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYAL 334
           + RL R+ G +R+S    E+   VL+ +   V + AV   +H+ RKTVTA D+  AL
Sbjct: 9   VDRLIRKAGAERVSADAVEKMVEVLEDYAITVAKKAVEIAKHSGRKTVTADDIKLAL 65



>sp|P50485|HARA_PYRSG Archaeal histone A (Archaeal histone
           A1).>gb:PSU08837_161787 Pyrococcus GB-3a archaeal
           histone gene clone pKS392, complete cds.
          Length = 67

 Score = 38.1 bits (87), Expect = 0.082
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    EE   +L  +LE     V + AV +  HA RKTV A D+  A
Sbjct: 9   VDRLIRKAGAERVS----EEAAKILAEYLEEYAIEVSKKAVEFARHAGRKTVKAEDIKLA 64

Query: 332 LK 337
           +K
Sbjct: 65  IK 66



>pir|G69093|G69093 histone HMtA2 - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000927_29364
           Methanobacterium thermoautotrophicum from bases 1548720
           to 1560699 (section 133 of 148) of the complete
           genome.>gb:AE000666_926446 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 68

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           + R+ +  G +RIS    E    +L+   E + ++AV   +HA RKTV A D+  A K+
Sbjct: 9   VGRIIKNAGAQRISDDAREALAKILEEKGEEIAKEAVKLAKHAGRKTVKASDIELAAKK 67



>sp|O27731|HMT2_METTH DNA binding protein HMt-1.2 (Archaeal histone
           A2).
          Length = 67

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           + R+ +  G +RIS    E    +L+   E + ++AV   +HA RKTV A D+  A K+
Sbjct: 8   VGRIIKNAGAQRISDDAREALAKILEEKGEEIAKEAVKLAKHAGRKTVKASDIELAAKK 66



>sp|P48784|HFOB_METFO Archaeal histone B.>gb:MFU12929_143398
           Methanobacterium formicicum archaeal histone (hfoB)
           gene, complete cds.
          Length = 67

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/59 (37%), Positives = 31/59 (52%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           I R+ +  G +R+S    E     L+   E +  +AV   +HA RKTV A DV  A+KR
Sbjct: 8   IGRIIKNAGAERVSDDAREALAKALEEKGETIATEAVKLAKHAGRKTVKASDVELAVKR 66



>pir|G69209|G69209 histone-related protein HMtA1 - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000859_28517
           Methanobacterium thermoautotrophicum from bases 739092
           to 749403 (section 65 of 148) of the complete
           genome.>gb:MBFHMTA_142711 Methanobacterium
           thermoautotrophicum archeal histone, DNA binding protein
           (hmtA) gene, complete cds.>gb:AE000666_925599
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 68

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           + R+ +  G +RIS    E     L+   E + R AV   +HA RKTV A D+  A K+
Sbjct: 9   VGRIIKNAGAQRISDDAKEALAKALEEMGEEISRKAVELAKHAGRKTVKATDIEMAAKQ 67



>sp|P50483|HMT1_METTH DNA binding protein HMt-1.1 (Archaeal histone
           A1).
          Length = 67

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           + R+ +  G +RIS    E     L+   E + R AV   +HA RKTV A D+  A K+
Sbjct: 8   VGRIIKNAGAQRISDDAKEALAKALEEMGEEISRKAVELAKHAGRKTVKATDIEMAAKQ 66



>sp|Q9Y8I1|HARA_PYRKO Archaeal histone A (Archaeal histone
           A1).>gb:AB016003_2675 Pyrococcus kodakaraensis gene for
           archaeal histone HPkA, complete cds.>gb:AP006878_576565
           Thermococcus kodakaraensis strain KOD1 DNA, complete
           genome.
          Length = 67

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   VL  +LE     + + AV +  HA RKTV A D+  A
Sbjct: 9   VDRLIRKAGAERVS----EDAAKVLAEYLEEYAIELSKKAVDFARHAGRKTVKAEDIKLA 64

