BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7318
         (691 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF534888_1809603 Catharanthus roseus type-A response regulato...   223   2e-57   
pir|E96778|E96778 hypothetical protein F9E10.26 [imported] - Ara...   198   7e-50   Arabidopsis thaliana [mouse-ear cress]
pir|T50857|T50857 response regulator 6 [imported] - Arabidopsis ...   195   7e-49   Arabidopsis thaliana [mouse-ear cress]
pir|T50856|T50856 response regulator 5 [imported] - Arabidopsis ...   191   1e-47   Arabidopsis thaliana [mouse-ear cress]
pir|T50855|T50855 two-component response regulator homolog [impo...   191   1e-47   Arabidopsis thaliana [mouse-ear cress]
pir|T06673|T06673 response reactor 2 [imported] - Arabidopsis th...   191   1e-47   Arabidopsis thaliana [mouse-ear cress]
pir|T50854|T50854 response regulator 7 [imported] - Arabidopsis ...   187   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AF339732_1787775 Dianthus caryophyllus response regulator pro...   186   4e-46   
pir|T48851|T48851 response regulator 1 [imported] - Arabidopsis ...   182   5e-45   Arabidopsis thaliana [mouse-ear cress]
pir|T50853|T50853 response regulator 3 [imported] - Arabidopsis ...   177   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AF305722_1784465 Arabidopsis thaliana ecotype Columbia respon...   159   6e-38   
gb:AB042268_1519873 Zea mays ZmRR6 mRNA for response regulator 6...   155   6e-37   
gb:AX048778_1458094 Sequence 49 from Patent WO0070059.                155   6e-37   
gb:AP003683_1831959 Oryza sativa (japonica cultivar-group) genom...   154   1e-36   
pir|D84832|D84832 hypothetical protein At2g40670 [imported] - Ar...   153   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AF534890_1809605 Catharanthus roseus type-A response regulato...   151   9e-36   
gb:AB042267_1519872 Zea mays ZmRR5 mRNA for response regulator 5...   151   9e-36   
pir|T50860|T50860 response regulator 6 [imported] - Arabidopsis ...   151   9e-36   Arabidopsis thaliana [mouse-ear cress]
pir|T48853|T48853 response reactor 3 [imported] - Arabidopsis th...   151   1e-35   Arabidopsis thaliana [mouse-ear cress]
pir|T47764|T47764 responce reactor 4 - Arabidopsis thaliana>gb:A...   150   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AF534889_1809604 Catharanthus roseus type-A response regulato...   146   4e-34   
gb:AB042261_1519871 Zea mays ZmRR4 mRNA for response regulator 4...   140   2e-32   
gb:AP006452_1861887 Oryza sativa (japonica cultivar-group) genom...   137   2e-31   
gb:OSJN00211_1696783 Oryza sativa genomic DNA, chromosome 4, BAC...   135   5e-31   
gb:AB042260_1519870 Zea mays ZmRR3 mRNA for response regulator, ...   135   5e-31   
pir|T50858|T50858 repsonse regulator ZmRR2 [imported] - maize>gb...   135   9e-31   Zea mays [maize]
gb:OSJN00002_1693074 Oryza sativa genomic DNA, chromosome 4, BAC...   134   2e-30   
pir|T49039|T49039 response regulator-like protein - Arabidopsis ...   132   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AP004043_1836790 Oryza sativa (japonica cultivar-group) genom...   129   5e-29   
pir|T50859|T50859 response regulator Cip1 [imported] - maize>gb:...   127   2e-28   Zea mays [maize]
gb:AX048782_1458095 Sequence 53 from Patent WO0070059.                124   1e-27   
gb:AP003802_1833574 Oryza sativa (japonica cultivar-group) genom...   117   2e-25   
gb:AB042269_1519874 Zea mays ZmRR7 mRNA for response regulator 7...   110   2e-23   
gb:AP005808_1858218 Oryza sativa (japonica cultivar-group) genom...   109   5e-23   
gb:AP003962_1835754 Oryza sativa (japonica cultivar-group) genom...   105   8e-22   
gb:AY261524_1593495 Populus alba x Populus tremula putative two-...   102   8e-21   
gb:OSJN00292_1698073 Oryza sativa genomic DNA, chromosome 4, BAC...    91   2e-17   
gb:AP003962_1835759 Oryza sativa (japonica cultivar-group) genom...    89   7e-17   
gb:AP005523_1853415 Oryza sativa (japonica cultivar-group) genom...    87   2e-16   
gb:AB046953_1520551 Arabidopsis thaliana APRR9 mRNA for pseudo-r...    72   7e-12   
gb:AE017180_399583 Geobacter sulfurreducens PCA, complete genome.      72   9e-12   
gb:AE016914_356151 Chromobacterium violaceum ATCC 12472 section ...    72   9e-12   
gb:AP005199_1849343 Oryza sativa (japonica cultivar-group) genom...    72   1e-11   
gb:AB189042_1529381 Oryza sativa (indica cultivar-group) OsPRR37...    72   1e-11   
gb:AB189039_1529378 Oryza sativa (japonica cultivar-group) OsPRR...    72   1e-11   
gb:AE016863_351640 Pseudomonas syringae pv. tomato str. DC3000 s...    70   4e-11   
gb:AC084405_1733621 Oryza sativa chromosome 3 BAC OSJNBa0044H10 ...    68   1e-10   
gb:AB189043_1529382 Oryza sativa (indica cultivar-group) OsPRR73...    68   1e-10   
gb:AB189040_1529379 Oryza sativa (japonica cultivar-group) OsPRR...    68   1e-10   
sp|Q23917|REGA_DICDI|REGA_DICDI 3',5'-cyclic-nucleotide phosphodiesterase r...    68   1e-10   Dictyostelium discoideum
gb:AB019231_1514162 Arabidopsis thaliana genomic DNA, chromosome...    68   2e-10   
pir|C83843|C83843 hypothetical protein BH1547 [imported] - Bacil...    65   1e-09   Bacillus halodurans
gb:AB185930_16747 Vibrio cholerae cheY1 gene for cheY homolog, c...    64   2e-09   
gb:BA000039_726806 Thermosynechococcus elongatus BP-1 DNA, compl...    64   3e-09   
pir|A87630|A87630 sensor histidine kinase/response regulator [im...    64   3e-09   Caulobacter vibrioides
gb:BA000012_670416 Mesorhizobium loti MAFF303099 DNA, complete g...    63   4e-09   
gb:AY157498_593519 Synechococcus sp. PCC 7942 cosmid 4G8, comple...    63   4e-09   
gb:AP008231_581974 Synechococcus elongatus PCC 6301 DNA, complet...    63   4e-09   
gb:AE017309_438368 Desulfovibrio vulgaris subsp. vulgaris str. H...    63   6e-09   
pir|T02680|T02680 hypothetical protein At2g46790 [imported] - Ar...    63   6e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AB046955_1520553 Arabidopsis thaliana APRR5 mRNA for pseudo-r...    62   1e-08   
gb:AB025641_1516715 Arabidopsis thaliana genomic DNA, chromosome...    62   1e-08   
gb:BX842653_825482 Bdellovibrio bacteriovorus complete genome, s...    62   1e-08   
gb:AE017316_440318 Desulfovibrio vulgaris subsp. vulgaris str. H...    62   1e-08   
gb:CR522870_99204 Desulfotalea psychrophila LSv54 chromosome.          62   1e-08   
pir|C97489|C97489 response regulator protein AGR_C_1956 (U67070)...    62   1e-08   Agrobacterium tumefaciens
pir|AC2707|AC2707 two component response regulator Atu1060 [impo...    62   1e-08   Agrobacterium tumefaciens
gb:AY456019_1607104 Cochliobolus heterostrophus putative histidi...    62   1e-08   
gb:AE017180_400828 Geobacter sulfurreducens PCA, complete genome.      61   2e-08   
pir|G82721|G82721 regulator of pathogenicity factors XF1114 [imp...    61   2e-08   Xylella fastidiosa
gb:BX571867_787359 Photorhabdus luminescens subsp. laumondii TTO...    61   2e-08   
gb:AP006840_568033 Symbiobacterium thermophilum DNA, complete ge...    61   2e-08   
pir|B97052|B97052 chemotaxis protein CheV ortholog (CheW-like ad...    61   2e-08   Clostridium acetobutylicum
gb:AF362373_1265606 Dictyostelium discoideum histidine kinase Dh...    60   3e-08   
gb:AF258796_1256785 Dictyostelium discoideum hybrid histidine ki...    60   3e-08   
gb:BX294143_768467 Pirellula sp. strain 1 complete genome; segme...    60   3e-08   
gb:AE012554_283834 Xylella fastidiosa Temecula1, section 2 of 9 ...    60   3e-08   
pir|H97556|H97556 response regulator protein (U67070) [imported]...    60   3e-08   Agrobacterium tumefaciens
pir|AC2777|AC2777 two component response regulator rrpX [importe...    60   3e-08   Agrobacterium tumefaciens
pir|H87338|H87338 sensor histidine kinase / response regulator [...    60   3e-08   Caulobacter vibrioides
pir|T52074|T52074 response regulator ARR11 [imported] - Arabidop...    60   3e-08   Arabidopsis thaliana [mouse-ear cress]
pir|C96700|C96700 protein F12A21.15 [imported] - Arabidopsis tha...    60   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP004087_1837524 Oryza sativa (japonica cultivar-group) genom...    60   4e-08   
gb:AB046954_1520552 Arabidopsis thaliana APRR7 mRNA for pseudo-r...    60   4e-08   
gb:AE012287_281101 Xanthomonas campestris pv. campestris str. AT...    60   4e-08   
gb:XCA251547_210727 Xanthomonas campestris regulatory operon (rp...    60   4e-08   
pir|S16003|S16003 rpfC protein - Xanthomonas campestris                60   4e-08   Xanthomonas campestris pv. campestris str. 8004
pir|H95884|H95884 probable regulatory protein [imported] - Sinor...    60   4e-08   Sinorhizobium meliloti
pir|T48302|T48302 hypothetical protein F9G14.120 - Arabidopsis t...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
sp|P49246|RPFC_XANCP|RPFC_XANCP Sensory/regulatory protein rpfC (EC 2.7.3.-).     60   4e-08   Xanthomonas campestris pv. campestris
gb:AC132483_1741113 Oryza sativa (japonica cultivar-group) chrom...    60   5e-08   
gb:BX572606_803800 Rhodopseudomonas palustris CGA009 complete ge...    60   5e-08   
gb:AE017320_441470 Desulfovibrio vulgaris subsp. vulgaris str. H...    60   5e-08   
gb:AE013073_288767 Thermoanaerobacter tengcongensis MB4, section...    60   5e-08   
gb:AF534891_1809606 Catharanthus roseus type-B response regulato...    59   6e-08   
gb:AY456046_1607131 Gibberella moniliformis putative histidine k...    59   6e-08   
gb:AY714873_1190649 Uncultured archaeon GZfos9E5 clone GZfos9E5,...    59   6e-08   
gb:AE016860_350715 Pseudomonas syringae pv. tomato str. DC3000 s...    59   6e-08   
gb:AE015758_317547 Shewanella oneidensis MR-1 section 307 of 457...    59   6e-08   
pir|AE1886|AE1886 two-component hybrid sensor and regulator all0...    59   6e-08   Nostoc sp. PCC 7120
pir|E83443|E83443 probable sensor/response regulator hybrid PA16...    59   6e-08   Pseudomonas aeruginosa
pir|T52034|T52034 receiver-like protein 3 [imported] - Arabidops...    59   6e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AF199025_487725 Sinorhizobium medicae two component sensor pr...    59   8e-08   
gb:AE016862_351410 Pseudomonas syringae pv. tomato str. DC3000 s...    59   8e-08   
pir|T48492|T48492 hypothetical protein T28J14.150 - Arabidopsis ...    59   8e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP006838_1862972 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AB189041_1529380 Oryza sativa (japonica cultivar-group) OsPRR...    59   1e-07   
gb:BX572607_804030 Rhodopseudomonas palustris CGA009 complete ge...    59   1e-07   
gb:AE016918_357473 Chromobacterium violaceum ATCC 12472 section ...    59   1e-07   
gb:AE013598_296571 Xanthomonas oryzae pv. oryzae KACC10331, comp...    59   1e-07   
gb:XORPFCGEN_210943 X.oryzae rpfC gene.                                59   1e-07   
gb:SME591789_186017 Sinorhizobium meliloti 1021 complete chromos...    59   1e-07   
gb:HPCHEY_137552 H.pylori cheY gene homologue, partial.                59   1e-07   
pir|C84645|C84645 hypothetical protein At2g25180 [imported] - Ar...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AY456060_1607140 Botryotinia fuckeliana putative histidine ki...    58   1e-07   
gb:AY456058_1607138 Botryotinia fuckeliana putative histidine ki...    58   1e-07   
gb:AY714821_1188596 Uncultured archaeon GZfos17A3 clone GZfos17A...    58   1e-07   
gb:BX294133_765090 Pirellula sp. strain 1 complete genome; segme...    58   1e-07   
gb:BA000040_730548 Bradyrhizobium japonicum USDA 110 DNA, comple...    58   1e-07   
gb:AY596297_631910 Haloarcula marismortui ATCC 43049 chromosome ...    58   1e-07   
gb:AE016790_333733 Pseudomonas putida KT2440 section 17 of 21 of...    58   1e-07   
gb:AY740079_1626172 Ostreococcus tauri APRR-like protein gene, c...    58   2e-07   
gb:AY456034_1607119 Gibberella moniliformis putative histidine k...    58   2e-07   
gb:AY272055_1594234 Chlamydomonas reinhardtii chlamyopsin-5 gene...    58   2e-07   
gb:CP000020_872009 Vibrio fischeri ES114 chromosome I, complete ...    58   2e-07   
gb:CP000001_851523 Bacillus cereus ZK, complete genome.                58   2e-07   
gb:AF031898_471065 Pseudomonas putida chemotaxis and motility ge...    58   2e-07   
gb:AE017001_375951 Bacillus cereus ATCC 14579 section 4 of 18 of...    58   2e-07   
gb:AE014196_305465 Streptococcus agalactiae 2603V/R section 6 of...    58   2e-07   
gb:SAG766843_169649 Streptococcus agalactiae NEM316 complete gen...    58   2e-07   
pir|F83292|F83292 probable sensor/response regulator hybrid PA28...    58   2e-07   Pseudomonas aeruginosa
pir|H69433|H69433 response regulator homolog - Archaeoglobus ful...    58   2e-07   Archaeoglobus fulgidus
gb:BX950851_840437 Erwinia carotovora subsp. atroseptica SCRI104...    57   2e-07   
gb:AF481091_514457 Pseudomonas fluorescens FlhA (flhA) gene, par...    57   2e-07   
gb:AE017355_462232 Bacillus thuringiensis serovar konkukian str....    57   2e-07   
gb:AE011821_276811 Xanthomonas axonopodis pv. citri str. 306, se...    57   2e-07   
gb:HPU97567_137742 Helicobacter pylori sress responsive operon c...    57   2e-07   
sp|P71403|CHEY_HELPY|CHEY_HELPY Chemotaxis protein cheY homolog.>pir|C64653...    57   2e-07   Helicobacter pylori
gb:AP006627_566305 Bacillus clausii KSM-K16 DNA, complete genome.      57   3e-07   
gb:AE017295_434239 Leptospira interrogans serovar Copenhageni st...    57   3e-07   
gb:AE017027_381225 Bacillus anthracis str. Ames section 4 of 18 ...    57   3e-07   
gb:AE016915_356540 Chromobacterium violaceum ATCC 12472 section ...    57   3e-07   
gb:AE011351_271982 Leptospira interrogans serovar lai str. 56601...    57   3e-07   
gb:RCU64519_162830 Rhodospirillum centenum cheAY, cheW, cheY, ch...    57   3e-07   
pir|A23567|QREBCY chemotaxis protein cheY [validated] - Salmonel...    57   3e-07   
sp|P06657|CHEY_SALTY|CHEY_SALTY Chemotaxis protein cheY.                          57   3e-07   Salmonella enterica subsp. enterica serovar Typhimurium
gb:AF466202_1802262 Zea mays putative pol protein gene, partial ...    57   4e-07   
gb:BX321856_772377 Nitrosomonas europaea ATCC 19718, complete ge...    57   4e-07   
gb:BA000037_723289 Vibrio vulnificus YJ016 DNA, chromosome I, co...    57   4e-07   
gb:AP006841_575050 Bacteroides fragilis YCH46 DNA, complete genome.    57   4e-07   
gb:AE016780_331308 Pseudomonas putida KT2440 section 7 of 21 of ...    57   4e-07   
pir|AI1979|AI1979 two-component hybrid sensor and regulator all1...    57   4e-07   Nostoc sp. PCC 7120
gb:BX842651_824713 Bdellovibrio bacteriovorus complete genome, s...    56   5e-07   
gb:AY548449_627435 Fremyella diplosiphon clone 3109D10 putative ...    56   5e-07   
gb:AE017146_390578 Helicobacter hepaticus ATCC 51449 section 3 o...    56   5e-07   
gb:AE011645_275171 Xanthomonas axonopodis pv. citri str. 306, se...    56   5e-07   
gb:CP000031_84202 Silicibacter pomeroyi DSS-3, complete genome.        56   5e-07   
pir|E83901|E83901 hypothetical protein BH2013 [imported] - Bacil...    56   5e-07   Bacillus halodurans
pir|C82123|C82123 chemotaxis protein CheY VC2065 [imported] - Vi...    56   5e-07   Vibrio cholerae
sp|Q9ZM64|CHEY_HELPJ|CHEY_HELPJ Chemotaxis protein cheY homolog.>pir|F71941...    56   5e-07   Helicobacter pylori
gb:AY657420_2146430 Synthetic construct Peudomonas aeruginosa cl...    56   7e-07   
gb:BX571659_778217 Wolinella succinogenes, complete genome; segm...    56   7e-07   
gb:BA000012_668889 Mesorhizobium loti MAFF303099 DNA, complete g...    56   7e-07   
gb:AF450326_512280 Azospirillum brasilense chemotaxis gene clust...    56   7e-07   
gb:AE017180_400514 Geobacter sulfurreducens PCA, complete genome.      56   7e-07   
gb:AE016803_336606 Vibrio vulnificus CMCP6 chromosome I section ...    56   7e-07   
gb:AE013598_298184 Xanthomonas oryzae pv. oryzae KACC10331, comp...    56   7e-07   
sp|Q51455|CHEY_PSEAE|CHEY_PSEAE Chemotaxis protein cheY.>pir|S20545|S20545 ...    56   7e-07   Pseudomonas aeruginosa
gb:AY600439_1617277 Lycopersicon esculentum ethylene receptor ne...    55   9e-07   
gb:AY456056_1607137 Botryotinia fuckeliana putative histidine ki...    55   9e-07   
gb:AY088149_1573172 Arabidopsis thaliana clone 41875 mRNA, compl...    55   9e-07   
gb:CP000009_863541 Gluconobacter oxydans 621H, complete genome.        55   9e-07   
gb:BX321860_773578 Nitrosomonas europaea ATCC 19718, complete ge...    55   9e-07   
gb:BA000032_709670 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    55   9e-07   
gb:AE017340_456878 Idiomarina loihiensis L2TR, complete genome.        55   9e-07   
gb:AE017320_441511 Desulfovibrio vulgaris subsp. vulgaris str. H...    55   9e-07   
gb:AE017267_422320 Bacillus cereus ATCC 10987, section 4 of 18 o...    55   9e-07   
gb:AE016913_355977 Chromobacterium violaceum ATCC 12472 section ...    55   9e-07   
gb:AE013334_291398 Methanosarcina mazei strain Goe1, section 116...    55   9e-07   
pir|G84428|G84428 hypothetical protein At2g01760 [imported] - Ar...    55   9e-07   Arabidopsis thaliana [mouse-ear cress]
pir|AF2820|AF2820 two component response regulator Atu1985 [impo...    55   9e-07   Agrobacterium fabrum str. C58
gb:AK176489_1818477 Arabidopsis thaliana mRNA for putative ARR1 ...    55   1e-06   
gb:AY056099_1563437 Arabidopsis thaliana AT3g16857/MUH15_1 mRNA,...    55   1e-06   
gb:AB042110_1519764 Pyrus pyrifolia PPETR2 mRNA for ethylene rec...    55   1e-06   
gb:BX842652_825256 Bdellovibrio bacteriovorus complete genome, s...    55   1e-06   
gb:BX571865_786714 Photorhabdus luminescens subsp. laumondii TTO...    55   1e-06   
gb:BA000040_732548 Bradyrhizobium japonicum USDA 110 DNA, comple...    55   1e-06   
gb:AY273869_604941 Pseudomonas aeruginosa PA14 pathogenicity isl...    55   1e-06   
gb:AE017282_429249 Methylococcus capsulatus str. Bath, complete ...    55   1e-06   
gb:AE017180_400582 Geobacter sulfurreducens PCA, complete genome.      55   1e-06   
gb:AE016762_326301 Escherichia coli CFT073 section 8 of 18 of th...    55   1e-06   
gb:ECOCHE3_128264 E.coli cheR, cheB, cheY, and cheZ chemotaxis-r...    55   1e-06   
pir|S74707|S74707 nitrogen fixation positive activator protein -...    55   1e-06   Synechocystis sp. PCC 6803
pir|T51246|T51246 ARR1 protein [imported] - Arabidopsis thaliana...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
pir|E25195|QRECCY chemotaxis protein cheY [validated] - Escheric...    55   1e-06   
sp|P06143|CHEY_ECOLI|CHEY_ECOLI Chemotaxis protein cheY.                          55   1e-06   Escherichia coli [E. coli]
sp|Q8FGP6|CHEY_ECOL6|CHEY_ECOL6 Chemotaxis protein cheY.                          55   1e-06   
sp|O49397|ARRA_ARATH|ARRA_ARATH Putative transcription factor ARR10 (Arabid...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AY456009_1607094 Cochliobolus heterostrophus putative histidi...    55   2e-06   
gb:BX842656_826393 Bdellovibrio bacteriovorus complete genome, s...    55   2e-06   
gb:BX842646_823391 Bdellovibrio bacteriovorus complete genome, s...    55   2e-06   
gb:BX572598_801242 Rhodopseudomonas palustris CGA009 complete ge...    55   2e-06   
gb:BX571658_778005 Wolinella succinogenes, complete genome; segm...    55   2e-06   
gb:BA000040_735390 Bradyrhizobium japonicum USDA 110 DNA, comple...    55   2e-06   
gb:BA000038_724417 Vibrio vulnificus YJ016 DNA, chromosome II, c...    55   2e-06   
gb:BA000032_709276 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    55   2e-06   
gb:AL646060_545597 Ralstonia solanacearum GMI1000 chromosome, co...    55   2e-06   
gb:AF069392_475827 Vibrio parahaemolyticus polar flagellar and c...    55   2e-06   
gb:AE017311_438935 Desulfovibrio vulgaris subsp. vulgaris str. H...    55   2e-06   
gb:AE017180_399337 Geobacter sulfurreducens PCA, complete genome.      55   2e-06   
gb:AE013598_296323 Xanthomonas oryzae pv. oryzae KACC10331, comp...    55   2e-06   
pir|AD2215|AD2215 two-component hybrid sensor and regulator all3...    55   2e-06   Nostoc sp. PCC 7120
pir|AB2196|AB2196 two-component hybrid sensor and regulator alr3...    55   2e-06   Nostoc sp. PCC 7120
pir|E87322|E87322 chemotaxis protein CheYII [imported] - Cauloba...    55   2e-06   Caulobacter vibrioides
gb:AY456037_1607122 Gibberella moniliformis putative histidine k...    54   2e-06   
gb:CP000021_873763 Vibrio fischeri ES114 chromosome II, complete...    54   2e-06   
gb:BA000040_734911 Bradyrhizobium japonicum USDA 110 DNA, comple...    54   2e-06   
gb:BA000040_730454 Bradyrhizobium japonicum USDA 110 DNA, comple...    54   2e-06   
gb:BA000038_724672 Vibrio vulnificus YJ016 DNA, chromosome II, c...    54   2e-06   
gb:AY216911_598362 Vibrio parahaemolyticus bvg-like sensory locu...    54   2e-06   
gb:AE017314_439844 Desulfovibrio vulgaris subsp. vulgaris str. H...    54   2e-06   
gb:AE016919_357604 Chromobacterium violaceum ATCC 12472 section ...    54   2e-06   
gb:AE016911_355433 Chromobacterium violaceum ATCC 12472 section ...    54   2e-06   
gb:AE012294_281150 Xanthomonas campestris pv. campestris str. AT...    54   2e-06   
pir|AI2195|AI2195 two-component hybrid sensor and regulator alr3...    54   2e-06   Nostoc sp. PCC 7120
pir|B96032|B96032 probable two-component response regulator prot...    54   2e-06   Sinorhizobium meliloti
pir|D75276|D75276 response regulator - Deinococcus radiodurans (...    54   2e-06   Deinococcus radiodurans
pir|AF1922|AF1922 two-component system, regulatory protein all09...    54   2e-06   Nostoc sp. PCC 7120
pir|B69158|B69158 sensory transduction regulatory protein - Meth...    54   2e-06   Methanothermobacter thermautotrophicus str. Delta H
pir|S74913|S74913 sensory transduction system regulatory protein...    54   2e-06   Synechocystis sp. PCC 6803
gb:AP007226_1863314 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:BX572593_799759 Rhodopseudomonas palustris CGA009 complete ge...    54   3e-06   
gb:BX571869_787906 Photorhabdus luminescens subsp. laumondii TTO...    54   3e-06   
gb:BX321862_774251 Nitrosomonas europaea ATCC 19718, complete ge...    54   3e-06   
gb:AE017312_439245 Desulfovibrio vulgaris subsp. vulgaris str. H...    54   3e-06   
gb:AE016922_358407 Chromobacterium violaceum ATCC 12472 section ...    54   3e-06   
gb:AE016808_337843 Vibrio vulnificus CMCP6 chromosome II section...    54   3e-06   
gb:AE015782_317789 Shewanella oneidensis MR-1 section 331 of 457...    54   3e-06   
gb:AE011828_276865 Xanthomonas axonopodis pv. citri str. 306, se...    54   3e-06   
gb:U93704_207944 Riftia pachyptila endosymbiont bacterioferritin...    54   3e-06   
gb:CR555306_106351 Azoarcus sp. EbN1 complete genome.                  54   3e-06   
gb:AB040876_6590 Enterobacter cloacae cheR, cheB, cheY, cheZ gen...    54   3e-06   
pir|A82174|A82174 sensory box sensor histidine kinase/response r...    54   3e-06   Vibrio cholerae
pir|T09112|T09112 probable sensor kinase VieS - Vibrio cholerae>...    54   3e-06   Vibrio cholerae
sp|Q9FAD7|CHEY_ENTCL|CHEY_ENTCL Chemotaxis protein cheY.                          54   3e-06   Enterobacter cloacae
sp|P71129|CHEY_CAMJE|CHEY_CAMJE Chemotaxis protein cheY homolog.>pir|A81316...    54   3e-06   
gb:AY456021_1607106 Cochliobolus heterostrophus putative histidi...    54   3e-06   
gb:AY371288_1603051 Mesembryanthemum crystallinum timing of CAB ...    54   3e-06   
gb:CP000025_879398 Campylobacter jejuni RM1221, complete genome.       54   3e-06   
gb:BX572596_800790 Rhodopseudomonas palustris CGA009 complete ge...    54   3e-06   
gb:AE017355_462230 Bacillus thuringiensis serovar konkukian str....    54   3e-06   
gb:AE017180_399968 Geobacter sulfurreducens PCA, complete genome.      54   3e-06   
gb:AE016920_357993 Chromobacterium violaceum ATCC 12472 section ...    54   3e-06   
gb:AE016813_339166 Vibrio vulnificus CMCP6 chromosome II section...    54   3e-06   
gb:AE016805_337224 Vibrio vulnificus CMCP6 chromosome I section ...    54   3e-06   
gb:AE016790_333763 Pseudomonas putida KT2440 section 17 of 21 of...    54   3e-06   
gb:AE013787_300151 Yersinia pestis KIM section 187 of 415 of the...    54   3e-06   
gb:AE011821_276810 Xanthomonas axonopodis pv. citri str. 306, se...    54   3e-06   
gb:AE010886_267352 Methanosarcina acetivorans str. C2A, section ...    54   3e-06   
gb:CR378665_94328 Photobacterium profundum SS9; segment 3/12.          54   3e-06   
pir|T51247|T51247 ARR2 protein [imported] - Arabidopsis thaliana...    54   3e-06   Arabidopsis thaliana [mouse-ear cress]
pir|H81295|H81295 probable two-component regulator Cj1491c [impo...    54   3e-06   Campylobacter jejuni
pir|S75287|S75287 sensory transduction system regulatory protein...    54   3e-06   Synechocystis sp. PCC 6803
gb:NCB13H18_1689181 Neurospora crassa DNA linkage group V BAC co...    53   4e-06   
gb:AB026500_1516997 Cucumis sativus mRNA for ethylene receptor C...    53   4e-06   
gb:CP000001_851521 Bacillus cereus ZK, complete genome.                53   4e-06   
gb:BA000045_743508 Gloeobacter violaceus PCC 7421 DNA, complete ...    53   4e-06   
gb:BA000045_740710 Gloeobacter violaceus PCC 7421 DNA, complete ...    53   4e-06   
gb:AF354753_504123 Yersinia enterocolitica FlhB (flhB) gene, par...    53   4e-06   
gb:AE017180_399614 Geobacter sulfurreducens PCA, complete genome.      53   4e-06   
gb:AE017001_375949 Bacillus cereus ATCC 14579 section 4 of 18 of...    53   4e-06   
gb:AE011157_269654 Methanosarcina acetivorans str. C2A, section ...    53   4e-06   
gb:CR522870_100638 Desulfotalea psychrophila LSv54 chromosome.         53   4e-06   
gb:CR378675_97112 Photobacterium profundum SS9 chromosome 2; seg...    53   4e-06   
gb:CR378664_93926 Photobacterium profundum SS9; segment 2/12.          53   4e-06   
pir|T00441|T00441 probable histidine kinase [imported] - Arabido...    53   4e-06   Arabidopsis thaliana [mouse-ear cress]
pir|A97517|A97517 probable response regulator celR2 (AF121341) [...    53   4e-06   Agrobacterium fabrum str. C58
pir|E83529|E83529 sensor/response regulator hybrid PA0928 [impor...    53   4e-06   Pseudomonas aeruginosa
pir|H84485|H84485 hypothetical protein At2g07440 [imported] - Ar...    53   4e-06   Arabidopsis thaliana [mouse-ear cress]
sp|Q93P00|CHEY_YEREN|CHEY_YEREN Chemotaxis protein cheY.                          53   4e-06   
gb:AC107226_1738402 Oryza sativa (japonica cultivar-group) chrom...    53   6e-06   
gb:AY456035_1607120 Gibberella moniliformis putative histidine k...    53   6e-06   
gb:CP000021_873775 Vibrio fischeri ES114 chromosome II, complete...    53   6e-06   
gb:BX640414_805461 Bordetella pertussis strain Tohama I, complet...    53   6e-06   
gb:BX571659_778216 Wolinella succinogenes, complete genome; segm...    53   6e-06   
gb:BA000040_733383 Bradyrhizobium japonicum USDA 110 DNA, comple...    53   6e-06   
gb:BA000037_722494 Vibrio vulnificus YJ016 DNA, chromosome I, co...    53   6e-06   
gb:BA000012_671222 Mesorhizobium loti MAFF303099 DNA, complete g...    53   6e-06   
gb:AE017318_440921 Desulfovibrio vulgaris subsp. vulgaris str. H...    53   6e-06   
gb:AE012115_279464 Xanthomonas campestris pv. campestris str. AT...    53   6e-06   
gb:SME591786_185312 Sinorhizobium meliloti 1021 complete chromos...    53   6e-06   
pir|AI1939|AI1939 two-component hybrid sensor and regulator all1...    53   6e-06   
pir|T52075|T52075 pseudo-response regulator APRR1 [imported] - A...    53   6e-06   
pir|A83324|A83324 probable sensor/response regulator hybrid PA25...    53   6e-06   
pir|B87323|B87323 chemotaxis protein CheYIV [imported] - Cauloba...    53   6e-06   
pir|AB2821|AB2821 two component response regulator Atu1989 [impo...    53   6e-06   
pir|B97599|B97599 sensory transduction regulatory protein [impor...    53   6e-06   
pir|AI0204|AI0204 chemotaxis protein CheY [imported] - Yersinia ...    53   6e-06   
sp|Q8D0P1|CHEY_YERPE|CHEY_YERPE Chemotaxis protein cheY.                          53   6e-06   
gb:AY657347_2146357 Synthetic construct Peudomonas aeruginosa cl...    52   8e-06   
gb:AE017343_1755577 Cryptococcus neoformans var. neoformans JEC2...    52   8e-06   
gb:AY456033_1607118 Gibberella moniliformis putative histidine k...    52   8e-06   
gb:AY456018_1607103 Cochliobolus heterostrophus putative histidi...    52   8e-06   
gb:AY359964_1602031 Oryza sativa (indica cultivar-group) pseudo-...    52   8e-06   
gb:AB060130_1521812 Zea mays ZmRR8 mRNA for response regulator 8...    52   8e-06   
gb:CP000011_867661 Burkholderia mallei ATCC 23344 chromosome 2, ...    52   8e-06   
gb:BX842655_826283 Bdellovibrio bacteriovorus complete genome, s...    52   8e-06   
gb:AY500852_622219 Burkholderia cenocepacia CblT (cblT) and CblR...    52   8e-06   
gb:AY378300_614802 Aeromonas hydrophila clone PA91 hypothetical ...    52   8e-06   
gb:AL646079_548968 Ralstonia solanacearum GMI1000 megaplasmid, c...    52   8e-06   
gb:AF448145_512071 Myxococcus xanthus che3 chemosensory regulato...    52   8e-06   
gb:AF071215_476124 Proteus mirabilis regulator of swarming behav...    52   8e-06   
gb:AE017180_400509 Geobacter sulfurreducens PCA, complete genome.      52   8e-06   
gb:AE017180_399587 Geobacter sulfurreducens PCA, complete genome.      52   8e-06   
gb:AE015673_316693 Shewanella oneidensis MR-1 section 222 of 457...    52   8e-06   
gb:AE015654_316506 Shewanella oneidensis MR-1 section 203 of 457...    52   8e-06   
gb:AE013598_296572 Xanthomonas oryzae pv. oryzae KACC10331, comp...    52   8e-06   
pir|AE2276|AE2276 two-component hybrid sensor and regulator all3...    52   8e-06   
pir|AB2318|AB2318 two-component hybrid sensor and regulator all4...    52   8e-06   
pir|B97640|B97640 sensory transduction histidine kinase slr2098 ...    52   8e-06   
pir|AC2863|AC2863 hypothetical protein Atu2332 [imported] - Agro...    52   8e-06   
pir|D84668|D84668 hypothetical protein At2g27070 [imported] - Ar...    52   8e-06   
sp|P46384|PILG_PSEAE|PILG_PSEAE PilG protein.>pir|A48491|A48491 twitching m...    52   8e-06   
gb:AF362369_1265602 Dictyostelium discoideum histidine kinase Dh...    52   1e-05   
gb:BX936398_834667 Yersinia pseudotuberculosis IP32953 genome, c...    52   1e-05   
gb:BX571966_795136 Burkholderia pseudomallei strain K96243, chro...    52   1e-05   
gb:BA000012_668843 Mesorhizobium loti MAFF303099 DNA, complete g...    52   1e-05   
gb:AE017254_417537 Treponema denticola ATCC 35405, section 9 of ...    52   1e-05   
gb:AE016792_334368 Pseudomonas putida KT2440 section 19 of 21 of...    52   1e-05   
gb:AE015762_317589 Shewanella oneidensis MR-1 section 311 of 457...    52   1e-05   
gb:AE015502_314969 Shewanella oneidensis MR-1 section 51 of 457 ...    52   1e-05   
gb:AE013983_302093 Yersinia pestis KIM section 383 of 415 of the...    52   1e-05   
gb:AE013598_296498 Xanthomonas oryzae pv. oryzae KACC10331, comp...    52   1e-05   
gb:AE013579_293536 Methanosarcina mazei strain Goe1, section 361...    52   1e-05   
gb:AE013555_293337 Methanosarcina mazei strain Goe1, section 337...    52   1e-05   
gb:AE012406_282152 Xanthomonas campestris pv. campestris str. AT...    52   1e-05   
gb:AE011887_277414 Xanthomonas axonopodis pv. citri str. 306, se...    52   1e-05   
gb:CP000031_84166 Silicibacter pomeroyi DSS-3, complete genome.        52   1e-05   
gb:CP000031_84093 Silicibacter pomeroyi DSS-3, complete genome.        52   1e-05   
pir|AC3592|AC3592 response regulator protein [imported] - Brucel...    52   1e-05   
pir|AG0003|AG0003 nitrogen regulation protein [imported] - Yersi...    52   1e-05   
pir|AE2439|AE2439 two-component response regulator all5069 [impo...    52   1e-05   
pir|B83227|B83227 probable chemotaxis protein PA3349 [imported] ...    52   1e-05   
gb:AP003980_1835867 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP003975_1835813 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AY456022_1607107 Cochliobolus heterostrophus putative histidi...    52   1e-05   
gb:AB071695_1522928 Zea mays ZmRR10 mRNA for response regulator ...    52   1e-05   
gb:CP000002_856322 Bacillus licheniformis ATCC 14580, complete g...    52   1e-05   
gb:BX936398_836565 Yersinia pseudotuberculosis IP32953 genome, c...    52   1e-05   
gb:BX571966_794867 Burkholderia pseudomallei strain K96243, chro...    52   1e-05   
gb:BX321859_773335 Nitrosomonas europaea ATCC 19718, complete ge...    52   1e-05   
gb:BA000040_730545 Bradyrhizobium japonicum USDA 110 DNA, comple...    52   1e-05   
gb:BA000038_724096 Vibrio vulnificus YJ016 DNA, chromosome II, c...    52   1e-05   
gb:BA000031_707007 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    52   1e-05   
gb:AL646084_549779 Ralstonia solanacearum GMI1000 megaplasmid, c...    52   1e-05   
gb:AE017333_446510 Bacillus licheniformis DSM 13, complete genome.     52   1e-05   
gb:AE017267_422318 Bacillus cereus ATCC 10987, section 4 of 18 o...    52   1e-05   
gb:AE017197_402215 Rickettsia typhi str. Wilmington complete gen...    52   1e-05   
gb:AE017180_398457 Geobacter sulfurreducens PCA, complete genome.      52   1e-05   
gb:AE017133_387473 Yersinia pestis biovar Medievalis str. 91001 ...    52   1e-05   
gb:AE017027_381223 Bacillus anthracis str. Ames section 4 of 18 ...    52   1e-05   
gb:AE016928_359892 Bacteroides thetaiotaomicron VPI-5482, sectio...    52   1e-05   
gb:AE016917_357174 Chromobacterium violaceum ATCC 12472 section ...    52   1e-05   
gb:AE016914_356150 Chromobacterium violaceum ATCC 12472 section ...    52   1e-05   
gb:AE016862_351386 Pseudomonas syringae pv. tomato str. DC3000 s...    52   1e-05   
gb:AE016862_351214 Pseudomonas syringae pv. tomato str. DC3000 s...    52   1e-05   
gb:AE016808_337900 Vibrio vulnificus CMCP6 chromosome II section...    52   1e-05   
gb:AE016790_333785 Pseudomonas putida KT2440 section 17 of 21 of...    52   1e-05   
gb:AE016789_333568 Pseudomonas putida KT2440 section 16 of 21 of...    52   1e-05   
gb:AE013841_300687 Yersinia pestis KIM section 241 of 415 of the...    52   1e-05   
gb:AE013539_293210 Methanosarcina mazei strain Goe1, section 321...    52   1e-05   
gb:AE012406_282149 Xanthomonas campestris pv. campestris str. AT...    52   1e-05   
gb:AE010937_267767 Methanosarcina acetivorans str. C2A, section ...    52   1e-05   
gb:CR555306_108455 Azoarcus sp. EbN1 complete genome.                  52   1e-05   
pir|T47035|T47035 hypothetical protein [imported] - Yersinia pes...    52   1e-05   
pir|A71678|A71678 probable response regulatory protein RP237 - R...    52   1e-05   
pir|A82619|A82619 pilus protein XF1955 [imported] - Xylella fast...    52   1e-05   
sp|Q55169|RCP1_SYNY3|RCP1_SYNY3 Response regulator rcp1.>pir|S74390|S74390 ...    52   1e-05   
gb:AF350323_1790258 Lactuca sativa putative ethylene receptor ET...    51   2e-05   
gb:AE016819_1749119 Ashbya gossypii (= Eremothecium gossypii) AT...    51   2e-05   
gb:HAK237941_1681424 Heterosigma akashiwo chloroplast trg1 gene....    51   2e-05   
gb:AY456004_1607089 Cochliobolus heterostrophus putative histidi...    51   2e-05   
gb:AB062095_1522097 Zea mays ZmRR9 mRNA for response regulator 9...    51   2e-05   
gb:CP000021_873767 Vibrio fischeri ES114 chromosome II, complete...    51   2e-05   
gb:BX572600_802046 Rhodopseudomonas palustris CGA009 complete ge...    51   2e-05   
gb:BX571657_777667 Wolinella succinogenes, complete genome; segm...    51   2e-05   
gb:BX294153_771182 Pirellula sp. strain 1 complete genome; segme...    51   2e-05   
gb:BA000040_735739 Bradyrhizobium japonicum USDA 110 DNA, comple...    51   2e-05   
gb:BA000038_724735 Vibrio vulnificus YJ016 DNA, chromosome II, c...    51   2e-05   
gb:BA000030_698971 Streptomyces avermitilis MA-4680 genomic DNA,...    51   2e-05   
gb:AY772188_645851 Myxococcus xanthus DZ2 red gene locus, comple...    51   2e-05   
gb:AP006840_569588 Symbiobacterium thermophilum DNA, complete ge...    51   2e-05   
gb:AF072440_476288 Enterobacter gergoviae GTPase (bipA) gene, pa...    51   2e-05   
gb:AE017309_438313 Desulfovibrio vulgaris subsp. vulgaris str. H...    51   2e-05   
gb:AE016859_350361 Pseudomonas syringae pv. tomato str. DC3000 s...    51   2e-05   
gb:AE015830_318314 Shewanella oneidensis MR-1 section 379 of 457...    51   2e-05   
gb:AE013598_295447 Xanthomonas oryzae pv. oryzae KACC10331, comp...    51   2e-05   
gb:AE012406_282153 Xanthomonas campestris pv. campestris str. AT...    51   2e-05   
gb:AE011954_278018 Xanthomonas axonopodis pv. citri str. 306, se...    51   2e-05   
gb:AE011954_278017 Xanthomonas axonopodis pv. citri str. 306, se...    51   2e-05   
gb:AE010795_266624 Methanosarcina acetivorans str. C2A, section ...    51   2e-05   
gb:KPNTRC_139624 Klebsiella pneumoniae ntrC gene.                      51   2e-05   
gb:CR555306_105818 Azoarcus sp. EbN1 complete genome.                  51   2e-05   
pir|AG2415|AG2415 two-component hybrid sensor and regulator alr4...    51   2e-05   
pir|AE2469|AE2469 two-component hybrid sensor and regulator all5...    51   2e-05   
pir|T52076|T52076 ABI3-interacting protein aip1 [imported] - Ara...    51   2e-05   
pir|D83149|D83149 probable two-component sensor PA3974 [imported...    51   2e-05   
pir|E72408|E72408 response regulator - Thermotoga maritima (stra...    51   2e-05   
pir|AI2317|AI2317 two-component hybrid sensor and regulator all4...    51   2e-05   
sp|P03029|NTRC_KLEPN|NTRC_KLEPN Nitrogen assimilation regulatory protein.>p...    51   2e-05   
gb:AK175378_1817366 Arabidopsis thaliana mRNA for hypothetical p...    51   2e-05   
gb:CP000021_873449 Vibrio fischeri ES114 chromosome II, complete...    51   2e-05   
gb:BA000039_726810 Thermosynechococcus elongatus BP-1 DNA, compl...    51   2e-05   
gb:AY055428_587098 Vibrio cholerae STX transposon-like element a...    51   2e-05   
gb:AP008231_580379 Synechococcus elongatus PCC 6301 DNA, complet...    51   2e-05   
gb:AP006841_575005 Bacteroides fragilis YCH46 DNA, complete genome.    51   2e-05   
gb:AE017291_433417 Leptospira interrogans serovar Copenhageni st...    51   2e-05   
gb:AE017239_414094 Mycobacterium avium subsp. paratuberculosis s...    51   2e-05   
gb:AE017180_399428 Geobacter sulfurreducens PCA, complete genome.      51   2e-05   
gb:AE017130_386752 Yersinia pestis biovar Medievalis str. 91001 ...    51   2e-05   
gb:AE016961_367868 Coxiella burnetii strain RSA 493, section 2 o...    51   2e-05   
gb:AE016922_358409 Chromobacterium violaceum ATCC 12472 section ...    51   2e-05   
gb:AE016918_357361 Chromobacterium violaceum ATCC 12472 section ...    51   2e-05   
gb:AE016874_354370 Pseudomonas syringae pv. tomato str. DC3000 s...    51   2e-05   
gb:AE016792_334207 Pseudomonas putida KT2440 section 19 of 21 of...    51   2e-05   
gb:AE016770_328784 Escherichia coli CFT073 section 16 of 18 of t...    51   2e-05   
gb:AE011448_273066 Leptospira interrogans serovar lai str. 56601...    51   2e-05   
gb:XCA251547_210725 Xanthomonas campestris regulatory operon (rp...    51   2e-05   
gb:PSEFLESR_160581 Pseudomonas aeruginosa (strain PAK) putative ...    51   2e-05   
gb:CR543861_102789 Acinetobacter sp. ADP1 complete genome.             51   2e-05   
gb:CR522870_100635 Desulfotalea psychrophila LSv54 chromosome.         51   2e-05   
gb:CP000031_87039 Silicibacter pomeroyi DSS-3, complete genome.        51   2e-05   
gb:AE005674_73522 Shigella flexneri 2a str. 301, complete genome...    51   2e-05   
pir|S76044|S76044 hypothetical protein slr0322 - Synechocystis s...    51   2e-05   
pir|H83132|H83132 probable sensor/response regulator hybrid PA41...    51   2e-05   
pir|E87698|E87698 sensor histidine kinase/response regulator [im...    51   2e-05   
pir|E87554|E87554 hypothetical protein CC2462 [imported] - Caulo...    51   2e-05   
pir|D83508|D83508 two-component response regulator PA1099 [impor...    51   2e-05   
pir|H83863|H83863 modulation of CheA activity in response to att...    51   2e-05   
pir|F75609|F75609 response regulator - Deinococcus radiodurans (...    51   2e-05   
pir|AD0149|AD0149 two component sensor kinase/response regulator...    51   2e-05   
pir|B30377|RGECGG nitrogen regulation protein I ntrC - Escherich...    51   2e-05   
sp|P06713|NTRC_ECOLI|NTRC_ECOLI Nitrogen regulation protein NR(I).>pir|F912...    51   2e-05   
sp|P18769|FRZE_MYXXA|FRZE_MYXXA Gliding motility regulatory protein (EC 2.7...    51   2e-05   
gb:CCRPLED_845629 Caulobacter crescentus pleD gene, complete cds.      50   3e-05   
gb:BA000045_741759 Gloeobacter violaceus PCC 7421 DNA, complete ...    50   3e-05   
gb:BA000040_728651 Bradyrhizobium japonicum USDA 110 DNA, comple...    50   3e-05   
gb:BA000039_728230 Thermosynechococcus elongatus BP-1 DNA, compl...    50   3e-05   
gb:BA000039_726130 Thermosynechococcus elongatus BP-1 DNA, compl...    50   3e-05   
gb:BA000038_725560 Vibrio vulnificus YJ016 DNA, chromosome II, c...    50   3e-05   
gb:BA000031_708027 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    50   3e-05   
gb:AY037869_586138 Pseudomonas chlororaphis GacS gene, complete ...    50   3e-05   
gb:AP006840_567681 Symbiobacterium thermophilum DNA, complete ge...    50   3e-05   
gb:AF517688_518355 Pseudomonas chlororaphis two-component sensor...    50   3e-05   
gb:AF192795_486983 Pseudomonas chlororaphis two component histid...    50   3e-05   
gb:AE017340_457475 Idiomarina loihiensis L2TR, complete genome.        50   3e-05   
gb:AE017180_399955 Geobacter sulfurreducens PCA, complete genome.      50   3e-05   
gb:AE016940_362669 Bacteroides thetaiotaomicron VPI-5482, sectio...    50   3e-05   
gb:AE016916_356880 Chromobacterium violaceum ATCC 12472 section ...    50   3e-05   
gb:AE016870_353448 Pseudomonas syringae pv. tomato str. DC3000 s...    50   3e-05   
gb:AE016812_338857 Vibrio vulnificus CMCP6 chromosome II section...    50   3e-05   
gb:AE013598_297903 Xanthomonas oryzae pv. oryzae KACC10331, comp...    50   3e-05   
gb:CR543861_103331 Acinetobacter sp. ADP1 complete genome.             50   3e-05   
gb:CP000026_78498 Salmonella enterica subsp. enterica serovar Pa...    50   3e-05   
pir|AE2041|AE2041 two-component hybrid sensor and regulator alr1...    50   3e-05   
pir|E82198|E82198 sensor histidine kinase/response regulator VC1...    50   3e-05   
pir|S53024|S53024 nitrogen regulation protein I ntrC - Salmonell...    50   3e-05   
pir|E86074|E86074 hypothetical protein glnG [imported] - Escheri...    50   3e-05   
sp|P41789|NTRC_SALTY|NTRC_SALTY Nitrogen regulation protein NR(I).>gb:AE008...    50   3e-05   
gb:AY225134_2312738 Feldmannia irregularis virus a strain FirrV-...    50   4e-05   
gb:AY456059_1607139 Botryotinia fuckeliana putative histidine ki...    50   4e-05   
gb:AB189038_1529377 Oryza sativa (japonica cultivar-group) OsPRR...    50   4e-05   
gb:AB006362_1509766 Candida albicans CaSLN1 gene, complete cds.        50   4e-05   
gb:BX842655_826282 Bdellovibrio bacteriovorus complete genome, s...    50   4e-05   
gb:BX842653_825654 Bdellovibrio bacteriovorus complete genome, s...    50   4e-05   
gb:BX640427_809731 Bordetella parapertussis strain 12822, comple...    50   4e-05   
gb:AP006627_566199 Bacillus clausii KSM-K16 DNA, complete genome.      50   4e-05   
gb:AF502252_517231 Pseudomonas chlororaphis strain PCL1391 senso...    50   4e-05   
gb:AE017320_441544 Desulfovibrio vulgaris subsp. vulgaris str. H...    50   4e-05   
gb:AE017310_438514 Desulfovibrio vulgaris subsp. vulgaris str. H...    50   4e-05   
gb:AE017180_400518 Geobacter sulfurreducens PCA, complete genome.      50   4e-05   
gb:AE017180_399416 Geobacter sulfurreducens PCA, complete genome.      50   4e-05   
gb:AE016921_358209 Chromobacterium violaceum ATCC 12472 section ...    50   4e-05   
gb:AE016871_353736 Pseudomonas syringae pv. tomato str. DC3000 s...    50   4e-05   
gb:AE016812_338869 Vibrio vulnificus CMCP6 chromosome II section...    50   4e-05   
gb:AE016777_330340 Pseudomonas putida KT2440 section 4 of 21 of ...    50   4e-05   
gb:AE012556_284264 Xylella fastidiosa Temecula1, section 4 of 9 ...    50   4e-05   
gb:AE011953_278014 Xanthomonas axonopodis pv. citri str. 306, se...    50   4e-05   
gb:SME591791_186813 Sinorhizobium meliloti 1021 complete chromos...    50   4e-05   
pir|AH2264|AH2264 two-component hybrid sensor and regulator alr3...    50   4e-05   
pir|G97400|G97400 sensor/response regulator hybrid protein (PA09...    50   4e-05   
pir|AI2873|AI2873 transcription regulator, LuxR family Atu2419 [...    50   4e-05   
pir|AG2618|AG2618 hypothetical protein barA [imported] - Agrobac...    50   4e-05   
pir|F82618|F82618 chemotaxis-related protein kinase XF1952 [impo...    50   4e-05   
pir|E75450|E75450 DNA-binding response regulator - Deinococcus r...    50   4e-05   
gb:AY658181_2147191 Synthetic construct Peudomonas aeruginosa cl...    50   5e-05   
gb:AY282750_1594716 Emericella nidulans histidine kinase J7 (hk4...    50   5e-05   
gb:AB036054_1518999 Emericella nidulans NHK1 mRNA, complete cds.       50   5e-05   
gb:AF462151_1273286 Tritrichomonas foetus hybrid histidine kinas...    50   5e-05   
gb:CP000009_862723 Gluconobacter oxydans 621H, complete genome.        50   5e-05   


