BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7302
         (884 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB126259_1528262 Nicotiana tabacum mRNA for aspartate aminotr...   372   e-102   
gb:AF029898_1762438 Lotus corniculatus aspartate aminotransferas...   358   8e-98   
gb:ATAAT1_1542716 A.thaliana aat1 mRNA.>gb:ATASP5GEN_1544088 A.t...   355   6e-97   
sp|P46248|AAT5_ARATH|AAT5_ARATH Aspartate aminotransferase, chloroplast pre...   355   6e-97   Arabidopsis thaliana [mouse-ear cress]
gb:AY084314_1569406 Arabidopsis thaliana clone 103854 mRNA, comp...   352   7e-96   
pir|S46316|S46316 aspartate transaminase (EC 2.6.1.1) - alfalfa>...   351   1e-95   Medicago sativa [alfalfa]
pir|S33528|S33528 aspartate transaminase (EC 2.6.1.1) AAT5 precu...   350   3e-95   Glycine max [soybeans]
gb:AF315376_1785415 Phaseolus vulgaris aspartate aminotransferas...   349   4e-95   
pir|S22465|XNYLB aspartate transaminase (EC 2.6.1.1) precursor -...   348   8e-95   
sp|P26563|AATM_LUPAN|AATM_LUPAN Aspartate aminotransferase-P2, mitochondria...   348   8e-95   Lupinus angustifolius
gb:AP003975_1835824 Oryza sativa (japonica cultivar-group) genom...   346   3e-94   
gb:S60967_1704337 Glycine max aspartate aminotransferase isozyme...   346   3e-94   
gb:AY157306_1585424 Oryza sativa aspartate aminotransferase mRNA...   346   3e-94   
pir|S65675|S65675 aspartate transaminase (EC 2.6.1.1) - proso mi...   346   4e-94   Panicum miliaceum [broom millet]
gb:CLU89494_1647911 Canavalia lineata aspartate aminotransferase...   337   1e-91   
pir|S39925|S39925 aspartate transaminase (EC 2.6.1.1) chain 2a, ...   336   4e-91   Medicago sativa [alfalfa]
pir|S39928|S39928 aspartate transaminase (EC 2.6.1.1) chain 2c, ...   335   5e-91   Medicago sativa [alfalfa]
pir|S39927|S39927 aspartate transaminase (EC 2.6.1.1) chain 2a, ...   335   9e-91   Medicago sativa [alfalfa]
pir|S39926|S39926 aspartate transaminase (EC 2.6.1.1) chain 2c, ...   333   2e-90   Medicago sativa [alfalfa]
gb:CLJ001360_1647848 Canavalia lineata gene for aspartate aminot...   322   6e-87   
gb:AP003274_1826970 Oryza sativa (japonica cultivar-group) genom...   236   3e-61   
sp|P37833|AATC_ORYSA|AATC_ORYSA Aspartate aminotransferase, cytoplasmic (EC...   236   3e-61   Oryza sativa [red rice]
gb:AF034210_1762765 Glycine max aspartate aminotransferase glyox...   233   4e-60   
gb:AY128343_1580642 Arabidopsis thaliana aspartate aminotransfer...   233   4e-60   
gb:ATU15033_1556773 Arabidopsis thaliana aspartate aminotransfer...   233   4e-60   
pir|T06136|T06136 aspartate transaminase (EC 2.6.1.1) AAT1 perox...   233   4e-60   Glycine max [soybeans]
sp|P46645|AAT2_ARATH|AAT2_ARATH Aspartate aminotransferase, cytoplasmic iso...   233   4e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AF419301_1798406 Securigera parviflora aspartate aminotransfe...   232   8e-60   
sp|P28734|AATC_DAUCA|AATC_DAUCA Aspartate aminotransferase, cytoplasmic (EC...   232   8e-60   Daucus carota [carrots]
sp|P46644|AAT3_ARATH|AAT3_ARATH Aspartate aminotransferase, chloroplast pre...   232   8e-60   Arabidopsis thaliana [mouse-ear cress]
pir|S53303|S53303 aspartate transaminase (EC 2.6.1.1) AAT2 - pro...   230   3e-59   Panicum miliaceum [broom millet]
gb:MSAAT1MR_1687044 M.sativa aat-1 mRNA for aspartate aminotrans...   226   3e-58   
gb:LUPASPAMP1_1685447 Lupinus angustifolius aspartate aminotrans...   226   5e-58   
gb:LUPAATP1A_1685446 L.angustifolius aspartate aminotransferase ...   226   5e-58   
gb:LJAAT_1684998 L.japonicus mRNA for aspartate aminotransferase.     224   2e-57   
sp|P28011|AAT1_MEDSA|AAT1_MEDSA Aspartate aminotransferase 1 (EC 2.6.1.1) (...   224   2e-57   Medicago sativa [alfalfa]
gb:ATU15035_1556775 Arabidopsis thaliana aspartate aminotransfer...   216   6e-55   
sp|P46646|AAT4_ARATH|AAT4_ARATH Aspartate aminotransferase, cytoplasmic iso...   216   6e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AE017353_1759964 Cryptococcus neoformans var. neoformans JEC2...   209   4e-53   
gb:AE017353_1760018 Cryptococcus neoformans var. neoformans JEC2...   208   1e-52   
gb:BC054684_2551085 Danio rerio zgc:66329, mRNA (cDNA clone MGC:...   206   5e-52   
gb:BC056110_2551692 Xenopus laevis glutamate oxaloacetate transa...   204   1e-51   
gb:AF395206_1267737 Aedes aegypti aspartate aminotransferase (mA...   204   2e-51   
gb:CR382132_1666150 Yarrowia lipolytica chromosome F of strain C...   200   3e-50   
gb:MMU82470_2123631 Mus musculus aspartate aminotransferase prec...   199   6e-50   
pir|S01174|S01174 aspartate transaminase (EC 2.6.1.1) precursor,...   199   6e-50   Mus musculus [mouse]
sp|P00507|AATM_RAT|AATM_RAT Aspartate aminotransferase, mitochondrial pre...   199   6e-50   Rattus norvegicus [brown rat]
sp|P05202|AATM_MOUSE|AATM_MOUSE Aspartate aminotransferase, mitochondrial p...   199   6e-50   Mus musculus [mouse]
pir|H96652|H96652 protein F23N19.17 [imported] - Arabidopsis tha...   198   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb:BC000525_1966799 Homo sapiens glutamic-oxaloacetic transamina...   198   1e-49   
gb:BC049435_2550243 Danio rerio zgc:56425, mRNA (cDNA clone MGC:...   197   2e-49   
gb:AF003140_1230833 Caenorhabditis elegans cosmid C44E4, complet...   196   4e-49   
gb:CR857622_1181845 Pongo pygmaeus mRNA; cDNA DKFZp459L1636 (fro...   196   4e-49   
pir|T30955|T30955 probable aspartate transaminase (EC 2.6.1.1) C...   196   4e-49   Caenorhabditis elegans [roundworm]
pir|H87756|H87756 protein C44E4.3 [imported] - Caenorhabditis el...   196   4e-49   Caenorhabditis elegans [roundworm]
sp|P00505|AATM_HUMAN|AATM_HUMAN Aspartate aminotransferase, mitochondrial p...   196   4e-49   Homo sapiens [man]
pir|T15494|T15494 aspartate transaminase (EC 2.6.1.1) C14F11.1 [...   196   5e-49   Caenorhabditis elegans [roundworm]
sp|P00506|AATM_PIG|AATM_PIG Aspartate aminotransferase, mitochondrial pre...   196   5e-49   Sus scrofa [pigs]
sp|P00508|AATM_CHICK|AATM_CHICK Aspartate aminotransferase, mitochondrial p...   196   7e-49   Gallus gallus [bantam]
gb:CR860094_1184185 Pongo pygmaeus mRNA; cDNA DKFZp469B0125 (fro...   195   9e-49   
sp|P08907|AATM_HORSE|AATM_HORSE Aspartate aminotransferase, mitochondrial (...   195   1e-48   Equus caballus [domestic horse]
sp|P12344|AATM_BOVIN|AATM_BOVIN Aspartate aminotransferase, mitochondrial p...   195   1e-48   Bos taurus [bovine]
pir|S56678|S56678 aspartate transaminase (EC 2.6.1.1) precursor ...   192   7e-48   Glycine max [soybeans]
gb:AY069166_1293896 Drosophila melanogaster GH20337 full length ...   192   9e-48   
gb:AE014134_1127076 Drosophila melanogaster chromosome 2L, compl...   192   9e-48   
gb:AE014134_1127075 Drosophila melanogaster chromosome 2L, compl...   192   9e-48   
sp|P46643|AAT1_ARATH|AAT1_ARATH Aspartate aminotransferase, mitochondrial p...   191   1e-47   Arabidopsis thaliana [mouse-ear cress]
pir|S22379|S22379 aspartate transaminase (EC 2.6.1.1) AAT3 precu...   190   3e-47   Panicum miliaceum [broom millet]
pir|S22377|S22377 aspartate transaminase (EC 2.6.1.1) AAT1 precu...   189   5e-47   Panicum miliaceum [broom millet]
gb:AP003991_1836030 Oryza sativa (japonica cultivar-group) genom...   189   6e-47   
gb:AP004731_1843940 Oryza sativa (japonica cultivar-group) genom...   189   8e-47   
pir|JC5125|JC5125 aspartate transaminase (EC 2.6.1.1) precursor,...   189   8e-47   Oryza sativa Japonica Group [Japonica rice]
gb:CR382128_1660430 Yarrowia lipolytica chromosome B of strain C...   185   1e-45   
pir|T40653|T40653 aspartate transaminase (EC 2.6.1.1) SPBC725.01...   184   3e-45   Schizosaccharomyces pombe
gb:BC067312_2554674 Xenopus tropicalis Xr-406-prov protein, mRNA...   183   3e-45   
gb:BC045269_2549116 Xenopus laevis Aspartate aminotransferase, m...   183   3e-45   
pir|JT0439|JT0439 aspartate transaminase (EC 2.6.1.1), cytosolic...   183   3e-45   Rattus norvegicus [brown rat]
pir|S29028|S29028 aspartate transaminase (EC 2.6.1.1) (clone 8C7...   183   3e-45   Homo sapiens [man]
gb:BT020856_1436214 Bos taurus glutamic-oxaloacetic transaminase...   182   6e-45   
pir|I46006|S21560 aspartate transaminase (EC 2.6.1.1) - bovine>g...   182   6e-45   
sp|P33097|AATC_BOVIN|AATC_BOVIN Aspartate aminotransferase, cytoplasmic (EC...   182   6e-45   Bos taurus [bovine]
gb:BC002057_2088831 Mus musculus glutamate oxaloacetate transami...   182   1e-44   
sp|P05201|AATC_MOUSE|AATC_MOUSE Aspartate aminotransferase, cytoplasmic (EC...   182   1e-44   Mus musculus [mouse]
gb:RATASPATB_2131536 Rat aspartate aminotransferase mRNA, comple...   181   1e-44   
pir|A30138|XNPGDC aspartate transaminase (EC 2.6.1.1), cytosolic...   181   1e-44   
sp|P13221|AATC_RAT|AATC_RAT Aspartate aminotransferase, cytoplasmic (EC 2...   181   1e-44   Rattus norvegicus [brown rat]
sp|P00503|AATC_PIG|AATC_PIG Aspartate aminotransferase, cytoplasmic (EC 2...   181   1e-44   Sus scrofa [pigs]
pir|S01076|S01076 aspartate transaminase (EC 2.6.1.1), cytosolic...   180   4e-44   Mus musculus [mouse]
pir|S05583|XNCHDC aspartate transaminase (EC 2.6.1.1), cytosolic...   179   5e-44   
sp|P08906|AATC_HORSE|AATC_HORSE Aspartate aminotransferase, cytoplasmic (EC...   179   5e-44   Equus caballus [domestic horse]
sp|P00504|AATC_CHICK|AATC_CHICK Aspartate aminotransferase, cytoplasmic (EC...   179   5e-44   Gallus gallus [bantam]
gb:BC047800_2549887 Danio rerio zgc:55996, mRNA (cDNA clone MGC:...   179   6e-44   
gb:AF326989_1262833 Trypanosoma brucei aspartate aminotransferas...   178   1e-43   
gb:CR860603_1184664 Pongo pygmaeus mRNA; cDNA DKFZp459L2119 (fro...   177   2e-43   
pir|S29027|S29027 aspartate transaminase (EC 2.6.1.1) (clone H10...   176   5e-43   Homo sapiens [man]
pir|S13035|S13035 aspartate transaminase (EC 2.6.1.1) - human         176   5e-43   Homo sapiens [man]
sp|P17174|AATC_HUMAN|AATC_HUMAN Aspartate aminotransferase, cytoplasmic (EC...   176   5e-43   Homo sapiens [man]
gb:CR861057_1185081 Pongo pygmaeus mRNA; cDNA DKFZp459F1115 (fro...   175   9e-43   
gb:AF411604_1268878 Brugia malayi aspartate aminotransferase mRN...   175   1e-42   
gb:BT001324_1356097 Drosophila melanogaster AT16867 full insert ...   174   2e-42   
gb:AY339650_1320839 Drosophila melanogaster aminotransferase (CG...   174   2e-42   
gb:AE013599_1132139 Drosophila melanogaster chromosome 2R, compl...   174   3e-42   
gb:AE013599_1132138 Drosophila melanogaster chromosome 2R, compl...   174   3e-42   
gb:AY529105_1333193 Leishmania donovani strain MHOM/SD/90/D83 gl...   173   3e-42   
gb:AY529107_1333195 Leishmania donovani strain MHOM/SD/90/2828 g...   173   5e-42   
gb:AF326990_1262834 Trypanosoma brucei aspartate aminotransferas...   173   5e-42   
gb:AY529109_1333197 Leishmania donovani strain MHOM/SD/90/2655 g...   172   6e-42   
gb:AF416601_1269288 Leishmania mexicana broad specificity aminot...   172   1e-41   
gb:NSU581792_156264 Neisseria subflava dedA gene (partial), manB...   171   2e-41   
gb:AY529113_1333201 Leishmania donovani strain MHOM/NP/02/NEP3 g...   171   2e-41   
gb:AE004969_61123 Neisseria gonorrhoeae FA 1090, complete genome.     171   2e-41   
gb:AE016827_342660 Mannheimia succiniciproducens MBEL55E, comple...   170   4e-41   
gb:AY529115_1333203 Leishmania donovani strain MHOM/SD/91/D1809 ...   169   5e-41   
gb:AE016918_357343 Chromobacterium violaceum ATCC 12472 section ...   169   5e-41   
pir|C81188|C81188 aspartate transaminase (EC 2.6.1.1) NMB0540 [s...   169   7e-41   Neisseria meningitidis serogroup B
gb:AF395205_1267736 Aedes aegypti aspartate aminotransferase mRN...   169   9e-41   
gb:BX908798_829625 Parachlamydia-related symbiont UWE25, complet...   168   1e-40   
pir|B81915|B81915 aspartate transaminase (EC 2.6.1.1) NMA0719 [s...   168   1e-40   Neisseria meningitidis serogroup A
gb:BX571864_786607 Photorhabdus luminescens subsp. laumondii TTO...   167   2e-40   
gb:AF147795_483382 Pseudomonas aeruginosa integration host facto...   166   6e-40   
gb:CR555306_108497 Azoarcus sp. EbN1 complete genome.                 166   6e-40   
sp|P72173|AAT_PSEAE|AAT_PSEAE Aspartate aminotransferase (EC 2.6.1.1) (Tra...   166   6e-40   Pseudomonas aeruginosa
pir|H81054|H81054 aromatic-amino-acid transaminase (EC 2.6.1.57)...   166   7e-40   Neisseria meningitidis serogroup B
pir|G81821|G81821 aromatic-amino-acid transaminase (EC 2.6.1.57)...   165   9e-40   Neisseria meningitidis serogroup A
pir|T29856|T29856 probable aspartate transaminase (EC 2.6.1.1) T...   165   9e-40   Caenorhabditis elegans [roundworm]
pir|T37507|T37507 aspartate transaminase (EC 2.6.1.1), cytosolic...   165   1e-39   Schizosaccharomyces pombe
gb:AL646062_545938 Ralstonia solanacearum GMI1000 chromosome, co...   164   2e-39   
gb:CR382135_1667955 Debaryomyces hansenii chromosome C of strain...   164   3e-39   
gb:AF326988_1262832 Crithidia fasciculata aspartate aminotransfe...   164   3e-39   
gb:AE004969_61008 Neisseria gonorrhoeae FA 1090, complete genome.     163   4e-39   