Query: 332 LK 337
           +K
Sbjct: 65  IK 66



>sp|P61881|HARA_PYRAB Archaeal histone A (Archaeal histone
           A1).>sp|P61882|HARA_PYRFU Archaeal histone A (Archaeal
           histone A1).>pir|F75148|F75148 histone-like protein han1
           chain PAB3089 - Pyrococcus abyssi  (strain
           Orsay)>gb:AE010279_261398 Pyrococcus furiosus DSM 3638,
           section 154 of 173 of the complete
           genome.>gb:CNSPAX02_849108 Pyrococcus abyssi complete
           genome; segment 2/6.>gb:AE009950_902179 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 67

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   VL  +LE     V + AV +  HA RKTV   D+  A
Sbjct: 9   VDRLIRKAGAERVS----EQAAKVLAEYLEEYAIEVAKKAVEFARHAGRKTVKVEDIKLA 64

Query: 332 LK 337
           +K
Sbjct: 65  IK 66



>gb:AE000812_27956 Methanobacterium thermoautotrophicum from bases
           193159 to 207048 (section 18 of 148) of the complete
           genome.>gb:AE000666_925038 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 72

 Score = 35.8 bits (81), Expect = 0.41
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           I R+ +  G + +S    E    VL+   E +  +AV   +HA RKTV A D+  A+KR
Sbjct: 13  IGRIIKNAGAEIVSDDAREALAKVLEAKGEEIAENAVKLAKHAGRKTVKASDIELAVKR 71



>pir|F71188|F71188 probable archaeal histon - Pyrococcus
           horikoshii>gb:BA000001_650463 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 70

 Score = 35.8 bits (81), Expect = 0.41
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   VL  +LE     + + AV +  HA RKTV   D+  A
Sbjct: 12  VDRLIRKAGAERVS----EQAAKVLAEYLEEYAIEIAKKAVEFARHAGRKTVKVEDIKLA 67

Query: 332 LK 337
           +K
Sbjct: 68  IK 69



>sp|P50484|HMTB_METTH DNA binding protein HMt-2 (Archaeal histone
           A).>pir|C47036|C47036 archaeal histone HMt2 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:MBFHMTB_142712 Methanobacterium
           thermoautotrophicum DNA binding protein (hmtB) gene,
           complete cds.
          Length = 67

 Score = 35.8 bits (81), Expect = 0.41
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           I R+ +  G + +S    E    VL+   E +  +AV   +HA RKTV A D+  A+KR
Sbjct: 8   IGRIIKNAGAEIVSDDAREALAKVLEAKGEEIAENAVKLAKHAGRKTVKASDIELAVKR 66



>sp|Q57632|HJA1_METJA Probable archaeal histone 1.>pir|A64321|A64321
           archaeal histone - Methanococcus
           jannaschii>gb:U67474_206257 Methanocaldococcus
           jannaschii DSM 2661 section 16 of 150 of the complete
           genome.>gb:L77117_1099015 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 67

 Score = 35.8 bits (81), Expect = 0.41
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = +2

Query: 170 RLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           R+ ++ G +R+S    E     ++     + ++AV   +HA+RKTV   D+  ALK+
Sbjct: 11  RILKKAGAERVSRAAAEYLAEAVEEIALEIAKEAVELAKHAKRKTVKVEDIKLALKK 67



>sp|Q9Y8I2|HARB_PYRKO Archaeal histone B (Archaeal histone
           A2).>gb:AB016004_2676 Pyrococcus kodakaraensis gene for
           archaeal histone HPkB, complete cds.>gb:AP006878_577441
           Thermococcus kodakaraensis strain KOD1 DNA, complete
           genome.
          Length = 67

 Score = 35.8 bits (81), Expect = 0.41
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G  R+S    EE   VL   LE     + + AV   +HA RKTV A D+  A
Sbjct: 9   VDRLIRKAGAARVS----EEAAKVLAEHLEEKALEIAKKAVALAQHAGRKTVKAEDIKLA 64

Query: 332 LK 337
           +K
Sbjct: 65  IK 66



>sp|O74098|HARA_PYRHO Archaeal histone A (Archaeal histone A1).
          Length = 67

 Score = 35.8 bits (81), Expect = 0.41
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   VL  +LE     + + AV +  HA RKTV   D+  A
Sbjct: 9   VDRLIRKAGAERVS----EQAAKVLAEYLEEYAIEIAKKAVEFARHAGRKTVKVEDIKLA 64