>gb:AF534888_1809603 Catharanthus roseus type-A response regulator
           (RR1) mRNA, complete cds.
          Length = 254

 Score =  223 bits (569), Expect = 2e-57
 Identities = 112/142 (78%), Positives = 127/142 (89%)
 Frame = -2

Query: 657 CSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSA 478
           CSS   G  +ELHVLAVDDS VDRKVIE++LKISCCKVTAV+SG RALQYLGLDGE+S+ 
Sbjct: 6   CSS---GSAKELHVLAVDDSLVDRKVIERLLKISCCKVTAVESGRRALQYLGLDGEKSTV 62

Query: 477 ATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAK 298
             DGLKVNLI+TDYSMPGMTGYELLKKIKGSS L++IPVVIMSSE IL RID CLEEGA+
Sbjct: 63  GFDGLKVNLILTDYSMPGMTGYELLKKIKGSSTLKEIPVVIMSSENILTRIDRCLEEGAE 122

Query: 297 EFLMKPVKLSDVKRVVDFIVRG 232
           EFL+KPVKLSDVKR+ DF+++G
Sbjct: 123 EFLVKPVKLSDVKRIKDFVLKG 144



>pir|E96778|E96778 hypothetical protein F9E10.26 [imported] -
           Arabidopsis thaliana>gb:AE005173_895031 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC013258_1537838 Arabidopsis thaliana
           chromosome 1 BAC F9E10 genomic sequence, complete
           sequence.>gb:F25A4_1678024 Arabidopsis thaliana
           chromosome 1 BAC F25A4 sequence, complete
           sequence.>gb:AF305720_1784463 Arabidopsis thaliana
           ecotype Columbia response regulator 15 mRNA, complete
           cds.
          Length = 206

 Score =  198 bits (504), Expect = 7e-50
 Identities = 102/148 (68%), Positives = 121/148 (81%)
 Frame = -2

Query: 675 IAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLD 496
           +A  D  SS       ELHVLAVDDS+VDRKVIE++LKIS CKVT V+SG+RALQYLGLD
Sbjct: 1   MALRDLSSSLSSSSSPELHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLD 60

Query: 495 GEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSC 316
           G+  S+    LKVNLI+TDYSMPG+TGYELLKKIK SSALR+IPVVIMSSE I  RI+ C
Sbjct: 61  GDNGSSGLKDLKVNLIVTDYSMPGLTGYELLKKIKESSALREIPVVIMSSENIQPRIEQC 120

Query: 315 LEEGAKEFLMKPVKLSDVKRVVDFIVRG 232
           + EGA+EFL+KPVKL+DVKR+ + I+RG
Sbjct: 121 MIEGAEEFLLKPVKLADVKRLKELIMRG 148



>pir|T50857|T50857 response regulator 6 [imported] - Arabidopsis
           thaliana>gb:AB008489_1510525 Arabidopsis thaliana ARR6
           mRNA for response regulator 6, complete
           cds.>gb:AB009053_1510703 Arabidopsis thaliana genomic
           DNA, chromosome 5, P1 clone:MQB2.>gb:BT004799_1637833
           Arabidopsis thaliana At5g62920 gene, complete cds.
          Length = 186

 Score =  195 bits (495), Expect = 7e-49
 Identities = 101/140 (72%), Positives = 117/140 (83%)
 Frame = -2

Query: 654 SSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAA 475
           SS FG     LHVLAVDDS+VDRK IE++L++S CKVT VDS +RALQYLGLD EE S  
Sbjct: 16  SSKFGSPD-PLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGLDVEEKSVG 74

Query: 474 TDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKE 295
            + LKVNLIMTDYSMPGMTGYELLKKIK SSA R++PVVIMSSE IL RID CLEEGA++
Sbjct: 75  FEDLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRCLEEGAED 134

Query: 294 FLMKPVKLSDVKRVVDFIVR 235
           FL+KPVKLSDVKR+ D +++
Sbjct: 135 FLLKPVKLSDVKRLRDSLMK 154



>pir|T50856|T50856 response regulator 5 [imported] - Arabidopsis
           thaliana>gb:AB008488_1510524 Arabidopsis thaliana ARR5
           mRNA for response regulator 5, complete cds.
          Length = 184

 Score =  191 bits (485), Expect = 1e-47
 Identities = 102/152 (67%), Positives = 121/152 (79%), Gaps = 1/152 (0%)
 Frame = -2

Query: 687 RPEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQY 508
           RPE +   +  SS      + LHVLAVDDS VDRK IE++L++S CKVT VDS +RALQY
Sbjct: 6   RPEMLDISNDTSSL--ASPKLLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQY 63

Query: 507 LGLDGEE-SSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILA 331
           LGLDGE  SS   + LK+NLIMTDYSMPGMTGYELLKKIK SSA R+IPVVIMSSE IL 
Sbjct: 64  LGLDGENNSSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILP 123

Query: 330 RIDSCLEEGAKEFLMKPVKLSDVKRVVDFIVR 235
           RID CLEEGA++FL+KPVKL+DVKR+ D +++
Sbjct: 124 RIDRCLEEGAEDFLLKPVKLADVKRLRDSLMK 155



>pir|T50855|T50855 two-component response regulator homolog
           [imported] - Arabidopsis thaliana>gb:AF057281_1764782
           Arabidopsis thaliana two-component response regulator
           homolog (IBC6) mRNA, complete cds.
          Length = 184

 Score =  191 bits (485), Expect = 1e-47
 Identities = 102/152 (67%), Positives = 121/152 (79%), Gaps = 1/152 (0%)
 Frame = -2

Query: 687 RPEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQY 508
           RPE +   +  SS      + LHVLAVDDS VDRK IE++L++S CKVT VDS +RALQY
Sbjct: 6   RPEMLDISNDTSSL--ASPKLLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQY 63

Query: 507 LGLDGEE-SSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILA 331
           LGLDGE  SS   + LK+NLIMTDYSMPGMTGYELLKKIK SSA R+IPVVIMSSE IL 
Sbjct: 64  LGLDGENNSSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILP 123

Query: 330 RIDSCLEEGAKEFLMKPVKLSDVKRVVDFIVR 235
           RID CLEEGA++FL+KPVKL+DVKR+ D +++
Sbjct: 124 RIDRCLEEGAEDFLLKPVKLADVKRLRDSLMK 155



>pir|T06673|T06673 response reactor 2 [imported] - Arabidopsis
           thaliana>gb:AB010916_1511290 Arabidopsis thaliana mRNA
           for responce reactor2, complete cds.>gb:ATT17F15_1554694
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           T17F15.>gb:AY072390_1567207 Arabidopsis thaliana
           response reactor 2 (ATRR2) (At3g48100) mRNA, complete
           cds.>gb:AY114698_1578740 Arabidopsis thaliana response
           reactor 2 (ATRR2) (At3g48100) mRNA, complete cds.
          Length = 184

 Score =  191 bits (485), Expect = 1e-47
 Identities = 102/152 (67%), Positives = 121/152 (79%), Gaps = 1/152 (0%)
 Frame = -2

Query: 687 RPEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQY 508
           RPE +   +  SS      + LHVLAVDDS VDRK IE++L++S CKVT VDS +RALQY
Sbjct: 6   RPEMLDISNDTSSL--ASPKLLHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQY 63

Query: 507 LGLDGEE-SSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILA 331
           LGLDGE  SS   + LK+NLIMTDYSMPGMTGYELLKKIK SSA R+IPVVIMSSE IL 
Sbjct: 64  LGLDGENNSSVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILP 123

Query: 330 RIDSCLEEGAKEFLMKPVKLSDVKRVVDFIVR 235
           RID CLEEGA++FL+KPVKL+DVKR+ D +++
Sbjct: 124 RIDRCLEEGAEDFLLKPVKLADVKRLRDSLMK 155



>pir|T50854|T50854 response regulator 7 [imported] - Arabidopsis
           thaliana>gb:AE005172_890865 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AB008490_1510526 Arabidopsis thaliana ARR7
           mRNA for response regulator 7, complete
           cds.>gb:AC068602_1540394 Genomic sequence for
           Arabidopsis thaliana BAC F14D16 from chromosome I,
           complete sequence.
          Length = 206

 Score =  187 bits (475), Expect = 2e-46
 Identities = 93/131 (70%), Positives = 113/131 (86%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           ELHVLAVDDS VDRKVIE++L+IS CKVT V+SG+RALQYLGLDG + ++    LKVNLI
Sbjct: 23  ELHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGGKGASNLKDLKVNLI 82

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TDYSMPG++GY+LLKKIK SSA R++PVVIMSSE IL RI  CL+EGA+EFL+KPVKL+
Sbjct: 83  VTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQECLKEGAEEFLLKPVKLA 142

Query: 267 DVKRVVDFIVR 235
           DVKR+   I+R
Sbjct: 143 DVKRIKQLIMR 153



>gb:AF339732_1787775 Dianthus caryophyllus response regulator
           protein (RR) mRNA, complete cds.
          Length = 264

 Score =  186 bits (471), Expect = 4e-46
 Identities = 88/129 (68%), Positives = 111/129 (86%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           E HVLAVDDS +DRKVIE++LK + CKVT VDSG RAL++LGLD E+ ++  DGLK++LI
Sbjct: 34  EAHVLAVDDSLIDRKVIERLLKTTSCKVTVVDSGMRALEFLGLDAEQRTSVVDGLKIDLI 93

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TDY MPGMTGYELLKKIK SS  ++ PVVIMSSE ++ARID CLEEGA++F++KPVKLS
Sbjct: 94  ITDYCMPGMTGYELLKKIKESSTFKETPVVIMSSENVIARIDRCLEEGAEDFILKPVKLS 153

Query: 267 DVKRVVDFI 241
           DVKR+ D++
Sbjct: 154 DVKRLRDYM 162



>pir|T48851|T48851 response regulator 1 [imported] - Arabidopsis
           thaliana>gb:AE005172_890054 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AB008487_1510523 Arabidopsis thaliana ARR4
           mRNA for response regulator 4, complete
           cds.>gb:AB010915_1511289 Arabidopsis thaliana mRNA for
           responce regulator1, complete cds.>gb:AC007067_1535126
           Genomic sequence for Arabidopsis thaliana BAC T10O24
           from Chromosome 1, complete
           sequence.>gb:AF057282_1764783 Arabidopsis thaliana
           two-component response regulator homolog (IBC7) mRNA,
           complete cds.
          Length = 259

 Score =  182 bits (462), Expect = 5e-45
 Identities = 91/125 (72%), Positives = 110/125 (88%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           E+HVLAVDDS VDR VIE++L+I+ CKVTAVDSG RAL++LGLD E++SA  D LKV+LI
Sbjct: 33  EVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDNEKASAEFDRLKVDLI 92

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TDY MPGMTGYELLKKIK SS  R++PVVIMSSE +L RID CLEEGA++FL+KPVKL+
Sbjct: 93  ITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVKLA 152

Query: 267 DVKRV 253
           DVKR+
Sbjct: 153 DVKRL 157



>pir|T50853|T50853 response regulator 3 [imported] - Arabidopsis
           thaliana>gb:AE005173_893676 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AB008486_1510522 Arabidopsis thaliana ARR3
           mRNA for response regulator 3, complete
           cds.>gb:AC007258_1535677 Arabidopsis thaliana chromosome
           I BAC F23H11 genomic sequence, complete sequence.
          Length = 231

 Score =  177 bits (450), Expect = 1e-43
 Identities = 85/131 (64%), Positives = 113/131 (86%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           ++HVLAVDDS VDR VIE++L+I+ CKVTAVDSG RAL++LGLD ++++   D LKV+LI
Sbjct: 32  QVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDDDKAAVEFDRLKVDLI 91

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TDY MPGMTGYELLKKIK S++ +++PVVIMSSE ++ RID CLEEGA++FL+KPVKL+
Sbjct: 92  ITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVMTRIDRCLEEGAEDFLLKPVKLA 151

Query: 267 DVKRVVDFIVR 235
           DVKR+  ++ R
Sbjct: 152 DVKRLRSYLTR 162



>gb:AF305722_1784465 Arabidopsis thaliana ecotype Columbia response
           regulator 17 mRNA, complete cds.
          Length = 153

 Score =  159 bits (401), Expect = 6e-38
 Identities = 78/137 (56%), Positives = 107/137 (78%), Gaps = 1/137 (0%)
 Frame = -2

Query: 660 GCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGL-DGEES 484
           G  S       ELHVLAVDD+ +DRK++E++LKIS CKVT  ++G RAL+YLGL D +++
Sbjct: 8   GSDSCLSSMEEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGLGDPQQT 67

Query: 483 SAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEG 304
            + T+ +KVNLI+TDY MPGMTG+ELLKK+K SS L+++PVVI+SSE I  RI+ CL  G
Sbjct: 68  DSLTNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRINKCLASG 127

Query: 303 AKEFLMKPVKLSDVKRV 253
           A+ F+ KP+KLSDV+++
Sbjct: 128 AQMFMQKPLKLSDVEKL 144



>gb:AB042268_1519873 Zea mays ZmRR6 mRNA for response regulator 6,
           complete cds.
          Length = 235

 Score =  155 bits (392), Expect = 6e-37
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 11/140 (7%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESS-----------AA 475
           HVLAVDDS  DRK+IE++LK S  +VT VDSGS+ALQ+LGL  ++S+           AA
Sbjct: 43  HVLAVDDSLPDRKLIERLLKTSSFQVTTVDSGSKALQFLGLHDQDSTVPPVHTHQLDVAA 102

Query: 474 TDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKE 295
              + VNLI+TDY MPGMTGY+LLKKIK SS+LR IPVVIMSSE I +RI+ CLEEGA E
Sbjct: 103 NQDVAVNLIITDYCMPGMTGYDLLKKIKESSSLRDIPVVIMSSENIPSRINRCLEEGADE 162