sp|Q22067|AATC_CAEEL|AATC_CAEEL Probable aspartate aminotransferase, cytopl...   163   5e-39   Caenorhabditis elegans [roundworm]
gb:BX640443_814922 Bordetella bronchiseptica strain RB50, comple...   162   6e-39   
gb:BX640429_810276 Bordetella parapertussis strain 12822, comple...   162   6e-39   
gb:BX640416_806209 Bordetella pertussis strain Tohama I, complet...   162   6e-39   
gb:BX571966_793591 Burkholderia pseudomallei strain K96243, chro...   161   1e-38   
gb:AE016781_331401 Pseudomonas putida KT2440 section 8 of 21 of ...   161   2e-38   
gb:CR555306_105714 Azoarcus sp. EbN1 complete genome.                 160   4e-38   
gb:AE015676_316723 Shewanella oneidensis MR-1 section 225 of 457...   159   7e-38   
gb:AE006099_215509 Pasteurella multocida subsp. multocida str. P...   159   7e-38   
sp|P58661|AAT_SALTY|AAT_SALTY Aspartate aminotransferase (EC 2.6.1.1) (Tra...   159   7e-38   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q56114|AAT_SALTI|AAT_SALTI Aspartate aminotransferase (EC 2.6.1.1) (Tra...   159   7e-38   Salmonella enterica subsp. enterica serovar Typhi
gb:CP000026_76600 Salmonella enterica subsp. enterica serovar Pa...   159   9e-38   
gb:AY168853_594397 Pseudomonas putida aromatic amino acid aminot...   158   1e-37   
gb:AE016758_325107 Escherichia coli CFT073 section 4 of 18 of th...   158   1e-37   
pir|A85619|A85619 aspartate aminotransferase [imported] - Escher...   158   1e-37   Escherichia coli O157:H7
sp|P00509|AAT_ECOLI|AAT_ECOLI Aspartate aminotransferase (EC 2.6.1.1) (Tra...   158   1e-37   Escherichia coli [E. coli]
gb:BX950851_841279 Erwinia carotovora subsp. atroseptica SCRI104...   157   2e-37   
gb:AF183931_486407 Aeromonas hydrophila putative ATP-dependent h...   157   2e-37   
gb:AE016863_351592 Pseudomonas syringae pv. tomato str. DC3000 s...   157   2e-37   
gb:AE013598_293717 Xanthomonas oryzae pv. oryzae KACC10331, comp...   157   3e-37   
gb:AE011635_275088 Xanthomonas axonopodis pv. citri str. 306, se...   157   3e-37   
gb:AE005674_70507 Shigella flexneri 2a str. 301, complete genome...   157   3e-37   
gb:CR378670_95703 Photobacterium profundum SS9; segment 8/12.         156   4e-37   
gb:AE017154_392829 Haemophilus ducreyi strain 35000HP section 4 ...   156   6e-37   
gb:CR522870_99462 Desulfotalea psychrophila LSv54 chromosome.         156   6e-37   
gb:BA000031_707360 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   155   8e-37   
gb:AE016875_354677 Pseudomonas syringae pv. tomato str. DC3000 s...   155   8e-37   
gb:AE012104_279372 Xanthomonas campestris pv. campestris str. AT...   155   1e-36   
gb:AE012553_283481 Xylella fastidiosa Temecula1, section 1 of 9 ...   154   2e-36   
sp|P44425|AAT_HAEIN|AAT_HAEIN Aspartate aminotransferase (EC 2.6.1.1) (Tra...   154   2e-36   Haemophilus influenzae
gb:AF326991_1262835 Giardia intestinalis aspartate aminotransfer...   154   2e-36   
gb:BX571966_794057 Burkholderia pseudomallei strain K96243, chro...   154   2e-36   
gb:AE013879_301054 Yersinia pestis KIM section 279 of 415 of the...   153   4e-36   
pir|AD0172|AD0172 aspartate transaminase (EC 2.6.1.1) [imported]...   153   4e-36   Yersinia pestis
pir|S71928|S71928 aromatic-amino-acid transaminase (EC 2.6.1.57)...   152   6e-36   Salmonella enterica subsp. enterica serovar Typhimurium
gb:CP000026_78695 Salmonella enterica subsp. enterica serovar Pa...   152   8e-36   
pir|A82217|A82217 transaminase (EC 2.6.1.-) [similarity] - Vibri...   152   8e-36   Vibrio cholerae
sp|P74861|TYRB_SALTY|TYRB_SALTY Aromatic-amino-acid aminotransferase (EC 2....   152   8e-36   Salmonella enterica subsp. enterica serovar Typhimurium
gb:AE016911_355292 Chromobacterium violaceum ATCC 12472 section ...   151   1e-35   
gb:CR926063_1185570 Pongo pygmaeus mRNA; cDNA DKFZp459D0410 (fro...   150   3e-35   
gb:AE016804_336880 Vibrio vulnificus CMCP6 chromosome I section ...   150   3e-35   
gb:AE016848_348074 Salmonella enterica subsp. enterica serovar T...   150   4e-35   
pir|C82855|C82855 aromatic-amino-acid transaminase (EC 2.6.1.57)...   150   4e-35   Xylella fastidiosa
pir|AG1016|AG1016 aromatic-amino-acid transaminase (EC 2.6.1.57)...   150   4e-35   Salmonella enterica subsp. enterica serovar Typhi
gb:AE016819_1749046 Ashbya gossypii (= Eremothecium gossypii) AT...   149   5e-35   
gb:BA000037_722922 Vibrio vulnificus YJ016 DNA, chromosome I, co...   149   5e-35   
gb:CR382134_1667077 Debaryomyces hansenii chromosome B of strain...   149   9e-35   
gb:CP000020_871664 Vibrio fischeri ES114 chromosome I, complete ...   149   9e-35   
gb:BX248585_764028 Blochmannia floridanus complete genome; segme...   149   9e-35   
gb:AF074934_476754 Klebsiella pneumoniae tyrosine aminotransfera...   149   9e-35   
gb:AE005674_73735 Shigella flexneri 2a str. 301, complete genome...   149   9e-35   
gb:BX294155_772095 Pirellula sp. strain 1 complete genome; segme...   148   1e-34   
pir|H86098|H86098 tyrosine aminotransferase, tyrosine repressibl...   148   1e-34   Escherichia coli O157:H7
sp|P04693|TYRB_ECOLI|TYRB_ECOLI Aromatic-amino-acid aminotransferase (EC 2....   148   1e-34   Escherichia coli [E. coli]
gb:BX640440_813834 Bordetella bronchiseptica strain RB50, comple...   148   2e-34   
gb:BX640419_807258 Bordetella pertussis strain Tohama I, complet...   148   2e-34   
gb:AE016770_328995 Escherichia coli CFT073 section 16 of 18 of t...   147   3e-34   
gb:MSMASPC_150556 Moraxella sp. maspC gene.                           147   3e-34   
gb:CR382137_1669690 Debaryomyces hansenii chromosome E of strain...   145   1e-33   
gb:CR382126_1659140 Kluyveromyces lactis strain NRRL Y-1140 chro...   145   1e-33   
gb:BX950851_842405 Erwinia carotovora subsp. atroseptica SCRI104...   145   1e-33   
gb:BX571966_795473 Burkholderia pseudomallei strain K96243, chro...   145   1e-33   
gb:CR382134_1667044 Debaryomyces hansenii chromosome B of strain...   144   2e-33   
gb:CR380956_1652179 Candida glabrata strain CBS138 chromosome J ...   144   2e-33   
gb:AE016787_333004 Pseudomonas putida KT2440 section 14 of 21 of...   144   2e-33   
pir|AD0040|AD0040 aromatic-amino-acid transaminase (EC 2.6.1.57)...   144   3e-33   Yersinia pestis
pir|S64854|S64854 aspartate transaminase (EC 2.6.1.1), cytosolic...   143   4e-33   Saccharomyces cerevisiae [brewer's yeast]
sp|P23542|AATC_YEAST|AATC_YEAST Aspartate aminotransferase, cytoplasmic (EC...   143   4e-33   Saccharomyces cerevisiae [brewer's yeast]
gb:BX936398_835022 Yersinia pseudotuberculosis IP32953 genome, c...   143   5e-33   
gb:AE015681_316779 Shewanella oneidensis MR-1 section 230 of 457...   141   1e-32   
gb:CR380950_1649733 Candida glabrata strain CBS138 chromosome D ...   139   7e-32   
gb:AY659111_2148121 Synthetic construct Peudomonas aeruginosa cl...   138   1e-31   
sp|P43336|PHHC_PSEAE|PHHC_PSEAE Aromatic-amino-acid aminotransferase (EC 2....   138   1e-31   Pseudomonas aeruginosa
gb:AY762327_1350285 Trypanosoma cruzi putative aspartate aminotr...   137   2e-31   
gb:BA000021_686870 Wigglesworthia glossinidia endosymbiont of Gl...   137   2e-31   
gb:BX571873_789212 Photorhabdus luminescens subsp. laumondii TTO...   137   4e-31   
gb:PSEPHHY_160861 Pseudomonas aeruginosa phenylalanine hydroxyla...   136   5e-31   
gb:CR378677_97539 Photobacterium profundum SS9 chromosome 2; seg...   136   6e-31   
gb:CR543861_102186 Acinetobacter sp. ADP1 complete genome.            135   1e-30   
gb:BA000038_724980 Vibrio vulnificus YJ016 DNA, chromosome II, c...   134   2e-30   
gb:AE016809_338084 Vibrio vulnificus CMCP6 chromosome II section...   134   2e-30   
pir|T29709|T29709 probable aspartate transaminase (EC 2.6.1.1) C...   134   2e-30   Caenorhabditis elegans [roundworm]
gb:CP000021_873034 Vibrio fischeri ES114 chromosome II, complete...   133   4e-30   
gb:AE016815_1746197 Ashbya gossypii (= Eremothecium gossypii) AT...   130   4e-29   
gb:BA000032_709476 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   130   4e-29   
gb:BC029504_1979526 Homo sapiens hypothetical protein MGC33309, ...   129   1e-28   
gb:CR382126_1658958 Kluyveromyces lactis strain NRRL Y-1140 chro...   129   1e-28   
gb:AX491305_1469531 Sequence 1 from Patent WO0229040.                 129   1e-28   
sp|P95468|TYRB_PARDE|TYRB_PARDE Aromatic-amino-acid aminotransferase (EC 2....   129   1e-28   Paracoccus denitrificans
gb:BC052754_2101260 Mus musculus RIKEN cDNA 1700083M11 gene, mRN...   128   2e-28   
pir|G82449|G82449 amino acid biosynthesis aminotransferase VCA05...   126   5e-28   Vibrio cholerae
pir|H71620|H71620 aspartate transaminase (EC 2.6.1.1) PFB0200c [...   126   6e-28   Plasmodium falciparum 3D7
gb:BA000012_666281 Mesorhizobium loti MAFF303099 DNA, complete g...   125   1e-27   
gb:AE017345_1756781 Cryptococcus neoformans var. neoformans JEC2...   124   2e-27   
gb:CR380957_1652883 Candida glabrata strain CBS138 chromosome K ...   124   2e-27   
sp|Q02636|ATTY_RHIME|ATTY_RHIME Tyrosine aminotransferase (EC 2.6.1.5) (L-t...   124   2e-27   Sinorhizobium meliloti
pir|S37933|S37933 aspartate transaminase (EC 2.6.1.1) precursor,...   120   5e-26   Saccharomyces cerevisiae [brewer's yeast]
gb:CP000031_87712 Silicibacter pomeroyi DSS-3, complete genome.       119   8e-26   
sp|Q01802|AATM_YEAST|AATM_YEAST Aspartate aminotransferase, mitochondrial p...   118   2e-25   Saccharomyces cerevisiae [brewer's yeast]
pir|A86583|A86583 aromatic AA aminotransferase [imported] - Chla...   117   3e-25   Chlamydia pneumoniae
gb:D67042_1674743 Oryza sativa (japonica cultivar-group) mRNA fo...   117   4e-25   
pir|T02971|T02971 probable aspartate transaminase (EC 2.6.1.1) -...   117   4e-25   Oryza sativa Japonica Group [Japonica rice]
gb:AF498406_516751 Pseudomonas aeruginosa serotype O15-ATCC puta...   115   1e-24   
gb:AF416331_509154 Ruegeria sp. PR1b plasmid pSD25, complete seq...   110   5e-23   
gb:AF470319_1802850 Musa acuminata aspartate aminotransferase 1 ...   107   3e-22   
gb:AE016994_374073 Chlamydophila caviae GPIC section 1 of 4 of t...   105   1e-21   
gb:AE008692_240675 Zymomonas mobilis subsp. mobilis ZM4, complet...   103   3e-21   
gb:AE002269_44603 Chlamydia muridarum Nigg section 1 of 85 of th...   103   4e-21   
gb:AY422172_1605163 Flammulina velutipes aspartate transaminase ...   101   2e-20   
pir|A71490|A71490 aromatic-amino-acid transaminase (EC 2.6.1.57)...   100   6e-20   Chlamydia trachomatis
gb:AY347851_1178009 Malus x domestica clone 12-2 aspartate trans...    97   4e-19   
gb:BC079187_2107316 Rattus norvegicus cDNA clone MGC:94235 IMAGE...    86   1e-15   
gb:RATGOTA_2132374 Rat mitochondrial glutamic oxaloacetic transa...    73   8e-12   
gb:AF233353_1416529 Ovis aries aspartate aminotransferase mRNA, ...    73   8e-12   
gb:AF462031_1801840 Tuber borchii aspartate aminotransferase mRN...    57   5e-07   
gb:SEN237788_182048 Salmonella enterica tyrB (partial), aphA, yj...    52   2e-05   
gb:AK006984_1153795 Mus musculus adult male testis cDNA, RIKEN f...    50   8e-05   
gb:AB047807_1520667 Arabidopsis thaliana YLS4 mRNA for aspartate...    47   4e-04   
gb:AE010545_264239 Fusobacterium nucleatum subsp. nucleatum ATCC...    45   0.002   
gb:PAU62582_157188 Pseudomonas aeruginosa aromatic aminotransfer...    44   0.004   
gb:AY223393_1176853 Schistosoma japonicum clone ZZZ295 mRNA sequ...    41   0.027   
gb:BA000039_727842 Thermosynechococcus elongatus BP-1 DNA, compl...    37   0.39    
gb:AE014297_1138896 Drosophila melanogaster chromosome 3R, compl...    35   1.9     
gb:AK125394_1915923 Homo sapiens cDNA FLJ43404 fis, clone OCBBF2...    34   3.3     
gb:SPAPB1A10_1718652 S.pombe chromosome I BAC pB1A10.                  34   3.3     
gb:BX640438_813145 Bordetella bronchiseptica strain RB50, comple...    34   3.3     
pir|S60921|S60921 farnesyltranstransferase (EC 2.5.1.29) - yeast...    34   4.3     Saccharomyces cerevisiae [brewer's yeast]
gb:AF339475_2237606 Fort Morgan virus strain CM4-146 nonstructur...    33   5.6     
gb:AF339474_2237604 Buggy Creek virus strain 81V8122 nonstructur...    33   5.6     
gb:AF242738_1491529 Bacteriophage phi LC3, complete genome.            33   9.6     
gb:CEF16A11_1362554 Caenorhabditis elegans cosmid F16A11, comple...    33   9.6     
gb:CEF16A11_1362553 Caenorhabditis elegans cosmid F16A11, comple...    33   9.6     
gb:CEF16A11_1362552 Caenorhabditis elegans cosmid F16A11, comple...    33   9.6     
gb:AB005262_1192913 Acyrthosiphon pisum mRNA for aspartate amino...    33   9.6     
pir|T23715|T23715 hypothetical protein M04C9.6c - Caenorhabditis...    33   9.6     Caenorhabditis elegans [roundworm]
pir|T23713|T23713 hypothetical protein M04C9.6b - Caenorhabditis...    33   9.6     Caenorhabditis elegans [roundworm]
pir|T23714|T23714 hypothetical protein M04C9.6a - Caenorhabditis...    33   9.6     Caenorhabditis elegans [roundworm]
sp|Q9RXE1|SYK_DEIRA|SYK_DEIRA Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--...    33   9.6     Deinococcus radiodurans