Query: 332 LK 337
           +K
Sbjct: 65  IK 66



>sp|Q58342|HJA2_METJA Probable archaeal histone 2.>pir|D64416|D64416
           archaeal histone - Methanococcus
           jannaschii>gb:U67536_207041 Methanocaldococcus
           jannaschii DSM 2661 section 78 of 150 of the complete
           genome.>gb:L77117_1099799 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 67

 Score = 35.4 bits (80), Expect = 0.53
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = +2

Query: 170 RLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           R+ ++ G +R+S    E     ++     + ++AV   +HA+RKTV   D+  ALK+
Sbjct: 11  RILKKAGAERVSRAAAEYLAEAVEEIALEIAKEAVELAKHAKRKTVKVEDIKLALKQ 67



>gb:MFU12930_143399 Methanobacterium formicicum archaeal histone
           (hfoA1) gene, complete cds.
          Length = 68

 Score = 35.0 bits (79), Expect = 0.69
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           + R+ +  G  R+S    +    VL+   E +  +AV   +HA RKTV A D+  A+K
Sbjct: 9   VGRIIKNAGAPRVSDDARDALAKVLEEMGEGIAAEAVKLAKHAGRKTVKASDIEMAVK 66



>sp|P48782|HFO1_METFO Archaeal histone A1.
          Length = 67

 Score = 35.0 bits (79), Expect = 0.69
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           + R+ +  G  R+S    +    VL+   E +  +AV   +HA RKTV A D+  A+K
Sbjct: 8   VGRIIKNAGAPRVSDDARDALAKVLEEMGEGIAAEAVKLAKHAGRKTVKASDIEMAVK 65



>gb:CR382127_1660239 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 456

 Score = 34.7 bits (78), Expect = 0.90
 Identities = 17/65 (26%), Positives = 30/65 (46%)
 Frame = +2

Query: 149 ITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVY 328
           + +P ++ L        +   + EE     ++F +    D   YT+H +RKTV   DV  
Sbjct: 329 LPRPFLKSLVASITGDNVDKSVIEELVTSSEMFFDQAADDLAAYTDHCKRKTVEPKDVTQ 388

Query: 329 ALKRQ 343
            ++RQ
Sbjct: 389 LMRRQ 393



>sp|Q60264|HJA4_METJA Probable archaeal histone 4.>pir|D64513|D64513
           archaeal histone, extrachromosomal - Methanococcus
           jannaschii plasmid pURB800>gb:MII2CG_144188
           Methanocaldococcus jannaschii DSM 2661 large
           extra-chromosomal element, complete sequence.
          Length = 67

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = +2

Query: 170 RLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKR 340
           R+ ++ G +R+S    E      +     + ++AV   +HA+RKTV   D+  ALK+
Sbjct: 11  RILKKVGAERVSRAAAEYLAEAFEEIALEIAKEAVDLAKHAKRKTVKVEDIKLALKK 67



>pir|S71485|S71485 histone-like protein HAN1 chain A1 - Thermococcus
           sp.  (strain AN1)>gb:TSU93078_198384 Thermococcus sp.
           AN1 histone-like protein HAN1 A subunit (han1A) gene,
           complete cds.
          Length = 67

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           I RL R+ G +R+S    +     L+ +   V + A  +  HA RKTV A DV  A+K
Sbjct: 9   IDRLIRKAGAERVSEDAAKALAEYLEEYAIEVGKKATEFARHAGRKTVKAEDVRLAVK 66



>sp|P95669|HANA_THEZI Archaeal histone HAN1 subunit A.
          Length = 66

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 21/58 (36%), Positives = 30/58 (51%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           I RL R+ G +R+S    +     L+ +   V + A  +  HA RKTV A DV  A+K
Sbjct: 8   IDRLIRKAGAERVSEDAAKALAEYLEEYAIEVGKKATEFARHAGRKTVKAEDVRLAVK 65



>gb:PSU08838_161788 Pyrococcus GB-3a archaeal histone gene clones
           pKS389 and pKS390, complete cds.
          Length = 67

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   +L   LE     + R AV   +HA RKTV A D+  A
Sbjct: 9   VDRLIRKAGAQRVS----EQAAKLLAEHLEEKALEIARKAVDLAKHAGRKTVKAEDIKLA 64