Query: 294 FLMKPVKLSDVKRVVDFIVR 235
           F +KPV+LSD+ ++   I++
Sbjct: 163 FFLKPVRLSDMNKLKPHILK 182



>gb:AX048778_1458094 Sequence 49 from Patent WO0070059.
          Length = 235

 Score =  155 bits (392), Expect = 6e-37
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 11/140 (7%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESS-----------AA 475
           HVLAVDDS  DRK+IE++LK S  +VT VDSGS+ALQ+LGL  ++S+           AA
Sbjct: 43  HVLAVDDSLPDRKLIERLLKTSSFQVTTVDSGSKALQFLGLHDQDSTVPPVHTHQLDVAA 102

Query: 474 TDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKE 295
              + VNLI+TDY MPGMTGY+LLKKIK SS+LR IPVVIMSSE I +RI+ CLEEGA E
Sbjct: 103 NQDVAVNLIITDYCMPGMTGYDLLKKIKESSSLRDIPVVIMSSENIPSRINRCLEEGADE 162

Query: 294 FLMKPVKLSDVKRVVDFIVR 235
           F +KPV+LSD+ ++   I++
Sbjct: 163 FFLKPVRLSDMNKLKPHILK 182



>gb:AP003683_1831959 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0431G06.
          Length = 232

 Score =  154 bits (390), Expect = 1e-36
 Identities = 79/138 (57%), Positives = 109/138 (78%), Gaps = 9/138 (6%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGL--DGEESSAATDG------ 466
           HVLAVDDS +DRK+IE +LK S  +VT VDSGS+AL+ LGL  +G++SS++         
Sbjct: 11  HVLAVDDSLIDRKLIEMLLKNSSYQVTTVDSGSKALELLGLRDEGDDSSSSPSSSSPDHQ 70

Query: 465 -LKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFL 289
            + VNLI+TDY MPGMTGY+LLK++KGSS+L+ IPVVIMSSE + ARI+ CLE+GA+EF 
Sbjct: 71  EIDVNLIITDYCMPGMTGYDLLKRVKGSSSLKDIPVVIMSSENVPARINRCLEDGAEEFF 130

Query: 288 MKPVKLSDVKRVVDFIVR 235
           +KPVKL+D+K++   +++
Sbjct: 131 LKPVKLADMKKLKSHLLK 148



>pir|D84832|D84832 hypothetical protein At2g40670 [imported] -
           Arabidopsis thaliana>gb:AC007660_1536076 Arabidopsis
           thaliana chromosome II section 220 of 255 of the
           complete sequence. Sequence from clones T2P4, T7D17,
           T20B5.>gb:ATH279079_1552272 Arabidopsis thaliana mRNA
           for putative type A response regulator (ARR15
           gene).>gb:AF305721_1784464 Arabidopsis thaliana ecotype
           Columbia response regulator 16 mRNA, complete cds.
          Length = 164

 Score =  153 bits (387), Expect = 2e-36
 Identities = 75/132 (56%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = -2

Query: 639 GGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEES---SAATD 469
           G   ELHVLAVDD+ +DRK++E++LKISCCKVT  ++  RAL+YLGL  +     +   +
Sbjct: 24  GHDEELHVLAVDDNLIDRKLVERLLKISCCKVTTAENALRALEYLGLGDQNQHIDALTCN 83

Query: 468 GLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFL 289
            +KV+LI+TDY MPGMTG+ELLKK+K SS LR++PVVIMSSE I  RI+ CL  GA+ F+
Sbjct: 84  VMKVSLIITDYCMPGMTGFELLKKVKESSNLREVPVVIMSSENIPTRINKCLASGAQMFM 143

Query: 288 MKPVKLSDVKRV 253
            KP+KL+DV+++
Sbjct: 144 QKPLKLADVEKL 155



>gb:AF534890_1809605 Catharanthus roseus type-A response regulator
           (RR3) mRNA, complete cds.
          Length = 188

 Score =  151 bits (382), Expect = 9e-36
 Identities = 78/131 (59%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDG----LKVN 454
           HVLAVDDS VDRK+IE++LK S  +VT VDSG +AL++LGL  EE   +       ++VN
Sbjct: 11  HVLAVDDSLVDRKLIERLLKTSAYQVTVVDSGIKALEFLGLLDEEKEISGSNHQQVVEVN 70

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           LI+TDYSMPGMTGY+LL+K+K SS L+ IPVVIMSSE I +RI+ CLEEGA +F +KPVK
Sbjct: 71  LIITDYSMPGMTGYDLLRKVKESSYLKDIPVVIMSSENIPSRINRCLEEGADDFFLKPVK 130

Query: 273 LSDVKRVVDFI 241
            SDV +++  +
Sbjct: 131 QSDVNKLIPLV 141



>gb:AB042267_1519872 Zea mays ZmRR5 mRNA for response regulator 5,
           complete cds.
          Length = 236

 Score =  151 bits (382), Expect = 9e-36
 Identities = 77/133 (57%), Positives = 103/133 (77%), Gaps = 4/133 (3%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDG----LKVN 454
           HVLAVDDS VDRK+IE +LK S  +VT VDSGS+AL+ LGL    S + +      + VN
Sbjct: 11  HVLAVDDSLVDRKLIEMLLKTSSYQVTTVDSGSKALELLGLRDASSPSPSSPDHQEIDVN 70

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           LI+TDY MPGMTGY+LLK++KGSS+L+ IPVVIMSSE + ARI  CL++GA+EF +KPVK
Sbjct: 71  LIITDYCMPGMTGYDLLKRVKGSSSLKDIPVVIMSSENVPARISRCLQDGAEEFFLKPVK 130

Query: 273 LSDVKRVVDFIVR 235
           L+D+K++   +++
Sbjct: 131 LADMKKLKSHLLK 143



>pir|T50860|T50860 response regulator 6 [imported] - Arabidopsis
           thaliana>gb:AB008491_1510527 Arabidopsis thaliana ARR6
           gene for response regulator 6, complete cds.
          Length = 162

 Score =  151 bits (382), Expect = 9e-36
 Identities = 84/140 (60%), Positives = 98/140 (70%)
 Frame = -2

Query: 654 SSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAA 475
           SS FG     LHVLAVDDS+VDRK IE++L++S CKVT VDS +RALQYLGLD EE S  
Sbjct: 16  SSKFGSPD-PLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGLDVEEKSVG 74

Query: 474 TDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKE 295
            + LKVNLIMTDYSMPGMTGYELLKKIK                        CLEEGA++
Sbjct: 75  FEDLKVNLIMTDYSMPGMTGYELLKKIK------------------------CLEEGAED 110

Query: 294 FLMKPVKLSDVKRVVDFIVR 235
           FL+KPVKLSDVKR+ D +++
Sbjct: 111 FLLKPVKLSDVKRLRDSLMK 130



>pir|T48853|T48853 response reactor 3 [imported] - Arabidopsis
           thaliana>gb:AB010917_1511291 Arabidopsis thaliana mRNA
           for responce reactor3, complete cds.>gb:AC005662_1532874
           Arabidopsis thaliana chromosome 2 clone F13H10 map
           CIC11C08, complete sequence.>gb:AY074643_1567645
           Arabidopsis thaliana At2g41310/F13H10.14 mRNA, complete
           cds.
          Length = 225

 Score =  151 bits (381), Expect = 1e-35
 Identities = 77/133 (57%), Positives = 104/133 (78%), Gaps = 8/133 (6%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGL---DGEESSAATDG--- 466
           + HVLAVDDS  DRK+IE++L+ S C+VT VDSGS+AL++LGL   D + ++ +T     
Sbjct: 8   KFHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGLRVDDNDPNALSTSPQIH 67

Query: 465 --LKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEF 292
             +++NLI+TDY MPGMTGY+LLKK+K S+A R IPVVIMSSE + ARI  CLEEGA+EF
Sbjct: 68  QEVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRCLEEGAEEF 127

Query: 291 LMKPVKLSDVKRV 253
            +KPVKL+D+ ++
Sbjct: 128 FLKPVKLADLTKL 140



>pir|T47764|T47764 responce reactor 4 - Arabidopsis
           thaliana>gb:AB010918_1511292 Arabidopsis thaliana mRNA
           for responce reactor4, complete cds.>gb:ATF24I3_1549903
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           F24I3.>gb:AY090234_1573989 Arabidopsis thaliana
           AT3g57040/F24I3_120 mRNA, complete
           cds.>gb:AY133571_1581394 Arabidopsis thaliana
           At3g57040/F24I3_120 mRNA, complete cds.
          Length = 234

 Score =  150 bits (380), Expect = 2e-35
 Identities = 78/135 (57%), Positives = 103/135 (76%), Gaps = 10/135 (7%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGL----DGEESSAATDG-- 466
           + HVLAVDDS  DRK+IE++L+ S C+VT VDSGS+AL++LGL    D  + +A +    
Sbjct: 8   QFHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQSTDSNDPNAFSKAPV 67

Query: 465 ----LKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAK 298
               ++VNLI+TDY MPGMTGY+LLKK+K SSA R IPVVIMSSE + ARI  CLEEGA+
Sbjct: 68  NHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISRCLEEGAE 127

Query: 297 EFLMKPVKLSDVKRV 253
           EF +KPV+L+D+ ++
Sbjct: 128 EFFLKPVRLADLNKL 142



>gb:AF534889_1809604 Catharanthus roseus type-A response regulator
           (RR2) mRNA, complete cds.
          Length = 154

 Score =  146 bits (368), Expect = 4e-34
 Identities = 78/139 (56%), Positives = 97/139 (69%), Gaps = 13/139 (9%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGL---- 463
           +ELHVLAVDD+ +DRK++EK+L  S CKVT  ++G RAL+YLG  G  S + T  L    
Sbjct: 7   KELHVLAVDDNIIDRKIVEKLLISSSCKVTTAENGIRALEYLGNLGVHSESQTPALHQDD 66

Query: 462 ---------KVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLE 310
                    KVNLI+TDY  P MTGYELLKKIK SS L+ IPV++MSSE I  RI  CLE
Sbjct: 67  AIPTAAGDLKVNLIITDYCKPEMTGYELLKKIKESSILKDIPVIVMSSENIPTRIHKCLE 126

Query: 309 EGAKEFLMKPVKLSDVKRV 253
           EGA+ F++KP+K SDV R+
Sbjct: 127 EGAQMFMLKPLKHSDVTRL 145



>gb:AB042261_1519871 Zea mays ZmRR4 mRNA for response regulator 4,
           complete cds.
          Length = 235

 Score =  140 bits (353), Expect = 2e-32
 Identities = 74/145 (51%), Positives = 104/145 (71%), Gaps = 16/145 (11%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGL--------------DGEES 484
           HVLAVDDS +DRK+IE +LK S  +VT V+SG++AL+ LGL                  S
Sbjct: 11  HVLAVDDSIIDRKLIEMLLKSSSYQVTTVESGNKALELLGLRDNGAEDASPPSSSSSSSS 70

Query: 483 SAATDG--LKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLE 310
           S++ D   + V+LI+TDY MPGMTGY+LLK++KGSS+L+ IPVVIMSSE + ARI  CL+
Sbjct: 71  SSSPDHQEIDVSLIITDYCMPGMTGYDLLKRVKGSSSLKDIPVVIMSSENVPARISRCLQ 130

Query: 309 EGAKEFLMKPVKLSDVKRVVDFIVR 235
           +GA+EF +KPVK +D+K++   +++
Sbjct: 131 DGAEEFFLKPVKPADMKKLKSHLLK 155



>gb:AP006452_1861887 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1250G12.
          Length = 147

 Score =  137 bits (344), Expect = 2e-31
 Identities = 76/129 (58%), Positives = 93/129 (72%)
 Frame = -2

Query: 639 GGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLK 460
           GGG   HVLAVDDS VDR VI  +L+ S  +VTAVDSG RAL+ LG +            
Sbjct: 23  GGGAPPHVLAVDDSSVDRAVIAGILRSSRFRVTAVDSGKRALELLGSEPN---------- 72

Query: 459 VNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           V++I+TDY MP MTGYELLKK+K SS L++IPVVIMSSE +  RI  CLEEGA++FL+KP
Sbjct: 73  VSMIITDYWMPEMTGYELLKKVKESSKLKKIPVVIMSSENVPTRISRCLEEGAEDFLVKP 132

Query: 279 VKLSDVKRV 253
           V+ SDV R+
Sbjct: 133 VRPSDVSRL 141



>gb:OSJN00211_1696783 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0065J09, complete sequence.
          Length = 137

 Score =  135 bits (341), Expect = 5e-31
 Identities = 77/141 (54%), Positives = 97/141 (68%)
 Frame = -2

Query: 657 CSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSA 478
           C S     G   HVLAVDDS VDR VI  +L+ S  +VTAVDSG RAL+ LG +      
Sbjct: 4   CRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAVDSGKRALELLGSEPN---- 59

Query: 477 ATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAK 298
                 V++I+TDY MP MTGYELLKK+K SS L++IPVVIMSSE +  RI+ CLEEGA+
Sbjct: 60  ------VSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVSTRINRCLEEGAE 113

Query: 297 EFLMKPVKLSDVKRVVDFIVR 235
           +FL+KPV+ SDV R+   ++R
Sbjct: 114 DFLLKPVQPSDVSRLCSRVLR 134



>gb:AB042260_1519870 Zea mays ZmRR3 mRNA for response regulator,
           complete cds.
          Length = 135

 Score =  135 bits (341), Expect = 5e-31
 Identities = 75/129 (58%), Positives = 94/129 (72%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           HVLAVDDS VDR VI  +L+ S  +VTAVDSG RAL+ LG +            V++I+T
Sbjct: 17  HVLAVDDSSVDRAVIAGILRSSQFRVTAVDSGKRALELLGTEPN----------VSMIIT 66

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
           DY MP MTGYELLKKIK SS L++IPVVIMSSE +  RI+ CLEEGA++FL+KPV+ SDV
Sbjct: 67  DYWMPEMTGYELLKKIKESSRLKEIPVVIMSSENVPTRINRCLEEGAEDFLLKPVRPSDV 126

Query: 261 KRVVDFIVR 235
            R+   ++R
Sbjct: 127 SRLCSRVLR 135



>pir|T50858|T50858 repsonse regulator ZmRR2 [imported] -
           maize>gb:AB024291_1515924 Zea mays ZmRR2 mRNA, complete
           cds.>gb:AB031012_1518588 Zea mays ZmRR2 gene for
           response regulator 2, complete cds.
          Length = 157

 Score =  135 bits (339), Expect = 9e-31
 Identities = 77/127 (60%), Positives = 92/127 (72%), Gaps = 2/127 (1%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGL--KVN 454
           E HVLAVDDS VDR VI K+L+ S  +VT VDS +RAL+ L L          GL   VN
Sbjct: 36  EKHVLAVDDSSVDRAVIAKILRSSKYRVTTVDSATRALELLAL----------GLVPDVN 85

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           +I+TDY MPGMTGYELLK +K SSALR IPVVIMSSE +  RI  CLEEGA++FL+KPV+
Sbjct: 86  MIITDYWMPGMTGYELLKHVKESSALRAIPVVIMSSENVPTRISRCLEEGAEDFLLKPVR 145

Query: 273 LSDVKRV 253
            +DV R+
Sbjct: 146 PADVSRL 152



>gb:OSJN00002_1693074 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0018M05, complete
           sequence.>gb:OSJN00095_1694829 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0004A17, complete
           sequence.
          Length = 170

 Score =  134 bits (337), Expect = 2e-30
 Identities = 78/148 (52%), Positives = 100/148 (67%), Gaps = 2/148 (1%)
 Frame = -2

Query: 690 GRPEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQ 511
           G   K+  V   ++       E+HVLAVDDS VDR VI K+L+ S  +VT V+S +RAL+
Sbjct: 28  GGDRKVVPVVVAAAAGDEAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALE 87

Query: 510 YLGLDGEESSAATDGL--KVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKI 337
            L L          GL   VN+I+TDY MPGMTGYELLK++K SS L++IPVVIMSSE +
Sbjct: 88  LLCL----------GLVPNVNMIITDYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENV 137

Query: 336 LARIDSCLEEGAKEFLMKPVKLSDVKRV 253
             RI  CLEEGA++FL+KPV+ SDV R+
Sbjct: 138 PNRISRCLEEGAEDFLLKPVRPSDVSRL 165



>pir|T49039|T49039 response regulator-like protein - Arabidopsis
           thaliana>gb:ATT5P19_1556243 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T5P19.
          Length = 122

 Score =  132 bits (332), Expect = 6e-30
 Identities = 66/114 (57%), Positives = 89/114 (78%), Gaps = 1/114 (0%)
 Frame = -2

Query: 660 GCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGL-DGEES 484
           G  S       ELHVLAVDD+ +DRK++E++LKIS CKVT  ++G RAL+YLGL D +++
Sbjct: 8   GSDSCLSSMEEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGLGDPQQT 67

Query: 483 SAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARID 322
            + T+ +KVNLI+TDY MPGMTG+ELLKK+K SS L+++PVVI+SSE I  RI+
Sbjct: 68  DSLTNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRIN 121



>gb:AP004043_1836790 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1124_D06.
          Length = 131

 Score =  129 bits (324), Expect = 5e-29
 Identities = 69/130 (53%), Positives = 93/130 (71%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           E HVLAVDDS VDR VI ++L+ S  +VT VDSG RAL+ L LD            V++I
Sbjct: 10  EPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGKRALEVLSLDRN----------VHMI 59

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TDY MP MTG++LLK++K S+ L++IPVV+MSSE    RI  CLEEGA++FL+KPV+ S
Sbjct: 60  ITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRRCLEEGAEDFLIKPVRPS 119

Query: 267 DVKRVVDFIV 238
           DV R+ + ++
Sbjct: 120 DVSRLCNRVI 129



>pir|T50859|T50859 response regulator Cip1 [imported] -
           maize>gb:AB004882_1509203 Zea mays ZmRR1 mRNA for
           response regulator, complete cds.>gb:AB031011_1518587
           Zea mays ZmRR1 gene for response regulator 1, complete
           cds.
          Length = 157

 Score =  127 bits (318), Expect = 2e-28
 Identities = 74/127 (58%), Positives = 92/127 (72%), Gaps = 2/127 (1%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGL--KVN 454
           E HVLAVDDS VDR VI ++L+ S  +VTAV+S +RAL+ L L          GL   V+
Sbjct: 36  EKHVLAVDDSSVDRAVIARILRGSRYRVTAVESATRALELLAL----------GLLPDVS 85

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           +I+TDY MPGMTGYELLK +K S+ALR IPVVIMSSE +  RI  CLEEGA+ FL+KPV+
Sbjct: 86  MIITDYWMPGMTGYELLKCVKESAALRGIPVVIMSSENVPTRITRCLEEGAEGFLLKPVR 145

Query: 273 LSDVKRV 253
            +DV R+
Sbjct: 146 PADVSRL 152



>gb:AX048782_1458095 Sequence 53 from Patent WO0070059.
          Length = 216

 Score =  124 bits (312), Expect = 1e-27
 Identities = 63/116 (54%), Positives = 88/116 (75%), Gaps = 4/116 (3%)
 Frame = -2

Query: 570 MLKISCCKVTAVDSGSRALQYLGLDGEESSAATDG----LKVNLIMTDYSMPGMTGYELL 403
           +LK S  +VT VDSGS+AL+ LGL    S + +      + VNLI+TDY MPGMTGY+LL
Sbjct: 2   LLKTSSYQVTTVDSGSKALELLGLRDASSPSPSSPDHQEIDVNLIITDYCMPGMTGYDLL 61

Query: 402 KKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVKRVVDFIVR 235
           K++KGSS+L+ IPVVIMSSE + ARI  CL++GA+EF +KPVKL+D+K++   +++
Sbjct: 62  KRMKGSSSLKDIPVVIMSSENVPARISRCLQDGAEEFFLKPVKLADMKKLKSHLLK 117



>gb:AP003802_1833574 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1047_A06.
          Length = 206

 Score =  117 bits (293), Expect = 2e-25
 Identities = 66/123 (53%), Positives = 86/123 (69%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           +V+AVDDS VDR VI  +L+ S  +    DSG RAL+ LG +            V++I+T
Sbjct: 92  YVMAVDDSSVDRAVITALLRRSKYR----DSGKRALEILGSEPN----------VSMIIT 137

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
           DY MP MTGY+LLKKIK SS L+QIPVVIMSSE +  RI  CLEEGA++FL+KPV+ +D+
Sbjct: 138 DYWMPEMTGYDLLKKIKESSELKQIPVVIMSSENVPTRISRCLEEGAEDFLLKPVRPADI 197

Query: 261 KRV 253
            R+
Sbjct: 198 SRI 200



>gb:AB042269_1519874 Zea mays ZmRR7 mRNA for response regulator 7,
           complete cds.
          Length = 242

 Score =  110 bits (275), Expect = 2e-23
 Identities = 63/136 (46%), Positives = 89/136 (65%), Gaps = 12/136 (8%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-------ISCCKVTAVDSGSRALQYLGL---DGEESSAA 475
           + VL VDDS VDRKV+E +L+        +   VTAVDSG +A+++L L    G+  S A
Sbjct: 13  VRVLVVDDSPVDRKVVELLLRNHNHQGGAAPFHVTAVDSGKKAMEHLRLMEQGGQLDSCA 72

Query: 474 TDG--LKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGA 301
            D   + +++++TDY MP MTGY+LLK IK  S+   IPVV+MSSE    RI  CL  GA
Sbjct: 73  ADANRITIDIVLTDYCMPEMTGYDLLKAIKALSSPNPIPVVVMSSENEPQRISRCLTAGA 132

Query: 300 KEFLMKPVKLSDVKRV 253
           ++F++KP+K  DV+R+
Sbjct: 133 EDFILKPLKTKDVQRL 148



>gb:AP005808_1858218 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0038F20.
          Length = 252

 Score =  109 bits (272), Expect = 5e-23
 Identities = 61/151 (40%), Positives = 89/151 (58%), Gaps = 23/151 (15%)
 Frame = -2

Query: 636 GGRELHVLAVDDSYVDRKVIEKMLKISC-------------CKVTAVDSGSRALQYLGL- 499
           G   + VL VDDS VDR+V+E +L+  C               VTAVDSG +A++ LG  
Sbjct: 2   GAEAVRVLVVDDSPVDRRVVELLLRAHCGGGGGAAAGEAAPFHVTAVDSGKKAMELLGRR 61

Query: 498 ---------DGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSS 346
                        ++AA +   +++++TDY MP MTGY+LLK IK   +   IPVV+MSS
Sbjct: 62  RGDRDHLTPSSPAAAAAANDQAIDIVLTDYCMPEMTGYDLLKAIKALGSPNPIPVVVMSS 121

Query: 345 EKILARIDSCLEEGAKEFLMKPVKLSDVKRV 253
           E    RI  CL  GA++F++KP+K++DV+R+
Sbjct: 122 ENEPQRISRCLTAGAEDFILKPLKMNDVQRL 152



>gb:AP003962_1835754 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1705_C03.>gb:AP004397_1841171 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0436B06.
          Length = 121

 Score =  105 bits (262), Expect = 8e-22
 Identities = 58/127 (45%), Positives = 82/127 (64%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           HVL VDD++VDR V+   L     +VTAV+S  +AL +L  D E          V++I++
Sbjct: 5   HVLVVDDTHVDRHVVSMALMRHNVRVTAVESVMQALMFL--DSEHD--------VDMIVS 54

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
           DY MP MTGY LL ++K S  L  +PVVI SS+ I  RI  CL+ GAK++++KPVK+ DV
Sbjct: 55  DYCMPDMTGYNLLMEVKKSPKLAHLPVVIASSDNIPERIRKCLDGGAKDYILKPVKIVDV 114

Query: 261 KRVVDFI 241
            R++ +I
Sbjct: 115 PRIMKYI 121



>gb:AY261524_1593495 Populus alba x Populus tremula putative
           two-component system response regulator mRNA, partial
           cds.
          Length = 74

 Score =  102 bits (253), Expect = 8e-21
 Identities = 49/63 (77%), Positives = 57/63 (90%)
 Frame = -2

Query: 432 MPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVKRV 253
           MPGMTGYELLKKIK SS+ R+IPVVIMSSE ++ARID CLEEGA+EF+ KPVKLSDVKR+
Sbjct: 2   MPGMTGYELLKKIKESSSFREIPVVIMSSENVMARIDRCLEEGAEEFIAKPVKLSDVKRL 61

Query: 252 VDF 244
            D+
Sbjct: 62  RDY 64



>gb:OSJN00292_1698073 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: P0076O17, complete sequence.
          Length = 108

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 53/109 (48%), Positives = 67/109 (61%), Gaps = 4/109 (3%)
 Frame = -2

Query: 639 GGGRELHVLAVDDSYVDRKVIEKMLKISCCK----VTAVDSGSRALQYLGLDGEESSAAT 472
           GG     VL VDDS VDR+V++ +L  S C     V AVDS  +A+++LGL  E    A 
Sbjct: 3   GGRGVTRVLLVDDSPVDRRVVQLLLSSSACAGSFHVIAVDSAKKAMEFLGLKEEGKEQAI 62

Query: 471 DGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARI 325
           D     +++TDY MP MTGYELLK IK  S L+ IPV++MSSE    RI
Sbjct: 63  D-----MVLTDYCMPEMTGYELLKAIKALSPLKPIPVIVMSSENEPQRI 106



>gb:AP003962_1835759 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1705_C03.
          Length = 167

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 47/103 (45%), Positives = 70/103 (67%)
 Frame = -2

Query: 549 KVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQ 370
           +VTAV+S  +AL +L  D E          VN+I++DY MP MTGY+LL ++K S  L  
Sbjct: 75  RVTAVESVMQALMFL--DSEHD--------VNMIVSDYCMPDMTGYDLLMEVKKSPKLAH 124

Query: 369 IPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVKRVVDFI 241
           +PVVI SS+ I  RI  CL+ GAK++++KPVK+ D+ R++++I
Sbjct: 125 LPVVIASSDNIPERIRKCLDGGAKDYILKPVKIVDLPRILNYI 167



>gb:AP005523_1853415 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0488B06.
          Length = 135

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 46/103 (44%), Positives = 70/103 (67%)
 Frame = -2

Query: 549 KVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQ 370
           +VTAV+S  +AL +L  D E          VN+I++DY MP MTGY+LL ++K S  L  
Sbjct: 43  RVTAVESVMQALVFL--DSEHD--------VNMIVSDYCMPEMTGYDLLMEVKKSPRLVH 92

Query: 369 IPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVKRVVDFI 241
           +PV+I SS+ I  RI  C + GAK++++KPVK++DV R++++I
Sbjct: 93  LPVIIASSDNIPERIRKCFDGGAKDYILKPVKIADVPRILNYI 135



>gb:AB046953_1520551 Arabidopsis thaliana APRR9 mRNA for
           pseudo-response regulator 9, complete
           cds.>gb:AC005310_1532483 Arabidopsis thaliana chromosome
           2 clone F19D11 map CIC06C03, complete
           sequence.>gb:AF272040_1782202 Arabidopsis thaliana
           timing of CAB expression 1-like protein mRNA, complete
           cds.
          Length = 468

 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 40/130 (30%), Positives = 73/130 (56%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL V+  Y  R++I  +L+  C KV AV  G  A + L    +E S       ++LI+
Sbjct: 37  LRVLLVESDYSTRQIITALLRKCCYKVVAVSDGLAAWEVL----KEKSH-----NIDLIL 87

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           T+  +P ++G+ LL  +    A + IPV++MSS+  +  +  C+  GA ++L+KP++ ++
Sbjct: 88  TELDLPSISGFALLALVMEHEACKNIPVIMMSSQDSIKMVLKCMLRGAADYLIKPMRKNE 147

Query: 264 VKRVVDFIVR 235
           +K +   + R
Sbjct: 148 LKNLWQHVWR 157



>gb:AE017180_399583 Geobacter sulfurreducens PCA, complete genome.
          Length = 772

 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 41/129 (31%), Positives = 69/129 (53%), Gaps = 2/129 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R L VL VDDS V RKV+  +L+    +VT    G  AL  +G +             +L
Sbjct: 544 RPLSVLLVDDSAVSRKVVSLLLESDGHRVTFAGDGVEALAAIGREA-----------FDL 592

Query: 450 IMTDYSMPGMTGYELLKKIKGSSAL--RQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MP M G+E ++ I+   A    ++P++ +++  +    + CLE GA ++L KPV
Sbjct: 593 VLMDVQMPVMDGFEAMRAIRAGEAAGGARLPIIALTARALAGDRELCLEAGADDYLAKPV 652

Query: 276 KLSDVKRVV 250
             S+++RV+
Sbjct: 653 NFSELRRVI 661



>gb:AE016914_356151 Chromobacterium violaceum ATCC 12472 section 5 of
            16 of the complete genome.>gb:AE016825_1041305
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 1105

 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 38/115 (33%), Positives = 64/115 (55%)
 Frame = -2

Query: 624  LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
            L +L VDDS ++R+V +++ +     V   + G  AL +LGL G E         V++++
Sbjct: 777  LRLLVVDDSDINREVAQRIFEDEGASVALANDGKEALDWLGLHGGE---------VDIVL 827

Query: 444  TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
             D  MP M GYE  + I+ + AL  +PVV +++   LA+ D+  E G  +++ KP
Sbjct: 828  MDVQMPVMDGYEATRAIRATPALAHLPVVALTAGAFLAQQDAAREAGMSDYIAKP 882



 Score = 40.4 bits (93), Expect = 0.030
 Identities = 34/131 (25%), Positives = 67/131 (51%), Gaps = 5/131 (3%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLG--LDGEESSAATDGLKVN 454
           +L+VL  DD+ + R+ +         KV +V+SG  A++ +   LDG+++        V+
Sbjct: 634 DLNVLIADDNPIARETLGVTASELGWKVRSVESGRLAVEKVMAMLDGDQA--------VD 685

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMS---SEKILARIDSCLEEGAKEFLMK 283
           +++ D+ MP M G    + I+ +   +++P+++M+   S ++L    +   E   E L K
Sbjct: 686 VVVLDWKMPDMDGLAAAQAIRQACRGKRMPIILMATAYSREVLQAEPAA--ELVTEVLNK 743

Query: 282 PVKLSDVKRVV 250
           PV  S +   V
Sbjct: 744 PVTPSGLYNAV 754



>gb:AP005199_1849343 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0627E10.
          Length = 742

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 39/132 (29%), Positives = 74/132 (56%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           + + VL VD     R+V+  +L+    +V   ++G +A  YL  D + S        ++L
Sbjct: 60  KTIKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLE-DMQNS--------IDL 110

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++T+  MPG++G  LL +I   +  + IPV++MSS   +  +  CL +GA +FL+KP++ 
Sbjct: 111 VLTEVVMPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRK 170

Query: 270 SDVKRVVDFIVR 235
           +++K +   + R
Sbjct: 171 NELKNLWQHVWR 182



>gb:AB189042_1529381 Oryza sativa (indica cultivar-group) OsPRR37
           mRNA for pseudo-response regulator 37, complete cds.
          Length = 704

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 39/132 (29%), Positives = 74/132 (56%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           + + VL VD     R+V+  +L+    +V   ++G +A  YL  D + S        ++L
Sbjct: 60  KTIKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLE-DMQNS--------IDL 110

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++T+  MPG++G  LL +I   +  + IPV++MSS   +  +  CL +GA +FL+KP++ 
Sbjct: 111 VLTEVVMPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRK 170

Query: 270 SDVKRVVDFIVR 235
           +++K +   + R
Sbjct: 171 NELKNLWQHVWR 182



>gb:AB189039_1529378 Oryza sativa (japonica cultivar-group) OsPRR37
           mRNA for pseudo-response regulator 37, complete cds.
          Length = 742

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 39/132 (29%), Positives = 74/132 (56%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           + + VL VD     R+V+  +L+    +V   ++G +A  YL  D + S        ++L
Sbjct: 60  KTIKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLE-DMQNS--------IDL 110

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++T+  MPG++G  LL +I   +  + IPV++MSS   +  +  CL +GA +FL+KP++ 
Sbjct: 111 VLTEVVMPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRK 170

Query: 270 SDVKRVVDFIVR 235
           +++K +   + R
Sbjct: 171 NELKNLWQHVWR 182



>gb:AE016863_351640 Pseudomonas syringae pv. tomato str. DC3000
           section 8 of 21 of the complete
           genome.>gb:AE016853_1036815 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 641

 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 39/128 (30%), Positives = 70/128 (54%)
 Frame = -2

Query: 633 GRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           G+E  +L V+D+ V+R V++ ML    CKV            + +DG ++          
Sbjct: 510 GKERSILLVEDNPVNRTVVQAMLHNLGCKVD-----------VAVDGVDAVMKAGAGNYA 558

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           LI+ D  +P M GYE  +KI+  S L +IP++ +++  +    D+CL+ G  ++L KP K
Sbjct: 559 LILMDCRLPVMDGYEATRKIRQLSGLERIPIIALTANALHGDRDACLQAGMDDYLPKPFK 618

Query: 273 LSDVKRVV 250
            +D+++V+
Sbjct: 619 HADLQQVL 626



>gb:AC084405_1733621 Oryza sativa chromosome 3 BAC OSJNBa0044H10
           genomic sequence, complete sequence.
          Length = 789

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 39/134 (29%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLK--V 457
           + L VL V++    R+V+  +L+  C +V   ++G  A Q L           + L+  +
Sbjct: 79  KTLRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCL-----------EDLQNHI 127

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           +L++T+  MP ++G  LL KI      + IPV++MSS   +  +  CL +GA +FL+KP+
Sbjct: 128 DLVLTEVVMPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPI 187