>gb:AB126259_1528262 Nicotiana tabacum mRNA for aspartate
           aminotransferase, partial cds.
          Length = 227

 Score =  372 bits (954), Expect = e-102
 Identities = 184/200 (92%), Positives = 191/200 (95%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASG LD DASSVR+FA+RG+ELLVAQSYSKNLGLY ERIGAINV 
Sbjct: 28  EKNHIPFFDVAYQGFASGGLDEDASSVRLFAARGMELLVAQSYSKNLGLYGERIGAINVP 87

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CSSADAA RVKSQLKRLARPMYSNPPIHGARIVANVVG PE F+EWKQEMEMMAGRIKSV
Sbjct: 88  CSSADAATRVKSQLKRLARPMYSNPPIHGARIVANVVGIPEFFDEWKQEMEMMAGRIKSV 147

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQKLYDSLS KDKSGKDW +ILKQIGMFSFTGLNKAQSENM+NKWH+YMTKDGRISLAGL
Sbjct: 148 RQKLYDSLSAKDKSGKDWPYILKQIGMFSFTGLNKAQSENMTNKWHVYMTKDGRISLAGL 207

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           SAAKCEYLADAIIDSYYNVS
Sbjct: 208 SAAKCEYLADAIIDSYYNVS 227



>gb:AF029898_1762438 Lotus corniculatus aspartate aminotransferase
           mRNA, complete cds.
          Length = 457

 Score =  358 bits (919), Expect = 8e-98
 Identities = 172/200 (86%), Positives = 192/200 (96%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KNHIPFFDVAYQGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAERIGAINV+
Sbjct: 258 QKNHIPFFDVAYQGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERIGAINVI 317

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AARVKSQLKR+ARPMYSNPP+HGARIVA++VGNP+LFNEWK EMEMMAGRIK+V
Sbjct: 318 SSSPESAARVKSQLKRIARPMYSNPPVHGARIVADIVGNPDLFNEWKAEMEMMAGRIKNV 377

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQKLYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGL
Sbjct: 378 RQKLYDSISSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGL 437

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 438 SLAKCEYLADAIIDSYHNVS 457



>gb:ATAAT1_1542716 A.thaliana aat1 mRNA.>gb:ATASP5GEN_1544088
           A.thaliana asp5 gene.
          Length = 453

 Score =  355 bits (911), Expect = 6e-97
 Identities = 173/200 (86%), Positives = 189/200 (94%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVV
Sbjct: 254 EKNHIPFFDVAYQGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVV 313

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CSSADAA RVKSQLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+V
Sbjct: 314 CSSADAATRVKSQLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTV 373

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGL
Sbjct: 374 RQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGL 433

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 434 SLAKCEYLADAIIDSYHNVS 453



>sp|P46248|AAT5_ARATH Aspartate aminotransferase, chloroplast
           precursor (EC 2.6.1.1) (Transaminase
           A).>pir|T04646|T04646 aspartate transaminase (EC
           2.6.1.1) precursor, chloroplast - Arabidopsis
           thaliana>gb:ATCHRIV76_1547120 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 76.>gb:ATF10N7_1548226
           Arabidopsis thaliana DNA chromosome 4, BAC clone F10N7
           (ESSA project).>gb:AY054660_1563314 Arabidopsis thaliana
           aspartate aminotransferase (At4g31990; F10N7.200) mRNA,
           complete cds.>gb:AY081506_1568766 Arabidopsis thaliana
           aspartate aminotransferase (At4g31990) mRNA, complete
           cds.
          Length = 453

 Score =  355 bits (911), Expect = 6e-97
 Identities = 173/200 (86%), Positives = 189/200 (94%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVV
Sbjct: 254 EKNHIPFFDVAYQGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVV 313

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CSSADAA RVKSQLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+V
Sbjct: 314 CSSADAATRVKSQLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTV 373

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNKAQS+NM++KWH+YMTKDGRISLAGL
Sbjct: 374 RQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGL 433

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 434 SLAKCEYLADAIIDSYHNVS 453



>gb:AY084314_1569406 Arabidopsis thaliana clone 103854 mRNA,
           complete sequence.
          Length = 453

 Score =  352 bits (902), Expect = 7e-96
 Identities = 171/200 (85%), Positives = 188/200 (94%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+FA RG+E  VAQSYSKNLGLYAERIGAINVV
Sbjct: 254 EKNHIPFFDVAYQGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVV 313

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CSSADAA RVKSQLKR+ARPMYSNPP+HGARIVANVVG+  +F+EWK EMEMMAGRIK+V
Sbjct: 314 CSSADAATRVKSQLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTV 373

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LYDSL  KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM++KWH+Y TKDGRISLAGL
Sbjct: 374 RQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMTDKWHVYXTKDGRISLAGL 433

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 434 SLAKCEYLADAIIDSYHNVS 453



>pir|S46316|S46316 aspartate transaminase (EC 2.6.1.1) -
           alfalfa>gb:ALFAAT2A_1818955 Medicago sativa aspartate
           aminotransferase (AAT2) gene, complete cds.
          Length = 455

 Score =  351 bits (900), Expect = 1e-95
 Identities = 169/200 (84%), Positives = 188/200 (94%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KNH PFFDVAYQGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+GAINV+
Sbjct: 256 QKNHFPFFDVAYQGFASGSLDEDAASVRLFESRGMEVLVAQSYSKNLGLYAERVGAINVI 315

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++A RVKSQLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+V
Sbjct: 316 SSSPESATRVKSQLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTV 375

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+NM+NKWHIYMTKDGRISLAGL
Sbjct: 376 RQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMTNKWHIYMTKDGRISLAGL 435

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 436 SLAKCEYLADAIIDSYHNVS 455



>pir|S33528|S33528 aspartate transaminase (EC 2.6.1.1) AAT5
           precursor - soybean>gb:SOYASPAM_1715964 Glycine max
           (clone pSAT17) aspartate aminotransferase mRNA, complete
           cds.
          Length = 463

 Score =  350 bits (897), Expect = 3e-95
 Identities = 169/200 (84%), Positives = 189/200 (94%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+
Sbjct: 264 EKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGIEVLVAQSYSKNLGLYAERIGAINVI 323

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AAR  SQLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+V
Sbjct: 324 SSSPESAARETSQLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNV 383

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGL
Sbjct: 384 RQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISLAGL 443

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 444 SLAKCEYLADAIIDSYHNVS 463



>gb:AF315376_1785415 Phaseolus vulgaris aspartate aminotransferase
           mRNA, complete cds; plastid gene for plastid product.
          Length = 461

 Score =  349 bits (896), Expect = 4e-95
 Identities = 168/200 (84%), Positives = 190/200 (95%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYAERIGAINV+
Sbjct: 262 EKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGMEVLVAQSYSKNLGLYAERIGAINVI 321

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AARVKSQLKRLARPMYSNPP+HGARIVA+VVGNP LFNEW+ EMEMMAGRIK+V
Sbjct: 322 SSSPESAARVKSQLKRLARPMYSNPPVHGARIVADVVGNPVLFNEWRAEMEMMAGRIKNV 381

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LY+S++ KD SGKDW+FILKQIGMFSFTGLNK Q++NM+NKWH+YMTKDGRISLAGL
Sbjct: 382 RQQLYNSITSKDNSGKDWSFILKQIGMFSFTGLNKEQTDNMTNKWHVYMTKDGRISLAGL 441

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 442 SLAKCEYLADAIIDSYHNVS 461



>pir|S22465|XNYLB aspartate transaminase (EC 2.6.1.1) precursor -
           narrow-leaved blue lupine (fragment)
          Length = 454

 Score =  348 bits (893), Expect = 8e-95
 Identities = 168/200 (84%), Positives = 190/200 (95%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+F +RGLE+LVAQSYSKNLGLYAERIGAINV+
Sbjct: 255 EKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGLEVLVAQSYSKNLGLYAERIGAINVI 314

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AARVKSQLKR+ARPMYSNPP+HGARIVA++VGNP LF+EWK EMEMMAGRIK+V
Sbjct: 315 SSSPESAARVKSQLKRIARPMYSNPPVHGARIVADIVGNPALFDEWKVEMEMMAGRIKNV 374

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LYDS+S KDKSGKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGL
Sbjct: 375 RQQLYDSISSKDKSGKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGL 434

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDS++ VS
Sbjct: 435 SLAKCEYLADAIIDSFHYVS 454



>sp|P26563|AATM_LUPAN Aspartate aminotransferase-P2, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase A)
           (Fragment).>gb:LAASPAT_1683881 L.angustifolius mRNA for
           aspartate aminotransferase.
          Length = 454