Query: 332 LK 337
           ++
Sbjct: 65  IR 66



>gb:MFU12931_143400 Methanobacterium formicicum archaeal histone
           (hfoA2) gene, complete cds.
          Length = 68

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           + R+ +  G +RIS    E     L+   E + + AV   +HA RKTV A D+  A+K
Sbjct: 9   VGRIIKNAGAQRISDDAKEALAKALEENGEELAKKAVELAKHAGRKTVKAEDIEMAVK 66



>gb:CP000032_88288 Silicibacter pomeroyi DSS-3 plasmid megaplasmid,
           complete sequence.
          Length = 448

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 25/58 (43%), Positives = 27/58 (46%), Gaps = 3/58 (5%)
 Frame = +1

Query: 208 PHLRGDSRRPQDLPRERHPRRCYLH*ARSPEDGHRNGRRLCSQET---GPHSVRIRRL 372
           P  R DSRRP+ L R RHPRR      R P   HR  R  C +     G    R RRL
Sbjct: 331 PRRRSDSRRPRHLRRPRHPRR-----LRHP---HRPRRLRCLRRLPLGGHQKCRPRRL 380



>sp|P48783|HFO2_METFO Archaeal histone A2.
          Length = 67

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 20/58 (34%), Positives = 30/58 (51%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           + R+ +  G +RIS    E     L+   E + + AV   +HA RKTV A D+  A+K
Sbjct: 8   VGRIIKNAGAQRISDDAKEALAKALEENGEELAKKAVELAKHAGRKTVKAEDIEMAVK 65



>sp|P50486|HARB_PYRSG Archaeal histone B (Archaeal histone A2).
          Length = 66

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   +L   LE     + R AV   +HA RKTV A D+  A
Sbjct: 8   VDRLIRKAGAQRVS----EQAAKLLAEHLEEKALEIARKAVDLAKHAGRKTVKAEDIKLA 63

Query: 332 LK 337
           ++
Sbjct: 64  IR 65



>gb:XELHIS4A2_2581882 X.laevis histone H4-1 gene, 3' end.
          Length = 14

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +2

Query: 329 ALKRQGRTLYGFGG 370
           ALKRQGRTLYGFGG
Sbjct: 1   ALKRQGRTLYGFGG 14



>gb:BC083370_2563198 Danio rerio zgc:103421, mRNA (cDNA clone
           MGC:103421 IMAGE:7233289), complete cds.
          Length = 570

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 27/73 (36%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +1

Query: 136 QHPRHHEAGHSPSCSPWWSEAYLRPHLRGDSRRPQ-DLPRERHPRRCYLH*ARSPEDGHR 312
           Q  R HE  HSP+  P+ S A      R  S R   D   ERH  R     +R  E+ H 
Sbjct: 452 QRDRGHERDHSPNAGPYNSMAMCSDEERYRSYRDYGDRGYERHRERA----SREKEERH- 506

Query: 313 NGRRLCSQETGPH 351
            GRR   +E G H
Sbjct: 507 GGRRHREKEEGRH 519



>gb:AE017199_403114 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 82

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 4/69 (5%)
 Frame = +2

Query: 143 QGITKPAIRRL----ARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVT 310
           +GI   A+ R+    A++ GV R+S       +  L+     + ++A+    HA+RKT+ 
Sbjct: 7   RGIPLAAVERILKEEAKKVGVTRVSDKAVRLLKEKLEQIYAEIAKEALKLATHAKRKTIK 66

Query: 311 AMDVVYALK 337
             DV+ A K
Sbjct: 67  KEDVLNAAK 75



>gb:AE013419_292155 Methanosarcina mazei strain Goe1, section 201 of
           379 of the complete genome.>gb:AE008384_966264
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 70

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYA 331
           I RL R  G  R+S         +L+ +   + ++A+   EHA RKTV A D+  A
Sbjct: 11  IERLIRTAGAHRVSESAGMALTEILEEYGLQISKEAIKLAEHAGRKTVKAEDIKLA 66



>gb:AE010728_266048 Methanosarcina acetivorans str. C2A, section 73
           of 534 of the complete genome.>gb:AE010299_906607
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 69

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYA 331
           I RL R  G  R+S         +L+ +   + ++A+   EHA RKTV A D+  A
Sbjct: 10  IERLIRTAGAHRVSESAGMALTEILEEYGLQISKEAIKLAEHAGRKTVKAEDIKLA 65