Query: 276 KLSDVKRVVDFIVR 235
           + +++K +   + R
Sbjct: 188 RKNELKNLWQHVWR 201



>gb:AB189043_1529382 Oryza sativa (indica cultivar-group) OsPRR73
           mRNA for pseudo-response regulator 73, complete cds.
          Length = 767

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 39/134 (29%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLK--V 457
           + L VL V++    R+V+  +L+  C +V   ++G  A Q L           + L+  +
Sbjct: 79  KTLRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCL-----------EDLQNHI 127

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           +L++T+  MP ++G  LL KI      + IPV++MSS   +  +  CL +GA +FL+KP+
Sbjct: 128 DLVLTEVVMPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPI 187

Query: 276 KLSDVKRVVDFIVR 235
           + +++K +   + R
Sbjct: 188 RKNELKNLWQHVWR 201



>gb:AB189040_1529379 Oryza sativa (japonica cultivar-group) OsPRR73
           mRNA for pseudo-response regulator 73, complete cds.
          Length = 767

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 39/134 (29%), Positives = 73/134 (54%), Gaps = 2/134 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLK--V 457
           + L VL V++    R+V+  +L+  C +V   ++G  A Q L           + L+  +
Sbjct: 79  KTLRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCL-----------EDLQNHI 127

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           +L++T+  MP ++G  LL KI      + IPV++MSS   +  +  CL +GA +FL+KP+
Sbjct: 128 DLVLTEVVMPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPI 187

Query: 276 KLSDVKRVVDFIVR 235
           + +++K +   + R
Sbjct: 188 RKNELKNLWQHVWR 201



>sp|Q23917|REGA_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA
           (EC 3.1.4.17) (PDEase regA).>gb:SFAJ5398_1397491
           Dictyostelium discoideum regA gene.>gb:U60170_1405441
           Dictyostelium discoideum RegA (regA) gene, complete cds.
          Length = 793

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 39/132 (29%), Positives = 73/132 (55%), Gaps = 1/132 (0%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           ++ +L  DD  V RK++  +LK     VT V +G  A +Y+   G++        K +L+
Sbjct: 159 KVRILVADDDDVQRKILNNLLKKFHYNVTLVPNGEIAWEYIN-KGQQ--------KYDLV 209

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKI-LARIDSCLEEGAKEFLMKPVKL 271
           +TD  MP +TG++LL++I      R IPV++MS   +     +  ++ G ++FL KP+  
Sbjct: 210 LTDVMMPHITGFDLLQRINDHPVHRHIPVILMSGTAVDYKYANDTIKIGGQDFLTKPIAK 269

Query: 270 SDVKRVVDFIVR 235
             +K+ +D +++
Sbjct: 270 ELLKKKIDTVLQ 281



>gb:AB019231_1514162 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MGO3.>gb:AB046956_1520554 Arabidopsis thaliana
           APRR3 mRNA for pseudo-response regulator 3, complete
           cds.
          Length = 495

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 42/132 (31%), Positives = 71/132 (53%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R L VL V++    R ++  +LK    +VTAV     A + L  + E+S        ++L
Sbjct: 62  RSLKVLLVENDDSTRHIVTALLKNCSYEVTAVPDVLEAWRIL--EDEKSC-------IDL 112

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++T+  MP  +G  LL KI     L+ IPV++MSS   +  +  CL  GA +FL+KP++ 
Sbjct: 113 VLTEVDMPVHSGTGLLSKIMSHKTLKNIPVIMMSSHDSMVLVFKCLSNGAVDFLVKPIRK 172

Query: 270 SDVKRVVDFIVR 235
           +++K +   + R
Sbjct: 173 NELKNLWQHVWR 184



>pir|C83843|C83843 hypothetical protein BH1547 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_655493 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 661

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 41/143 (28%), Positives = 70/143 (48%)
 Frame = -2

Query: 687 RPEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQY 508
           R  ++AA      T         +L VDD  V+ KVI  +L     +V  V         
Sbjct: 309 RENELAAATLSKPTISPVAYRPRILVVDDEPVNLKVIASILANEAYEVKTV--------- 359

Query: 507 LGLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILAR 328
             + GEE+ A  D  + +L++ D  MP M+GYEL K I+    L ++P++++++      
Sbjct: 360 --ISGEEAIAVLDTKEWDLVVADVMMPKMSGYELTKNIRQRFTLTELPILLITARSRPED 417

Query: 327 IDSCLEEGAKEFLMKPVKLSDVK 259
           I++    GA ++L KPV L +++
Sbjct: 418 IENGFRAGANDYLTKPVNLLELR 440



>gb:AB185930_16747 Vibrio cholerae cheY1 gene for cheY homolog,
           complete cds.
          Length = 126

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 40/129 (31%), Positives = 67/129 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDDS      ++ ML     +V     G  A           +    GLKVNLI+TD
Sbjct: 5   ILIVDDSSTVLMSVDAMLSKLGFQVEKAKDGVEA----------ETRLKGGLKVNLIITD 54

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
            +MP M G EL+ KI+  ++ R  P++++++E+  A+ +    +GA  +L+KPV    +K
Sbjct: 55  INMPRMDGIELISKIRAIASYRFTPILVLTTEQEQAKRNEARAKGATGYLVKPVTGDQLK 114

Query: 258 RVVDFIVRG 232
            V+  ++ G
Sbjct: 115 AVIQQVLPG 123



>gb:BA000039_726806 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 871

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 38/129 (29%), Positives = 69/129 (53%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            VL VDDS   R++++++L+ +   V     G  AL +L   G++         V+L++TD
Sbjct: 742  VLIVDDSITVRRLLDRVLRQAGYNVVQCRDGKEALDFLLAAGDQ---------VSLVITD 792

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
              MP + GY+LL+ I+ S+ LR +PV +++S          L+ GA  ++ KP +   + 
Sbjct: 793  IEMPRLDGYDLLEAIRLSARLRHLPVAMLTSRGGDTHRQKALQLGANGYITKPFQPQGIL 852

Query: 258  RVVDFIVRG 232
            + V  ++ G
Sbjct: 853  QTVTQLLTG 861



>pir|A87630|A87630 sensor histidine kinase/response regulator
            [imported] - Caulobacter crescentus>gb:AE005970_214200
            Caulobacter crescentus CB15 section 296 of 359 of the
            complete genome.>gb:AE005673_924099 Caulobacter
            crescentus CB15 complete genome.
          Length = 850

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 36/124 (29%), Positives = 67/124 (54%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            VL VDD  V+R+VI   L+   C++   ++G  AL  L  +            V+L++ D
Sbjct: 720  VLVVDDHPVNRRVIRLFLEPFECELVEAENGRHALDVLQHEA-----------VDLVLMD 768

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             +MP M G E  ++++      ++PVV ++++ + A+I +CL+ G    + KP+ L ++ 
Sbjct: 769  VNMPVMDGLEATRRLRQDPRFARLPVVALTADVMSAQIKTCLDAGCDAHVAKPIDLRNLL 828

Query: 258  RVVD 247
             V+D
Sbjct: 829  SVMD 832



>gb:BA000012_670416 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 148

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 38/122 (31%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = -2

Query: 633 GRELHVLAVDDSYVDRKVIEKMLKISCCK--VTAVDSGSRALQYL-GLDGEESSAATDGL 463
           G+ + ++ ++D     ++IEK ++ +     V A  +GS AL YL G DG   ++    L
Sbjct: 5   GKPVTIVMIEDDEGHARLIEKNIRRAGVNNDVVAFTNGSSALAYLLGPDGSGDASVGRHL 64

Query: 462 KVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMK 283
              L++ D ++P MTG ++L++IK +  L++IPVV++++      I  C + GA  ++ K
Sbjct: 65  ---LVLLDLNLPDMTGLDILQQIKANQHLKRIPVVVLTTTDDSREIQRCYDLGANVYITK 121

Query: 282 PV 277
           PV
Sbjct: 122 PV 123



>gb:AY157498_593519 Synechococcus sp. PCC 7942 cosmid 4G8, complete
           sequence.
          Length = 411

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 42/131 (32%), Positives = 68/131 (51%)
 Frame = -2

Query: 672 AAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDG 493
           AAV   + T   GGR   +L  +D+ ++R V+E+ L+     V  V SG  AL  L    
Sbjct: 163 AAVSASAVT---GGR---LLVAEDNEINRDVLERRLRRLGHDVVCVASGQEALNQLAQQ- 215

Query: 492 EESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCL 313
                       +L+  D  MPG+TG+E+L+++K    L ++PV+++S+   L  +  CL
Sbjct: 216 ----------PFDLLFLDVMMPGLTGFEVLQQLKADPTLAELPVLMISALDDLESVIRCL 265

Query: 312 EEGAKEFLMKP 280
             GA ++L KP
Sbjct: 266 RLGATDYLTKP 276



>gb:AP008231_581974 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 411

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 42/131 (32%), Positives = 68/131 (51%)
 Frame = -2

Query: 672 AAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDG 493
           AAV   + T   GGR   +L  +D+ ++R V+E+ L+     V  V SG  AL  L    
Sbjct: 163 AAVSASAVT---GGR---LLVAEDNEINRDVLERRLRRLGHDVVCVASGQEALNQLAQQ- 215

Query: 492 EESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCL 313
                       +L+  D  MPG+TG+E+L+++K    L ++PV+++S+   L  +  CL
Sbjct: 216 ----------PFDLLFLDLMMPGLTGFEVLQQLKADPTLAELPVLMISALDDLESVIRCL 265

Query: 312 EEGAKEFLMKP 280
             GA ++L KP
Sbjct: 266 RLGATDYLTKP 276



>gb:AE017309_438368 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 1 of 12 of the complete
           genome.>gb:AE017285_1071529 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 268

 Score = 62.8 bits (151), Expect = 6e-09
 Identities = 36/122 (29%), Positives = 63/122 (51%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R +H L VDDS   R +I ++L++ C  V   ++G   L  L  + +          V L
Sbjct: 129 RFVHALVVDDSRTQRGIIRQLLEVQCVNVLEAENGVEGLAVLEANPQ----------VTL 178

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++TDY MP M G EL+++++    + +I +V +S+          L+ GA +FL KP ++
Sbjct: 179 VITDYQMPEMDGIELVRELRQRHRMDKIAIVGVSAVGSGPLTAQFLKHGANDFLTKPFEV 238

Query: 270 SD 265
            +
Sbjct: 239 EE 240



>pir|T02680|T02680 hypothetical protein At2g46790 [imported] -
           Arabidopsis thaliana
          Length = 454

 Score = 62.8 bits (151), Expect = 6e-09
 Identities = 39/137 (28%), Positives = 73/137 (53%), Gaps = 7/137 (5%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESS--AATDGLK--- 460
           L VL V+  Y  R++I  +L+  C K      G     ++ L    S   AA + LK   
Sbjct: 37  LRVLLVESDYSTRQIITALLRKCCYK------GRLVFPFISLFVAVSDGLAAWEVLKEKS 90

Query: 459 --VNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLM 286
             ++LI+T+  +P ++G+ LL  +    A + IPV++MSS+  +  +  C+  GA ++L+
Sbjct: 91  HNIDLILTELDLPSISGFALLALVMEHEACKNIPVIMMSSQDSIKMVLKCMLRGAADYLI 150

Query: 285 KPVKLSDVKRVVDFIVR 235
           KP++ +++K +   + R
Sbjct: 151 KPMRKNELKNLWQHVWR 167



>gb:AB046955_1520553 Arabidopsis thaliana APRR5 mRNA for
           pseudo-response regulator 5, complete cds.
          Length = 667

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 37/130 (28%), Positives = 72/130 (55%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL V+     R++I  +L+    +V AV  G +A + L   G+  S       V+LI+
Sbjct: 159 LRVLLVEADDSTRQIIAALLRKCSYRVAAVPDGLKAWEML--KGKPES-------VDLIL 209

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           T+  +P ++GY LL  I      + IPV++MS++  +  +  C+ +GA ++L+KP++ ++
Sbjct: 210 TEVDLPSISGYALLTLIMEHDICKNIPVIMMSTQDSVNTVYKCMLKGAADYLVKPLRRNE 269

Query: 264 VKRVVDFIVR 235
           ++ +   + R
Sbjct: 270 LRNLWQHVWR 279



>gb:AB025641_1516715 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:T31K7.>gb:AY062114_1564979 Arabidopsis
           thaliana pseudo-response regulator 5 protein mRNA,
           complete cds.>gb:AY143934_1583391 Arabidopsis thaliana
           At5g24470/T31K7_5 mRNA, complete cds.
          Length = 558

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 37/130 (28%), Positives = 72/130 (55%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL V+     R++I  +L+    +V AV  G +A + L   G+  S       V+LI+
Sbjct: 50  LRVLLVEADDSTRQIIAALLRKCSYRVAAVPDGLKAWEML--KGKPES-------VDLIL 100

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           T+  +P ++GY LL  I      + IPV++MS++  +  +  C+ +GA ++L+KP++ ++
Sbjct: 101 TEVDLPSISGYALLTLIMEHDICKNIPVIMMSTQDSVNTVYKCMLKGAADYLVKPLRRNE 160

Query: 264 VKRVVDFIVR 235
           ++ +   + R
Sbjct: 161 LRNLWQHVWR 170



>gb:BX842653_825482 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 8/11.
          Length = 123

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 33/127 (25%), Positives = 67/127 (52%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           + LHVL  +D+ V++ ++  ML      +T V++G RA++ L                +L
Sbjct: 2   KPLHVLVAEDNTVNQLIVRGMLVKLGHNITMVENGKRAVEEL-----------QATAFDL 50

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           I+ D  MP M G+   + I+ +   + +P++ M++ +I    D C++ G  +FL KP+ +
Sbjct: 51  ILMDCHMPEMDGFLATQTIRANPKFKTLPIIAMTASEIAEEKDRCVQVGMTDFLAKPLTM 110

Query: 270 SDVKRVV 250
           + ++ V+
Sbjct: 111 ATLEAVL 117



>gb:AE017316_440318 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 8 of 12 of the complete
           genome.>gb:AE017285_1073479 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 122

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 36/116 (31%), Positives = 63/116 (54%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           H+L VDDS   R ++  ++K    KVT  + G        LDG E   +++G  V+LI++
Sbjct: 4   HILIVDDSKTVRNLVAFIMKKEGFKVTTAEDG--------LDGLEKLYSSEG--VDLIIS 53

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           D +MP M G+  +K ++     R +P+V++S+E     I   +  GA  +++KP +
Sbjct: 54  DVNMPRMDGFTFIKTVREQDTYRNLPIVVLSTEGQEKDIQMGMSLGANLYMVKPAQ 109



>gb:CR522870_99204 Desulfotalea psychrophila LSv54 chromosome.
          Length = 910

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 34/121 (28%), Positives = 65/121 (53%)
 Frame = -2

Query: 624  LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
            L +L VDD+ ++  ++E +L  +  +VT  ++G   L+ L    EESS        +LI+
Sbjct: 788  LKILLVDDNEINLYMMEAILLAAGAEVTLAENGQECLERL----EESS-------YDLIL 836

Query: 444  TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
             D  MP + GYE  ++I+     R +P++ +++  +   I+ C E G  + + KP K+ +
Sbjct: 837  MDVQMPVLDGYETTRRIRKDEKYRALPIIAITANALSDDIEKCFEAGMNDHVAKPFKIEE 896

Query: 264  V 262
            +
Sbjct: 897  L 897



>pir|C97489|C97489 response regulator protein AGR_C_1956 (U67070)
           [imported] - Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008036_232808 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 94 of 254 of the
           complete sequence.>gb:AE007869_1082477 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 445

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 39/128 (30%), Positives = 66/128 (51%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           +   VL VDD+   R  + ++L+    KV+   SG+RAL+ L  D            + L
Sbjct: 137 KRFSVLVVDDARTARSGLVEILERQNFKVSEAHSGNRALEILSQDPS----------IQL 186

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++TDY MP M GYEL ++I+ S +   + V+ +SS        S L+ GA +F+ +P   
Sbjct: 187 VITDYHMPDMDGYELTRRIRDSRSSEDLRVIGISSSTDRLLSASFLKAGASDFVYRPFVP 246

Query: 270 SDVKRVVD 247
            +++  +D
Sbjct: 247 EELQCRID 254



>pir|AC2707|AC2707 two component response regulator Atu1060
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009069_248100 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 95 of 256 of the
           complete sequence.>gb:AE008688_1085943 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 430

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 39/128 (30%), Positives = 66/128 (51%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           +   VL VDD+   R  + ++L+    KV+   SG+RAL+ L  D            + L
Sbjct: 122 KRFSVLVVDDARTARSGLVEILERQNFKVSEAHSGNRALEILSQDPS----------IQL 171

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++TDY MP M GYEL ++I+ S +   + V+ +SS        S L+ GA +F+ +P   
Sbjct: 172 VITDYHMPDMDGYELTRRIRDSRSSEDLRVIGISSSTDRLLSASFLKAGASDFVYRPFVP 231

Query: 270 SDVKRVVD 247
            +++  +D
Sbjct: 232 EELQCRID 239



>gb:AY456019_1607104 Cochliobolus heterostrophus putative histidine
            kinase HHK16p (HHK16) gene, complete cds.
          Length = 1251

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 32/127 (25%), Positives = 68/127 (53%), Gaps = 4/127 (3%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            ++LHVL V+D+++++K++ K L  + C     D+G  AL YL    +      +G+ +++
Sbjct: 1109 QQLHVLVVEDNHLNQKILCKQLTKAGCITATADNGVHALDYL---TKTQFCTPNGIPLSM 1165

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQ----IPVVIMSSEKILARIDSCLEEGAKEFLMK 283
            ++ D  MP M G    +KI+     +Q    +P++ +++     +ID   E G  + + K
Sbjct: 1166 VLMDCEMPEMDGLTCCRKIREMEQRKQVLGHVPIIAVTANIRCGQIDEARESGMDDVIGK 1225

Query: 282  PVKLSDV 262
            P ++ ++
Sbjct: 1226 PFRIPEL 1232



>gb:AE017180_400828 Geobacter sulfurreducens PCA, complete genome.
          Length = 147

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 44/135 (32%), Positives = 68/135 (50%), Gaps = 2/135 (1%)
 Frame = -2

Query: 636 GGRELHVLAVDDSYVDRKVIEKMLKI--SCCKVTAVDSGSRALQYLGLDGEESSAATDGL 463
           G R+  +L VDD     ++IEK L        V  +D+G RAL ++  +GE     T  L
Sbjct: 3   GFRDDVILLVDDDRGHARLIEKHLARMGGMQHVIWLDNGRRALDFIFEEGEFEGVKT--L 60

Query: 462 KVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMK 283
           +  L++ D +MP + G  +L ++KG      I VVI+++    A I++C E G   FL K
Sbjct: 61  RPCLVIADLNMPELGGVHVLSRLKGDERTSSIAVVILTTSDNPAEIEACHELGCDAFLRK 120

Query: 282 PVKLSDVKRVVDFIV 238
           P+       V + IV
Sbjct: 121 PMDSDGFVLVAERIV 135



>pir|G82721|G82721 regulator of pathogenicity factors XF1114
           [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE003947_48753 Xylella fastidiosa 9a5c, section
           93 of 229 of the complete genome.>gb:AE003849_1115963
           Xylella fastidiosa 9a5c, complete genome.
          Length = 662

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 2/135 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           + L VL  DD   +R V+ ++L  +  K+  VD     L  L             ++ ++
Sbjct: 400 KSLRVLVADDHETNRMVLSRILDKAGHKLLCVDGAEAVLDCL-----------ISMEFDV 448

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM+G E+LK+++   S+ L   PV+++S++     I  C E GA+ FL KPV
Sbjct: 449 VIIDLHMPGMSGLEMLKQLRVMQSAGLPYTPVLVLSADAASDSIRCCKEAGARAFLSKPV 508

Query: 276 KLSDVKRVVDFIVRG 232
             + +  V+  I  G
Sbjct: 509 LATKLLDVLAEIAEG 523



>gb:BX571867_787359 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 9/17.
          Length = 341

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 42/124 (33%), Positives = 63/124 (50%), Gaps = 1/124 (0%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L V+D  V   ++   L+    KV    +G+ ALQ LG +            V LI+ D
Sbjct: 10  ILIVEDEPVFCSLLAGYLRTLGAKVLVASNGAVALQVLGREAH----------VELILCD 59

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK-LSDV 262
             MP M G E + K+        IPV+I+S+   +A ID  L  GAK+ L+KPV  L+++
Sbjct: 60  LDMPVMNGIEFIAKLTNEGI--SIPVIIISATNKMAEIDEVLRLGAKDVLLKPVSDLNEI 117

Query: 261 KRVV 250
           K+ V
Sbjct: 118 KKSV 121



>gb:AP006840_568033 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 135

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 3/130 (2%)
 Frame = -2

Query: 630 RELH---VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLK 460
           RE H   +L  DD     +++   LK +  +VT           L  DG E+ A      
Sbjct: 12  RESHMALILVADDDPDIARLVAFHLKYNGYEVT-----------LARDGTEALARARETA 60

Query: 459 VNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +LI+ D+ MPGM G E L  +KG  A R IPVV+M++    A + + +  GA  +L+KP
Sbjct: 61  PDLILLDWMMPGMDGLECLTALKGDPATRGIPVVLMTARAQQADVQAGIAAGAAAYLVKP 120

Query: 279 VKLSDVKRVV 250
            +L  + R V
Sbjct: 121 FELDHLIRTV 130



>pir|B97052|B97052 chemotaxis protein CheV ortholog (CheW-like
           adaptor domain and CheY-like reciever domain) [imported]
           - Clostridium acetobutylicum>gb:AE007636_228566
           Clostridium acetobutylicum ATCC 824 section 124 of 356
           of the complete genome.>gb:AE001437_1091521 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 300

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYL-GLDGEESSAATDGLKVNL 451
           + +   DDS + RK+I+  L K    K+   D G + L YL  +  E+    TD  +V L
Sbjct: 171 IKIAMADDSTLIRKLIKDTLTKAGFTKLELFDDGKQLLDYLEAISKEKGDRVTD--EVQL 228

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++TD  MP M G+ L +KIK +  LR++PV+I SS             GA   + KP ++
Sbjct: 229 VITDIEMPQMDGHALTRKIKENPLLRKLPVIIFSSLITSELKHKGESVGANAQISKP-EV 287

Query: 270 SDVKRVVDFIV 238
            ++ R++D +V
Sbjct: 288 GELVRIIDELV 298



>gb:AF362373_1265606 Dictyostelium discoideum histidine kinase DhkL
            (dhkL) gene, complete cds.
          Length = 1709

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 36/126 (28%), Positives = 69/126 (54%), Gaps = 3/126 (2%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            VL VDD++++ +++ KML+   C+V +V SG+ AL  +     +S  A        I  D
Sbjct: 1571 VLVVDDNHINIQILSKMLQTVGCEVDSVLSGADALAKINQSSGDSYDA--------IFLD 1622

Query: 438  YSMPGMTGYELLKKIKGSSALRQIP-VVIMSSEKILARID--SCLEEGAKEFLMKPVKLS 268
              MP M G+++ +KI+       +P V I+++   + + D   C + G  +F+ KP+K +
Sbjct: 1623 IQMPDMDGFQVSRKIREREKKFSLPRVAIIATTANVFKEDQLKCFDAGMDDFISKPIKRA 1682

Query: 267  DVKRVV 250
            ++K ++
Sbjct: 1683 EIKEII 1688



>gb:AF258796_1256785 Dictyostelium discoideum hybrid histidine
           kinase gene, partial cds.
          Length = 148

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 36/126 (28%), Positives = 69/126 (54%), Gaps = 3/126 (2%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           VL VDD++++ +++ KML+   C+V +V SG+ AL  +     +S  A        I  D
Sbjct: 10  VLVVDDNHINIQILSKMLQTVGCEVDSVLSGADALAKINQSSGDSYDA--------IFLD 61

Query: 438 YSMPGMTGYELLKKIKGSSALRQIP-VVIMSSEKILARID--SCLEEGAKEFLMKPVKLS 268
             MP M G+++ +KI+       +P V I+++   + + D   C + G  +F+ KP+K +
Sbjct: 62  IQMPDMDGFQVSRKIREREKKFSLPRVAIIATTANVFKEDQLKCFDAGMDDFISKPIKRA 121

Query: 267 DVKRVV 250
           ++K ++
Sbjct: 122 EIKEII 127



>gb:BX294143_768467 Pirellula sp. strain 1 complete genome; segment
           11/24.
          Length = 141

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 36/129 (27%), Positives = 71/129 (55%), Gaps = 1/129 (0%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           +L  DD+  +R+++E  L  I C   TAVD            GE++ A  +  + +LI+ 
Sbjct: 4   ILIADDNTANRELLEAYLVNIDCELETAVD------------GEDTLAKVESFQPDLILL 51

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
           D  MP ++G+E+ +K+K  SA   I ++++++   L  I+  ++ G  +FL KPV   ++
Sbjct: 52  DVMMPKLSGFEVCEKLKADSATSNIMILMVTALSELGDIERGVQAGTDDFLSKPVNRIEL 111

Query: 261 KRVVDFIVR 235
            + V+ +++
Sbjct: 112 TKRVENMLK 120



>gb:AE012554_283834 Xylella fastidiosa Temecula1, section 2 of 9 of
           the complete genome.>gb:AE009442_960410 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 663

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 39/135 (28%), Positives = 69/135 (51%), Gaps = 2/135 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           + + VL  DD   +R V+ ++L  +  K+  VD     L  L             ++ ++
Sbjct: 401 KSMRVLVADDHETNRMVLSRILDKAGHKLLCVDGAEAVLDCL-----------ISMEFDV 449

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM+G ++LK+++   SS+L   PV+++S++     I  C E GA+ FL KPV
Sbjct: 450 VIIDLHMPGMSGLDMLKQLRVMQSSSLPYTPVLVLSADATSDSIRCCEEAGARAFLSKPV 509

Query: 276 KLSDVKRVVDFIVRG 232
             + +  V+  I  G
Sbjct: 510 LATKLLDVLAEIAEG 524



>pir|H97556|H97556 response regulator protein (U67070) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008085_233349 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 143 of 254 of the
           complete sequence.>gb:AE007869_1083018 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 304

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 39/117 (33%), Positives = 65/117 (55%), Gaps = 3/117 (2%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           HVL VDDS   R ++   LK    +V+  DSG++AL+ L  + +          + L++T
Sbjct: 170 HVLIVDDSPTARALLSSRLKRYNFRVSLADSGAKALEILRANPD----------IGLVVT 219

Query: 441 DYSMPGMTGYELLKKI---KGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           DY+MP + G+EL ++I   +GS  LR I V   ++  + AR    L+ G  +F+++P
Sbjct: 220 DYNMPDIDGFELTRRIRTVRGSHELRIIGVSSSTNRLLSARF---LKAGGNDFMLRP 273



>pir|AC2777|AC2777 two component response regulator rrpX [imported]
           - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009120_248660 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 146 of 256 of the
           complete sequence.>gb:AE008688_1086503 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 249

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 39/117 (33%), Positives = 65/117 (55%), Gaps = 3/117 (2%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           HVL VDDS   R ++   LK    +V+  DSG++AL+ L  + +          + L++T
Sbjct: 115 HVLIVDDSPTARALLSSRLKRYNFRVSLADSGAKALEILRANPD----------IGLVVT 164

Query: 441 DYSMPGMTGYELLKKI---KGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           DY+MP + G+EL ++I   +GS  LR I V   ++  + AR    L+ G  +F+++P
Sbjct: 165 DYNMPDIDGFELTRRIRTVRGSHELRIIGVSSSTNRLLSARF---LKAGGNDFMLRP 218



>pir|H87338|H87338 sensor histidine kinase / response regulator
           [imported] - Caulobacter crescentus>gb:AE005747_74738
           Caulobacter crescentus CB15 section 73 of 359 of the
           complete genome.>gb:AE005673_921770 Caulobacter
           crescentus CB15 complete genome.
          Length = 591

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 39/144 (27%), Positives = 70/144 (48%), Gaps = 2/144 (1%)
 Frame = -2

Query: 660 GCSSTFG--GGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEE 487
           G + T G   G   L +L VDD  V+RKVI  ML    C++   D+G RAL  L      
Sbjct: 458 GAAETGGPLSGEHPLRLLVVDDYAVNRKVIAMMLAPLGCEIVEADNGQRALDLLA----- 512

Query: 486 SSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEE 307
                   +V+ ++ D++MP M G E  ++++     R++P+V +++  +     +    
Sbjct: 513 ------EREVDAVLLDFNMPVMGGLETTRRLRADPRWRKLPIVCLTAGVMDDERAAAATA 566

Query: 306 GAKEFLMKPVKLSDVKRVVDFIVR 235
           G   F+ KP+++S +   +  + R
Sbjct: 567 GMDGFIEKPIEMSTLVSTLARVAR 590



>pir|T52074|T52074 response regulator ARR11 [imported] - Arabidopsis
           thaliana>gb:AB041532_1519684 Arabidopsis thaliana ARR11
           mRNA for response regulator 11, complete cds.
          Length = 457

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 71/130 (54%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL VDD     K++EKMLK    +VT       AL+ L           DG   ++++
Sbjct: 11  LRVLVVDDDPTWLKILEKMLKKCSYEVTTCGLAREALRLL-------RERKDGY--DIVI 61

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D +MP M G++LL+ +        +PV++MS +   +R+   ++ GA ++L+KP+++ +
Sbjct: 62  SDVNMPDMDGFKLLEHV---GLELDLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKE 118

Query: 264 VKRVVDFIVR 235
           +K +   ++R
Sbjct: 119 LKIIWQHVLR 128



>pir|C96700|C96700 protein F12A21.15 [imported] - Arabidopsis
           thaliana>gb:AE005173_894393 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC008113_1536529 Genomic sequence for
           Arabidopsis thaliana BAC F12A21 from chromosome I,
           complete sequence.>gb:BT008768_1639964 Arabidopsis
           thaliana At1g67710 gene, complete cds.
          Length = 521

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 71/130 (54%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL VDD     K++EKMLK    +VT       AL+ L           DG   ++++
Sbjct: 11  LRVLVVDDDPTWLKILEKMLKKCSYEVTTCGLAREALRLL-------RERKDGY--DIVI 61

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D +MP M G++LL+ +        +PV++MS +   +R+   ++ GA ++L+KP+++ +
Sbjct: 62  SDVNMPDMDGFKLLEHV---GLELDLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKE 118

Query: 264 VKRVVDFIVR 235
           +K +   ++R
Sbjct: 119 LKIIWQHVLR 128



>gb:AP004087_1837524 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1297_C09.
          Length = 626

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 41/154 (26%), Positives = 77/154 (50%), Gaps = 5/154 (3%)
 Frame = -2

Query: 681 EKIAAVDGCSSTFGGGGRE-----LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRA 517
           E+   V G   + GGGGR+     + VLAVDD     K++E +L      VT     + A
Sbjct: 5   ERQGRVGGHGVSGGGGGRDQFPVGMRVLAVDDDPTCLKILENLLLRCQYHVTTTGQAATA 64

Query: 516 LQYLGLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKI 337
           L+ L  + ++          +L+++D  MP M G++LL+ +        +PV+++S+   
Sbjct: 65  LKLLRENKDQ---------FDLVISDVHMPDMDGFKLLELV---GLEMDLPVIMLSANGE 112

Query: 336 LARIDSCLEEGAKEFLMKPVKLSDVKRVVDFIVR 235
              +   +  GA ++L+KPV+L  ++ +   ++R
Sbjct: 113 TQTVMKGITHGACDYLLKPVRLEQLRTIWQHVIR 146



>gb:AB046954_1520552 Arabidopsis thaliana APRR7 mRNA for
           pseudo-response regulator 7, complete
           cds.>gb:AY039943_1560454 Arabidopsis thaliana unknown
           protein (At5g02810) mRNA, complete
           cds.>gb:AY142560_1582976 Arabidopsis thaliana unknown
           protein (At5g02810) mRNA, complete cds.
          Length = 727

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 36/124 (29%), Positives = 68/124 (54%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + VL V++    R ++  +L+    +V    +G +A + L    E+ +   D     +
Sbjct: 76  RTIRVLLVENDDCTRYIVTALLRNCSYEVVEASNGIQAWKVL----EDLNNHID-----I 126

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++T+  MP ++G  LL KI    + R IPV++MSS   +  +  CL +GA +FL+KP++ 
Sbjct: 127 VLTEVIMPYLSGIGLLCKILNHKSRRNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRK 186

Query: 270 SDVK 259
           +++K
Sbjct: 187 NELK 190



>gb:AE012287_281101 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 195 of 460 of the complete
           genome.>gb:AE008922_914383 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 726

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 34/120 (28%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + +L  DD   +R V++++L+ +  KV  V+   + L  +  +  ++           
Sbjct: 460 RSMRMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEEDYDA----------- 508

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM G ++LK+++   +S +R  PVV++S++     I +C + GA+ FL KPV
Sbjct: 509 VIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPV 568



>gb:XCA251547_210727 Xanthomonas campestris regulatory operon
           (rpfGHC genes).
          Length = 726

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 34/120 (28%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + +L  DD   +R V++++L+ +  KV  V+   + L  +  +  ++           
Sbjct: 460 RSMRMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEEDYDA----------- 508

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM G ++LK+++   +S +R  PVV++S++     I +C + GA+ FL KPV
Sbjct: 509 VIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPV 568