 Score =  348 bits (893), Expect = 8e-95
 Identities = 168/200 (84%), Positives = 190/200 (95%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+F +RGLE+LVAQSYSKNLGLYAERIGAINV+
Sbjct: 255 EKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGLEVLVAQSYSKNLGLYAERIGAINVI 314

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AARVKSQLKR+ARPMYSNPP+HGARIVA++VGNP LF+EWK EMEMMAGRIK+V
Sbjct: 315 SSSPESAARVKSQLKRIARPMYSNPPVHGARIVADIVGNPALFDEWKVEMEMMAGRIKNV 374

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LYDS+S KDKSGKDW+FILKQIGMFS+TGLNK QS+NM+NKWH+YMTKDGRISLAGL
Sbjct: 375 RQQLYDSISSKDKSGKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGL 434

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDS++ VS
Sbjct: 435 SLAKCEYLADAIIDSFHYVS 454



>gb:AP003975_1835824 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1004_E04.
          Length = 458

 Score =  346 bits (888), Expect = 3e-94
 Identities = 169/200 (84%), Positives = 185/200 (92%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK H+PFFDVAYQGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINVV
Sbjct: 259 EKKHMPFFDVAYQGFASGSLDEDASSVRLFVQRGLEVFVAQSYSKNLGLYAERIGAINVV 318

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CS+ + A RVKSQLKRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+V
Sbjct: 319 CSTPEVANRVKSQLKRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNV 378

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQKLYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGL
Sbjct: 379 RQKLYDSLSAKDDSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGL 438

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDS++NVS
Sbjct: 439 SLAKCEYLADAIIDSFHNVS 458



>gb:S60967_1704337 Glycine max aspartate aminotransferase isozyme 5
           mRNA, complete cds; chloroplast gene for chloroplast
           product.
          Length = 463

 Score =  346 bits (888), Expect = 3e-94
 Identities = 167/200 (83%), Positives = 188/200 (94%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNHIPFFDVAYQGFASGSLD DA+SVR+F +RG+E+LVAQSYSKNLGLYA+RIGAINV+
Sbjct: 264 EKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGIEVLVAQSYSKNLGLYAQRIGAINVI 323

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AAR  SQLKR+ARPMYSNPP+HGARIVA+VVGNP LFNEWK EMEMMAGRIK+V
Sbjct: 324 SSSPESAARETSQLKRIARPMYSNPPVHGARIVADVVGNPVLFNEWKAEMEMMAGRIKNV 383

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+LYDS++ KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRIS AGL
Sbjct: 384 RQQLYDSITSKDKSGKDWSFILKQIGMFSFTGLNKNQSDNMTNKWHVYMTKDGRISSAGL 443

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 444 SLAKCEYLADAIIDSYHNVS 463



>gb:AY157306_1585424 Oryza sativa aspartate aminotransferase mRNA,
           partial cds; nuclear gene for plastid product.
          Length = 414

 Score =  346 bits (888), Expect = 3e-94
 Identities = 169/200 (84%), Positives = 185/200 (92%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK H+PFFDVAYQGFASGSLD DASSVR+F  RGLE+ VAQSYSKNLGLYAERIGAINVV
Sbjct: 215 EKKHMPFFDVAYQGFASGSLDEDASSVRLFVQRGLEVFVAQSYSKNLGLYAERIGAINVV 274

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CS+ + A RVKSQLKRLARPMYSNPPIHGARIVANVVG+P +F EWKQEME MAGRIK+V
Sbjct: 275 CSTPEVANRVKSQLKRLARPMYSNPPIHGARIVANVVGDPTMFGEWKQEMEEMAGRIKNV 334

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQKLYDSLS KD SGKDW+FIL+QIGMFS+TGLNK QS+NM++KWHIYMTKDGRISLAGL
Sbjct: 335 RQKLYDSLSAKDDSGKDWSFILRQIGMFSYTGLNKTQSDNMTDKWHIYMTKDGRISLAGL 394

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDS++NVS
Sbjct: 395 SLAKCEYLADAIIDSFHNVS 414



>pir|S65675|S65675 aspartate transaminase (EC 2.6.1.1) - proso
           millet>gb:PNIAA_1700890 Panicum miliaceum mRNA for
           plastidic aspartate aminotransferase , complete cds.
          Length = 457

 Score =  346 bits (887), Expect = 4e-94
 Identities = 166/200 (83%), Positives = 186/200 (93%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK H+PFFDVAYQGFASGSLD DA SVR+F  RG+E+ VAQSYSKNLGLYAERIGAINVV
Sbjct: 258 EKKHMPFFDVAYQGFASGSLDEDAFSVRLFVKRGMEVFVAQSYSKNLGLYAERIGAINVV 317

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CS+ + A RVKSQLKRLARPMYSNPPIHGARIVAN+VG+P +F EWKQEME MAGRIK+V
Sbjct: 318 CSAPEVADRVKSQLKRLARPMYSNPPIHGARIVANIVGDPTMFGEWKQEMEQMAGRIKNV 377

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQKLYDSLS KDKSGKDW+FIL+QIGMFS+TGLNKAQS+NM++KWH+YMTKDGRISLAGL
Sbjct: 378 RQKLYDSLSAKDKSGKDWSFILRQIGMFSYTGLNKAQSDNMTDKWHVYMTKDGRISLAGL 437

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKC+YLADAIIDS++NVS
Sbjct: 438 SLAKCDYLADAIIDSFHNVS 457



>gb:CLU89494_1647911 Canavalia lineata aspartate aminotransferase 2
           precursor (AAT2) mRNA, complete cds.
          Length = 465

 Score =  337 bits (865), Expect = 1e-91
 Identities = 163/200 (81%), Positives = 184/200 (92%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNH PFFDVAYQGFASGSLD DA+SVR+  +RG+EL +AQSYSKNLGLYA+RIGAINV+
Sbjct: 266 EKNHRPFFDVAYQGFASGSLDEDAASVRLLVARGIELFIAQSYSKNLGLYAQRIGAINVI 325

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AAR+ SQLKR+ARPMYSNPP+HGARIVA++VGNP LF EWK  MEMMAGRIK+V
Sbjct: 326 SSSPESAARLTSQLKRIARPMYSNPPVHGARIVADLVGNPLLFEEWKAFMEMMAGRIKNV 385

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+YMTKDGRISLAGL
Sbjct: 386 RQLLYDSISSKDKSGKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVYMTKDGRISLAGL 445

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 446 SLAKCEYLADAIIDSYHNVS 465



>pir|S39925|S39925 aspartate transaminase (EC 2.6.1.1) chain 2a,
           isoform 1, precursor - alfalfa
          Length = 463

 Score =  336 bits (861), Expect = 4e-91
 Identities = 166/201 (82%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KNH PFFDVAYQGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+G   V+
Sbjct: 266 QKNHFPFFDVAYQGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERVG---VI 322

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++A RVKSQLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+V
Sbjct: 323 SSSPESATRVKSQLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTV 382

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSEN-MSNKWHIYMTKDGRISLAG 345
           RQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+N M+NKWHIYMTKDGRISLAG
Sbjct: 383 RQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLAG 442

Query: 344 LSAAKCEYLADAIIDSYYNVS 282
           LS AKCEYLADAIIDSY+NVS
Sbjct: 443 LSLAKCEYLADAIIDSYHNVS 463



>pir|S39928|S39928 aspartate transaminase (EC 2.6.1.1) chain 2c,
           isoform 2, precursor - alfalfa
          Length = 453

 Score =  335 bits (860), Expect = 5e-91
 Identities = 166/201 (82%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KNH PFFDVAYQGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+G   V+
Sbjct: 256 QKNHFPFFDVAYQGFASGSLDEDAASVRLFESRGMEVLVAQSYSKNLGLYAERVG---VI 312

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++A RVKSQLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+V
Sbjct: 313 SSSPESATRVKSQLKRLARPMYSNPPVHGARIVANIVGTPALFDEWKAEMEMMAGRIKTV 372

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSEN-MSNKWHIYMTKDGRISLAG 345
           RQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+N M+NKWHIYMTKDGRISLAG
Sbjct: 373 RQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLAG 432

Query: 344 LSAAKCEYLADAIIDSYYNVS 282
           LS AKCEYLADAIIDSY+NVS
Sbjct: 433 LSLAKCEYLADAIIDSYHNVS 453



>pir|S39927|S39927 aspartate transaminase (EC 2.6.1.1) chain 2a,
           isoform 2, precursor - alfalfa
          Length = 453

 Score =  335 bits (858), Expect = 9e-91
 Identities = 166/201 (82%), Positives = 185/201 (92%), Gaps = 1/201 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KNH PFFDVAYQGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+G   V+
Sbjct: 256 QKNHFPFFDVAYQGFASGSLDEDAASVRLFVSRGMEVLVAQSYSKNLGLYAERVG---VI 312

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++A RVKSQLKRLARPMYSNPP+HGARIVAN+VG P LF+EWK EMEMMAGRIK+V
Sbjct: 313 SSSPESATRVKSQLKRLARPMYSNPPVHGARIVANIVGIPALFDEWKAEMEMMAGRIKTV 372

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSEN-MSNKWHIYMTKDGRISLAG 345
           RQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+N M+NKWHIYMTKDGRISLAG
Sbjct: 373 RQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLAG 432

Query: 344 LSAAKCEYLADAIIDSYYNVS 282
           LS AKCEYLADAIIDSY+NVS
Sbjct: 433 LSLAKCEYLADAIIDSYHNVS 453



>pir|S39926|S39926 aspartate transaminase (EC 2.6.1.1) chain 2c,
           isoform 1, precursor - alfalfa
          Length = 463

 Score =  333 bits (855), Expect = 2e-90
 Identities = 165/201 (82%), Positives = 184/201 (91%), Gaps = 1/201 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KNH PFFDVAYQGFASGSLD DA+SVR+F SRG+E+LVAQSYSKNLGLYAER+G   V+
Sbjct: 266 QKNHFPFFDVAYQGFASGSLDEDAASVRLFESRGMEVLVAQSYSKNLGLYAERVG---VI 322

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++A RVKSQLKRLARPMYSNPP+HGARI AN+VG P LF+EWK EMEMMAGRIK+V
Sbjct: 323 SSSPESATRVKSQLKRLARPMYSNPPVHGARIFANIVGTPALFDEWKAEMEMMAGRIKTV 382

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSEN-MSNKWHIYMTKDGRISLAG 345
           RQ LYDS+S KDKSGKDW+FILKQIGMFSFTGLNK+QS+N M+NKWHIYMTKDGRISLAG
Sbjct: 383 RQALYDSISSKDKSGKDWSFILKQIGMFSFTGLNKSQSDNMMTNKWHIYMTKDGRISLAG 442

Query: 344 LSAAKCEYLADAIIDSYYNVS 282
           LS AKCEYLADAIIDSY+NVS
Sbjct: 443 LSLAKCEYLADAIIDSYHNVS 463



>gb:CLJ001360_1647848 Canavalia lineata gene for aspartate
           aminotransferase 2.
          Length = 465

 Score =  322 bits (825), Expect = 6e-87
 Identities = 155/200 (77%), Positives = 179/200 (89%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EKNH PFFDVAYQGFASGSLD DA+SVR+  +RG+EL +A SY K++GLYA+RIGAINV+
Sbjct: 266 EKNHRPFFDVAYQGFASGSLDEDAASVRLLVARGIELFIADSYPKDVGLYAQRIGAINVI 325

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS ++AAR  SQLKR+ARPMYSNPP+HGARIVA++V  P+LF+EWK EMEMMAGRIK+V
Sbjct: 326 SSSPESAARDTSQLKRIARPMYSNPPVHGARIVADLVSKPQLFDEWKAEMEMMAGRIKNV 385

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ LYD +S KDKSGKDW+FILKQIGMFSFTGLNK QS+NM+NKWH+ MTKDGRIS AGL
Sbjct: 386 RQLLYDPISSKDKSGKDWSFILKQIGMFSFTGLNKEQSDNMTNKWHVLMTKDGRISPAGL 445

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           S AKCEYLADAIIDSY+NVS
Sbjct: 446 SLAKCEYLADAIIDSYHNVS 465



>gb:AP003274_1826970 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0512C01.
          Length = 460

 Score =  236 bits (603), Expect = 3e-61
 Identities = 117/188 (62%), Positives = 147/188 (78%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SA
Sbjct: 266 LPFFDSAYQGFASGSLDQDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSA 325

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A RV+SQLK + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L
Sbjct: 326 DVAVRVESQLKLVIRPMYSNPPIHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQL 385

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS   
Sbjct: 386 FDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRT 444

Query: 329 CEYLADAI 306
             +LADAI
Sbjct: 445 IPHLADAI 452



>sp|P37833|AATC_ORYSA Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A).>pir|JC5124|JC5124 aspartate
           transaminase (EC 2.6.1.1), cytosolic -
           rice>gb:AB110193_1526906 Oryza sativa (japonica
           cultivar-group) mRNA for aspartate aminotransferase,
           complete cds, clone: 22C4AG009.>gb:RICAAT_1703509 Oryza
           sativa (japonica cultivar-group) mRNA for aspartate
           aminotransferase, complete cds.>gb:AP003256_1826460
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0460E08.
          Length = 407

 Score =  236 bits (603), Expect = 3e-61
 Identities = 117/188 (62%), Positives = 147/188 (78%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASGSLD DA SVRMF + G ELL+AQSY+KN+GLY ER+GA+++VC SA
Sbjct: 213 LPFFDSAYQGFASGSLDQDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSA 272

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A RV+SQLK + RPMYSNPPIHGA IVA ++ +  +FNEW  E++ MA RI S+RQ+L
Sbjct: 273 DVAVRVESQLKLVIRPMYSNPPIHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQL 332

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  ++  G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGLS   
Sbjct: 333 FDALKTRETPG-DWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRT 391