>gb:AB013081_2130 Pyrococcus furiosus gene for archaeal histone,
           complete cds.
          Length = 68

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   VL   LE     + + AV   +HA RKTV   D+  A
Sbjct: 10  VDRLIRKAGAQRVS----EQAAKVLAEHLEEKAIEIAKKAVDLAKHAGRKTVKVEDIKLA 65

Query: 332 LK 337
           +K
Sbjct: 66  IK 67



>pir|I51432|I51432 histone H4-1 precursor - African clawed frog
           (fragment)
          Length = 14

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = +2

Query: 329 ALKRQGRTLYGFGG 370
           ALKRQGRTLYGFGG
Sbjct: 1   ALKRQGRTLYGFGG 14



>sp|O59627|HARB_PYRFU Archaeal histone B (Archaeal histone
           A2).>gb:AE010270_261289 Pyrococcus furiosus DSM 3638,
           section 145 of 173 of the complete
           genome.>gb:AE009950_902070 Pyrococcus furiosus DSM 3638,
           complete genome.
          Length = 67

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 4/62 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLEN----VIRDAVTYTEHARRKTVTAMDVVYA 331
           + RL R+ G +R+S    E+   VL   LE     + + AV   +HA RKTV   D+  A
Sbjct: 9   VDRLIRKAGAQRVS----EQAAKVLAEHLEEKAIEIAKKAVDLAKHAGRKTVKVEDIKLA 64

Query: 332 LK 337
           +K
Sbjct: 65  IK 66



>gb:AJ632079_528840 Methanococcus voltae hstA gene for histone HstA.
          Length = 67

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 7/64 (10%)
 Frame = +2

Query: 170 RLARRGGVKRISGLIYEETRGVLKIFLE-------NVIRDAVTYTEHARRKTVTAMDVVY 328
           R+ ++ G +R+S        G  K+F+E       ++ ++A   + HA RKTV   D+  
Sbjct: 11  RILKKAGAERVS-------EGAAKLFVEELESIAMDIAKEAAELSRHAGRKTVKVEDIKM 63

Query: 329 ALKR 340
            LKR
Sbjct: 64  VLKR 67



>pir|A47036|A47036 histone-related protein HMf1 - Methanothermus
           fervidus
          Length = 69

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           I R+ +  G +R+S         VL+   E +  +AV   +HA RKT+ A D+  A K
Sbjct: 9   IGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARK 66



>sp|P48781|HMFA_METFE DNA binding protein HMf-1 (Archaeal histone
           A).>pir|T48848|T48848 histone Hmf1 [imported] -
           Methanothermus fervidus>gb:MEFHMF1FSP_143275
           Methanothermus fervidus histone Hmf1 gene, complete cds,
           and iron-sulfur protein gene, 5' end.
          Length = 69

 Score = 32.3 bits (72), Expect = 4.5
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALK 337
           I R+ +  G +R+S         VL+   E +  +AV   +HA RKT+ A D+  A K
Sbjct: 9   IGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARK 66



>sp|P19267|HMFB_METFE DNA binding protein HMf-2 (Archaeal histone
           B).>pir|A35959|A35959 archaeal histone HMf2 [validated]
           - Methanothermus fervidus>gb:MEFDNABP_143271
           Methanothermus fervidus DNA binding protein (hmfB) and
           ureohydrolase genes, complete cds.
          Length = 69

 Score = 32.0 bits (71), Expect = 5.9
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
 Frame = +2

Query: 164 IRRLARRGGVKRISGLIYEETRGVLKIFLENVIRD----AVTYTEHARRKTVTAMDVVYA 331
           I R+ +  G +R+S    ++ R  L   LE + RD    A+    HA RKT+ A D+  A
Sbjct: 8   IGRIIKDAGAERVS----DDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELA 63

Query: 332 LKR 340
           ++R
Sbjct: 64  VRR 66


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 415,378,132
Number of Sequences: 1806583
Number of extensions: 6983195
Number of successful extensions: 16813
Number of sequences better than 10.0: 259
Number of HSP's better than 10.0 without gapping: 16550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16804
length of database: 581,917,975
effective HSP length: 116
effective length of database: 372,354,347
effective search space used: 21968906473
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)