>pir|S16003|S16003 rpfC protein - Xanthomonas campestris
          Length = 677

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 34/120 (28%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + +L  DD   +R V++++L+ +  KV  V+   + L  +  +  ++           
Sbjct: 411 RSMRMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEEDYDA----------- 459

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM G ++LK+++   +S +R  PVV++S++     I +C + GA+ FL KPV
Sbjct: 460 VIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPV 519



>pir|H95884|H95884 probable regulatory protein [imported] -
           Sinorhizobium meliloti (strain 1021) magaplasmid
           pSymB>gb:RME591985_164992 Sinorhizobium meliloti 1021
           complete pSymB.
          Length = 520

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 36/119 (30%), Positives = 60/119 (50%)
 Frame = -2

Query: 636 GGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKV 457
           GGR   +L VDD   +R ++ + L+    +V   +SG  AL  L  D           + 
Sbjct: 178 GGR---ILVVDDVASNRDLLSRRLRREGHRVVTAESGLSALARLAED-----------EF 223

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           +LI+ D  MP M G E+L ++K     + +PV+++S    +  +  C+E GA ++L KP
Sbjct: 224 DLILLDILMPDMNGIEMLSRLKSEERWQHVPVIMISGLSDVTAVARCIEAGADDYLTKP 282



>pir|T48302|T48302 hypothetical protein F9G14.120 - Arabidopsis
           thaliana>gb:ATF9G14_1551384 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F9G14 (ESSA project).
          Length = 720

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 36/124 (29%), Positives = 68/124 (54%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + VL V++    R ++  +L+    +V    +G +A + L    E+ +   D     +
Sbjct: 76  RTIRVLLVENDDCTRYIVTALLRNCSYEVVEASNGIQAWKVL----EDLNNHID-----I 126

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++T+  MP ++G  LL KI    + R IPV++MSS   +  +  CL +GA +FL+KP++ 
Sbjct: 127 VLTEVIMPYLSGIGLLCKILNHKSRRNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRK 186

Query: 270 SDVK 259
           +++K
Sbjct: 187 NELK 190



>sp|P49246|RPFC_XANCP Sensory/regulatory protein rpfC (EC 2.7.3.-).
          Length = 677

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 34/120 (28%), Positives = 65/120 (54%), Gaps = 2/120 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + +L  DD   +R V++++L+ +  KV  V+   + L  +  +  ++           
Sbjct: 411 RSMRMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEEDYDA----------- 459

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM G ++LK+++   +S +R  PVV++S++     I +C + GA+ FL KPV
Sbjct: 460 VIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPV 519



>gb:AC132483_1741113 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0014C03, complete
           sequence.>gb:AC134932_1741961 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0092G21,
           complete sequence.
          Length = 620

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 39/146 (26%), Positives = 72/146 (49%)
 Frame = -2

Query: 672 AAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDG 493
           A   GC    GG    LHVL VDD     + ++ ML ++   VT   +   AL+ +  + 
Sbjct: 7   AVPPGCKLPAGGFFGRLHVLVVDDDAAYLEELKLMLLLAGYAVTGKTTAEEALKEVDQNP 66

Query: 492 EESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCL 313
           E+          +++MTD  M GM G++LL +I G     ++PV++ S  + +  +   +
Sbjct: 67  ED--------YFHIVMTDVHMSGMDGFDLLHRING-----RVPVIMFSEGEDVVMVMRTV 113

Query: 312 EEGAKEFLMKPVKLSDVKRVVDFIVR 235
             GA ++++KP+    +K +   ++R
Sbjct: 114 MNGACDYMVKPMTSEAIKFIWKHVLR 139



>gb:BX572606_803800 Rhodopseudomonas palustris CGA009 complete
           genome; segment 14/16.
          Length = 495

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 33/114 (28%), Positives = 61/114 (53%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L  DD  V R+++E M++    +  +VDSG  A+        E+  A D   ++ ++ D
Sbjct: 5   ILIADDDAVQRRLVENMVQKCGYEAVSVDSGDAAV--------EALTAPDAPAIDAVVLD 56

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
             MPG+ G  +L KI+ S     +PV++ ++   +  + S +  GA +F++KPV
Sbjct: 57  LVMPGLDGLGVLSKIRASGL--DVPVIVQTAHGGIDNVVSAMRAGAHDFVVKPV 108



>gb:AE017320_441470 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 12 of 12 of the complete
           genome.>gb:AE017285_1074631 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 126

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 33/129 (25%), Positives = 67/129 (51%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +    V   D G+ A + L  D           +V+ +
Sbjct: 7   MRILVVDDFSTMRRIIKNILRQLGFSNVIEADDGTTAWETLNKD-----------RVDFV 55

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           ++D++MP MTG ELL+K++ S     +P +++++E     I   ++     +++KP    
Sbjct: 56  ISDWNMPNMTGIELLRKVRASEEFGDMPFLMVTAEAQQENIIEAVQAKVSNYIVKPFTAE 115

Query: 267 DVKRVVDFI 241
            +K+ +D I
Sbjct: 116 TMKQKIDKI 124



>gb:AE013073_288767 Thermoanaerobacter tengcongensis MB4, section
           100 of 244 of the complete genome.>gb:AE008691_1110832
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 267

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 1/127 (0%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDDS + R +++ +L      V A  +   A++ +    E           +LI+ D
Sbjct: 10  ILVVDDSVLIRLMVKDILGGEGYNVVAAATSEEAVRKIKSRKE---------LFDLIIVD 60

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD-V 262
            ++P   G+E ++ +K     R IPV+I+S +  +  I   +E GA ++L+KP K  + V
Sbjct: 61  INLPDQNGFEFIRNLKSEEKYRHIPVIILSIDATVPSIKRAVEAGAVDYLVKPFKAEELV 120

Query: 261 KRVVDFI 241
           KRVV  +
Sbjct: 121 KRVVKLV 127



>gb:AF534891_1809606 Catharanthus roseus type-B response regulator
           (RR5) mRNA, complete cds.
          Length = 643

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 42/143 (29%), Positives = 73/143 (51%)
 Frame = -2

Query: 663 DGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEES 484
           DG S  F  G   L VL VDD     +++EKMLK    +VT  +    AL+ L  D    
Sbjct: 26  DGVSDQFPAG---LRVLVVDDDPTCLRILEKMLKNCLYEVTKCNRAEIALKLLR-DNRNG 81

Query: 483 SAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEG 304
                    +++++D  MP M G++LL+++        +PV++MS++     +   +  G
Sbjct: 82  --------YDIVISDVHMPDMDGFKLLEQV---GLEMDLPVIMMSADDSKNVVMKGVTHG 130

Query: 303 AKEFLMKPVKLSDVKRVVDFIVR 235
           A ++L+KPV++  +K +   +VR
Sbjct: 131 ACDYLIKPVRIEALKNIWQHVVR 153



>gb:AY456046_1607131 Gibberella moniliformis putative histidine
           kinase TCS1p (TCS1) gene, complete cds.
          Length = 685

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 37/115 (32%), Positives = 67/115 (58%), Gaps = 1/115 (0%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           +LA +D+ +++KV+  ML      ++T V  G++A+  L       SAA D    +LI+ 
Sbjct: 559 ILAAEDNIINQKVLVGMLHGFGFKEITVVSDGAQAVSSL-------SAAADTF--DLILM 609

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           D SMP M GYE   +I+ SS   ++P++ M++  +   ++ CLE+G  +++ KP+
Sbjct: 610 DISMPVMNGYEATLRIRRSSI--RLPIIAMTAYALKGDMERCLEKGMDDYIPKPM 662



>gb:AY714873_1190649 Uncultured archaeon GZfos9E5 clone GZfos9E5,
           *** SEQUENCING IN PROGRESS ***.
          Length = 148

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 2/129 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKIS--CCKVTAVDSGSRALQYLGLDGEESSAATDGLKV 457
           R   VL V+D   D+K+I+  +K      ++  VDSG   + +L   G  S+        
Sbjct: 5   RPATVLLVEDDPGDQKLIKVSMKNQRIANELYIVDSGEEGMDFLYHRGNYSAETPFP--- 61

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           +LI+ D  MPGM G E L++IK    +++I VVI++S      I       A  ++ KPV
Sbjct: 62  DLILLDLKMPGMGGKEFLRRIKQDEKMKKIQVVILTSSDSEKDILDSYNLQASGYIKKPV 121

Query: 276 KLSDVKRVV 250
           +L D KRV+
Sbjct: 122 ELEDFKRVM 130



>gb:AE016860_350715 Pseudomonas syringae pv. tomato str. DC3000
           section 5 of 21 of the complete
           genome.>gb:AE016853_1035890 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 705

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 37/119 (31%), Positives = 60/119 (50%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDD    R ++E +L+    +    +SG +AL           A  D    +LI+ D
Sbjct: 8   ILIVDDDVHVRDLLEVLLQNQGYETLTAESGEQAL-----------AMVDARAPDLILLD 56

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
             MPGM GYE+   +K       IP++++S+        S LE GA+E+L KPV+ +++
Sbjct: 57  IMMPGMDGYEVASVLKAGKGTANIPIIMLSALDEQGARLSGLEAGAEEYLSKPVESAEL 115



>gb:AE015758_317547 Shewanella oneidensis MR-1 section 307 of 457 of
           the complete genome.>gb:AE014299_953144 Shewanella
           oneidensis MR-1 complete genome.
          Length = 127

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 35/131 (26%), Positives = 68/131 (51%), Gaps = 1/131 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           + + +L VDD    R++I+ +L+ +        D GS AL  L                +
Sbjct: 3   KNMKILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGD-----------FD 51

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
            ++TD++MPGM G +LLK I+   +L+ +PV+++++E    +I +  + G   +++KP  
Sbjct: 52  FVVTDWNMPGMQGIDLLKAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFT 111

Query: 273 LSDVKRVVDFI 241
            + +K  +D I
Sbjct: 112 AATLKEKLDKI 122



>pir|AE1886|AE1886 two-component hybrid sensor and regulator all0638
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_681630 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 820

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 39/129 (30%), Positives = 71/129 (55%), Gaps = 2/129 (1%)
 Frame = -2

Query: 642 GGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGL 463
           G  G + H+L VDD + +R V+  +L+     +T  ++G       GLD  +        
Sbjct: 610 GYEGVKRHILVVDDRWENRAVLLNLLEPLGFIITEAENGQA-----GLDQLQQHLP---- 660

Query: 462 KVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDS--CLEEGAKEFL 289
             +L++TD  MP M G+E+L+KI+    LR + +++ S+   +A+ID    ++ G  +FL
Sbjct: 661 --DLVITDLVMPVMDGFEMLRKIREQEQLRSLKILVSSAS--VAQIDQQMSIDAGGDDFL 716

Query: 288 MKPVKLSDV 262
            KPV+++D+
Sbjct: 717 AKPVQVNDL 725



>pir|E83443|E83443 probable sensor/response regulator hybrid PA1611
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004589_55847 Pseudomonas aeruginosa PAO1,
           section 150 of 529 of the complete
           genome.>gb:AE004091_969947 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 651

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 30/123 (24%), Positives = 69/123 (56%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L V+D+ V++ VIE ML+    +VT V  G +A++           + +  + + I+ D
Sbjct: 517 ILLVEDNPVNQTVIEAMLRSLGYRVTLVADGIQAVR-----------SAERQRYDAILMD 565

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             +P + GY   ++I+     R++P++ +++  +    ++CL+ G  ++L KP K ++++
Sbjct: 566 CRLPVLDGYSATREIRAQENGRRVPIIALTANALQGDRENCLQAGMNDYLAKPFKRAELQ 625

Query: 258 RVV 250
           R++
Sbjct: 626 RIL 628



>pir|T52034|T52034 receiver-like protein 3 [imported] - Arabidopsis
           thaliana>gb:ATAJ5194_1543912 Arabidopsis thaliana mRNA
           for receiver-like protein 3.
          Length = 444

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 38/130 (29%), Positives = 70/130 (53%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL VDD     K++EKMLK    +VT       AL+ L           DG   ++++
Sbjct: 11  LRVLVVDDDPTWLKILEKMLKKCSYEVTTCGLAREALRLL-------RERKDGY--DIVI 61

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D +MP M G++LL+ +        +PV++MS +   +R+   +  GA ++L+KP+++ +
Sbjct: 62  SDVNMPDMDGFKLLEHV---GLELDLPVIMMSVDGETSRVMKGVHTGACDYLLKPIRMKE 118

Query: 264 VKRVVDFIVR 235
           +K +   ++R
Sbjct: 119 LKIIWQHVLR 128



>gb:AF199025_487725 Sinorhizobium medicae two component sensor
           protein A (tcsA) gene, partial cds; and two component
           regulator protein A (tcrA), fused sensor regulator
           protein R (fsrR), low pH inducible protein A (lpiA),
           acid virulence protein B (acvB), and two component
           regulator protein B (tcrB) genes, complete cds.
          Length = 145

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 33/121 (27%), Positives = 66/121 (54%), Gaps = 2/121 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCK--VTAVDSGSRALQYLGLDGEESSAATDGLKV 457
           R + ++ ++D     ++IEK ++ +  +  + A   G+ A+ YL   GE  +  +   + 
Sbjct: 3   RHVTIVMIEDDKGHARLIEKNIRRAGVRNDIVAFRDGTSAIAYLF--GEPGAGGSHAGRA 60

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
            LI+ D ++P MTG ++LK+IK    L++ PVV++++      I  C + G   ++ KPV
Sbjct: 61  LLILLDLNLPDMTGIDILKRIKADEHLKRSPVVVLTTTDDQDEIKRCYDLGCNVYITKPV 120

Query: 276 K 274
           +
Sbjct: 121 E 121



>gb:AE016862_351410 Pseudomonas syringae pv. tomato str. DC3000
           section 7 of 21 of the complete
           genome.>gb:AE016853_1036585 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 124

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 35/129 (27%), Positives = 68/129 (52%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +     +  D G  AL  L       S A D      +
Sbjct: 1   MKILIVDDFSTMRRIIKNLLRDLGFTNTSEADDGLTALPML------QSGAFD-----FL 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGMTG +LL++++    L+ +PV+++++E    +I    + G   +++KP    
Sbjct: 50  VTDWNMPGMTGIDLLRQVRADDRLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQ 109

Query: 267 DVKRVVDFI 241
            +K  ++ I
Sbjct: 110 ALKEKIEKI 118



>pir|T48492|T48492 hypothetical protein T28J14.150 - Arabidopsis
           thaliana>gb:ATT28J14_1555602 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 621

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 41/136 (30%), Positives = 72/136 (52%), Gaps = 8/136 (5%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCK--------VTAVDSGSRALQYLGLDGEESSAAT 472
           +++V+ VDD +V   ++ +ML+ S  +        V AVD   +AL  L +  +      
Sbjct: 15  KINVMVVDDDHVFLDIMSRMLQHSKYRDPSVMEIAVIAVDDPKKALSTLKIQRDN----- 69

Query: 471 DGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEF 292
               ++LI+TDY MPGM G +L K+I  +     +PV++MSS+    + +  L  GA  F
Sbjct: 70  ----IDLIITDYYMPGMNGLQLKKQI--TQEFGNLPVLVMSSD--TNKEEESLSCGAMGF 121

Query: 291 LMKPVKLSDVKRVVDF 244
           + KP+  +D+ ++  F
Sbjct: 122 IPKPIHPTDLTKIYQF 137



>gb:AP006838_1862972 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, fosmid clone:OSJNOa013M08.
          Length = 586

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 38/130 (29%), Positives = 70/130 (53%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL VDD     K++EKML+    +VT       AL  L    E  +      K ++++
Sbjct: 10  LRVLVVDDDPTWLKILEKMLRKCSYEVTTCGLARVALDILR---ERKN------KFDIVI 60

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D +MP M G++LL+ I        +PV++MS +   +R+   ++ GA ++L+KPV++ +
Sbjct: 61  SDVNMPDMDGFKLLEHI---GLEMDLPVIMMSIDGETSRVMKGVQHGACDYLLKPVRMKE 117

Query: 264 VKRVVDFIVR 235
           ++ +   + R
Sbjct: 118 LRNIWQHVYR 127



>gb:AB189041_1529380 Oryza sativa (japonica cultivar-group) OsPRR95
           mRNA for pseudo-response regulator 95, complete
           cds.>gb:AP005314_1850446 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0515E01.>gb:AP005567_1854168 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1254_E07.
          Length = 623

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 58/98 (59%), Gaps = 11/98 (11%)
 Frame = -2

Query: 495 GEESSAATDGLK-----------VNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMS 349
           G   +AA+DG+K           ++L++T+  +P M+G+ LL  I    A + IPV++MS
Sbjct: 66  GYRVAAASDGVKAWDILKEKSFNIDLVLTEVELPLMSGFLLLSTIMEHDACKNIPVIMMS 125

Query: 348 SEKILARIDSCLEEGAKEFLMKPVKLSDVKRVVDFIVR 235
           S   ++ +  C+ +GA +FL+KP++ ++++ +   + R
Sbjct: 126 SNDSVSMVFKCMLKGAADFLVKPIRKNELRNLWQHVWR 163



>gb:BX572607_804030 Rhodopseudomonas palustris CGA009 complete
           genome; segment 15/16.
          Length = 873

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 37/135 (27%), Positives = 67/135 (49%), Gaps = 1/135 (0%)
 Frame = -2

Query: 633 GRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           GR L VL  +D   ++ V+ KML+    ++T V  G+ A+Q  G +GE           +
Sbjct: 625 GRPLRVLIAEDDSTNQMVVMKMLQEFAAEITVVSDGTDAVQAAG-EGE----------FD 673

Query: 453 LIMTDYSMPGMTGYELLKKIKGSS-ALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           +++ D  MP M G    + I+G   AL ++P++ +++      +  C + G  +FL KP+
Sbjct: 674 VVLMDVRMPNMDGLAATRAIRGKGGALAKLPIIALTANAFPDDVKVCRDAGMNDFLAKPL 733

Query: 276 KLSDVKRVVDFIVRG 232
           +   +   V   +RG
Sbjct: 734 RKPALVAAVLRALRG 748



>gb:AE016918_357473 Chromobacterium violaceum ATCC 12472 section 9
           of 16 of the complete genome.>gb:AE016825_1042627
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 122

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 27/73 (36%), Positives = 50/73 (68%)
 Frame = -2

Query: 498 DGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDS 319
           DG ++ +  +G++VNL+++D +MPGM G  LLK++K  +A R +PV+++++E    +   
Sbjct: 34  DGNDALSKLNGVRVNLVISDVNMPGMDGITLLKRLKEGAATRFLPVIMLTTEGSDDKKMQ 93

Query: 318 CLEEGAKEFLMKP 280
             E GAK +++KP
Sbjct: 94  GKEAGAKAWIVKP 106



>gb:AE013598_296571 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 725

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 33/120 (27%), Positives = 66/120 (55%), Gaps = 2/120 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + +L  DD   +R V++++L+ +  +V  V+   + L  +  +  ++           
Sbjct: 459 RSMRMLVADDHEANRMVLQRLLEKAGHRVMCVNGAEQVLDAMADEDFDA----------- 507

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM+G ++LK+++   +S +R  PVV++S++     I +C + GA+ FL KPV
Sbjct: 508 VIVDLHMPGMSGLDMLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPV 567



>gb:XORPFCGEN_210943 X.oryzae rpfC gene.
          Length = 676

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 33/120 (27%), Positives = 66/120 (55%), Gaps = 2/120 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + +L  DD   +R V++++L+ +  +V  V+   + L  +  +  ++           
Sbjct: 410 RSMRMLVADDHEANRMVLQRLLEKAGHRVMCVNGAEQVLDAMADEDFDA----------- 458

Query: 450 IMTDYSMPGMTGYELLKKIK--GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++ D  MPGM+G ++LK+++   +S +R  PVV++S++     I +C + GA+ FL KPV
Sbjct: 459 VIVDLHMPGMSGLDMLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPV 518



>gb:SME591789_186017 Sinorhizobium meliloti 1021 complete
           chromosome; segment 8/12.
          Length = 277

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 34/114 (29%), Positives = 62/114 (54%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           HVL VDDS   R V+   LK    + ++ ++GS AL+ L  + +          + L++T
Sbjct: 143 HVLIVDDSATARAVLTTQLKRYNFRTSSAENGSAALEILKNNPD----------IALVIT 192

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           DY+MP + G+EL ++I+ +    Q+ ++ +SS K        L+ G  +F+++P
Sbjct: 193 DYNMPDIDGFELTRRIRAAHGPHQLRIIGVSSSKDRLLSARFLKAGGNDFVVRP 246



>gb:HPCHEY_137552 H.pylori cheY gene homologue, partial.
          Length = 140

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 32/131 (24%), Positives = 71/131 (54%), Gaps = 1/131 (0%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           +L +L VDDS   R++I+  L ++    V   + G  A + L  + +            +
Sbjct: 16  KLKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANAD----------TKV 65

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++TD++MP M G +L+KK++  S  ++IP++++++E   A + + L+ G   +++KP   
Sbjct: 66  LITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTP 125

Query: 270 SDVKRVVDFIV 238
             +K  ++ ++
Sbjct: 126 QVLKEKLEVVL 136



>pir|C84645|C84645 hypothetical protein At2g25180 [imported] -
           Arabidopsis thaliana
          Length = 573

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 35/130 (26%), Positives = 68/130 (52%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + VLAVDD     K++E +L+     VT  +   +AL+ L  +           K +L++
Sbjct: 17  MRVLAVDDDQTCLKILESLLRHCQYHVTTTNQAQKALELLRENKN---------KFDLVI 67

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D  MP M G++LL+ +        +PV+++S+      +   +  GA ++L+KPV++ +
Sbjct: 68  SDVDMPDMDGFKLLELV---GLEMDLPVIMLSAHSDPKYVMKGVTHGACDYLLKPVRIEE 124

Query: 264 VKRVVDFIVR 235
           +K +   +VR
Sbjct: 125 LKNIWQHVVR 134



>gb:AY456060_1607140 Botryotinia fuckeliana putative histidine kinase
            M3C8p (M3C8) gene, complete cds.
          Length = 1020

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 34/129 (26%), Positives = 64/129 (49%), Gaps = 4/129 (3%)
 Frame = -2

Query: 636  GGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKV 457
            G + +HVL V+D+ V++K++EK LK + C V   + G  AL+ L           D  K+
Sbjct: 874  GSKSMHVLLVEDNLVNQKILEKQLKKAGCIVYVANHGLEALETLRQCSCWHEPVKDAKKL 933

Query: 456  NLIMTDYSMPGMTGYELLKKIK----GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFL 289
            ++I+ D+ MP M G    ++I+        LR + ++ +++     ++   L  G    +
Sbjct: 934  DIILMDWEMPVMDGLTCSREIRALQQSGKILRHLEIIAITANAREEQVQLALHNGINFVM 993

Query: 288  MKPVKLSDV 262
             KP  +S +
Sbjct: 994  SKPFIVSSL 1002



>gb:AY456058_1607138 Botryotinia fuckeliana putative histidine kinase
            M2QJp (M2QJ) gene, complete cds.
          Length = 1148

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 41/148 (27%), Positives = 76/148 (51%), Gaps = 14/148 (9%)
 Frame = -2

Query: 639  GGGRE---LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYL-------GLDGE 490
            GG RE   L VL V+D+ +++KV+ K L+    ++   + G  AL++L       G  GE
Sbjct: 925  GGEREEVALEVLVVEDNLLNQKVLVKSLRKEGYRINVANHGGEALEFLKKTTFWVGESGE 984

Query: 489  ESSAATDGLKVNLIMTDYSMP---GMTGYELLKKIKGSSALR-QIPVVIMSSEKILARID 322
            E +       +NLI+ D  MP   G+T    ++K +    +R  +P++ +++     +I 
Sbjct: 985  EENTKQP---LNLILMDLEMPIMDGITCVRQIRKWEAQGVIRGHVPIIAVTANARKDQIM 1041

Query: 321  SCLEEGAKEFLMKPVKLSDVKRVVDFIV 238
            S +E G  +   KP ++ D+ R ++ +V
Sbjct: 1042 STIEAGMDDVTTKPYRIHDMLRQIETLV 1069



>gb:AY714821_1188596 Uncultured archaeon GZfos17A3 clone GZfos17A3,
           *** SEQUENCING IN PROGRESS ***.
          Length = 148

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 2/129 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKIS--CCKVTAVDSGSRALQYLGLDGEESSAATDGLKV 457
           R   VL V+D   D+K+I+  +K      ++  V SG  A+ +L   G  S+        
Sbjct: 5   RPATVLLVEDDPGDQKLIKVSMKNQRIANELYIVGSGEEAMDFLYHRGNYSAETPFP--- 61

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           +LI+ D  MPGM G E L++IK    +++I VVI++S      I       A  ++ KPV
Sbjct: 62  DLILLDLKMPGMGGKEFLRRIKQDEKMKKIQVVILTSSDSEKDILDSYNLQASGYIKKPV 121

Query: 276 KLSDVKRVV 250
           +L D KRV+
Sbjct: 122 ELEDFKRVM 130



>gb:BX294133_765090 Pirellula sp. strain 1 complete genome; segment
           1/24.
          Length = 993

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 35/123 (28%), Positives = 62/123 (50%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           VL VDD   +R++IE +LK +   V + ++G  AL  +  +G ES     G    L++ D
Sbjct: 584 VLVVDDGEANRRLIELVLKRAGATVMSAENGQEALDMIA-EGNES-----GYPYELVLMD 637

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MP + GY   + ++        PV+ ++   +    + C++ G  +FL KPV L ++ 
Sbjct: 638 MQMPVLDGYSATRLLREREDTT--PVIALTGNAMRGDREKCMDAGCDDFLTKPVNLDELL 695

Query: 258 RVV 250
            +V
Sbjct: 696 EMV 698



>gb:BA000040_730548 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 527

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 33/113 (29%), Positives = 61/113 (53%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDD   +R ++ + L     +V++V  G +ALQ L  D           + +L++ D
Sbjct: 185 ILVVDDIEANRDLLSRRLTRDGHRVSSVAGGQQALQALAND-----------EFDLVLLD 233

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
             MP + G ++L ++K    LR+IPV+++++         C+E GA+++L KP
Sbjct: 234 LMMPDINGLDVLVRMKADERLRRIPVIMITALAETESAVRCIEAGAEDYLPKP 286



>gb:AY596297_631910 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 148

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 2/133 (1%)
 Frame = -2

Query: 633 GRELHVLAVDDSYVDRKVIEKMLKISCC--KVTAVDSGSRALQYLGLDGEESSAATDGLK 460
           GR + +L  +D+  D K+ EK L+       +  V+ G  AL +L  +GE   A     +
Sbjct: 7   GRPVEILLAEDNPGDVKLTEKALEKGKVLNNLHVVNDGVEALSFLRQEGEYDDAP----R 62

Query: 459 VNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +L++ D +MP   G E+L+++K   +LR+IPVV+++S +    I    +  A  +L KP
Sbjct: 63  PDLLLLDLNMPRKGGQEVLEEMKDDESLRRIPVVVLTSSEAEEDIIESYDLHANAYLTKP 122

Query: 279 VKLSDVKRVVDFI 241
           V       +V  +
Sbjct: 123 VDFDGFVDIVSSV 135



>gb:AE016790_333733 Pseudomonas putida KT2440 section 17 of 21 of
           the complete genome.>gb:AE015451_948810 Pseudomonas
           putida KT2440 complete genome.
          Length = 124

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 33/129 (25%), Positives = 68/129 (52%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +        D G+ AL  L           +    + +
Sbjct: 1   MKILIVDDFSTMRRIIKNLLRDLGFTNTDEADDGTTALPML-----------ENGHYDFL 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGM+G +LL+K++ S  L+ +PV+++++E    +I    + G   +++KP    
Sbjct: 50  VTDWNMPGMSGIDLLRKVRASDKLKSMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQ 109

Query: 267 DVKRVVDFI 241
            +K  ++ I
Sbjct: 110 VLKEKIEKI 118



>gb:AY740079_1626172 Ostreococcus tauri APRR-like protein gene,
           complete cds.
          Length = 580

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 5/132 (3%)
 Frame = -2

Query: 639 GGGRE---LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATD 469
           GG R+   L VL   D    R ++ KML+    +V    +G   L+ L    +  +AA +
Sbjct: 48  GGERDADALRVLLATDDAHTRGMVHKMLRELGVEVVMATNGKEVLEVLRGRPKGVAAAAE 107

Query: 468 GLKVNLIMTDYSMPGMTG-YELLKKIKGSSALRQIPVVIMSSEKILARIDSCLE-EGAKE 295
            + V++I+ D  MP + G  EL++  K + ALR +P+VIMS+        +  E  GA  
Sbjct: 108 DVSVDMILLDVLMPALDGEVELVEVCKSNEALRGVPIVIMSTVDERKACGTRYEHSGAAG 167

Query: 294 FLMKPVKLSDVK 259
           FL KPV  +++K
Sbjct: 168 FLTKPVNRTELK 179



>gb:AY456034_1607119 Gibberella moniliformis putative histidine kinase
            HHK1p (HHK1) gene, complete cds.
          Length = 2362

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 36/130 (27%), Positives = 70/130 (53%), Gaps = 3/130 (2%)
 Frame = -2

Query: 627  ELHVLAVDDSYVDRKV-IEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            E+ +   +D+ +++K+ I+ + ++    V A D+G +A++ L         A +G   ++
Sbjct: 2218 EIRICVAEDNPINQKIAIQYVQRLGYKGVVAYDNGLKAVEGL------RQKAKEGKPYHV 2271

Query: 450  IMTDYSMPGMTGYELLKKIKGSS--ALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
            ++ D  MP + GYE  K I+  S  A+R I V+ M++  I    + CL  G  ++L KPV
Sbjct: 2272 VLMDVQMPVLDGYEATKLIRKDSLDAVRTILVIAMTASAIQGDREKCLAAGMNDYLAKPV 2331

Query: 276  KLSDVKRVVD 247
            +   +K+ +D
Sbjct: 2332 RSEILKKKLD 2341



>gb:AY272055_1594234 Chlamydomonas reinhardtii chlamyopsin-5 gene,
            complete cds.
          Length = 1425

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 38/124 (30%), Positives = 66/124 (53%)
 Frame = -2

Query: 651  STFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAAT 472
            S+F   G ++ VL+VDD  V++ VI+ +L     ++     G  AL+ L     E     
Sbjct: 695  SSFRERGAKVRVLSVDDDPVNQLVIQNLLAPVGYEILQAMDGQEALKVL----TEEERLP 750

Query: 471  DGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEF 292
            D     +I+ D  MPGM+GYE+ +K++    L  IPV+++S++     I   L  G+ ++
Sbjct: 751  D-----VILLDVMMPGMSGYEVCRKLREMYPLSCIPVIMISAKSKEEHIVEGLAAGSNDY 805

Query: 291  LMKP 280
            ++KP
Sbjct: 806  VVKP 809



>gb:CP000020_872009 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 122

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 34/129 (26%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++++ +L+ +        D G  AL  L   G            + +
Sbjct: 1   MKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPLLKKGG-----------FDFV 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGM G +LLK I+    L+ +PV+++++E    +I    + G   +++KP   +
Sbjct: 50  VTDWNMPGMQGIDLLKTIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAA 109

Query: 267 DVKRVVDFI 241
            +K  +D I
Sbjct: 110 TLKEKLDKI 118



>gb:CP000001_851523 Bacillus cereus ZK, complete genome.
          Length = 896

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/127 (24%), Positives = 63/127 (49%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            +E  +L VDD + +   ++  LK     +    +G   L+ L           +   ++L
Sbjct: 774  QEKTILIVDDDHRNIFALQNALKKQHANIITAQNGLECLEIL----------KNNTNIDL 823

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
            I+ D  MP M GYE ++ I+ +  L +IP++ ++++ +    + CL  GA +++ KP+ L
Sbjct: 824  ILMDIMMPNMDGYETMEHIRMNLGLHEIPIIALTAKAMPNDKEKCLSAGASDYISKPLNL 883

Query: 270  SDVKRVV 250
              +  V+
Sbjct: 884  HQLYSVM 890



>gb:AF031898_471065 Pseudomonas putida chemotaxis and motility gene
           region, flagellar structural protein FlhA (flhA) gene,
           partial cds; and flagellar structural protein FlhF
           (flhF), motility sigma factor FliA (fliA), response
           regulator CheY (cheY), dephosphorylase CheZ (cheZ),
           sensor histidine kinase CheA (cheA), methylesterase CheB
           (cheB), flagellar motor MotA (motA), flagellar motor
           MotB (motB), and CheA/MCP coupling protein CheW (cheW)
           genes, complete cds.>gb:AF183382_486363 Pseudomonas
           putida flagellar protein FlhA (flhA) gene, partial cds;
           flagellar protein FlhF (flhF), MinD homolog, motility
           sigma factor FliA (fliA), response regulator CheY
           (cheY), dephosphorylase CheZ (cheZ), sensor histidine
           kinase CheA (cheA), and methylesterase CheB (cheB)
           genes, complete cds; and flagellar motor protein MotA
           (motA) gene, partial cds.
          Length = 124

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 33/129 (25%), Positives = 68/129 (52%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +        D G+ AL  L           +    + +
Sbjct: 1   MKILIVDDFSTMRRIIKNLLRDLGFTNTEEADDGTTALPML-----------ENGHYDFL 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGM+G +LL+K++ S  L+ +PV+++++E    +I    + G   +++KP    
Sbjct: 50  VTDWNMPGMSGIDLLRKVRASEKLKTMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQ 109