Query: 329 CEYLADAI 306
             +LADAI
Sbjct: 392 IPHLADAI 399



>gb:AF034210_1762765 Glycine max aspartate aminotransferase
           glyoxysomal isozyme AAT1 precursor and aspartate
           aminotransferase cytosolic isozyme AAT2 (AAT) mRNA,
           complete cds.
          Length = 419

 Score =  233 bits (594), Expect = 4e-60
 Identities = 117/188 (62%), Positives = 148/188 (78%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASGSLDADA  VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SA
Sbjct: 225 LPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSA 284

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A+RV+SQLK + RPMYS+PPIHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L
Sbjct: 285 DVASRVESQLKLVIRPMYSSPPIHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQEL 344

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+  
Sbjct: 345 FDALCSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKT 403

Query: 329 CEYLADAI 306
              LADAI
Sbjct: 404 VPLLADAI 411



>gb:AY128343_1580642 Arabidopsis thaliana aspartate aminotransferase
           Asp2 (At5g19550) mRNA, complete cds.
          Length = 201

 Score =  233 bits (594), Expect = 4e-60
 Identities = 111/191 (58%), Positives = 152/191 (79%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC
Sbjct: 4   KSLLPFFDSAYQGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVC 63

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            SAD A++V+SQ+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+R
Sbjct: 64  KSADVASKVESQVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMR 123

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS
Sbjct: 124 QQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLS 182

Query: 338 AAKCEYLADAI 306
           +    +LADA+
Sbjct: 183 SKTVPHLADAM 193



>gb:ATU15033_1556773 Arabidopsis thaliana aspartate aminotransferase
           (Asp2) mRNA, complete cds.
          Length = 405

 Score =  233 bits (594), Expect = 4e-60
 Identities = 111/191 (58%), Positives = 152/191 (79%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC
Sbjct: 208 KSLLPFFDSAYQGFASGSLDTDAQSVRTFVADGGECLIAQSYTKNMGLYGERVGALSIVC 267

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            SAD A++V+SQ+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+R
Sbjct: 268 KSADVASKVESQVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMR 327

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS
Sbjct: 328 QQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLS 386

Query: 338 AAKCEYLADAI 306
           +    +LADA+
Sbjct: 387 SKTVPHLADAM 397



>pir|T06136|T06136 aspartate transaminase (EC 2.6.1.1) AAT1
           peroxisomal/ glyoxysomal precursor -
           soybean>gb:AF034210_1762764 Glycine max aspartate
           aminotransferase glyoxysomal isozyme AAT1 precursor and
           aspartate aminotransferase cytosolic isozyme AAT2 (AAT)
           mRNA, complete cds.
          Length = 456

 Score =  233 bits (594), Expect = 4e-60
 Identities = 117/188 (62%), Positives = 148/188 (78%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASGSLDADA  VR+F + G ELLVAQSY+KNLGLY ER+GA+++VC SA
Sbjct: 262 LPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNLGLYGERVGALSIVCKSA 321

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A+RV+SQLK + RPMYS+PPIHGA IVA ++ +  LFN+W  E++ MA RI S+RQ+L
Sbjct: 322 DVASRVESQLKLVIRPMYSSPPIHGASIVAAILKDRNLFNDWTIELKAMADRIISMRQEL 381

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+  
Sbjct: 382 FDALCSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFMTKEFHIYMTSDGRISMAGLSSKT 440

Query: 329 CEYLADAI 306
              LADAI
Sbjct: 441 VPLLADAI 448



>sp|P46645|AAT2_ARATH Aspartate aminotransferase, cytoplasmic
           isozyme 1 (EC 2.6.1.1) (Transaminase A).
          Length = 405

 Score =  233 bits (594), Expect = 4e-60
 Identities = 111/191 (58%), Positives = 152/191 (79%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLD DA SVR F + G E L+AQSY+KN+GLY ER+GA+++VC
Sbjct: 208 KSLLPFFDSAYQGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVC 267

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            SAD A++V+SQ+K + RPMYS+PPIHGA IVA ++ + +++N W  E++ MA RIKS+R
Sbjct: 268 KSADVASKVESQVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMR 327

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+L++++  +   G DW+ I+KQIGMF+FTGLNK Q E M+ ++HIYMT DGRIS+AGLS
Sbjct: 328 QQLFEAIQARGTPG-DWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLS 386

Query: 338 AAKCEYLADAI 306
           +    +LADA+
Sbjct: 387 SKTVPHLADAM 397



>gb:AF419301_1798406 Securigera parviflora aspartate
           aminotransferase (CRAAT1) mRNA, partial cds.
          Length = 341

 Score =  232 bits (591), Expect = 8e-60
 Identities = 114/188 (60%), Positives = 147/188 (78%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASGSLDADA SVR F + G ELL+AQSY+KN+GLY ER+GA+++VC SA
Sbjct: 147 LPFFDSAYQGFASGSLDADAQSVRSFVADGGELLMAQSYAKNMGLYGERVGALSIVCKSA 206

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A+  +SQLK + RPMYSNPP+HGA IVA ++ +  L+NEW  E++ MA RI S+RQ+L
Sbjct: 207 DVASLAESQLKLVIRPMYSNPPLHGASIVATILKDRNLYNEWTIELKAMADRIISMRQQL 266

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  K   G DW+ I+KQIGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+  
Sbjct: 267 FDALRAKGTPG-DWSHIIKQIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKT 325

Query: 329 CEYLADAI 306
             +LADAI
Sbjct: 326 VSHLADAI 333



>sp|P28734|AATC_DAUCA Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A).>pir|T14311|T14311 aspartate
           transaminase (EC 2.6.1.1), cytosolic [similarity] -
           carrot>gb:DARAAT_1675538 Daucus carota aspartate
           aminotransferase (cytoplasmic isoform) mRNA, complete
           cds.
          Length = 405

 Score =  232 bits (591), Expect = 8e-60
 Identities = 113/191 (59%), Positives = 152/191 (79%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLDADA SVR+F + G E L AQSY+KN+GLY ER+GA+++VC
Sbjct: 208 KSLLPFFDSAYQGFASGSLDADAQSVRIFVADGGECLAAQSYAKNMGLYGERVGALSIVC 267

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            +AD A++V+SQLK + RPMYS+PP+HGA IVA ++ + +L+NEW  E++ MA RI S+R
Sbjct: 268 KTADVASKVESQLKLVIRPMYSSPPLHGASIVAAILKDGDLYNEWTLELKAMADRIISMR 327

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+L+++L  K   G DW+ I+KQIGMF+FTGLN  Q   M+N++HIY+T DGRIS+AGLS
Sbjct: 328 QELFNALQAKGTPG-DWSHIVKQIGMFTFTGLNSEQVTFMTNEYHIYLTSDGRISMAGLS 386

Query: 338 AAKCEYLADAI 306
           +    +LADAI
Sbjct: 387 SRTVPHLADAI 397



>sp|P46644|AAT3_ARATH Aspartate aminotransferase, chloroplast
           precursor (EC 2.6.1.1) (Transaminase
           A).>pir|T48511|T48511 aspartate transaminase (EC
           2.6.1.1) Asp3 F15N18.110 [similarity] - Arabidopsis
           thaliana>gb:ATF15N18_1548739 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F15N18 (ESSA
           project).>gb:ATU15034_1556774 Arabidopsis thaliana
           aspartate aminotransferase (Asp3) mRNA, complete
           cds.>gb:AY050765_1562275 Arabidopsis thaliana putative
           aspartate aminotransferase Asp3 (At5g11520) mRNA,
           complete cds.>gb:AY079310_1568200 Arabidopsis thaliana
           putative aspartate aminotransferase ASP3 (At5g11520)
           mRNA, complete cds.
          Length = 449

 Score =  232 bits (591), Expect = 8e-60
 Identities = 115/191 (60%), Positives = 148/191 (77%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  +PFFD AYQGFASGSLD DA  +RMF + G E LVAQSY+KN+GLY ER+GA+++VC
Sbjct: 252 KGLMPFFDSAYQGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVC 311

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            SAD A RV+SQLK + RPMYS+PPIHGA IVA ++ +  LFNEW  E++ MA RI S+R
Sbjct: 312 KSADVAGRVESQLKLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMR 371

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           ++L+++L  +   G DW+ I+KQIGMF+FTGLN AQ   M+ ++HIYMT DGRIS+AGLS
Sbjct: 372 KQLFEALRTRGTPG-DWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLS 430

Query: 338 AAKCEYLADAI 306
           +    +LADAI
Sbjct: 431 SKTVPHLADAI 441



>pir|S53303|S53303 aspartate transaminase (EC 2.6.1.1) AAT2 - proso
           millet>gb:PMAAT2_1700704 P.miliaceum mRNA for aspartate
           aminotransferase (pcAAT2).>gb:PNIAATA_1700891 Panicum
           miliaceum gene for cytosolic aspartate aminotransferase,
           complete cds.
          Length = 409

 Score =  230 bits (586), Expect = 3e-59
 Identities = 112/191 (58%), Positives = 148/191 (77%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLD DA  VRMF + G ELL+AQSY+KN+G+Y ER+GA+++VC
Sbjct: 212 KSLLPFFDSAYQGFASGSLDKDAQPVRMFIADGGELLMAQSYAKNMGMYGERVGALSIVC 271

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            SAD AARV+SQLK + RPMYS+PP+HG  +VA ++ + E+F+EW  E++ MA RI S+R
Sbjct: 272 GSADVAARVESQLKLVIRPMYSSPPLHGPSVVATILKDSEMFHEWTVELKAMADRIISMR 331

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   M  ++HIYMT DGRIS+AGL+
Sbjct: 332 QQLFDALKSRGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMRQEYHIYMTSDGRISMAGLN 390

Query: 338 AAKCEYLADAI 306
                +LADAI
Sbjct: 391 MKNVPHLADAI 401



>gb:MSAAT1MR_1687044 M.sativa aat-1 mRNA for aspartate
           aminotransferase.
          Length = 417

 Score =  226 bits (577), Expect = 3e-58
 Identities = 111/191 (58%), Positives = 151/191 (79%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLDADA  VR+F + G ELLVAQSY+KN+GLY ER+GA+++V 
Sbjct: 220 KSLLPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVS 279

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            SAD ++RV+SQLK + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++R
Sbjct: 280 KSADVSSRVESQLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMR 339

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS
Sbjct: 340 QQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLS 398

Query: 338 AAKCEYLADAI 306
           +    +LADAI
Sbjct: 399 SKTVPHLADAI 409



>gb:LUPASPAMP1_1685447 Lupinus angustifolius aspartate
           aminotransferase-P1 gene, complete cds.
          Length = 420

 Score =  226 bits (576), Expect = 5e-58
 Identities = 110/188 (58%), Positives = 148/188 (78%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASGSLD DA +VR+F + G ELL+AQSY+KN+GLY ER+GA+++V  SA
Sbjct: 226 LPFFDSAYQGFASGSLDIDAQAVRLFVADGGELLLAQSYAKNMGLYGERVGALSIVSKSA 285

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A+RV+SQ+K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L
Sbjct: 286 DVASRVESQVKLVVRPMYSNPPIHGASIVAAILRDRDLYNEWTIELKAMADRIIKMRQQL 345

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+  
Sbjct: 346 FDALQSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKT 404

Query: 329 CEYLADAI 306
             +LADAI
Sbjct: 405 VPHLADAI 412



>gb:LUPAATP1A_1685446 L.angustifolius aspartate aminotransferase P1
           (AAT-P1) mRNA, complete cds.
          Length = 420

 Score =  226 bits (576), Expect = 5e-58
 Identities = 110/188 (58%), Positives = 148/188 (78%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASGSLD DA +VR+F + G ELL+AQSY+KN+GLY ER+GA+++V  SA
Sbjct: 226 LPFFDSAYQGFASGSLDIDAQAVRLFVADGGELLLAQSYAKNMGLYGERVGALSIVSKSA 285

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A+RV+SQ+K + RPMYSNPPIHGA IVA ++ + +L+NEW  E++ MA RI  +RQ+L
Sbjct: 286 DVASRVESQVKLVVRPMYSNPPIHGASIVAAILRDRDLYNEWHIELKAMADRIIKMRQQL 345

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS+  
Sbjct: 346 FDALQSRGTPG-DWSHIIKQIGMFTFTGLNAEQVSFLTKEYHIYLTSDGRISMAGLSSKT 404

Query: 329 CEYLADAI 306
             +LADAI
Sbjct: 405 VPHLADAI 412



>gb:LJAAT_1684998 L.japonicus mRNA for aspartate aminotransferase.
          Length = 418

 Score =  224 bits (570), Expect = 2e-57
 Identities = 111/188 (59%), Positives = 146/188 (77%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PFFD AYQGFASG+LDADA SVR F + G ELL AQSY+KN+GLY ER+GA+++V  SA
Sbjct: 224 LPFFDSAYQGFASGNLDADAHSVRSFVADGGELLAAQSYAKNMGLYGERVGALSIVSKSA 283

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A+ V+SQLK + RPMYSNPP+HGA IVA ++ + +L+NEW  E++ MA RI S+RQ+L
Sbjct: 284 DVASLVESQLKLVIRPMYSNPPLHGASIVATILKDRDLYNEWTIELKGMADRIISMRQQL 343

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D+L  +   G DW+ I+K IGMF+FTGLN  Q   M+ ++HIY+T DGRIS+AGLS+  
Sbjct: 344 FDALRSRGTPG-DWSHIIKSIGMFTFTGLNPEQVSFMTKEYHIYLTSDGRISMAGLSSKT 402

Query: 329 CEYLADAI 306
             +LADAI
Sbjct: 403 VPHLADAI 410



>sp|P28011|AAT1_MEDSA Aspartate aminotransferase 1 (EC 2.6.1.1)
           (Transaminase A).>pir|S46315|S46315 aspartate
           transaminase (EC 2.6.1.1) - alfalfa>gb:ALFAAT1A_1818954
           Medicago sativa aspartate aminotransferase (AAT1) gene,
           complete cds.
          Length = 418

 Score =  224 bits (570), Expect = 2e-57
 Identities = 110/191 (57%), Positives = 150/191 (78%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLDADA  VR+F + G ELLVAQSY+KN+GLY ER+GA+++V 
Sbjct: 221 KSLLPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVS 280

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            SAD ++RV+SQLK + RPMYS+PPIHGA IVA ++ + +L+N+W  E++ MA RI ++R
Sbjct: 281 KSADVSSRVESQLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMR 340

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+L+D+L  +   G DW+ I+KQIGMF+FTGLN  Q   ++ ++HIY+T DGRIS+AGLS
Sbjct: 341 QQLFDALRARGTPG-DWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLS 399

Query: 338 AAKCEYLADAI 306
           +    +LA AI
Sbjct: 400 SKTVPHLAHAI 410



>gb:ATU15035_1556775 Arabidopsis thaliana aspartate aminotransferase
           (Asp4) mRNA, complete cds.
          Length = 403

 Score =  216 bits (549), Expect = 6e-55
 Identities = 106/191 (55%), Positives = 144/191 (75%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLDADA +VRMF + G E L+AQSY+KN+GLY ERIG++ +VC
Sbjct: 206 KSLLPFFDSAYQGFASGSLDADAQAVRMFVADGGECLIAQSYAKNMGLYGERIGSLTIVC 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +S D A +V++Q+  + RPMY  PPIHGA IVA ++ N +++N+W  E++ MA RI S+R
Sbjct: 266 TSEDVAKKVENQVLLVVRPMYLTPPIHGASIVATILKNSDMYNDWTIELKGMADRIISMR 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+LY +L  +   G DW+ I+K IGMF+FTGL++ Q   M+ ++HIYMT DGRIS+A LS
Sbjct: 326 QQLYAALEARGTPG-DWSHIIKHIGMFTFTGLSEEQVRLMAKEYHIYMTYDGRISMASLS 384

Query: 338 AAKCEYLADAI 306
           +     LADAI
Sbjct: 385 SKTVPQLADAI 395



>sp|P46646|AAT4_ARATH Aspartate aminotransferase, cytoplasmic
           isozyme 2 (EC 2.6.1.1) (Transaminase A).
          Length = 403

 Score =  216 bits (549), Expect = 6e-55
 Identities = 106/191 (55%), Positives = 144/191 (75%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLDADA +VRMF + G E L+AQSY+KN+GLY ERIG++ +VC
Sbjct: 206 KSLLPFFDSAYQGFASGSLDADAQAVRMFVADGGECLIAQSYAKNMGLYGERIGSLTIVC 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +S D A +V++Q+  + RPMY  PPIHGA IVA ++ N +++N+W  E++ MA RI S+R
Sbjct: 266 TSEDVAKKVENQVLLVVRPMYLTPPIHGASIVATILKNSDMYNDWTIELKGMADRIISMR 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q+LY +L  +   G DW+ I+K IGMF+FTGL++ Q   M+ ++HIYMT DGRIS+A LS
Sbjct: 326 QQLYAALEARGTPG-DWSHIIKHIGMFTFTGLSEEQVRLMAKEYHIYMTYDGRISMASLS 384

Query: 338 AAKCEYLADAI 306
           +     LADAI
Sbjct: 385 SKTVPQLADAI 395



>gb:AE017353_1759964 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 413

 Score =  209 bits (533), Expect = 4e-53
 Identities = 97/191 (50%), Positives = 145/191 (75%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H+P FD+AYQGFASG +  DA +VR F  +G ++++ QS++KNLGLYAER G  ++VC
Sbjct: 210 KKHLPLFDMAYQGFASGDIIRDAFAVRYFVEQGHQIILCQSFAKNLGLYAERAGTFSMVC 269

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +S +   RV SQ+KR+ RP+YS+PPIHGA++VA ++G PEL++EW  E++ MA RI ++R
Sbjct: 270 ASPEEKERVMSQIKRVVRPLYSSPPIHGAQLVATILGTPELYDEWLTEVKKMADRIIAMR 329

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           +KLY +L ++ K+  +W  I  QIGMFSFTG++K Q ++++   H+YMTKDGRIS+AGL+
Sbjct: 330 EKLY-NLLIELKTPGEWGHIKSQIGMFSFTGISKEQVDDLAEYAHVYMTKDGRISMAGLN 388

Query: 338 AAKCEYLADAI 306
               +Y A+++
Sbjct: 389 EHNIQYFAESL 399



>gb:AE017353_1760018 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 453

 Score =  208 bits (530), Expect = 1e-52
 Identities = 102/192 (53%), Positives = 138/192 (71%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK H PFFD+AYQGFASG    DA +VR F  +G +LL+ QS++KN+GLY ER GAI+ V
Sbjct: 255 EKKHFPFFDMAYQGFASGDTLKDAFAVRYFVEQGHQLLLCQSFAKNMGLYGERAGAISFV 314

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C S +  ARV SQLK + RPMYSNPP+HGAR+V+ ++G+PEL  EW  E++ MA RI  +
Sbjct: 315 CESPEEKARVDSQLKIIIRPMYSNPPVHGARLVSTILGSPELTKEWLVEVKGMADRIIEM 374

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R++LY+ L   D  G +W  I  QIGMFSFTGL   Q + ++ K  IY+T+DGRIS+AGL
Sbjct: 375 RERLYNKLVELDTPG-EWGHIKSQIGMFSFTGLKPEQVDKLAEKASIYLTRDGRISMAGL 433

Query: 341 SAAKCEYLADAI 306
           ++   +Y A+++
Sbjct: 434 NSNNVDYFAESV 445



>gb:BC054684_2551085 Danio rerio zgc:66329, mRNA (cDNA clone
           MGC:66329 IMAGE:5602691), complete cds.
          Length = 428

 Score =  206 bits (524), Expect = 5e-52
 Identities = 102/192 (53%), Positives = 139/192 (72%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N + FFD+AYQGFASG +D DA +VR F  +G  +L++QS++KN+GLY ER+G   VV
Sbjct: 233 KRNLLVFFDMAYQGFASGDIDRDAWAVRYFIEQGHNILLSQSFAKNMGLYGERVGGFTVV 292

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RP+YSNPP++GARI A ++  PEL+ EW QE++ MA RI  +
Sbjct: 293 CKDAEEAKRVESQLKILIRPIYSNPPMNGARIAATILNTPELYKEWLQEVKGMADRIIRM 352

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ L  +L  K+ S  +W  +  QIGMF FTGL   Q E + N++ IYMTKDGRIS+AG+
Sbjct: 353 REMLVSNLK-KEGSTHNWQHVTDQIGMFCFTGLKPEQVERLINEFSIYMTKDGRISVAGV 411

Query: 341 SAAKCEYLADAI 306
           ++A  EYLA AI
Sbjct: 412 TSANVEYLAHAI 423



>gb:BC056110_2551692 Xenopus laevis glutamate oxaloacetate
           transaminase 2, mRNA (cDNA clone MGC:69130
           IMAGE:5048189), complete cds.
          Length = 427

 Score =  204 bits (520), Expect = 1e-51
 Identities = 104/187 (55%), Positives = 137/187 (73%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD+AYQGFASG  D DA +VR F   G+ L+++QSY+KN+GLY ER+GA  VVCS A+
Sbjct: 237 PFFDMAYQGFASGDTDRDAWAVRHFIQEGINLVLSQSYAKNMGLYGERVGAFTVVCSDAE 296

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
            A RV+SQ+K L RPMYSNPP++GARI A+++  P+L  EW QE++ MA RI S+R++L 
Sbjct: 297 EAKRVESQIKILIRPMYSNPPLNGARIAASILTQPDLRKEWLQEVKGMANRIISMREQLV 356

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
            +L  K+ S  +W  I  QIGMF FTGL   Q E +  ++ IYMTKDGRIS+AG+++A  
Sbjct: 357 SNLK-KEGSIHNWQHISDQIGMFCFTGLRPEQVERLIKEFSIYMTKDGRISVAGVTSANN 415

Query: 326 EYLADAI 306
            YLA AI
Sbjct: 416 GYLAHAI 422



>gb:AF395206_1267737 Aedes aegypti aspartate aminotransferase (mAAT)
           mRNA, complete cds; nuclear gene for mitochondrial
           product.
          Length = 429

 Score =  204 bits (518), Expect = 2e-51
 Identities = 98/192 (51%), Positives = 141/192 (73%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N  PFFD+AYQGFASG +  DA +VR F   G ++ +AQS++KN+GLY ER GA +++
Sbjct: 234 KRNLFPFFDMAYQGFASGDVAKDALAVRAFLKDGHQIALAQSFAKNMGLYGERAGAFSLI 293

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CS  + AAR  SQ+K L RPMYSNPPIHGAR+V+ ++G+  L  EW  ++++MA RI SV
Sbjct: 294 CSDKEEAARTMSQIKILIRPMYSNPPIHGARLVSEILGDANLKQEWLGDVKLMADRIISV 353

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R KL D+L  K  S ++W  I +QIGMF FTG+++ Q E ++ ++ +Y+TKDGRIS+AG+
Sbjct: 354 RTKLQDNLK-KLGSSRNWQHITEQIGMFCFTGMDQKQCERLTKEFSVYLTKDGRISMAGV 412

Query: 341 SAAKCEYLADAI 306
           +    +YLA+AI
Sbjct: 413 TTKNVDYLAEAI 424



>gb:CR382132_1666150 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 431

 Score =  200 bits (508), Expect = 3e-50
 Identities = 102/190 (53%), Positives = 132/190 (69%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K   PFFD AYQGFASG L+ DA +V+ F S+GLELL+ QS++KN GLY +R G ++ + 
Sbjct: 236 KKLFPFFDSAYQGFASGDLERDAWAVQYFVSQGLELLICQSFAKNFGLYGQRAGCLHFIT 295

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            +A A+  VKSQL  L R   SNPPI+GARIVA V+ NPELFNEWK+ +  MA RIKS+R
Sbjct: 296 QTAKASENVKSQLAFLQRSEISNPPIYGARIVARVLNNPELFNEWKENLLEMANRIKSMR 355

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L   L   D  G +W  I  QIGMFSFTGL+  Q + + N++H+Y+TK+GRIS+AGL+
Sbjct: 356 DALKSELIKLDTPG-NWDHITNQIGMFSFTGLSPQQVDRLVNEFHVYLTKNGRISMAGLN 414

Query: 338 AAKCEYLADA 309
                Y+A A
Sbjct: 415 THNVAYVAKA 424



>gb:MMU82470_2123631 Mus musculus aspartate aminotransferase
           precursor (Got-2) mRNA, Got-2-a allele, complete cds;
           nuclear gene for mitochondrial product.
          Length = 430

 Score =  199 bits (506), Expect = 6e-50
 Identities = 100/192 (52%), Positives = 136/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KN   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  VV
Sbjct: 235 KKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RP+YSNPP++GARI A ++ +P+L  +W QE++ MA RI S+
Sbjct: 295 CKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E ++ ++ +YMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           ++    YLA AI
Sbjct: 414 TSGNVGYLAHAI 425



>pir|S01174|S01174 aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial - mouse>gb:MUSASPT10_2125186 Mouse
           mitochondrial aspartate aminotransferase gene, exon 10,
           complete cds.
          Length = 433

 Score =  199 bits (506), Expect = 6e-50
 Identities = 100/192 (52%), Positives = 136/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KN   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  VV
Sbjct: 238 KKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVV 297

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RP+YSNPP++GARI A ++ +P+L  +W QE++ MA RI S+
Sbjct: 298 CKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISM 357

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E ++ ++ +YMTKDGRIS+AG+
Sbjct: 358 RTQLVSNLK-KEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGV 416

Query: 341 SAAKCEYLADAI 306
           ++    YLA AI
Sbjct: 417 TSGNVGYLAHAI 428



>sp|P00507|AATM_RAT Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase A) (Glutamate
           oxaloacetate transaminase-2).>pir|A28005|XNRTDM
           aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial - rat>gb:BC061792_2104653 Rattus
           norvegicus glutamate oxaloacetate transaminase 2, mRNA
           (cDNA clone MGC:72536 IMAGE:5597941), complete
           cds.>gb:RATASPATA_2131535 Rattus norvegicus
           mitochondrial aspartate aminotransferase mRNA, complete
           cds.
          Length = 430

 Score =  199 bits (506), Expect = 6e-50
 Identities = 100/192 (52%), Positives = 136/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KN   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  VV
Sbjct: 235 KKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RP+YSNPP++GARI A ++ +P+L  +W QE++ MA RI S+
Sbjct: 295 CKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E ++ ++ +YMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           ++    YLA AI
Sbjct: 414 TSGNVGYLAHAI 425



>sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase A) (Glutamate
           oxaloacetate transaminase-2).>gb:BC089015_2110675 Mus
           musculus glutamate oxaloacetate transaminase 2,
           mitochondrial, mRNA (cDNA clone MGC:115763
           IMAGE:30606379), complete cds.>gb:BC089341_2110788 Mus
           musculus glutamate oxaloacetate transaminase 2,
           mitochondrial, mRNA (cDNA clone MGC:102129
           IMAGE:6832287), complete cds.>gb:MMAT01_2114223 Mus
           musculus aspartate aminotransferase gene 5'-flank and
           exon 1 (joined CDS).>gb:MUSASPATM_2125185 Mouse
           mitochondrial aspartate aminotransferase isoenzyme mRNA,
           complete cds.
          Length = 430

 Score =  199 bits (506), Expect = 6e-50
 Identities = 100/192 (52%), Positives = 136/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KN   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  VV
Sbjct: 235 KKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RP+YSNPP++GARI A ++ +P+L  +W QE++ MA RI S+
Sbjct: 295 CKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E ++ ++ +YMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           ++    YLA AI
Sbjct: 414 TSGNVGYLAHAI 425