Query: 267 DVKRVVDFI 241
            +K  ++ I
Sbjct: 110 VLKEKIEKI 118



>gb:AE017001_375951 Bacillus cereus ATCC 14579 section 4 of 18 of the
            complete genome.>gb:AE016877_1016201 Bacillus cereus ATCC
            14579 complete genome.
          Length = 896

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/127 (24%), Positives = 62/127 (48%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            +E  +L VDD + +   ++  LK     +    +G   L+ L               ++L
Sbjct: 774  QEKTILIVDDDHRNIFALQNALKKQNANIITAQNGIECLEIL----------KSNTNIDL 823

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
            I+ D  MP M GYE ++ I+ +  L +IP++ ++++ +    + CL  GA +++ KP+ L
Sbjct: 824  ILMDIMMPNMDGYETMENIRMNLGLHEIPIIALTAKAMPNDKEKCLSAGASDYISKPLNL 883

Query: 270  SDVKRVV 250
              +  V+
Sbjct: 884  HQLYSVM 890



>gb:AE014196_305465 Streptococcus agalactiae 2603V/R section 6 of
           100 of the complete genome.>gb:AE009948_935578
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 223

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 36/130 (27%), Positives = 70/130 (53%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + +L V+D+ V +K+I   L     +     +G  AL  L  D EE         V LI+
Sbjct: 2   IKILVVEDNIVQQKIITTKLTQEGYQFITASNGQEALNCL--DTEE---------VQLII 50

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           TD  MP M GY+L+++++  SA   +P+++M+++  +  +      GA ++++KPV+L +
Sbjct: 51  TDIMMPMMDGYQLIQELR--SAAYNVPIIVMTAKSQMEDMTKGFGLGADDYMVKPVQLQE 108

Query: 264 VKRVVDFIVR 235
           +   +  ++R
Sbjct: 109 LALRIKALLR 118



>gb:SAG766843_169649 Streptococcus agalactiae NEM316 complete
           genome, segment 1.
          Length = 223

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 36/130 (27%), Positives = 70/130 (53%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + +L V+D+ V +K+I   L     +     +G  AL  L  D EE         V LI+
Sbjct: 2   IKILVVEDNIVQQKIITTKLTQEGYQFITASNGQEALNCL--DTEE---------VQLII 50

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           TD  MP M GY+L+++++  SA   +P+++M+++  +  +      GA ++++KPV+L +
Sbjct: 51  TDIMMPMMDGYQLIQELR--SAAYNVPIIVMTAKSQMEDMTKGFGLGADDYMVKPVQLQE 108

Query: 264 VKRVVDFIVR 235
           +   +  ++R
Sbjct: 109 LALRIKALLR 118



>pir|F83292|F83292 probable sensor/response regulator hybrid PA2824
            [imported] - Pseudomonas aeruginosa (strain
            PAO1)>gb:AE004709_57060 Pseudomonas aeruginosa PAO1,
            section 270 of 529 of the complete
            genome.>gb:AE004091_971160 Pseudomonas aeruginosa PAO1,
            complete genome.
          Length = 786

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 38/145 (26%), Positives = 70/145 (48%)
 Frame = -2

Query: 681  EKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLG 502
            E  A     +S   G  R   VL V+D+ V++ V + +L    C+V   + G  AL+ L 
Sbjct: 644  EHTAIAPSSASDTTGEQRNTRVLLVEDNPVNQLVAKGLLHKLGCQVWIAEHGLNALKML- 702

Query: 501  LDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARID 322
               EE         ++L++ D +MP M GYE  ++I+ S     +P++ +++  +    +
Sbjct: 703  ---EEHP-------IDLVLMDCNMPVMDGYEATRQIRDSGRWGGLPIIALTANALPDERE 752

Query: 321  SCLEEGAKEFLMKPVKLSDVKRVVD 247
             C   G  ++L KP    ++K ++D
Sbjct: 753  RCRAAGMDDYLAKPFHRDELKAILD 777



>pir|H69433|H69433 response regulator homolog - Archaeoglobus
           fulgidus>gb:AE001001_30442 Archaeoglobus fulgidus DSM
           4304 section 106 of 172 of the complete
           genome.>gb:AE000782_975356 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 133

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = -2

Query: 498 DGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDS 319
           DGEE+ +     K  LI+ D  +P ++G+E+LK +K    L++IPVV+++S +    I+ 
Sbjct: 35  DGEEAISYLQENKPVLILLDLKLPKVSGFEVLKWVKSKERLKRIPVVVLTSSRNGEDINR 94

Query: 318 CLEEGAKEFLMKPVKLSDV 262
             + GA  +L+KPV+  D+
Sbjct: 95  AYDLGANSYLVKPVRFEDL 113



>gb:BX950851_840437 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 129

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + GS AL  L       S A D     
Sbjct: 4   KELRFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGSDALNKL------RSGAFD----- 52

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELL+ I+   AL ++PV+++++E     I +  + GA  +++KP
Sbjct: 53  FVISDWNMPNMDGLELLQTIRADGALSKLPVLMVTAEAKKENIIAAAQAGASGYVVKP 110



>gb:AF481091_514457 Pseudomonas fluorescens FlhA (flhA) gene,
           partial cds; FlhF (flhF), FleN (fleN), FliA (fliA), CheY
           (cheY), CheZ (cheZ), and CheA (cheA) genes, complete
           cds; and CheB (cheB) gene, partial cds.
          Length = 124

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 32/129 (24%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +        D G  A+  L               ++ +
Sbjct: 1   MKILIVDDFSTMRRIIKNLLRDLGFTNTVEADDGLTAIPILNSGS-----------IDFL 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGMTG +LL+ ++    LR +PV+++++E    +I    + G   +++KP    
Sbjct: 50  VTDWNMPGMTGIDLLRHVRADEKLRSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAL 109

Query: 267 DVKRVVDFI 241
            +K  ++ I
Sbjct: 110 ALKEKIEKI 118



>gb:AE017355_462232 Bacillus thuringiensis serovar konkukian str.
            97-27, complete genome.
          Length = 896

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 31/127 (24%), Positives = 63/127 (49%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            +E  +L VDD + +   ++  LK     +    +G   L+ L           +   ++L
Sbjct: 774  QEKTILIVDDDHRNIFALQNALKKHHANIITAQNGLECLEIL----------KNNTNIDL 823

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
            I+ D  MP M GYE ++ I+ +  L +IP++ ++++ +    + CL  GA +++ KP+ L
Sbjct: 824  ILMDIMMPNMDGYETMEHIRMNLGLHEIPIIALTAKAMPNDKEKCLSAGASDYISKPLNL 883

Query: 270  SDVKRVV 250
              +  V+
Sbjct: 884  HQLYSVM 890



>gb:AE011821_276811 Xanthomonas axonopodis pv. citri str. 306,
           section 199 of 469 of the complete
           genome.>gb:AE008923_918586 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 725

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 39/122 (31%), Positives = 66/122 (54%), Gaps = 4/122 (3%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R + +L  DD   +R V++++L+ +  +VT VD G   L  L        A TD    + 
Sbjct: 458 RSMQILVADDHLANRLVLQRLLQKAGHRVTCVDGGEAVLDAL--------ADTD---YDA 506

Query: 450 IMTDYSMPGMTGYELLKKIK----GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMK 283
            + D  MPG++G ++LK+++    G +++ Q  VV++S++     I SC + GA  FL K
Sbjct: 507 AIVDLHMPGVSGLDMLKQLRVMQAGGASVTQ--VVVLSADVTPESIRSCEQAGAYAFLAK 564

Query: 282 PV 277
           PV
Sbjct: 565 PV 566



>gb:HPU97567_137742 Helicobacter pylori sress responsive operon
           containing: chemotaxis response regulator (cheY), heat
           shock and methylase homolog (hsm), FtsH (ftsH),
           phosphatidyltransferase homolog (ptr), copper
           transporter ATPase (copA) and heavy metal-binding
           homolog (copP) genes, complete cds.
          Length = 124

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 31/130 (23%), Positives = 70/130 (53%), Gaps = 1/130 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDDS   R++I+  L ++    V   + G  A + L  + +            ++
Sbjct: 1   MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANAD----------TKVL 50

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MP M G +L+KK++  S  ++IP++++++E   A + + L+ G   +++KP    
Sbjct: 51  ITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQ 110

Query: 267 DVKRVVDFIV 238
            +K  ++ ++
Sbjct: 111 VLKEKLEVVL 120



>sp|P71403|CHEY_HELPY Chemotaxis protein cheY
           homolog.>pir|C64653|C64653 chemotaxis protein -
           Helicobacter pylori (strain 26695)>gb:AE000614_25231
           Helicobacter pylori 26695 section 92 of 134 of the
           complete genome.>gb:AF021090_469754 Helicobacter pylori
           conserved hypothetical protein (HP1066) gene, partial
           cds; CheY (cheY) gene, complete cds; and
           methyltransferase (prmA) gene, partial
           cds.>gb:AE000511_880670 Helicobacter pylori 26695
           complete genome.
          Length = 124

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 31/130 (23%), Positives = 70/130 (53%), Gaps = 1/130 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDDS   R++I+  L ++    V   + G  A + L  + +            ++
Sbjct: 1   MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANAD----------TKVL 50

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MP M G +L+KK++  S  ++IP++++++E   A + + L+ G   +++KP    
Sbjct: 51  ITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQ 110

Query: 267 DVKRVVDFIV 238
            +K  ++ ++
Sbjct: 111 VLKEKLEVVL 120



>gb:AP006627_566305 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 610

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 36/124 (29%), Positives = 64/124 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDD     +V+E +L      VT V SG  AL  L           D  + +L+++D
Sbjct: 283 ILMVDDDPAHLQVLEGILSPEDYDVTMVTSGKEALAML-----------DAQEWDLVISD 331

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MP ++GYEL + I+    L ++PV++++S      I +    GA +++ KPVK  +++
Sbjct: 332 TMMPQLSGYELTRLIRKRFTLIELPVLLLTSRSQSKDIQTGFLAGANDYVTKPVKALELR 391

Query: 258 RVVD 247
             ++
Sbjct: 392 ARIE 395



>gb:AE017295_434239 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 9 of 14 of the
           complete sequence.>gb:AE016823_1067250 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 201

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 63/122 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDD   +   + K+L      V   + G+ AL+ L  + +          V+L++ D
Sbjct: 83  ILLVDDDMRNVFALSKILSEKGMNVLKAEDGNSALELLSKNED----------VDLVLMD 132

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MP M GYE +KKI+  S  + + ++ ++++ +      C+E GA +++ KPV   DV+
Sbjct: 133 IMMPEMDGYETMKKIREISKYKNLTIIALTAKAMQNDRQKCIEAGANDYIPKPV---DVE 189

Query: 258 RV 253
           R+
Sbjct: 190 RL 191



>gb:AE017027_381225 Bacillus anthracis str. Ames section 4 of 18 of
            the complete genome.>gb:AE017225_406333 Bacillus
            anthracis str. Sterne, complete
            genome.>gb:AE017334_451074 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE016879_1010930 Bacillus
            anthracis str. Ames complete genome.
          Length = 896

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 30/127 (23%), Positives = 63/127 (49%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            +E  ++ VDD + +   ++  LK     +    +G   L+ L           +   ++L
Sbjct: 774  QEKTIMIVDDDHRNIFALQNALKKQHANIITAQNGLECLEIL----------KNNTNIDL 823

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
            I+ D  MP M GYE ++ I+ +  L +IP++ ++++ +    + CL  GA +++ KP+ L
Sbjct: 824  ILMDIMMPNMDGYETMEHIRMNLGLHEIPIIALTAKAMPNDKEKCLSAGASDYISKPLNL 883

Query: 270  SDVKRVV 250
              +  V+
Sbjct: 884  HQLYSVM 890



>gb:AE016915_356540 Chromobacterium violaceum ATCC 12472 section 6 of
            16 of the complete genome.>gb:AE016825_1041694
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 1234

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 42/137 (30%), Positives = 66/137 (48%)
 Frame = -2

Query: 687  RPEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQY 508
            R E+ A      S    G R   VL VDD   +  VI   L+    K+ +  +G RAL++
Sbjct: 1094 RAERKAPAAASGSKLLDGRR---VLVVDDDPRNLFVITAALERHGAKLNSAVNGRRALEF 1150

Query: 507  LGLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILAR 328
            L               V+L++ D  MP M GY+ +  I+ + A + IPVV ++++ + A 
Sbjct: 1151 L-----------QHQSVDLVLMDIMMPEMDGYQAIAAIRANPAWKDIPVVAITAKALPAE 1199

Query: 327  IDSCLEEGAKEFLMKPV 277
             +  L  GA ++L KPV
Sbjct: 1200 REKILATGADDYLSKPV 1216



>gb:AE011351_271982 Leptospira interrogans serovar lai str. 56601
            chromosome I, section 160 of 397 of the complete
            sequence.>gb:AE010300_1005381 Leptospira interrogans
            serovar lai str. 56601 chromosome I, complete sequence.
          Length = 1207

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 63/122 (51%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            +L VDD   +   + K+L      V   + G+ AL+ L  + +          V+L++ D
Sbjct: 1089 ILLVDDDMRNVFALSKILSEKGMNVLKAEDGNSALELLSKNED----------VDLVLMD 1138

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
              MP M GYE +KKI+  S  + + ++ ++++ +      C+E GA +++ KPV   DV+
Sbjct: 1139 IMMPEMDGYETMKKIREISKYKNLTIIALTAKAMQNDRQKCIEAGANDYIPKPV---DVE 1195

Query: 258  RV 253
            R+
Sbjct: 1196 RL 1197



 Score = 43.5 bits (101), Expect = 0.004
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 5/121 (4%)
 Frame = -2

Query: 582  VIEKMLKISCCKVT-AVDSGSRALQYLGLDGEESSAATDGLKVNLIMTDYSMPGMTGYEL 406
            VIE  LK +   +  A + G + +      GE+    T   K + I+ D  +PG+ G  +
Sbjct: 823  VIEDDLKFASVLIKQANEKGFKCIS--AATGEDGLILTRKYKPHAIILDLDLPGIKGQTV 880

Query: 405  LKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV----KRVVDFIV 238
            L ++K   ++R IPV I+S+ +    +   +  GA E + KP+   ++     R+ +FI 
Sbjct: 881  LNELKADQSIRHIPVHIVSANEYSLEL---IRGGAVEHIRKPIHKKELDEAFNRIENFIN 937

Query: 237  R 235
            R
Sbjct: 938  R 938



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 26/116 (22%), Positives = 59/116 (50%)
 Frame = -2

Query: 621  HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
            ++L ++D +  RK++ K++     K    DSG  AL+    +             + I+ 
Sbjct: 942  NLLIIEDDFNSRKMMLKLIGNGDVKCFEADSGKEALRVYAEN-----------HFDCIVL 990

Query: 441  DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
            D  +P M+G+EL+++++     R  P+VI + +++    D  L++ ++  ++K +K
Sbjct: 991  DIGLPDMSGFELIQEMEKIKNGRIPPIVIYTGKELTKEEDKELQKYSESIIIKGIK 1046



>gb:RCU64519_162830 Rhodospirillum centenum cheAY, cheW, cheY, cheB,
           and cheR genes, complete cds.
          Length = 121

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 37/112 (33%), Positives = 58/112 (51%)
 Frame = -2

Query: 615 LAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTDY 436
           L VDDS V RKV  K+L+      T  + G +A++        + A  D      ++ D+
Sbjct: 5   LVVDDSRVVRKVARKILEELGFTCTEAEDGKQAMEKC------AEAMPDA-----VLLDW 53

Query: 435 SMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           +MP MTG E L++++  +  +   VV  ++E  LA I   L  GA E++MKP
Sbjct: 54  NMPVMTGIEFLRRLRKMTGGQAPKVVFCTTENDLAHIQEALSAGANEYIMKP 105



>pir|A23567|QREBCY chemotaxis protein cheY [validated] - Salmonella
           typhimurium>pir|AH0745|AH0745 chemotaxis protein CheY
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)>gb:CP000026_75811 Salmonella
           enterica subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:STYCHEY_194206 Salmonella typhimurium Meche
           operon, partial sequence.>gb:AE008785_243604 Salmonella
           typhimurium LT2, section 89 of 220 of the complete
           genome.>gb:AE016837_345101 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 4 of 16 of the
           complete genome.>gb:AL627272_542280 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 8/20.>gb:AE014613_982433 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1000686 Salmonella typhimurium LT2,
           complete genome.
          Length = 129

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 4   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG-----------FG 52

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            I++D++MP M G ELLK I+  SA+  +PV+++++E     I +  + GA  +++KP
Sbjct: 53  FIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKP 110



>sp|P06657|CHEY_SALTY Chemotaxis protein cheY.
          Length = 128

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 3   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG-----------FG 51

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            I++D++MP M G ELLK I+  SA+  +PV+++++E     I +  + GA  +++KP
Sbjct: 52  FIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKP 109



>gb:AF466202_1802262 Zea mays putative pol protein gene, partial
           cds; and putative gag-pol precursor -orf2, putative
           Fourf gag/pol protein, putative NADP-dependent malic
           enzyme, putative argonaute protein, putative pinhead
           protein, putative pol protein, putative gag protein,
           putative TNP2, r1-B73 proteins, putative genetic
           modifier, putative S-receptor kinase, putative aldose
           reductase-related protein, putative glutathione
           peroxidase, putative glycerol 3-phosphate permease,
           putative response regulator, and putative
           4-coumarate-CoA ligase-like protein genes, complete cds.
          Length = 87

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 28/43 (65%), Positives = 34/43 (79%)
 Frame = -2

Query: 435 SMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEE 307
           ++PGMTGYELLK++K S+AL  I VVIMSSE +  RI  CLEE
Sbjct: 37  AVPGMTGYELLKRVKESAALSDILVVIMSSENVPNRITRCLEE 79



>gb:BX321856_772377 Nitrosomonas europaea ATCC 19718, complete genome;
            segment 1/10.
          Length = 1229

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 1/125 (0%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            +L  +D+ +++KVI + L +       V +G  ALQ    +GE +          LI+TD
Sbjct: 970  ILVAEDNEINQKVIHQQLTLLGFAADIVINGREALQSWK-NGEYA----------LILTD 1018

Query: 438  YSMPGMTGYELLKKIKGSSALR-QIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
              MP M GY+L + I+       QIP++ +++  +    + C   G  ++L KPV+L  +
Sbjct: 1019 LHMPEMDGYQLTQSIRSEKTGHYQIPIIALTANALKGEAEKCRALGMDDYLSKPVQLEQL 1078

Query: 261  KRVVD 247
            K V++
Sbjct: 1079 KSVLE 1083



>gb:BA000037_723289 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 130

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 33/131 (25%), Positives = 66/131 (50%), Gaps = 1/131 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           + + +L VDD    R++++ +L+ +        D G  AL  L                +
Sbjct: 7   KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGD-----------FD 55

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
            ++TD++MPGM G +LLK I+  + L+ +PV+++++E    +I    + G   +++KP  
Sbjct: 56  FVVTDWNMPGMQGIDLLKNIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFT 115

Query: 273 LSDVKRVVDFI 241
            + +K  +D I
Sbjct: 116 AATLKEKLDKI 126



>gb:AP006841_575050 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 918

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 37/130 (28%), Positives = 68/130 (52%), Gaps = 1/130 (0%)
 Frame = -2

Query: 627  ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
            + HVL V+D    R  + K L  +  +V    +G+ AL  LG           G   +LI
Sbjct: 664  DYHVLVVEDDPDVRYSLRKELSANF-QVEVAGNGNEALDLLG----------QGDAFHLI 712

Query: 447  MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
            ++D  MPGM G++L+ ++K   A   IP++++++    ++    + EGA E++ KP  + 
Sbjct: 713  LSDVLMPGMNGFQLVNRVKNDLAFSHIPIILLTALSEDSQRIYGIAEGADEYIPKPFNID 772

Query: 267  DVK-RVVDFI 241
             +K R+++ I
Sbjct: 773  FLKIRIINMI 782



>gb:AE016780_331308 Pseudomonas putida KT2440 section 7 of 21 of the
            complete genome.>gb:AE015451_946385 Pseudomonas putida
            KT2440 complete genome.
          Length = 785

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 32/124 (25%), Positives = 64/124 (51%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            +L V+D+ V++ V + ML    C+V     G+ AL+ L  +           + +L++ D
Sbjct: 666  ILLVEDNPVNQLVAKGMLAKLGCQVQLATQGAEALELLARE-----------EFDLVLMD 714

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             +MP M GYE  ++I+ S    ++P+V +++  +    + C   G  ++L KP +  ++ 
Sbjct: 715  CNMPVMDGYEASRRIRQSGRWPELPIVALTANAMPEERERCRAAGMNDYLAKPFRREELL 774

Query: 258  RVVD 247
             +VD
Sbjct: 775  ALVD 778



>pir|AI1979|AI1979 two-component hybrid sensor and regulator all1388
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682379 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 431

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 39/119 (32%), Positives = 60/119 (50%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +LAVDD+  + +V+   L  S  +V A  SG +ALQ L  D          L  +LI+ D
Sbjct: 21  ILAVDDNPNNLQVLSSFLDDSSFEVWAARSGEKALQRLEND----------LLPDLILLD 70

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
             MPGM G+E  +++K       IPVV M++    A      + GA +++ KP +  +V
Sbjct: 71  IMMPGMDGFETCQRLKSDQRFCDIPVVFMTALSETADKVKGFQLGAVDYITKPFQHEEV 129



>gb:BX842651_824713 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 6/11.
          Length = 154

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 33/120 (27%), Positives = 60/120 (50%), Gaps = 1/120 (0%)
 Frame = -2

Query: 615 LAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           L VDD    RK+I+K+L ++    V   D G  AL  +       +A   G     +++D
Sbjct: 22  LVVDDFATMRKIIKKVLNELGYTNVEEADDGKTALPMI------QAAHDAGQPYGFVISD 75

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
           ++MPGM G +LLK  K     + +P +++++E     I    + G  ++++KP   + +K
Sbjct: 76  WNMPGMQGIDLLKACKADPRTKSVPFMLVTAESEQKHILEAAKAGVSDYVVKPFNSATLK 135



>gb:AY548449_627435 Fremyella diplosiphon clone 3109D10 putative
           methyl accepting chemotaxis protein gene, partial cds;
           putative chemotaxis proteins and putative two component
           regulatory protein genes, complete cds; and hypothetical
           protein gene, partial cds.
          Length = 121

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 37/129 (28%), Positives = 64/129 (49%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           VL V+DS   R++I  +LK S   VT    G  AL+           A      +L++ D
Sbjct: 4   VLIVEDSIAQREMITDLLKASGLTVTHASDGVEALE-----------AIQSTPPDLVVLD 52

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MP M GYE+ +++K     + +PVV+ SS+         +++GA  ++ KP + +++ 
Sbjct: 53  IVMPRMNGYEVCRRLKSDPKTQNVPVVMCSSKGEEFDRYWGMKQGADAYIAKPFQPTELV 112

Query: 258 RVVDFIVRG 232
             V  ++RG
Sbjct: 113 GTVKQLLRG 121



>gb:AE017146_390578 Helicobacter hepaticus ATCC 51449 section 3 of 6
           of the complete genome.>gb:AE017125_1024840 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 125

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 32/130 (24%), Positives = 70/130 (53%), Gaps = 1/130 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDDS   R++I+  L ++    +   + G  A Q +          T+G++V  +
Sbjct: 1   MKLLVVDDSSTMRRIIKNTLQRLGYEDILEAEHGVEAWQIMD--------TTEGIQV--L 50

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MP M G +L+KK++       IP++++++E   A + + L+ G   +++KP    
Sbjct: 51  ITDWNMPEMNGLDLVKKVRSDERYTSIPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQ 110

Query: 267 DVKRVVDFIV 238
            +K  ++ ++
Sbjct: 111 VLKEKLEVVL 120



>gb:AE011645_275171 Xanthomonas axonopodis pv. citri str. 306,
           section 23 of 469 of the complete
           genome.>gb:AE008923_916946 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 475

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 40/119 (33%), Positives = 54/119 (45%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           H+  VDD    R V+   L+ +   V   DS + ALQ LG+              +L+ T
Sbjct: 9   HIWVVDDDRSVRFVLSTALRDAGYAVDGFDSAAAALQALGMRPTP----------DLLFT 58

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           D  MPG  G  LL K+K       +PV++MS+   +A        GA EFL KP  L D
Sbjct: 59  DVRMPGEDGLTLLDKLKSKHP--HLPVIVMSAYTDVASTAGAFRGGAHEFLSKPFDLDD 115



>gb:CP000031_84202 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 739

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 39/124 (31%), Positives = 66/124 (53%)
 Frame = -2

Query: 633 GRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           GR  HVL VDD  V+R ++EK L     +VT   SG++AL       E+ S   D     
Sbjct: 457 GRLQHVLIVDDLAVNRAILEKQLAQLGVRVTCCASGAQAL-------EKMSDCVD----- 504

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           L+++D++MP M G EL + ++G +    +P+ ++SS   +A  D   +   +  L KP+ 
Sbjct: 505 LVLSDHNMPEMDGLELAEALRG-AGWSDLPIFLLSSNPGMAHADPA-KRHVQGILQKPIP 562

Query: 273 LSDV 262
            +++
Sbjct: 563 RAEL 566



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 2/121 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R++ VLA +D+  ++ V  KM+K     +   ++G  A++                + +L
Sbjct: 605 RQMRVLAAEDNRTNQLVFRKMVKTLDIDLRFANNGLEAVEIW-----------QDFQPDL 653

Query: 450 IMTDYSMPGMTGYELLKKIKGSSAL--RQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           I  D SMP M G +   +I+   A   R +P+V +++  +    +  L  G  ++L KP+
Sbjct: 654 IFMDISMPKMDGKQATGEIRRLEAGTGRHVPIVALTAHAMAGDAEGILAAGLDQYLTKPL 713

Query: 276 K 274
           +
Sbjct: 714 R 714



>pir|E83901|E83901 hypothetical protein BH2013 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_655959 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 914

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 32/124 (25%), Positives = 63/124 (50%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R+  +L VDD  V+  V++ ++      + AV SG   L  L    +            L
Sbjct: 584 RKPKILIVDDDAVNLHVLKNIICSEAYTIEAVTSGEEVLDRLDQGWD------------L 631

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           I+ D  MP M+GYEL ++I+   ++ ++PV+++++      + +    GA ++L+KP+  
Sbjct: 632 ILADVMMPSMSGYELTREIRNQFSISELPVLLLTARGQPEEVYTGFMSGANDYLVKPIDA 691

Query: 270 SDVK 259
            ++K
Sbjct: 692 LELK 695



>pir|C82123|C82123 chemotaxis protein CheY VC2065 [imported] -
           Vibrio cholerae  (strain N16961 serogroup
           O1)>gb:AB185932_16749 Vibrio cholerae cheY3 gene for
           cheY homolog, complete cds.>gb:AE004280_52441 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome I,
           section 188 of 251 of the complete
           chromosome.>gb:AE003852_1053215 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 130

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 33/131 (25%), Positives = 65/131 (49%), Gaps = 1/131 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           + + +L VDD    R++++ +L+ +        D G  AL  L                +
Sbjct: 7   KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGD-----------FD 55

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
            ++TD++MPGM G +LLK I+    L+ +PV+++++E    +I    + G   +++KP  
Sbjct: 56  FVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFT 115

Query: 273 LSDVKRVVDFI 241
            + +K  +D I
Sbjct: 116 AATLKEKLDKI 126



>sp|Q9ZM64|CHEY_HELPJ Chemotaxis protein cheY
           homolog.>pir|F71941|F71941 response regulator -
           Helicobacter pylori (strain J99)>gb:AE001471_35350
           Helicobacter pylori, strain J99 section 32 of 132 of the
           complete genome.>gb:AE001439_884120 Helicobacter pylori,
           strain J99 complete genome.
          Length = 124

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 30/130 (23%), Positives = 70/130 (53%), Gaps = 1/130 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDDS   R++I+  L ++    V   + G  A + L  + +            ++
Sbjct: 1   MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANAD----------TKVL 50

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MP M G +L+KK++  +  ++IP++++++E   A + + L+ G   +++KP    
Sbjct: 51  ITDWNMPEMNGLDLVKKVRADNRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQ 110

Query: 267 DVKRVVDFIV 238
            +K  ++ ++
Sbjct: 111 VLKEKLEVVL 120



>gb:AY657420_2146430 Synthetic construct Peudomonas aeruginosa clone
           FLH033223.01F PA1456 gene, partial cds.
          Length = 125

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 32/129 (24%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +        D G+ AL  L                + +
Sbjct: 1   MKILIVDDFSTMRRIIKNLLRDLGFTNTAEADDGTTALPMLHSGN-----------FDFL 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGMTG +LL+ ++    L+ +PV+++++E    +I    + G   +++KP    
Sbjct: 50  VTDWNMPGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQ 109

Query: 267 DVKRVVDFI 241
            +K  ++ I
Sbjct: 110 VLKEKIEKI 118



>gb:BX571659_778217 Wolinella succinogenes, complete genome; segment
           3/7.
          Length = 372

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 33/116 (28%), Positives = 60/116 (51%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           E  +LAVDD+ V+  ++  +LK        + +         L G+E+       K++LI
Sbjct: 5   EATILAVDDTEVNVDILMGILK----NYDVIPA---------LSGKEALEIVKNEKIDLI 51

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           + D  MP M GYE+ +++K   A R IP++ ++++   + I    E GA +++ KP
Sbjct: 52  LLDIMMPEMDGYEVCRRLKSEEATRSIPIIFITAKTTESDIKEGFERGAVDYVTKP 107



>gb:BA000012_668889 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 786

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 35/115 (30%), Positives = 58/115 (50%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           VL +DD+ V+R+++ + L+       A +SG+  L +L        A   G  V+ I+ D
Sbjct: 484 VLVIDDNPVNREILLEQLRSWSFDCAAAESGAVGLAFL------DRACQLGASVDCIILD 537

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
           Y MPGM G ++ + I   S L  IP+VI++S   +      ++ G    L KP +
Sbjct: 538 YQMPGMNGADVARAIAADSRLSAIPIVILTSVDQVDFGKMIIDFGISAHLTKPAR 592



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = -2

Query: 465 LKVNLIMTDYSMPGMTGYELLKKIKG--SSALRQIPVVIMSSEKILARIDSCLEEGAKEF 292
           L   LI+ D SMP M GYE  + I+   +S+   IP++ +++  +    D C+E G  ++
Sbjct: 700 LHPKLILMDVSMPEMNGYEATRAIRAIETSSGGHIPIIGVTAHALKGDRDKCIEAGMDDY 759

Query: 291 LMKPV 277
           L KPV
Sbjct: 760 LPKPV 764



>gb:AF450326_512280 Azospirillum brasilense chemotaxis gene cluster,
           complete sequence.
          Length = 121

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 38/112 (33%), Positives = 56/112 (50%)
 Frame = -2

Query: 615 LAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTDY 436
           L VDDS V RKV  K+L+      T  + G +A++           A      + I+ D+
Sbjct: 5   LVVDDSRVVRKVARKILEELHFACTEAEDGRQAME-----------ACAQKMPDAILLDW 53

Query: 435 SMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           +MP MTG E L++++  S      VV  ++E  LA I   L  GA E++MKP
Sbjct: 54  NMPVMTGIEFLRRLRKMSGGDIPKVVFCTTENDLAHIQEALSAGANEYIMKP 105



>gb:AE017180_400514 Geobacter sulfurreducens PCA, complete genome.
          Length = 123

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 38/123 (30%), Positives = 61/123 (49%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L V+D     K+   +L      V  V  G  AL Y+        AAT     +LI+ D
Sbjct: 6   ILIVEDEESLLKLESILLSSRGYAVAGVTDGKSALDYI--------AATPP---DLIILD 54

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             +PGM G+E+ + IK   + R IPVV+++++K     D  LE GA  ++ KP K + + 
Sbjct: 55  IMLPGMDGFEVCQMIKADPSTRHIPVVMLTAKKSTQDRDKGLEAGASAYVTKPFKSARII 114

Query: 258 RVV 250
            ++
Sbjct: 115 EII 117



>gb:AE016803_336606 Vibrio vulnificus CMCP6 chromosome I section 7
           of 11 of the complete sequence.>gb:AE016795_1046330
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 122

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 33/129 (25%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++++ +L+ +        D G  AL  L                + +
Sbjct: 1   MKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGD-----------FDFV 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGM G +LLK I+  + L+ +PV+++++E    +I    + G   +++KP   +
Sbjct: 50  VTDWNMPGMQGIDLLKNIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAA 109

Query: 267 DVKRVVDFI 241
            +K  +D I
Sbjct: 110 TLKEKLDKI 118



>gb:AE013598_298184 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 482

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 40/119 (33%), Positives = 54/119 (45%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           H+  VDD    R V+   L+ +   V   DS + ALQ L +              +L+ T
Sbjct: 16  HIWVVDDDRSVRFVLSTALRDAGYAVDGFDSAAAALQALAMRPTP----------DLLFT 65

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           D  MPG  G  LL K+K      Q+PV++MS+   +A        GA EFL KP  L D
Sbjct: 66  DVRMPGEDGLTLLDKLKAKHP--QLPVIVMSAYTDVASTAGAFRGGAHEFLSKPFDLDD 122