>pir|H96652|H96652 protein F23N19.17 [imported] - Arabidopsis
           thaliana>gb:AE005173_893948 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007190_1535517 Genomic sequence for
           Arabidopsis thaliana BAC F23N19 from chromosome I,
           complete sequence.
          Length = 387

 Score =  198 bits (504), Expect = 1e-49
 Identities = 95/172 (55%), Positives = 131/172 (76%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+ +PFFD AYQGFASGSLDADA +VRMF + G E L+AQSY+KN+GLY ERIG++ +VC
Sbjct: 217 KSLLPFFDSAYQGFASGSLDADAQAVRMFVADGGECLIAQSYAKNMGLYGERIGSLTIVC 276

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +S D A +V++Q+  + RPMY  PPIHGA IVA ++ N +++N+W  E++ MA RI S+R
Sbjct: 277 TSEDVAKKVENQVLLVVRPMYLTPPIHGASIVATILKNSDMYNDWTIELKGMADRIISMR 336

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDG 363
           Q+LY +L  +   G DW+ I+K IGMF+FTGL++ Q   M+ ++HIYMT DG
Sbjct: 337 QQLYAALEARGTPG-DWSHIIKHIGMFTFTGLSEEQVRLMAKEYHIYMTYDG 387



>gb:BC000525_1966799 Homo sapiens glutamic-oxaloacetic transaminase
           2, mitochondrial (aspartate aminotransferase 2), mRNA
           (cDNA clone MGC:8599 IMAGE:2961181), complete cds.
          Length = 430

 Score =  198 bits (503), Expect = 1e-49
 Identities = 100/192 (52%), Positives = 135/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  +V
Sbjct: 235 KRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  AD A RV+SQLK L RPMYSNPP++GARI A ++  P+L  +W QE+++MA RI  +
Sbjct: 295 CKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E +  ++ IYMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           +++   YLA AI
Sbjct: 414 TSSNVGYLAHAI 425



>gb:BC049435_2550243 Danio rerio zgc:56425, mRNA (cDNA clone
           MGC:56425 IMAGE:5611915), complete cds.
          Length = 428

 Score =  197 bits (501), Expect = 2e-49
 Identities = 97/192 (50%), Positives = 136/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  +PFFD+AYQGFASG +D DA +VR F  +G  +L++QS++KN+GLY ER+G   VV
Sbjct: 233 ERKLLPFFDMAYQGFASGDIDRDAWAVRYFIEQGHNILLSQSFAKNMGLYGERVGGFTVV 292

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RP+YSNPP++GARI + ++  PEL + W +E++ MA RI  +
Sbjct: 293 CGDAEEAKRVESQLKILIRPIYSNPPMNGARIASTILTTPELRSTWLEEVKGMADRIIRM 352

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ L  +L  K+ S  +W  +  QIGMF FTGL   Q E ++  + +YMTKDGRIS+AG+
Sbjct: 353 REMLVTNLK-KEGSTHNWQHVTDQIGMFCFTGLKPEQVERLTKDFSVYMTKDGRISVAGV 411

Query: 341 SAAKCEYLADAI 306
           ++   EYLA AI
Sbjct: 412 TSGNVEYLAHAI 423



>gb:AF003140_1230833 Caenorhabditis elegans cosmid C44E4, complete
           sequence.
          Length = 419

 Score =  196 bits (499), Expect = 4e-49
 Identities = 94/194 (48%), Positives = 136/194 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  +PFFD+AYQGFASG +D DA ++R F  +G  +LVAQS++KN+GLY ER+GA ++V
Sbjct: 224 ERKILPFFDMAYQGFASGDVDDDAFALRHFIEQGHNVLVAQSFAKNMGLYGERVGAFSIV 283

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C SA+ A RV SQ++ + RPM S PP+HGARI + ++ NPEL   W +++++MA RIKS+
Sbjct: 284 CDSAEEAIRVGSQMRIIIRPMISMPPLHGARIASRILSNPELKKSWLEDVKLMADRIKSM 343

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L   + S  +W  I  QIGMF FTG+N+ Q + +  +  +Y+T DGRIS++G+
Sbjct: 344 RTALKDGLK-AEGSTLNWDHITNQIGMFCFTGINEKQVQKLIKEHSVYLTNDGRISISGI 402

Query: 341 SAAKCEYLADAIID 300
           +     YLA A+ D
Sbjct: 403 NTGNVAYLAKALHD 416



>gb:CR857622_1181845 Pongo pygmaeus mRNA; cDNA DKFZp459L1636 (from
           clone DKFZp459L1636).
          Length = 430

 Score =  196 bits (499), Expect = 4e-49
 Identities = 100/192 (52%), Positives = 134/192 (69%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  +V
Sbjct: 235 KRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  AD A RV+SQLK L RPMYSNPP++GARI A ++  P+L  +W QE++ MA RI  +
Sbjct: 295 CKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E +  ++ IYMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           +++   YLA AI
Sbjct: 414 TSSNVGYLAHAI 425



>pir|T30955|T30955 probable aspartate transaminase (EC 2.6.1.1)
           C44E4.3 [similarity] - Caenorhabditis elegans
          Length = 449

 Score =  196 bits (499), Expect = 4e-49
 Identities = 94/194 (48%), Positives = 136/194 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  +PFFD+AYQGFASG +D DA ++R F  +G  +LVAQS++KN+GLY ER+GA ++V
Sbjct: 254 ERKILPFFDMAYQGFASGDVDDDAFALRHFIEQGHNVLVAQSFAKNMGLYGERVGAFSIV 313

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C SA+ A RV SQ++ + RPM S PP+HGARI + ++ NPEL   W +++++MA RIKS+
Sbjct: 314 CDSAEEAIRVGSQMRIIIRPMISMPPLHGARIASRILSNPELKKSWLEDVKLMADRIKSM 373

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L   + S  +W  I  QIGMF FTG+N+ Q + +  +  +Y+T DGRIS++G+
Sbjct: 374 RTALKDGLK-AEGSTLNWDHITNQIGMFCFTGINEKQVQKLIKEHSVYLTNDGRISISGI 432

Query: 341 SAAKCEYLADAIID 300
           +     YLA A+ D
Sbjct: 433 NTGNVAYLAKALHD 446



>pir|H87756|H87756 protein C44E4.3 [imported] - Caenorhabditis
           elegans
          Length = 418

 Score =  196 bits (499), Expect = 4e-49
 Identities = 94/194 (48%), Positives = 136/194 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  +PFFD+AYQGFASG +D DA ++R F  +G  +LVAQS++KN+GLY ER+GA ++V
Sbjct: 223 ERKILPFFDMAYQGFASGDVDDDAFALRHFIEQGHNVLVAQSFAKNMGLYGERVGAFSIV 282

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C SA+ A RV SQ++ + RPM S PP+HGARI + ++ NPEL   W +++++MA RIKS+
Sbjct: 283 CDSAEEAIRVGSQMRIIIRPMISMPPLHGARIASRILSNPELKKSWLEDVKLMADRIKSM 342

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L   + S  +W  I  QIGMF FTG+N+ Q + +  +  +Y+T DGRIS++G+
Sbjct: 343 RTALKDGLK-AEGSTLNWDHITNQIGMFCFTGINEKQVQKLIKEHSVYLTNDGRISISGI 401

Query: 341 SAAKCEYLADAIID 300
           +     YLA A+ D
Sbjct: 402 NTGNVAYLAKALHD 415



>sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase A) (Glutamate
           oxaloacetate transaminase-2).>pir|A31873|XNHUDM
           aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial [validated] - human>gb:HUMASPAT_2029412
           Human mitochondrial aspartate aminotransferase mRNA,
           complete cds.
          Length = 430

 Score =  196 bits (499), Expect = 4e-49
 Identities = 100/192 (52%), Positives = 134/192 (69%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  +V
Sbjct: 235 KRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  AD A RV+SQLK L RPMYSNPP++GARI A ++  P+L  +W QE++ MA RI  +
Sbjct: 295 CKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E +  ++ IYMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           +++   YLA AI
Sbjct: 414 TSSNVGYLAHAI 425



>pir|T15494|T15494 aspartate transaminase (EC 2.6.1.1) C14F11.1
           [similarity] - Caenorhabditis elegans>gb:U39645_1402961
           Caenorhabditis elegans cosmid C14F11, complete sequence.
          Length = 414

 Score =  196 bits (498), Expect = 5e-49
 Identities = 96/192 (50%), Positives = 138/192 (71%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N   FFD+AYQGFASG +D DA +VR F  +G  ++++QS++KN+GLY ER+GA +VV
Sbjct: 219 KRNLFVFFDMAYQGFASGDVDNDAFAVRYFVEQGHNIVLSQSFAKNMGLYGERVGAFSVV 278

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            S AD AARV SQ+K L RP+YSNPP+HGARI + ++ +P L  +W  ++++MA RI ++
Sbjct: 279 TSDADEAARVASQVKILIRPLYSNPPVHGARIASRILADPALNKQWLGDVKLMADRIITM 338

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L+ K+ S ++W  I  QIGMF FTG+N  Q E +  +  +Y+TKDGRIS+AG+
Sbjct: 339 RTTLKDLLA-KEGSTRNWEHITNQIGMFCFTGINPQQVEKLIKEHSVYLTKDGRISVAGI 397

Query: 341 SAAKCEYLADAI 306
           S+    YLA A+
Sbjct: 398 SSNNVAYLAHAL 409



>sp|P00506|AATM_PIG Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase A) (Glutamate
           oxaloacetate transaminase-2).>pir|A25165|XNPGDM
           aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial - pig>gb:PIGASPAT_1443058 Pig
           mitochondrial aspartate aminotransferase mRNA, complete
           cds.
          Length = 430

 Score =  196 bits (498), Expect = 5e-49
 Identities = 98/192 (51%), Positives = 136/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           + N   FFD+AYQGFASG  + DA +VR F  +G+ + + QSY+KN+GLY ER+GA  VV
Sbjct: 235 KNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RPMYSNPP++GARI + ++ +P+L  +W QE++ MA RI S+
Sbjct: 295 CKDAEEAKRVESQLKILIRPMYSNPPVNGARIASTILTSPDLRQQWLQEVKGMADRIISM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I+ QIGMF FTG+   Q E ++ ++ IYMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSSHNWQHIVDQIGMFCFTGIKPEQVERLTKEFSIYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           ++    YLA AI
Sbjct: 414 TSGNVGYLAHAI 425



>sp|P00508|AATM_CHICK Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase A) (Glutamate
           oxaloacetate transaminase-2).>pir|A24554|XNCHDM
           aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial - chicken>gb:CHKASPATM_2568780 Chicken
           mitochondrial isoenzyme of aspartate aminotransferase
           mRNA, complete cds.
          Length = 423

 Score =  196 bits (497), Expect = 7e-49
 Identities = 97/192 (50%), Positives = 139/192 (72%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N + +FD+AYQGFASG ++ DA ++R F  +G++++++QSY+KN+GLY ER GA  V+
Sbjct: 228 KRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVI 287

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RPMYSNPP++GARI + ++  PEL  EW  E++ MA RI S+
Sbjct: 288 CRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISM 347

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E ++ ++ IYMTKDGRIS+AG+
Sbjct: 348 RTQLVSNLK-KEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGV 406

Query: 341 SAAKCEYLADAI 306
           +++   YLA AI
Sbjct: 407 ASSNVGYLAHAI 418



>gb:CR860094_1184185 Pongo pygmaeus mRNA; cDNA DKFZp469B0125 (from
           clone DKFZp469B0125).
          Length = 430

 Score =  195 bits (496), Expect = 9e-49
 Identities = 100/192 (52%), Positives = 133/192 (69%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N   FFD+AYQGFASG  D DA +VR F  +G+ + + QSY+KN+GLY ER+GA  +V
Sbjct: 235 KRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  AD A RV+SQLK L RPMYSNPP++GARI A ++  P+L   W QE++ MA RI  +
Sbjct: 295 CKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKTWLQEVKGMADRIIGM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I  QIGMF FTGL   Q E +  ++ IYMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           +++   YLA AI
Sbjct: 414 TSSNVGYLAHAI 425



>sp|P08907|AATM_HORSE Aspartate aminotransferase, mitochondrial (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-2).>pir|B26341|B26341 aspartate
           transaminase (EC 2.6.1.1), mitochondrial - horse
          Length = 401

 Score =  195 bits (495), Expect = 1e-48
 Identities = 98/192 (51%), Positives = 134/192 (69%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           + N   FFD+AYQGFASG  + DA +VR F  +G+ + + QSY+KN+GLY ER+GA  +V
Sbjct: 206 KNNLFAFFDMAYQGFASGDGNKDAWAVRYFIEQGINVCLCQSYAKNMGLYGERVGAFTMV 265

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  AD A RV+SQLK L RP+YSNPP++GARI + ++ +P+L  +W QE++ MA RI S+
Sbjct: 266 CKDADEAKRVESQLKILIRPLYSNPPLNGARIASTILTSPDLRKQWLQEVKGMADRIISM 325

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S   W  I  QIGMF FTGL   Q E ++ ++ IYMTKDGRIS+AG+
Sbjct: 326 RTQLVSNLK-KEGSSHSWQHIADQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGV 384

Query: 341 SAAKCEYLADAI 306
           ++    YLA AI
Sbjct: 385 TSGNVGYLAHAI 396



>sp|P12344|AATM_BOVIN Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase A) (Glutamate
           oxaloacetate transaminase-2).>pir|S35960|S35960
           aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial - bovine>gb:BTASPAMTA_1436889 B.taurus
           mitochondrial aspartate aminotransferase mRNA, complete
           CDS.
          Length = 430

 Score =  195 bits (495), Expect = 1e-48
 Identities = 98/192 (51%), Positives = 135/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           + N   FFD+AYQGFASG  + DA +VR F  +G+ + + QSY+KN+GLY ER+GA  VV
Sbjct: 235 KNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVV 294