>sp|Q51455|CHEY_PSEAE Chemotaxis protein cheY.>pir|S20545|S20545
           phosphate acceptor regulatory protein - Pseudomonas
           aeruginosa>gb:AE004575_55692 Pseudomonas aeruginosa
           PAO1, section 136 of 529 of the complete
           genome.>gb:PAFLIA_156741 Pseudomonas aeruginosa fliA
           gene for sigma-28 class sigma factor.>gb:AE004091_969792
           Pseudomonas aeruginosa PAO1, complete genome.
          Length = 124

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 32/129 (24%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +        D G+ AL  L                + +
Sbjct: 1   MKILIVDDFSTMRRIIKNLLRDLGFTNTAEADDGTTALPMLHSGN-----------FDFL 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGMTG +LL+ ++    L+ +PV+++++E    +I    + G   +++KP    
Sbjct: 50  VTDWNMPGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQ 109

Query: 267 DVKRVVDFI 241
            +K  ++ I
Sbjct: 110 VLKEKIEKI 118



>gb:AY600439_1617277 Lycopersicon esculentum ethylene receptor
           neverripe (ETR5) gene, complete cds.>gb:AF118844_1769640
           Lycopersicon esculentum ethylene receptor homolog (ETR5)
           mRNA, complete cds.
          Length = 767

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 1/121 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R LHVL  DD  V+R V  K+L+   C+VTAV +G + L  LG      S  T      +
Sbjct: 637 RGLHVLLTDDDDVNRLVTRKLLEKLGCQVTAVSTGFQCLSALG-----PSLTT----FQV 687

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARI-DSCLEEGAKEFLMKPVK 274
           ++ D  MP M GYE+  +++   + R  P++I  +     ++ + CL+ G    + KPV 
Sbjct: 688 LILDLQMPEMDGYEVALRVRKFRS-RSWPLIIALTASSEEQVWEKCLQVGMNGLIRKPVL 746

Query: 273 L 271
           L
Sbjct: 747 L 747



>gb:AY456056_1607137 Botryotinia fuckeliana putative histidine kinase
            M3YPp (M3YP) gene, partial cds.
          Length = 992

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 36/141 (25%), Positives = 74/141 (52%), Gaps = 11/141 (7%)
 Frame = -2

Query: 621  HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAAT------DGLK 460
            H+L V+D+ V++KV+ K L+ + C V+  + G  AL++L    E+S+ +T       G+ 
Sbjct: 831  HILIVEDNIVNQKVLSKQLRSAGCIVSVANHGLEALEFL----EKSTFSTSLPEGVSGIP 886

Query: 459  VNLIMTDYSMPGMTGYELLKKI----KGSSALRQIPVVIMSSEKILARIDSCLEEGAKEF 292
             N+++ D  MP M G   +++I    +      ++PV+ +++     +I    E G    
Sbjct: 887  CNILLMDLEMPIMDGLTCVRQIRKWEREGRVKGRVPVIAVTANARSEQIARAKEAGMDSV 946

Query: 291  LMKPVKLSD-VKRVVDFIVRG 232
            + KP ++ + V  +  +++RG
Sbjct: 947  VTKPFRIGELVPEMERWLIRG 967



>gb:AY088149_1573172 Arabidopsis thaliana clone 41875 mRNA, complete
           sequence.
          Length = 382

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 38/130 (29%), Positives = 65/130 (50%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L +L VDD      ++EKML     +VT       AL  L     E   + D     L++
Sbjct: 11  LRILVVDDDTSCLFILEKMLLRLMYQVTICSQADVALTIL----RERKDSFD-----LVL 61

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D  MPGM GY LL+++        +PV++MS +     + + +  GA ++L+KP++  +
Sbjct: 62  SDVHMPGMNGYNLLQQV--GLLEMDLPVIMMSVDGRTTTVMTGINHGACDYLIKPIRPEE 119

Query: 264 VKRVVDFIVR 235
           +K +   +VR
Sbjct: 120 LKNIWQHVVR 129



>gb:CP000009_863541 Gluconobacter oxydans 621H, complete genome.
          Length = 131

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 33/129 (25%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + VL VDD    R ++   L +I   ++  V +G  AL++L  +           +V+LI
Sbjct: 7   MSVLLVDDQTSIRSILRNTLSQIGFVQIAGVRNGLEALEHLKSN-----------QVHLI 55

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           ++D++MP M G ELLK ++ ++   +   ++++ +     +   + EG   FL KP   S
Sbjct: 56  ISDFNMPDMDGLELLKAVRSNARTAKTGFIMLTGQASKELVQQAIAEGVNNFLAKPFTAS 115

Query: 267 DVKRVVDFI 241
            +K  ++ +
Sbjct: 116 SLKSRIEAV 124



>gb:BX321860_773578 Nitrosomonas europaea ATCC 19718, complete genome;
            segment 5/10.
          Length = 1713

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 35/129 (27%), Positives = 65/129 (50%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            V+ VDDS   RKV  ++L+    ++     G  ALQ L     E++ A       +++ D
Sbjct: 1596 VMIVDDSLTVRKVTSRLLERQGYEILIAKDGVGALQLL----RETTPA-------IMLVD 1644

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
              MP M G+EL++ ++ +  L  +P++I+SS           E G  EF+ KP +  ++ 
Sbjct: 1645 IEMPHMDGFELIRAVRDNPQLHTLPIIIISSRTADKHRKVAEELGVNEFMGKPYQEEELL 1704

Query: 258  RVVDFIVRG 232
              ++ +++G
Sbjct: 1705 YHIERLIKG 1713



>gb:BA000032_709670 Vibrio parahaemolyticus RIMD 2210633 DNA,
            chromosome 2, complete sequence.
          Length = 873

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 3/124 (2%)
 Frame = -2

Query: 624  LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
            LH+L  +DS+++R +IEKML+ +  K+T           L  DG E+      L  +L++
Sbjct: 741  LHLLVAEDSHINRILIEKMLQDTGVKLT-----------LAEDGVEAVELYKQLSPDLVI 789

Query: 444  TDYSMPGMTGYELLKKIK---GSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
            TD SMP   G+ + K I+    +      P+V  S+  +       +  G  ++L KPV+
Sbjct: 790  TDISMPNKDGFGVTKDIRELQENGEFPWCPIVAFSAHAMQEEQQKSIALGMNDYLTKPVQ 849

Query: 273  LSDV 262
             SD+
Sbjct: 850  KSDL 853



>gb:AE017340_456878 Idiomarina loihiensis L2TR, complete genome.
          Length = 123

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 34/129 (26%), Positives = 68/129 (52%), Gaps = 1/129 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDD    R++I+ +L+ +    +   D G+ AL  L  +G+           + +
Sbjct: 1   MKILVVDDFSTMRRIIKNLLRDLGFTNIQEADDGNTALPMLQ-NGD----------FDFV 49

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +TD++MPGM G +LL++I+    L  +PV+++++E    +I    + G   +++KP    
Sbjct: 50  VTDWNMPGMQGIDLLREIRKDDNLAHLPVLMVTAEAKREQIIMAAQAGVNGYIVKPFTAV 109

Query: 267 DVKRVVDFI 241
            +K  +D I
Sbjct: 110 TLKEKLDKI 118



>gb:AE017320_441511 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 12 of 12 of the complete
            genome.>gb:AE017285_1074672 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 839

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 42/128 (32%), Positives = 63/128 (49%), Gaps = 3/128 (2%)
 Frame = -2

Query: 621  HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
            HVL V+D  V+     +ML+   CKVT    G  AL  L       S+  D      +  
Sbjct: 711  HVLLVEDDPVNLMAARRMLERLECKVTTATCGQEALNAL------RSSVFDA-----VFM 759

Query: 441  DYSMPGMTGYELLKKI--KGSSALR-QIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
            D  MP   G E L+++  KGS  LR Q PVV M++  +    +  + EG  +++ KPV +
Sbjct: 760  DIQMPDFDGIEALRRMRAKGSGVLRPQTPVVAMTAFAMKGDRERFMTEGMADYVSKPVLI 819

Query: 270  SDVKRVVD 247
            S +K V++
Sbjct: 820  SALKDVLE 827



>gb:AE017267_422320 Bacillus cereus ATCC 10987, section 4 of 18 of the
            complete genome.>gb:AE017194_1060739 Bacillus cereus ATCC
            10987, complete genome.
          Length = 896

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 30/127 (23%), Positives = 62/127 (48%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            +E  +L VDD + +   ++  L+     +    +G   L  L           +   ++L
Sbjct: 774  QEKTILIVDDDHRNIFALQNALEKQHANIITAQNGIECLDIL----------KNNTNIDL 823

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
            I+ D  MP M GYE ++ I+ +  L +IP++ ++++ +    + CL  GA +++ KP+ L
Sbjct: 824  ILMDIMMPNMDGYETMEHIRMNLGLHEIPIIALTAKAMPNDKEKCLSAGASDYISKPLNL 883

Query: 270  SDVKRVV 250
              +  V+
Sbjct: 884  HQLYSVM 890



>gb:AE016913_355977 Chromobacterium violaceum ATCC 12472 section 4
           of 16 of the complete genome.>gb:AE016825_1041131
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 122

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 37/113 (32%), Positives = 58/113 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDDS   R+V+   L  +  +V    +G  AL  L           DG K++LI++D
Sbjct: 5   ILIVDDSTTLRQVVRMTLAGAGYEVLEAGNGKEALDIL-----------DGRKIHLIISD 53

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +MP M G  LLK IK     +  PV+++++E    +     E GAK +++KP
Sbjct: 54  VNMPQMDGLALLKNIKQLPHYKFTPVIMLTTESAEDKKREGKEAGAKAWVVKP 106



>gb:AE013334_291398 Methanosarcina mazei strain Goe1, section 116 of
           379 of the complete genome.>gb:AE008384_965507
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 123

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 31/124 (25%), Positives = 67/124 (54%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L V+D+ ++ ++I  +L+    +VT  + G +AL+ L              K +LI+ D
Sbjct: 6   ILIVEDNPMNMELILDLLEFYGHRVTEAEDGIKALERLAEK-----------KFDLILLD 54

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             +P M G E+L++IK + A  +IPV+ +++  +    +  +E G  +++ KP+ +   +
Sbjct: 55  MQLPKMDGLEVLERIKKNPATSEIPVIAVTAHAMKGSEEHFIEMGCVDYISKPIDIHRFR 114

Query: 258 RVVD 247
            ++D
Sbjct: 115 SLID 118



>pir|G84428|G84428 hypothetical protein At2g01760 [imported] -
           Arabidopsis thaliana>gb:AC006069_1533378 Arabidopsis
           thaliana chromosome 2 clone T8O11 map rga, complete
           sequence.>gb:AY099726_1576751 Arabidopsis thaliana
           putative two-component response regulator protein
           (At2g01760) mRNA, complete cds.>gb:AY128887_1580967
           Arabidopsis thaliana putative two-component response
           regulator protein (At2g01760) mRNA, complete cds.
          Length = 382

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 38/130 (29%), Positives = 65/130 (50%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L +L VDD      ++EKML     +VT       AL  L     E   + D     L++
Sbjct: 11  LRILVVDDDTSCLFILEKMLLRLMYQVTICSQADVALTIL----RERKDSFD-----LVL 61

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D  MPGM GY LL+++        +PV++MS +     + + +  GA ++L+KP++  +
Sbjct: 62  SDVHMPGMNGYNLLQQV--GLLEMDLPVIMMSVDGRTTTVMTGINHGACDYLIKPIRPEE 119

Query: 264 VKRVVDFIVR 235
           +K +   +VR
Sbjct: 120 LKNIWQHVVR 129



>pir|AF2820|AF2820 two component response regulator Atu1985
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>pir|F97598|F97598 hypothetical protein
           AGR_C_3613 [imported] - Agrobacterium tumefaciens
           (strain C58, Cereon)>gb:AE008116_233683 Agrobacterium
           tumefaciens str. C58 circular chromosome, section 174 of
           254 of the complete sequence.>gb:AE009150_249007
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 176 of 256 of the complete
           sequence.>gb:AE007869_1083352 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1086850 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 145

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 29/121 (23%), Positives = 68/121 (56%), Gaps = 2/121 (1%)
 Frame = -2

Query: 633 GRELHVLAVDDSYVDRKVIEKMLKISCC--KVTAVDSGSRALQYLGLDGEESSAATDGLK 460
           G+E+ ++ ++D     ++IEK ++ +    ++     G++AL ++  +  +   + D  +
Sbjct: 5   GQEVTIVMIEDDEGHARLIEKNVRRAGVNNEIVPFTLGAKALDFILGESRDGLVSKD--R 62

Query: 459 VNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
             L++ D ++P M+G  +L++IK +   R++PVV++++      I  C + GA  ++ KP
Sbjct: 63  YLLVLLDLNLPDMSGLNILEQIKSNEYTRRLPVVVLTTTDDETEIQKCYDLGANVYITKP 122

Query: 279 V 277
           V
Sbjct: 123 V 123



>gb:AK176489_1818477 Arabidopsis thaliana mRNA for putative ARR1
           protein, complete cds, clone: RAFL24-30-K07.
          Length = 690

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 38/144 (26%), Positives = 70/144 (48%), Gaps = 8/144 (5%)
 Frame = -2

Query: 642 GGGGRE--------LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEE 487
           GGGG          L VL VDD      ++E+ML+    +VT  +    AL  L  +   
Sbjct: 23  GGGGETVVEMFPSGLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHG 82

Query: 486 SSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEE 307
                     +++++D  MP M G++LL+ +        +PV++MS++   + +   +  
Sbjct: 83  ---------FDIVISDVHMPDMDGFKLLEHV---GLEMDLPVIMMSADDSKSVVLKGVTH 130

Query: 306 GAKEFLMKPVKLSDVKRVVDFIVR 235
           GA ++L+KPV++  +K +   +VR
Sbjct: 131 GAVDYLIKPVRMEALKNIWQHVVR 154



>gb:AY056099_1563437 Arabidopsis thaliana AT3g16857/MUH15_1 mRNA,
           complete cds.
          Length = 690

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 38/144 (26%), Positives = 70/144 (48%), Gaps = 8/144 (5%)
 Frame = -2

Query: 642 GGGGRE--------LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEE 487
           GGGG          L VL VDD      ++E+ML+    +VT  +    AL  L  +   
Sbjct: 23  GGGGETVVEMFPSGLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHG 82

Query: 486 SSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEE 307
                     +++++D  MP M G++LL+ +        +PV++MS++   + +   +  
Sbjct: 83  ---------FDIVISDVHMPDMDGFKLLEHV---GLEMDLPVIMMSADDSKSVVLKGVTH 130

Query: 306 GAKEFLMKPVKLSDVKRVVDFIVR 235
           GA ++L+KPV++  +K +   +VR
Sbjct: 131 GAVDYLIKPVRMEALKNIWQHVVR 154



>gb:AB042110_1519764 Pyrus pyrifolia PPETR2 mRNA for ethylene
           receptor, complete cds.
          Length = 767

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/121 (29%), Positives = 59/121 (48%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           L VL  DD  V+R V+ KML+   C VTAV SG   L  +G  G   S+        +++
Sbjct: 637 LQVLLTDDDDVNRVVMRKMLEKLGCIVTAVSSGLECLSTIGTFGPAGSS------FQVVL 690

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
            D  MP + G+E+  +I+   +L    ++ +++       D C++ G    + KPV L  
Sbjct: 691 LDLHMPELDGFEVAIRIRKFRSLTWPLIIAVTASADEDVWDRCMQTGINGVIRKPVLLQG 750

Query: 264 V 262
           +
Sbjct: 751 I 751



>gb:BX842652_825256 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 7/11.
          Length = 134

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 30/117 (25%), Positives = 62/117 (52%), Gaps = 1/117 (0%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCK-VTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           E  +L +DD    R +++  LK    K +   + G   L+ L  +       T G ++ L
Sbjct: 5   ETRILVIDDMPSIRDLVKNTLKAMGYKNLQEAEDGEAGLKILIQNN------TPGTQIQL 58

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           +++D++MP M G ELLK+++ ++    +P V+++SE    ++   +  G  ++++KP
Sbjct: 59  VISDWNMPKMKGLELLKQVRATAEFANLPFVLLTSESERDQVTEAVLAGVSQYIVKP 115



>gb:BX571865_786714 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 7/17.
          Length = 129

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/117 (29%), Positives = 63/117 (53%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           ++L  L VDD    R+++  +LK         + G   ++    DG E+ A     + + 
Sbjct: 4   KDLRFLVVDDFSTMRRIVRNLLK---------ELGFNNVEE-AQDGAEALAKIRASQFDF 53

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           I++D++MP M G ELLK I+  + L +IPV+++++E     I +  + GA  +++KP
Sbjct: 54  IISDWNMPNMDGLELLKIIREDAQLAKIPVLMVTAEAKKENIIAAAQAGASGYVVKP 110



>gb:BA000040_732548 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 146

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/126 (26%), Positives = 68/126 (53%), Gaps = 3/126 (2%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCC--KVTAVDSGSRALQYL-GLDGEESSAATDGLKVNLI 448
           ++ ++D     ++IE+ ++ S    ++    +G+ A+++L G DG   S   + L   LI
Sbjct: 7   IIMIEDDEGHARLIERNIRRSGVNNEIIPFGNGTDAMRHLFGADGSGLSQKGNAL---LI 63

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           + D ++P M+G ++LK+IK +S L+  PVV++++      I  C E G   ++ KPV   
Sbjct: 64  LLDLNLPDMSGIDILKQIKENSHLKASPVVVLTTTDDSQEIKRCYELGCNVYITKPVNYE 123

Query: 267 DVKRVV 250
           +    +
Sbjct: 124 NFANAI 129



>gb:AY273869_604941 Pseudomonas aeruginosa PA14 pathogenicity island
            PAPI-1, complete sequence.
          Length = 1084

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 32/134 (23%), Positives = 67/134 (50%)
 Frame = -2

Query: 636  GGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKV 457
            G  +L VL  +D+ V++ ++ + L+   C+V+    G +ALQ             D  + 
Sbjct: 847  GRLDLEVLVAEDNPVNQALLREQLEELGCRVSLAGDGRQALQLF-----------DSGRF 895

Query: 456  NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
            +L+++D +MP MTGYEL + ++       +P++ +++  +    + C   G   +L+KP+
Sbjct: 896  DLLLSDVNMPNMTGYELTQALRERG--ETLPIIGVTANALREEGERCRAVGMNSWLVKPI 953

Query: 276  KLSDVKRVVDFIVR 235
             L  +  ++    R
Sbjct: 954  TLHTLHELLSEFAR 967



>gb:AE017282_429249 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 470

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 40/132 (30%), Positives = 63/132 (47%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           R   V  VDD    R V+EK L+ +  +  A  + +  ++ L  D  ++           
Sbjct: 3   RAFQVWVVDDDRSIRWVLEKALQKASIQTRAFSTANSMMEALNRDRPDA----------- 51

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++TD  MPG+ G ELLK+++  +    +PVVIM++   L    S    GA E+L KP   
Sbjct: 52  VLTDIRMPGLDGIELLKQLQ--AKYPDLPVVIMTAHSDLESAVSAFSGGAFEYLPKPF-- 107

Query: 270 SDVKRVVDFIVR 235
            DV   VD + +
Sbjct: 108 -DVDEAVDLVAK 118



>gb:AE017180_400582 Geobacter sulfurreducens PCA, complete genome.
          Length = 136

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/134 (25%), Positives = 71/134 (52%), Gaps = 4/134 (2%)
 Frame = -2

Query: 636 GGRELHVLAVDDS----YVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATD 469
           G  E+ +L V+D+    ++ R+V++K   +S  ++  V  G  AL+YL       + A +
Sbjct: 3   GTEEITMLLVEDNPDEEFLTRRVLKKFPALS--RIDVVKDGVEALRYL-------TVAEN 53

Query: 468 GLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFL 289
            +    ++ D  +P + G ++L++++     R IPVV+++S      +++C + GA  FL
Sbjct: 54  RVPPRFVLLDLKLPRVDGVDVLREMRKREETRDIPVVVLTSSDHERDMEACGKLGAAHFL 113

Query: 288 MKPVKLSDVKRVVD 247
            KP+    +  V++
Sbjct: 114 QKPLDAGRMSEVLN 127



>gb:AE016762_326301 Escherichia coli CFT073 section 8 of 18 of the
           complete genome.>gb:AE014075_956885 Escherichia coli
           CFT073 complete genome.
          Length = 129

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 4   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGLDALNKLQAGG-----------YG 52

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELLK I+   A+  +PV+++++E     I +  + GA  +++KP
Sbjct: 53  FVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKP 110



>gb:ECOCHE3_128264 E.coli cheR, cheB, cheY, and cheZ
           chemotaxis-related genes.
          Length = 129

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 4   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG-----------YG 52

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELLK I+   A+  +PV+++++E     I +  + GA  +++KP
Sbjct: 53  FVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKP 110



>pir|S74707|S74707 nitrogen fixation positive activator protein -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_687637
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 840

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 30/119 (25%), Positives = 65/119 (54%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           V A+DDS ++ K++++ L+    KV   + G  A+  +           + ++ ++I+ D
Sbjct: 9   VFAIDDSPLNLKILQRFLEKQGWKVFIAEDGLTAITEI-----------NQVQPDIIVLD 57

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
             MPG+ G+E+ +++K + A  +IP++ +S+      I   LE GA +++ KP +  ++
Sbjct: 58  IMMPGIDGFEVCRRLKAAPATAEIPIIFLSALTDQKSIVKGLELGAVDYIHKPFQQEEI 116



>pir|T51246|T51246 ARR1 protein [imported] - Arabidopsis
           thaliana>gb:AB016471_1512829 Arabidopsis thaliana gene
           for ARR1 protein, complete cds.
          Length = 669

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 38/144 (26%), Positives = 70/144 (48%), Gaps = 8/144 (5%)
 Frame = -2

Query: 642 GGGGRE--------LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEE 487
           GGGG          L VL VDD      ++E+ML+    +VT  +    AL  L  +   
Sbjct: 23  GGGGETVVEMFPSGLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHG 82

Query: 486 SSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEE 307
                     +++++D  MP M G++LL+ +        +PV++MS++   + +   +  
Sbjct: 83  ---------FDIVISDVHMPDMDGFKLLEHV---GLEMDLPVIMMSADDSKSVVLKGVTH 130

Query: 306 GAKEFLMKPVKLSDVKRVVDFIVR 235
           GA ++L+KPV++  +K +   +VR
Sbjct: 131 GAVDYLIKPVRMEALKNIWQHVVR 154



>pir|E25195|QRECCY chemotaxis protein cheY [validated] - Escherichia
           coli  (strain K-12)>pir|H90952|H90952 chemotaxis protein
           CheY [imported] - Escherichia coli  (strain O157:H7,
           substrain RIMD 0509952)>pir|D85801|D85801 chemotaxis
           protein cheY [validated] - Escherichia coli  (strain
           O157:H7, substrain EDL933)>gb:AE005174_66871 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:AE005674_71513
           Shigella flexneri 2a str. 301, complete
           genome.>gb:D90830_123129 E.coli genomic DNA, Kohara
           clone #338(42.1-42.5 min.).>gb:ECOCHEY_128271 E. coli
           cheY gene with 3' end of cheB and 5' end of cheZ
           genes.>gb:U00096_200948 Escherichia coli K-12 MG1655
           complete genome.>gb:AE016984_371759 Shigella flexneri 2a
           str. 2457T section 7 of 16 of the complete
           genome.>gb:BA000007_660604 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014073_996509 Shigella flexneri 2a
           str. 2457T complete genome.
          Length = 129

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 4   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG-----------YG 52

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELLK I+   A+  +PV+++++E     I +  + GA  +++KP
Sbjct: 53  FVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKP 110



>sp|P06143|CHEY_ECOLI Chemotaxis protein cheY.
          Length = 128

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 3   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG-----------YG 51

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELLK I+   A+  +PV+++++E     I +  + GA  +++KP
Sbjct: 52  FVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKP 109



>sp|Q8FGP6|CHEY_ECOL6 Chemotaxis protein cheY.
          Length = 128

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 3   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGLDALNKLQAGG-----------YG 51

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELLK I+   A+  +PV+++++E     I +  + GA  +++KP
Sbjct: 52  FVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKP 109



>sp|O49397|ARRA_ARATH Putative transcription factor ARR10
           (Arabidopsis response regulator 10).>pir|T04653|T04653
           receiver-like protein 4 [imported] - Arabidopsis
           thaliana>gb:ATAJ5195_1543913 Arabidopsis thaliana mRNA
           for receiver-like protein 4.>gb:ATCHRIV76_1547113
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 76.>gb:ATF10N7_1548233 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F10N7 (ESSA
           project).>gb:BT003158_1636739 Arabidopsis thaliana
           At4g31920 mRNA, complete cds.
          Length = 552

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/130 (25%), Positives = 68/130 (52%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + VLAVDD     ++++ +L+     VT  +    AL+ L  +           K +L++
Sbjct: 17  MRVLAVDDDQTCLRILQTLLQRCQYHVTTTNQAQTALELLRENKN---------KFDLVI 67

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D  MP M G++LL+ +        +PV+++S+      +   ++ GA ++L+KPV++ +
Sbjct: 68  SDVDMPDMDGFKLLELV---GLEMDLPVIMLSAHSDPKYVMKGVKHGACDYLLKPVRIEE 124

Query: 264 VKRVVDFIVR 235
           +K +   +VR
Sbjct: 125 LKNIWQHVVR 134



>gb:AY456009_1607094 Cochliobolus heterostrophus putative histidine
            kinase HHK6p (HHK6) gene, complete cds.
          Length = 1364

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 6/125 (4%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            + +HVL V+D+++++++  K +K     V AV +G  AL+YL  +        D     +
Sbjct: 1034 QNVHVLVVEDNHINQQIALKTIKKLQFSVNAVWNGQEALEYLAKEFGPLHPRPD-----I 1088

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQ------IPVVIMSSEKILARIDSCLEEGAKEFL 289
            I+ D  MP   GY     I+  +  R       +P+V M++  I    + C+  G  ++L
Sbjct: 1089 ILMDVQMPIRDGYSATHAIRTEAPWRNMPEVQGVPIVAMTASAIQGDKEKCVSCGMDDYL 1148

Query: 288  MKPVK 274
             KPVK
Sbjct: 1149 AKPVK 1153



>gb:BX842656_826393 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 11/11.
          Length = 142

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 35/127 (27%), Positives = 69/127 (54%), Gaps = 3/127 (2%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISC--CKVTAVDSGSRALQYL-GLDGEESSAATDGLKVNLI 448
           +L V+D+     ++ + LK      KV  V  G +ALQYL G+   ES    D     +I
Sbjct: 1   MLLVEDNDDHALIVMRNLKKESFVSKVERVTDGVQALQYLRGIAPYESREEPD-----II 55

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           + D  +P + G+E+L ++K  + LR+IP++++++           +  A  +L+KP++  
Sbjct: 56  LLDLKLPRLDGHEVLSEVKDDAKLRKIPIIVLTTSDAETDKLKAYDLHANSYLVKPLQAD 115

Query: 267 DVKRVVD 247
           ++K++V+
Sbjct: 116 ELKKMVE 122



>gb:BX842646_823391 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 1/11.
          Length = 165

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 27/91 (29%), Positives = 50/91 (54%)
 Frame = -2

Query: 507 LGLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILAR 328
           L  DG E S   D   V+LI+ D  +P + G+EL + +K    L++IP+V +S +     
Sbjct: 72  LAADGTELSTVLDDHSVDLILMDVGLPWINGFELAQLLKEHRDLKKIPLVFVSGKASEED 131

Query: 327 IDSCLEEGAKEFLMKPVKLSDVKRVVDFIVR 235
           +    E GA +++ KP  +  +K+ V+ +++
Sbjct: 132 MKKAFEIGADDYIKKPFDVEKLKKTVETLLK 162



>gb:BX572598_801242 Rhodopseudomonas palustris CGA009 complete
           genome; segment 6/16.
          Length = 121

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 36/112 (32%), Positives = 57/112 (50%)
 Frame = -2

Query: 615 LAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTDY 436
           L VDDS V RKV  ++L+    ++   + G +AL+          A   GL  + ++ D+
Sbjct: 5   LVVDDSSVIRKVARRILEGLDFEIVEAEDGEKALE----------ACKHGLP-DAVLLDW 53

Query: 435 SMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           +MP M GYE L+ ++         VV  ++E  +A I   L  GA E++MKP
Sbjct: 54  NMPVMDGYEFLRNLRRMPGGDAPKVVFCTTENDVAHIARALHAGANEYIMKP 105



>gb:BX571658_778005 Wolinella succinogenes, complete genome; segment
           2/7.
          Length = 125

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 34/115 (29%), Positives = 62/115 (53%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + +L VDDS   R++I+  L  S      V  G       G++G +   A   +KV  ++
Sbjct: 1   MKLLVVDDSSTMRRIIKNTL--SRLGYNDVLEGEN-----GVEGWDQMDANADIKV--LI 51

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           TD++MP M G EL+KK++       IP++++++E   A + + L+ G   +++KP
Sbjct: 52  TDWNMPEMNGLELVKKVRADKRFVDIPIIMVTTEGGKAEVITALKAGVNNYIVKP 106



>gb:BA000040_735390 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 499

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 34/114 (29%), Positives = 59/114 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L  DD  V R++IE M++    +   VDSG  A+  L         A D   ++ ++ D
Sbjct: 5   ILIADDDAVARRLIENMVQKCGYETVVVDSGDAAIAAL--------TAPDAPAIDGVILD 56

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
             MPG+ G  +L KI+   A   +PV++ ++   +  + S +  GA +F++KPV
Sbjct: 57  LVMPGLDGMGVLAKIR--EAGLSVPVIVQTAHGGIDNVISAMRAGAADFVVKPV 108



>gb:BA000038_724417 Vibrio vulnificus YJ016 DNA, chromosome II,
            complete sequence.
          Length = 1243

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 31/119 (26%), Positives = 58/119 (48%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            VL  +D+ +++ +++            V++G  AL Y+   G+          V L++TD
Sbjct: 1022 VLVAEDNKINQHIVKMQFAELGLTPIVVNNGLEALNYIKQHGD----------VALLLTD 1071

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
            + MP M GYEL+K ++ +     +PVV +++E      +  ++ G  E L KP  L  +
Sbjct: 1072 FHMPEMDGYELVKTLRANERFAALPVVGVTAEDSRIANEKSMQSGINEILYKPYDLKQL 1130



>gb:BA000032_709276 Vibrio parahaemolyticus RIMD 2210633 DNA,
            chromosome 2, complete sequence.
          Length = 1221

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 33/123 (26%), Positives = 64/123 (52%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            VL  +D+ +++ VI   L+    +   V++G  A +Y+  D            V L++TD
Sbjct: 996  VLVAEDNPINQSVISMQLRELGIEPVIVNNGREAWEYINQDEN----------VVLLLTD 1045

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
            + MP M GYEL+K ++ +S  + +P++ +++E      +   + G  + L KP  L+ +K
Sbjct: 1046 FHMPEMDGYELIKHVR-ASGFKSLPIIGVTAEDARLASERTQDIGIDDVLYKPYDLNKLK 1104

Query: 258  RVV 250
             V+
Sbjct: 1105 TVL 1107



>gb:AL646060_545597 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 4/19.
          Length = 122

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 30/119 (25%), Positives = 61/119 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDDS  +   + ++L  +  KV+           +  D +++ A  +G   +L++ D
Sbjct: 6   ILVVDDSPTEALFLSEILSKNGFKVS-----------VAADSDQAMAKLEGEPFDLVLMD 54

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
             MPG  GY+  + IK     + IPV+I +++ +       + +GA ++++KPVK  ++
Sbjct: 55  VVMPGQNGYQATRAIKKDDRFKDIPVIICTTKGLETDRVWGMRQGASDYIVKPVKAEEL 113



>gb:AF069392_475827 Vibrio parahaemolyticus polar flagellar and
           chemotaxis genes, complete cds; and unknown
           genes.>gb:BA000031_707691 Vibrio parahaemolyticus RIMD
           2210633 DNA, chromosome 1, complete sequence.
          Length = 126

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 32/131 (24%), Positives = 66/131 (50%), Gaps = 1/131 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           + + +L VDD    R++++ +L+ +        D G  AL  L                +
Sbjct: 3   KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGD-----------FD 51

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVK 274
            ++TD++MPGM G +LLK I+  + L+ +PV+++++E    +I    + G   +++KP  
Sbjct: 52  FVVTDWNMPGMQGIDLLKHIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFT 111

Query: 273 LSDVKRVVDFI 241
            + +K  ++ I
Sbjct: 112 AATLKEKLEKI 122



>gb:AE017311_438935 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 3 of 12 of the complete
           genome.>gb:AE017285_1072096 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 667

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 41/149 (27%), Positives = 65/149 (43%), Gaps = 3/149 (2%)
 Frame = -2

Query: 684 PEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYL 505
           P + A     S+T   G R L VL VDD    R +  KML+           G+ ALQ L
Sbjct: 389 PSEHAQAPTSSATPASGARPLRVLVVDDDATGRTITCKMLRKRGHVCACAHDGATALQRL 448

Query: 504 GLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGS---SALRQIPVVIMSSEKIL 334
             D           + +L++ D  M  M G ELL++I+ +      R IPVV +++  + 
Sbjct: 449 TAD-----------RFDLVLLDVKMHPMGGLELLRRIRNAQYPGVDRNIPVVAVTAHALK 497

Query: 333 ARIDSCLEEGAKEFLMKPVKLSDVKRVVD 247
              +  L  G  +++ KP+       ++D
Sbjct: 498 GDRERFLASGMTDYIAKPINARAFNAMLD 526



>gb:AE017180_399337 Geobacter sulfurreducens PCA, complete genome.
          Length = 513

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 33/128 (25%), Positives = 60/128 (46%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDD  V RK++  +  +S  +V   + G+RA++               L  +L++ D
Sbjct: 23  ILLVDDDAVTRKMLRNLFTLSGYRVADAEDGARAVEMFR-----------ELSPDLVLLD 71

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MP M GY     I+G      +P++IM++      I    + GA +F+ KPV    + 
Sbjct: 72  IMMPVMDGYGACAAIRGLPGGEHVPIIIMTALDDANSIGRAFDAGATDFIEKPVNWMLLN 131

Query: 258 RVVDFIVR 235
             + +++R
Sbjct: 132 HRLPYLLR 139



>gb:AE013598_296323 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 130

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 31/117 (26%), Positives = 61/117 (52%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           + + +L VDD    R++++ +L       TA             DG  + AA      + 
Sbjct: 3   KNMRILIVDDFSTMRRIVKNLLGDLGFTNTAEAE----------DGNSALAALRAGPFDF 52

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           ++TD++MPGMTG +LL+ I+  + L+ +PV+++++E    +I    + G   +++KP
Sbjct: 53  VVTDWNMPGMTGIDLLRNIRADAKLKHLPVMMVTAEAKREQIIEAAQCGVNGYIIKP 109



>pir|AD2215|AD2215 two-component hybrid sensor and regulator all3275
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_684264 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 889

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 40/139 (28%), Positives = 70/139 (50%), Gaps = 2/139 (1%)
 Frame = -2

Query: 684  PEKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYL 505
            P+K+  V    +T+  GG  L++L VDD     + +  ML+ S  +VTAV S   AL+ +
Sbjct: 738  PQKVPQVGQPDNTWSLGG--LYILVVDDDVDTGEFLTLMLEQSGAEVTAVTSAGEALEVI 795

Query: 504  GLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALR--QIPVVIMSSEKILA 331
                          KV+L+++D  MPG+ GY L++ I+   + +  +IP + +++     
Sbjct: 796  ART-----------KVDLLLSDIGMPGIDGYMLMQLIRAMPSAKGGKIPAIALTAYAGEI 844

Query: 330  RIDSCLEEGAKEFLMKPVK 274
                 L  G +  L+KPV+
Sbjct: 845  NQKQALAAGFQLHLVKPVE 863



>pir|AB2196|AB2196 two-component hybrid sensor and regulator alr3121
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_684110 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 382

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 33/128 (25%), Positives = 64/128 (50%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L +DD   +  VIE +L      +  V SG  A+  L L            + +LI+ D
Sbjct: 6   ILVIDDLPDNFDVIETLLSEQDYTLHYVASGQEAIASLNL-----------FQPDLILLD 54

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MPGM G E+ ++IK     + +P++++++      +  CL+ GA +F+ KP+   +++
Sbjct: 55  VMMPGMDGIEVCQRIKAMPQWQPVPIIMVTALTAKEDLARCLQSGADDFISKPINALELR 114

Query: 258 RVVDFIVR 235
             +  ++R
Sbjct: 115 ARLHSMLR 122



>pir|E87322|E87322 chemotaxis protein CheYII [imported] -
           Caulobacter crescentus>gb:AE005733_74607 Caulobacter
           crescentus CB15 section 59 of 359 of the complete
           genome.>gb:AE005673_921639 Caulobacter crescentus CB15
           complete genome.
          Length = 127

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 30/124 (24%), Positives = 64/124 (51%), Gaps = 1/124 (0%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           +L VDD     K++  +L+ +    +   ++G  AL+ L     +           L+++
Sbjct: 8   ILVVDDYKTTIKIVHGLLRQLGFTNLDEAENGEEALRKLRTQSYQ-----------LVIS 56

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
           D++M  MTG ELL+ ++  SALR  P +++++E  +  + +  + GA  +++KP     +
Sbjct: 57  DWNMEPMTGIELLRSVRADSALRATPFIMITAESKVENVVAAKQAGANNYIVKPFSAEAL 116

Query: 261 KRVV 250
           K+ +
Sbjct: 117 KQKI 120



>gb:AY456037_1607122 Gibberella moniliformis putative histidine kinase
            HHK5p (HHK5) gene, complete cds.
          Length = 1150

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 39/145 (26%), Positives = 70/145 (48%), Gaps = 1/145 (0%)
 Frame = -2

Query: 681  EKIAAVDGCSSTFGGGGRELHVLAVDDSYVDRKVIEKMLKIS-CCKVTAVDSGSRALQYL 505
            +K+A +D   ++ G  GR L VL  DD+  + +V+ +MLK+     VT    G  A   +
Sbjct: 969  QKMAEIDRAIASKGDQGR-LRVLVADDNSTNIEVVSRMLKLEDVYDVTIAKDGQEAYDLV 1027

Query: 504  GLDGEESSAATDGLKVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARI 325
                E++ A       ++I  D  MP + G +  + I+       I  +   SE+  + +
Sbjct: 1028 KATMEKNQA------FDVIFMDVQMPNLDGLQSTRLIREMGYTSPIVALTAFSEE--SNV 1079

Query: 324  DSCLEEGAKEFLMKPVKLSDVKRVV 250
              C++ G  EFL KP++   +K+V+
Sbjct: 1080 KECIDSGMDEFLAKPIRRPALKQVL 1104



>gb:CP000021_873763 Vibrio fischeri ES114 chromosome II, complete
           sequence.
          Length = 299

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 30/113 (26%), Positives = 60/113 (53%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L  +D  V R V++++LK   C   +V +G  AL  +  +           +++L++ D
Sbjct: 7   ILIAEDEPVSRLVLQRLLKAFTC--ISVTNGQEALDVIHQE-----------RIDLVLLD 53

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
             MP M G+E+++K+K S   + IP+++++  +        L+ GA +F+ KP
Sbjct: 54  IHMPIMGGFEVIEKLKNSETTKDIPIIVITVNQSTEDEIRALDLGAVDFVTKP 106



>gb:BA000040_734911 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 256

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 38/130 (29%), Positives = 68/130 (52%), Gaps = 1/130 (0%)
 Frame = -2

Query: 621 HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
           ++L V+D    R +I K L+ + C VTAV            DG E S A    +V+LI+ 
Sbjct: 7   NILVVEDDRETRTLIAKYLRNNACNVTAVS-----------DGREMSRAMADHRVDLIIL 55

Query: 441 DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSE-KILARIDSCLEEGAKEFLMKPVKLSD 265
           D  +PG  G  L +K++  +   Q P++++++  + + RI   LE GA ++L KP    +
Sbjct: 56  DVMLPGEDGLSLCRKVRSEA---QTPIIMLTARGEDVDRIVG-LEMGADDYLTKPFNPRE 111

Query: 264 VKRVVDFIVR 235
           +   ++ ++R
Sbjct: 112 LLARINAVLR 121



>gb:BA000040_730454 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 121

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/112 (33%), Positives = 57/112 (50%)
 Frame = -2

Query: 615 LAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTDY 436
           L VDDS V RKV  ++L+    ++   + G +AL+          A   GL  + ++ D+
Sbjct: 5   LVVDDSSVIRKVARRILEGLDFQILEAEDGEKALE----------ACKRGLP-DAVLLDW 53

Query: 435 SMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           +MP M GYE L  ++      Q  VV  ++E  +A I   L  GA E++MKP
Sbjct: 54  NMPVMDGYEFLGHLRRMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKP 105



>gb:BA000038_724672 Vibrio vulnificus YJ016 DNA, chromosome II,
            complete sequence.
          Length = 1072

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 29/116 (25%), Positives = 61/116 (52%)
 Frame = -2

Query: 624  LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
            L VL  +D+ +++++  ++++ +   VT  ++G  AL +L       + A      ++I 
Sbjct: 695  LKVLLTEDNEINQQIAVELMEGNGLLVTVANNGQEALDHL------EAMAKGESHFDIIF 748

Query: 444  TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
             D  MP M GYE   +I+ +S+   IP++ M++  ++   + CL  G  + + KP+
Sbjct: 749  MDLQMPVMDGYEASHRIRANSSYDTIPLIAMTAHAMVEERERCLNLGMNDHISKPI 804



>gb:AY216911_598362 Vibrio parahaemolyticus bvg-like sensory locus,
            complete sequence.
          Length = 1221

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 33/123 (26%), Positives = 64/123 (52%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            VL  +D+ +++ VI   L+    +   V++G  A +Y+  D            V L++TD
Sbjct: 996  VLVAEDNPINQSVISMQLRELGIEPVIVNNGREAWEYINQDEN----------VVLLLTD 1045

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
            + MP M GYEL+K ++ +S  + +P++ +++E      +   + G  + L KP  L+ +K
Sbjct: 1046 FHMPEMDGYELIKHVR-ASGFKSLPIIGVTAEDARLANERTQDIGIDDVLYKPYDLNKLK 1104

Query: 258  RVV 250
             V+
Sbjct: 1105 TVL 1107



>gb:AE017314_439844 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 6 of 12 of the complete
           genome.>gb:AE017285_1073005 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 120

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/123 (30%), Positives = 65/123 (52%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +++VDDS   R+++   L+ +  +V     G  AL      G+ S        V +++TD
Sbjct: 5   IMSVDDSASIRQMVGFTLRNAGYEVIEASDGKDAL------GKLSGP------VKMVITD 52

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
            +MP M G EL+++I+ + A + IPVV++++E   AR       GA  +++KP K   + 
Sbjct: 53  LNMPNMDGIELIRRIRATPAYKFIPVVMLTTESQAARKQEGKAAGATGWIVKPFKPEQLL 112

Query: 258 RVV 250
            VV
Sbjct: 113 AVV 115



>gb:AE016919_357604 Chromobacterium violaceum ATCC 12472 section 10 of
            16 of the complete genome.>gb:AE016825_1042758
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 1436

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 38/131 (29%), Positives = 66/131 (50%)
 Frame = -2

Query: 639  GGGRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLK 460
            G  +   +L V+D+ ++++V   +L+ +  +V  V++G  A++ L   G E +       
Sbjct: 1183 GNLKPARILLVEDNPINQQVACGLLQQAGMQVETVENGRLAVEVLRERGGEYA------- 1235

Query: 459  VNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
              L++ D  MP M G      I+G   L Q+P+V MS+    A    CL  G  EF+ KP
Sbjct: 1236 --LVLMDRQMPEMDGDTAAALIRGELGL-QLPIVAMSAGLSPAERSECLRAGMDEFIAKP 1292

Query: 279  VKLSDVKRVVD 247
            ++L  +  V+D
Sbjct: 1293 IQLDRLYAVLD 1303



>gb:AE016911_355433 Chromobacterium violaceum ATCC 12472 section 2
           of 16 of the complete genome.>gb:AE016825_1040587
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 297

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 32/113 (28%), Positives = 59/113 (52%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDD   + +++ ++L+ +  +    ++G  A   L  +GE+ S          ++ D
Sbjct: 5   LLLVDDEPFNLELMAELLQDAGYETRQAENGEIAWDILSQEGEQYST---------VLLD 55

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
             MPGM+G+++LKKIK    L  +PV++ ++    A +   L  GA  +L KP
Sbjct: 56  KMMPGMSGFDVLKKIKAEPRLEFLPVIMQTAMGAAASVQEGLAAGAFYYLTKP 108



>gb:AE012294_281150 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 202 of 460 of the complete
           genome.>gb:AE008922_914432 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 126

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 31/115 (26%), Positives = 60/115 (52%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + +L VDD    R++++ +L       TA             DG  + AA      + ++
Sbjct: 1   MRILIVDDFSTMRRIVKNLLADLGFTNTAEAE----------DGNSALAALRAGPFDFVV 50

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           TD++MPGMTG +LL+ I+  + L+ +PV+++++E    +I    + G   +++KP
Sbjct: 51  TDWNMPGMTGIDLLRNIRADAKLKHLPVMMVTAEAKREQIIEAAQCGVNGYIIKP 105



>pir|AI2195|AI2195 two-component hybrid sensor and regulator alr3120
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_684109 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1286

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = -2

Query: 510  YLGLDGEESSAATDGLKV---------NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVV 358
            YL   G +   AT+G +          +LI+ D  MPG+ G E +++I+    L  IP+V
Sbjct: 1182 YLSAKGYDILLATNGQQAIELATIHQPDLILMDIQMPGIDGLEAIRQIRLDPQLVNIPIV 1241

Query: 357  IMSSEKILARIDSCLEEGAKEFLMKPVKLSDVKRVV 250
             +++  +    D CL+ GA ++L KPVKL  +   +
Sbjct: 1242 ALTALAMTGDRDRCLQAGANDYLTKPVKLKQLATTI 1277



>pir|B96032|B96032 probable two-component response regulator protein
           SMb20610 [imported] - Sinorhizobium meliloti (strain
           1021) magaplasmid pSymB>gb:RME591985_166170
           Sinorhizobium meliloti 1021 complete pSymB.
          Length = 309

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 33/120 (27%), Positives = 59/120 (49%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           VL VDDS      + + L+ S   V    SG+ AL              D +  ++I+ D
Sbjct: 13  VLLVDDSPEALGFLTEALEQSGFSVLIATSGNAALNI-----------ADRITPDIILLD 61

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MPGM G++   ++K ++++ Q+PVV M+       +   LE G  ++L KP+ + +++
Sbjct: 62  AVMPGMDGFDTCTRLKANASVAQVPVVFMTGLTETEHVVRALEAGGVDYLTKPINIDELR 121



>pir|D75276|D75276 response regulator - Deinococcus radiodurans
           (strain R1)>gb:AE002072_42663 Deinococcus radiodurans R1
           section 209 of 229 of the complete chromosome
           1.>gb:AE000513_883558 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 148

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 35/120 (29%), Positives = 64/120 (53%), Gaps = 2/120 (1%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCC--KVTAVDSGSRALQYLGLDGEESSAATDGLKV 457
           R + +L V+DS  D  + E+    +    ++  V  G  ALQ+L  +GE + A     + 
Sbjct: 7   RTIEILLVEDSEPDILLTEEAFSEARVPNRLHIVRDGEEALQFLRREGEHAQAP----RP 62

Query: 456 NLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
           ++I+ D +MP   G E+L++IK  + LR IPV+I+++ +    +       A  +++KPV
Sbjct: 63  DVILMDINMPRKNGLEVLEEIKADADLRSIPVLILTTSQAEDDVRRSYSGHASSYVVKPV 122



>pir|AF1922|AF1922 two-component system, regulatory protein all0929
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_681920 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 121

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/129 (27%), Positives = 65/129 (50%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           VL V+DS   R++I  +LK S   VT    G  AL+ +  +  +           L++ D
Sbjct: 4   VLIVEDSLAQREMITDLLKASGLTVTHATDGLEALEAIKEEPPD-----------LVVLD 52

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MP M GYE+ +++K     + +PVV+ SS+         +++GA  ++ KP + +++ 
Sbjct: 53  IVMPKMNGYEVCRRLKSDPKTQNVPVVMCSSKGEEFDRYWGMKQGADAYIAKPFQPTELV 112

Query: 258 RVVDFIVRG 232
             V  ++RG
Sbjct: 113 GTVKQLLRG 121



>pir|B69158|B69158 sensory transduction regulatory protein -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000828_28147 Methanobacterium
           thermoautotrophicum from bases 372599 to 383542 (section
           34 of 148) of the complete genome.>gb:AE000666_925229
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 145

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 2/120 (1%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKIS--CCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           +L V+D+  D ++  + LK +    K+  V  G+ AL Y+   G  S    + L   LI+
Sbjct: 7   ILLVEDNPTDAELTIRALKKNNLANKLHWVKDGAEALDYIFASGSYSDRDPENLP-KLIL 65

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
            D  MP + G E+L++IK + +  +IPVV+++S K    I    + G   ++ KPV+  +
Sbjct: 66  LDLRMPKVDGLEVLQEIKRNDSTSKIPVVVLTSSKEDRDIVESYKLGVNSYVSKPVEFDE 125



>pir|S74913|S74913 sensory transduction system regulatory protein
           slr1400 - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_687732 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 380

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 31/128 (24%), Positives = 66/128 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L  DD   +  VI+ +L     ++   DSG RA+  L           D  + +L++ D
Sbjct: 6   LLVADDDPDNFDVIDALLADQGYELNYADSGQRAIDNL-----------DTFQPDLLLLD 54

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             MPG++G E+ + I+ S+    +P++++++      + +CL  GA +F+ KP+   +++
Sbjct: 55  VMMPGLSGVEVCRMIRASARWHALPIIMVTALDSKLSLANCLAAGADDFISKPLNGLELQ 114

Query: 258 RVVDFIVR 235
             +  ++R
Sbjct: 115 ARIQAMLR 122



>gb:AP007226_1863314 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0036B04.
          Length = 696

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 35/130 (26%), Positives = 68/130 (52%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + VLAVDD  V  KV+E +L+     VT+ +    AL+ L  + +           +L++
Sbjct: 26  MRVLAVDDDPVCLKVLETLLRRCQYHVTSTNQAITALKLLRENRD---------MFDLVI 76

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D  MP M G++LL+ +        +PV+++S       +   +  GA ++L+KPV++ +
Sbjct: 77  SDVHMPDMDGFKLLELV---GLEMDLPVIMLSVNGETKTVMKGITHGACDYLLKPVRIEE 133

Query: 264 VKRVVDFIVR 235
           ++ +   +VR
Sbjct: 134 LRNIWQHVVR 143



>gb:BX572593_799759 Rhodopseudomonas palustris CGA009 complete
           genome; segment 1/16.
          Length = 121

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 39/128 (30%), Positives = 63/128 (49%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDDS   R++I         KVT   +G   ++    DG +  +     KV+L++TD
Sbjct: 4   ILTVDDSPSIRQMI---------KVTLEPAGHSVVE--AGDGAQGLSKAQATKVDLVITD 52

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
            +MP M G EL+K ++    L  +P+V +++E   A        GA  ++ KP K   + 
Sbjct: 53  LNMPVMNGLELIKALRKQPNLVGLPIVFLTTESNDAVKQEAKSCGATGWITKPFKPEQLL 112

Query: 258 RVVDFIVR 235
            VV  +VR
Sbjct: 113 SVVSKLVR 120



>gb:BX571869_787906 Photorhabdus luminescens subsp. laumondii TTO1
            complete genome; segment 11/17.
          Length = 938

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 31/123 (25%), Positives = 61/123 (49%)
 Frame = -2

Query: 618  VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
            VL VDD  ++R+++   LK    +    + G  AL+YL   G           +++I+TD
Sbjct: 825  VLVVDDHPINRRLLADQLKSIGFQTAMANDGLDALEYLKSGG-----------IDIILTD 873

Query: 438  YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDVK 259
             +MP M GY L   ++      ++P++ +++  +      C++ G  + L KPV L  ++
Sbjct: 874  VNMPNMDGYALTMYLRNDGC--KLPIIGITANALAEEKQRCIDAGMDDCLSKPVSLVTLR 931

Query: 258  RVV 250
            + +
Sbjct: 932  QTL 934



>gb:BX321862_774251 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 7/10.
          Length = 131

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 32/118 (27%), Positives = 61/118 (51%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           + L  L VDD    R++I  +LK +    V   + G+ AL+ L   G            +
Sbjct: 4   KNLRFLVVDDFSTMRRIIRNLLKELGFNNVEEAEDGAMALKKLRDGG-----------FD 52

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G  +L+ ++   AL+ IPV+++++E     I +  + GA  +++KP
Sbjct: 53  FVVSDWNMPNMDGLTMLQNVRADDALKDIPVLMVTAEAKKENIIAAAQAGASGYIVKP 110



>gb:AE017312_439245 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 4 of 12 of the complete
           genome.>gb:AE017285_1072406 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 320

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = -2

Query: 633 GRELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYL---GLDGEESSAATDGL 463
           G   HVL  DDS   R +I   L+ +  +VT   SG  A   L     D EE     + +
Sbjct: 182 GEPDHVLIADDSASIRNMIGNTLEKAGYRVTRTASGREAWNVLLGYRRDAEERKVPVNDI 241

Query: 462 KVNLIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMK 283
            V L+++D  MP M G+ L + IK  S L+++PVV+ SS    A        GA + + K
Sbjct: 242 -VQLVISDIEMPEMDGHTLTRNIKDDSILQRLPVVLFSSLITDALRHKGESVGADDQISK 300

Query: 282 PVKLSDVKRVVDFIVR 235
           P      +RV   I +
Sbjct: 301 PDLPMLTERVAGLIAK 316



>gb:AE016922_358407 Chromobacterium violaceum ATCC 12472 section 13
           of 16 of the complete genome.>gb:AE016825_1043561
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 317

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGL--KVN 454
           E  +   DDS V RK IE+ L+    K T+  +G R  + L    +++ AA   L  +++
Sbjct: 181 ERRIFFADDSAVARKQIERTLEAMNIKYTSAINGMRGWEDLQKMAQQAEAAGRKLSDELH 240

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSS 346
           L++TD  MP M GY L K IK       IPV++ SS
Sbjct: 241 LVLTDVEMPEMDGYMLTKMIKSDPRFAGIPVLMHSS 276



>gb:AE016808_337843 Vibrio vulnificus CMCP6 chromosome II section 1 of
            6 of the complete sequence.>gb:AE016796_1047567 Vibrio
            vulnificus CMCP6 chromosome II complete sequence.
          Length = 1072

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 29/117 (24%), Positives = 64/117 (54%), Gaps = 1/117 (0%)
 Frame = -2

Query: 624  LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYL-GLDGEESSAATDGLKVNLI 448
            L VL  +D+ +++++  ++++ +   VT  ++G  AL++L  ++  ES         +++
Sbjct: 695  LKVLLTEDNEINQQIAVELMEGNGLLVTVANNGQEALEHLEAMEKGESH-------FDIV 747

Query: 447  MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
              D  MP M GYE   +I+ +S+   IP++ M++  ++   + CL  G  + + KP+
Sbjct: 748  FMDLQMPVMDGYEASHRIRANSSYDTIPLIAMTAHAMVEERERCLNLGMNDHISKPI 804



>gb:AE015782_317789 Shewanella oneidensis MR-1 section 331 of 457 of
            the complete genome.>gb:AE014299_953386 Shewanella
            oneidensis MR-1 complete genome.
          Length = 929

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 36/128 (28%), Positives = 63/128 (49%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            + L VLAVDD++ + K+I+ +L      V AV+SG  A++       ++   T     +L
Sbjct: 674  QSLTVLAVDDNFANLKLIDTLLNELVTTVIAVNSGEEAVK-------QAKTRT----FDL 722

Query: 450  IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
            I  D  MPG  G    K+I+  S  R  P++ +++  I    +  L  G   +L KP+  
Sbjct: 723  IFMDIQMPGTDGISATKQIRQGSMNRNTPIIAVTAHAIAEERELILGSGMDGYLPKPIDE 782

Query: 270  SDVKRVVD 247
            + +K  ++
Sbjct: 783  AALKAEIN 790



>gb:AE011828_276865 Xanthomonas axonopodis pv. citri str. 306,
           section 206 of 469 of the complete
           genome.>gb:AE008923_918640 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 126

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 31/115 (26%), Positives = 60/115 (52%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + +L VDD    R++++ +L       TA             DG  + AA      + ++
Sbjct: 1   MRILIVDDFSTMRRIVKNLLGDLGFTNTAEAE----------DGNSALAALRAGPFDFVV 50

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           TD++MPGMTG +LL+ I+  + L+ +PV+++++E    +I    + G   +++KP
Sbjct: 51  TDWNMPGMTGIDLLRNIRADAKLKHLPVMMVTAEAKREQIIEAAQCGVNGYIIKP 105



>gb:U93704_207944 Riftia pachyptila endosymbiont bacterioferritin
           comigratory protein homolog (bcp), sensor protein RssA
           (rssA) and regulatory protein RssB (rssB) genes,
           complete cds.
          Length = 773

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 31/126 (24%), Positives = 66/126 (52%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + +L VD++  +   +  +L+    +VTA   G   L+ L    EES  A       + +
Sbjct: 651 VRLLLVDNNLNNLLALTPLLEGWGLEVTAAGDGDEVLETLN---EESDFA-------ITL 700

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
            D  M GM GY+ +++I+  +    + ++ ++++      + CLE GA +F+ KP+++ +
Sbjct: 701 VDTMMLGMDGYDTIRRIREEARFSAMAIIALTADTTAEDRERCLEVGADDFISKPIEMEE 760

Query: 264 VKRVVD 247
           +K V++
Sbjct: 761 LKTVIE 766



>gb:CR555306_106351 Azoarcus sp. EbN1 complete genome.
          Length = 121

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 32/114 (28%), Positives = 59/114 (51%)
 Frame = -2

Query: 618 VLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMTD 439
           +L VDDS  +R  + ++L     +V   ++G           E++ A +     +LI+ D
Sbjct: 6   ILVVDDSPTERFALTELLSARGYQVVTAENG-----------EDAIAKSKSEMPDLILMD 54

Query: 438 YSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPV 277
             MPG+ GY+  + I  S + R IP++I +S+ +       + +GA ++L+KPV
Sbjct: 55  VVMPGINGYQATRMIARSESTRSIPIIICTSKGLETDRIWGMRQGAHDYLVKPV 108



>gb:AB040876_6590 Enterobacter cloacae cheR, cheB, cheY, cheZ genes,
           complete cds.
          Length = 129

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 4   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG-----------FG 52

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELLK I+  + +  +PV+++++E     I +  + GA  +++KP
Sbjct: 53  FVISDWNMPNMDGLELLKTIRADAGMASMPVLMVTAEAKKENIIAAAQAGASGYVVKP 110



>pir|A82174|A82174 sensory box sensor histidine kinase/response
            regulator VieS VC1653 [imported] - Vibrio cholerae
            (strain N16961 serogroup O1)>gb:AE004243_52034 Vibrio
            cholerae O1 biovar eltor str. N16961 chromosome I,
            section 151 of 251 of the complete
            chromosome.>gb:AE003852_1052808 Vibrio cholerae O1 biovar
            eltor str. N16961 chromosome I, complete chromosome.
          Length = 1146

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 34/124 (27%), Positives = 62/124 (50%)
 Frame = -2

Query: 621  HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
            HVL  DD  ++R +I+K L       T V  G +A + L    E+          +L++T
Sbjct: 919  HVLVADDDAINRLLIKKQLSELGLSATLVSDGLQAFEKLSQHPEQ---------YDLLIT 969

Query: 441  DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
            D  MP + G+ L +K+K   +L +  VV  ++E      +  L+ G  + + KP  L+++
Sbjct: 970  DCHMPHLDGFALTRKVKQEISLFKGAVVGCTAEDSRLAAEQALQAGMDKVIYKPYTLANL 1029

Query: 261  KRVV 250
            ++V+
Sbjct: 1030 RKVL 1033



>pir|T09112|T09112 probable sensor kinase VieS - Vibrio
            cholerae>gb:AF031552_471020 Vibrio cholerae magnesium
            transporter (mgtE) gene, partial cds; sensor kinase
            (vieS), response regulator (vieA), and response regulator
            (vieB) genes, complete cds; and collagenase (vcc) gene,
            partial cds.
          Length = 1146

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 34/124 (27%), Positives = 62/124 (50%)
 Frame = -2

Query: 621  HVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIMT 442
            HVL  DD  ++R +I+K L       T V  G +A + L    E+          +L++T
Sbjct: 919  HVLVADDDAINRLLIKKQLSELGLSATLVSDGLQAFEKLSQHPEQ---------YDLLIT 969

Query: 441  DYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSDV 262
            D  MP + G+ L +K+K   +L +  VV  ++E      +  L+ G  + + KP  L+++
Sbjct: 970  DCHMPHLDGFALTRKVKQEISLFKGAVVGCTAEDSRLAAEQALQAGMDKVIYKPYTLANL 1029

Query: 261  KRVV 250
            ++V+
Sbjct: 1030 RKVL 1033



>sp|Q9FAD7|CHEY_ENTCL Chemotaxis protein cheY.
          Length = 128

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLK-ISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVN 454
           +EL  L VDD    R+++  +LK +    V   + G  AL  L   G             
Sbjct: 3   KELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGG-----------FG 51

Query: 453 LIMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
            +++D++MP M G ELLK I+  + +  +PV+++++E     I +  + GA  +++KP
Sbjct: 52  FVISDWNMPNMDGLELLKTIRADAGMASMPVLMVTAEAKKENIIAAAQAGASGYVVKP 109



>sp|P71129|CHEY_CAMJE Chemotaxis protein cheY
           homolog.>pir|A81316|A81316 chemotaxis regulatory protein
           Cj1118c [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X4_847492 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           4/6.>gb:CJU75208_848413 Campylobacter jejuni response
           regulator protein (cheY) gene, complete
           cds.>gb:CJY11648_848432 Campylobacter jejuni waaC, galE,
           wla[B,C,D,E,F,G,H,I,K,L,M], cheY genes and
           orf1.>gb:CP000025_879002 Campylobacter jejuni RM1221,
           complete genome.
          Length = 130

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 1/116 (0%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKML-KISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           + +L VDDS   R++I+  L ++    V   + G  A   L          T    V ++
Sbjct: 1   MKLLVVDDSSTMRRIIKNTLTRLGHDDVLEAEHGVEAWDLL----------TKNEDVKVL 50

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKP 280
           +TD++MP M G EL+KK++       +P++++++E   A + + L+ G   +++KP
Sbjct: 51  ITDWNMPEMNGLELVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKP 106



>gb:AY456021_1607106 Cochliobolus heterostrophus putative histidine
            kinase HHK18p (HHK18) gene, complete cds.
          Length = 1159

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 31/127 (24%), Positives = 67/127 (52%), Gaps = 4/127 (3%)
 Frame = -2

Query: 630  RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
            ++LHVL V+D+ V+++V+ K L+ +   VT  + G  A+++L       S  + G  ++L
Sbjct: 1020 KDLHVLIVEDNLVNQRVLAKQLRNTGMHVTVANHGGEAIEHLHTTNYCVSDGS-GKPLSL 1078

Query: 450  IMTDYSMPGMTGYELLKKIKG----SSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMK 283
            I+ D+ MP M G   ++ I+           +PV+ +++     +++  L+ G    + K
Sbjct: 1079 ILMDWEMPVMDGLTCVRNIRDLQRKGVVTAHVPVIAVTANVRSEQVEVALKAGMDNVISK 1138

Query: 282  PVKLSDV 262
            P ++ ++
Sbjct: 1139 PFRIPEL 1145



>gb:AY371288_1603051 Mesembryanthemum crystallinum timing of CAB
           expression 1 (TOC1) mRNA, complete cds.
          Length = 544

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 29/122 (23%), Positives = 67/122 (54%)
 Frame = -2

Query: 627 ELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLI 448
           ++ +L  D+     + +  +L     +VTAV S  + +  L  +G +         +++I
Sbjct: 28  KVRILLCDNDSKSCEEVFGLLSNCSYQVTAVRSARQVIDALNAEGPD---------IDII 78

Query: 447 MTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLS 268
           +++  +P   G ++LK I     L++IPV++MS++  ++ +  CL  GA ++L+KP++ +
Sbjct: 79  LSEVDLPTKKGLKMLKYIMRDRDLQRIPVIMMSTQDEVSLVVKCLRLGAADYLVKPLRTN 138

Query: 267 DV 262
           ++
Sbjct: 139 EM 140



>gb:CP000025_879398 Campylobacter jejuni RM1221, complete genome.
          Length = 226

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 33/131 (25%), Positives = 68/131 (51%)
 Frame = -2

Query: 630 RELHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNL 451
           +EL +L V+D    R+ +  +L     KV    +G   L+                K +L
Sbjct: 6   KELIILVVEDEVKARESMINILSERFSKVIGAQNGDEGLKKF-----------KKFKPDL 54

Query: 450 IMTDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKL 271
           ++TD +MP M G ++ ++IK  S    +P+V++S+     R+   ++ G  ++L+KPV +
Sbjct: 55  VITDIAMPIMDGLDMAREIKEISD--DVPIVVLSAYSEKERLLRSIDIGIDKYLIKPVDI 112

Query: 270 SDVKRVVDFIV 238
            ++ +V+D+++
Sbjct: 113 EELFKVLDYLI 123



>gb:BX572596_800790 Rhodopseudomonas palustris CGA009 complete
           genome; segment 4/16.
          Length = 131

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 32/128 (25%), Positives = 63/128 (49%)
 Frame = -2

Query: 624 LHVLAVDDSYVDRKVIEKMLKISCCKVTAVDSGSRALQYLGLDGEESSAATDGLKVNLIM 445
           + VL VDD     ++I  +LK        +D  S        DG  + A     K  L++
Sbjct: 7   MSVLVVDDYSTMIRIIRNLLKQ--LGFENIDDAS--------DGSAALAKMRTKKYGLVI 56

Query: 444 TDYSMPGMTGYELLKKIKGSSALRQIPVVIMSSEKILARIDSCLEEGAKEFLMKPVKLSD 265
           +D++M  MTGY+LLK+++    L Q P +++++E     + +  + G   +++KP   + 
Sbjct: 57  SDWNMEPMTGYDLLKEVRADPNLSQTPFIMITAESKTENVIAAKKAGVNNYIVKPFNAAT 116

Query: 264 VKRVVDFI 241
           +K  ++ +
Sbjct: 117 LKTKIEAV 124


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 681,389,121
Number of Sequences: 1806583
Number of extensions: 12771502
Number of successful extensions: 37368
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 35201
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36473
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 39798953635
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)