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  A+ A RV+SQLK L RPMYSNPPI+GARI + ++ +P+L  +W  E++ MA RI S+
Sbjct: 295 CKDAEEAKRVESQLKILIRPMYSNPPINGARIASTILTSPDLRKQWLHEVKGMADRIISM 354

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L  +L  K+ S  +W  I+ QIGMF +TGL   Q E ++ ++ IYMTKDGRIS+AG+
Sbjct: 355 RTQLVSNLK-KEGSSHNWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTKDGRISVAGV 413

Query: 341 SAAKCEYLADAI 306
           ++    YLA AI
Sbjct: 414 TSGNVAYLAHAI 425



>pir|S56678|S56678 aspartate transaminase (EC 2.6.1.1) precursor -
           soybean>gb:SOYMAA_1716045 Glycine max (clone pSAT2)
           nuclear-encoded mitochondrial aspartate aminotransferase
           mRNA, complete cds.
          Length = 427

 Score =  192 bits (488), Expect = 7e-48
 Identities = 94/191 (49%), Positives = 134/191 (70%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H PFFD+AYQGFASG  + DA ++++F   G  + +AQSY+KN+GLY +R G+++V+C
Sbjct: 231 KGHFPFFDMAYQGFASGDPERDAKAIKIFLEDGHLIGLAQSYAKNMGLYGQRAGSLSVLC 290

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                A  VKSQL+ +ARPMYSNPP+HGA IV+ V+G+P+L   W +E+++MA RI  +R
Sbjct: 291 EDEKQAVAVKSQLQLIARPMYSNPPLHGALIVSTVLGDPDLKKLWLKEVKVMADRIIGMR 350

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L ++L  K  S   W  I  QIGMF ++GL   Q + M+N++HIYMT++GRIS+AGL+
Sbjct: 351 TTLRENLE-KKGSTLPWQHITNQIGMFCYSGLTPEQVDRMTNEFHIYMTRNGRISMAGLN 409

Query: 338 AAKCEYLADAI 306
                Y+ DAI
Sbjct: 410 TGNVGYVLDAI 420



>gb:AY069166_1293896 Drosophila melanogaster GH20337 full length
           cDNA.
          Length = 393

 Score =  192 bits (487), Expect = 9e-48
 Identities = 93/192 (48%), Positives = 135/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N  PF D+AYQGFA+G +D DA +VR F + G +  +AQS++KN+GLY ER GA  V+
Sbjct: 198 KRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVL 257

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CS  + AARV SQ+K L R +YSNPP+HGARI A ++ N +L  +W +++++MA RI  V
Sbjct: 258 CSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDV 317

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R KL D+L +K  S ++W  I+ QIGMF FTGL   Q + +     +Y+T DGR+S+AG+
Sbjct: 318 RTKLKDNL-IKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGV 376

Query: 341 SAAKCEYLADAI 306
           ++   EYLA++I
Sbjct: 377 TSKNVEYLAESI 388



>gb:AE014134_1127076 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003584_1216511 Drosophila melanogaster
           chromosome 2L, section 7 of 83 of the complete sequence.
          Length = 431

 Score =  192 bits (487), Expect = 9e-48
 Identities = 93/192 (48%), Positives = 135/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N  PF D+AYQGFA+G +D DA +VR F + G +  +AQS++KN+GLY ER GA  V+
Sbjct: 236 KRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVL 295

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CS  + AARV SQ+K L R +YSNPP+HGARI A ++ N +L  +W +++++MA RI  V
Sbjct: 296 CSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDV 355

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R KL D+L +K  S ++W  I+ QIGMF FTGL   Q + +     +Y+T DGR+S+AG+
Sbjct: 356 RTKLKDNL-IKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGV 414

Query: 341 SAAKCEYLADAI 306
           ++   EYLA++I
Sbjct: 415 TSKNVEYLAESI 426



>gb:AE014134_1127075 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003584_1216510 Drosophila melanogaster
           chromosome 2L, section 7 of 83 of the complete sequence.
          Length = 424

 Score =  192 bits (487), Expect = 9e-48
 Identities = 93/192 (48%), Positives = 135/192 (70%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++N  PF D+AYQGFA+G +D DA +VR F + G +  +AQS++KN+GLY ER GA  V+
Sbjct: 229 KRNLYPFIDMAYQGFATGDIDRDAQAVRTFEADGHDFCLAQSFAKNMGLYGERAGAFTVL 288

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           CS  + AARV SQ+K L R +YSNPP+HGARI A ++ N +L  +W +++++MA RI  V
Sbjct: 289 CSDEEEAARVMSQVKILIRGLYSNPPVHGARIAAEILNNEDLRAQWLKDVKLMADRIIDV 348

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R KL D+L +K  S ++W  I+ QIGMF FTGL   Q + +     +Y+T DGR+S+AG+
Sbjct: 349 RTKLKDNL-IKLGSSQNWDHIVNQIGMFCFTGLKPEQVQKLIKDHSVYLTNDGRVSMAGV 407

Query: 341 SAAKCEYLADAI 306
           ++   EYLA++I
Sbjct: 408 TSKNVEYLAESI 419



>sp|P46643|AAT1_ARATH Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase
           A).>pir|H84714|H84714 aspartate aminotransferase (AAT1)
           [imported] - Arabidopsis thaliana>gb:AC004669_1531991
           Arabidopsis thaliana chromosome 2 clone F7F1 map m283,
           complete sequence.>gb:ATU15026_1556772 Arabidopsis
           thaliana aspartate aminotransferase (Asp1) mRNA,
           complete cds.>gb:AY059912_1564756 Arabidopsis thaliana
           aspartate aminotransferase (AAT1) (At2g30970; F7F1.18)
           mRNA, complete cds.>gb:AY128806_1580886 Arabidopsis
           thaliana aspartate aminotransferase AAT1 (At2g30970)
           mRNA, complete cds.
          Length = 430

 Score =  191 bits (486), Expect = 1e-47
 Identities = 92/191 (48%), Positives = 136/191 (71%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H  FFD+AYQGFASG    DA S+R+F   G  + ++QSY+KN+GLY +R+G ++V+C
Sbjct: 234 KKHFAFFDMAYQGFASGDPARDAKSIRIFLEDGHHIGISQSYAKNMGLYGQRVGCLSVLC 293

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                A  VKSQL++LARPMYSNPP+HGA++V+ ++ +PEL + W +E+++MA RI  +R
Sbjct: 294 EDPKQAVAVKSQLQQLARPMYSNPPLHGAQLVSTILEDPELKSLWLKEVKVMADRIIGMR 353

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L +SL  K  S   W  + KQIGMF ++GL   Q + +++++HIYMT++GRIS+AG++
Sbjct: 354 TTLRESLE-KLGSPLSWEHVTKQIGMFCYSGLTPEQVDRLTSEYHIYMTRNGRISMAGVT 412

Query: 338 AAKCEYLADAI 306
                YLA+AI
Sbjct: 413 TGNVGYLANAI 423



>pir|S22379|S22379 aspartate transaminase (EC 2.6.1.1) AAT3
           precursor - proso millet>gb:PMAAT3_1700705 P.miliaceum
           mRNA for aspartate aminotransferase
           (pmAAT3).>gb:PNIAATB_1700892 Panicum miliaceum gene for
           mitochondrial aspartate aminotransferase, complete cds.
          Length = 428

 Score =  190 bits (483), Expect = 3e-47
 Identities = 90/191 (47%), Positives = 135/191 (70%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H PFFD+AYQGFASG  + DA ++R+F   G ++  AQSY+KN+GLY +R+G ++++C
Sbjct: 234 KKHFPFFDMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRVGCLSILC 293

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                A  VKSQL+++ARPMYSNPP+HGA +V+ ++ +PEL + W +E++ MA RI  +R
Sbjct: 294 EDEMQAVSVKSQLQQIARPMYSNPPVHGALVVSIILSDPELKSLWLKEVKGMADRIIGMR 353

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L ++L  K  S   W  I  QIGMF ++G+   Q + ++N++HIYMT++GRIS+AG++
Sbjct: 354 TALKENLE-KLGSSLSWEHITNQIGMFCYSGMTPEQVDRLTNEFHIYMTRNGRISMAGVT 412

Query: 338 AAKCEYLADAI 306
                YLA+AI
Sbjct: 413 TGNVAYLANAI 423



>pir|S22377|S22377 aspartate transaminase (EC 2.6.1.1) AAT1
           precursor - proso millet>gb:PMAAT1_1700703 P.miliaceum
           mRNA for aspartate aminotransferase (pmAAT1).
          Length = 428

 Score =  189 bits (481), Expect = 5e-47
 Identities = 90/191 (47%), Positives = 135/191 (70%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H PFFD+AYQGFASG  + DA ++R+F   G ++  AQSY+KN+GLY +R+G ++++C
Sbjct: 234 KKHFPFFDMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRVGCLSILC 293

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                A  VKSQL+++ARPMYSNPP+HGA +V+ ++ +PEL + W +E++ MA RI  +R
Sbjct: 294 EDEMQAVAVKSQLQQIARPMYSNPPVHGALVVSIILNDPELKSLWLKEVKGMADRIIGMR 353

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L ++L  K  S   W  I  QIGMF ++G+   Q + ++N++HIYMT++GRIS+AG++
Sbjct: 354 TALKENLE-KLGSSLSWEHITNQIGMFCYSGMTPEQVDRLTNEFHIYMTRNGRISMAGVT 412

Query: 338 AAKCEYLADAI 306
                YLA+AI
Sbjct: 413 TRNVGYLANAI 423



>gb:AP003991_1836030 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1077_A12.
          Length = 432

 Score =  189 bits (480), Expect = 6e-47
 Identities = 90/191 (47%), Positives = 135/191 (70%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           KNH PFFD+AYQGFASG  + DA ++R+F   G ++  AQSY+KN+GLY +R G ++++C
Sbjct: 236 KNHFPFFDMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSILC 295

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                A  VKSQL+++ARPMYSNPP+HGA +V+ ++ +PEL + W +E++ MA RI  +R
Sbjct: 296 EDEMQAVSVKSQLQQIARPMYSNPPVHGALVVSIILNDPELKSLWLKEVKGMADRIIGMR 355

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + L ++L     S   W  I  QIGMF ++G+   Q + ++N++HIYMT++GRIS+AG++
Sbjct: 356 KALRENLEGLG-SPLSWDHITNQIGMFCYSGMTPEQVDRLTNEYHIYMTRNGRISMAGVT 414

Query: 338 AAKCEYLADAI 306
                YLA+AI
Sbjct: 415 TGNVAYLANAI 425



>gb:AP004731_1843940 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0016D02.
          Length = 430

 Score =  189 bits (479), Expect = 8e-47
 Identities = 90/191 (47%), Positives = 134/191 (70%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H PFFD+AYQGFASG  + DA ++R+F   G ++  AQSY+KN+GLY +R G ++++C
Sbjct: 234 KKHFPFFDMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSILC 293

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                A  VKSQL+++ARP+YSNPP+HGA IV+ ++G+PEL + W +E++ MA RI  +R
Sbjct: 294 DDEMQAVAVKSQLQQIARPLYSNPPVHGALIVSTILGDPELKSLWLKEVKGMADRIIGMR 353

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L ++L  K  S   W  I  QIGMF ++G+   Q + ++ ++HIYMT++GRIS+AG++
Sbjct: 354 TALKENLE-KLGSPMSWEHITNQIGMFCYSGMTPEQVDRLTKEFHIYMTRNGRISMAGVT 412

Query: 338 AAKCEYLADAI 306
                YLA+AI
Sbjct: 413 TGNVAYLANAI 423



>pir|JC5125|JC5125 aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial - rice>gb:D67043_1674744 Oryza sativa
           (japonica cultivar-group) mRNA for aspartate
           aminotransferase, complete cds.
          Length = 430

 Score =  189 bits (479), Expect = 8e-47
 Identities = 90/191 (47%), Positives = 134/191 (70%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H PFFD+AYQGFASG  + DA ++R+F   G ++  AQSY+KN+GLY +R G ++++C
Sbjct: 234 KKHFPFFDMAYQGFASGDPERDAKAIRIFLEDGHQIGCAQSYAKNMGLYGQRAGCLSILC 293

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                A  VKSQL+++ARP+YSNPP+HGA IV+ ++G+PEL + W +E++ MA RI  +R
Sbjct: 294 DDEMQAVAVKSQLQQIARPLYSNPPVHGALIVSTILGDPELKSLWLKEVKGMADRIIGMR 353

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L ++L  K  S   W  I  QIGMF ++G+   Q + ++ ++HIYMT++GRIS+AG++
Sbjct: 354 TALKENLE-KLGSPMSWEHITNQIGMFCYSGMTPEQVDRLTKEFHIYMTRNGRISMAGVT 412

Query: 338 AAKCEYLADAI 306
                YLA+AI
Sbjct: 413 TGNVAYLANAI 423



>gb:CR382128_1660430 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 433

 Score =  185 bits (469), Expect = 1e-45
 Identities = 89/193 (46%), Positives = 130/193 (67%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H PFFD+AYQGFA+G ++ DA  +R F  +G E+ + QS++KN+GLY ER+GA ++VC
Sbjct: 239 KGHFPFFDMAYQGFATGDVNRDAYPIRYFVEQGHEVALCQSFAKNMGLYGERVGAFSLVC 298

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                  RV SQLK + RP YSNPP+HGARI A ++ NPEL  +W  E++ MA R+  +R
Sbjct: 299 QDTAEKNRVDSQLKIIIRPFYSNPPVHGARIAATILNNPELKKQWLGEVKQMADRMIKMR 358

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L ++L  +  S ++W  +  QIGMF +TGL+  Q E ++ ++ +Y TKDGRIS+AG++
Sbjct: 359 ALLKENLE-RLGSQQNWDHVTSQIGMFCYTGLSPEQVERLAKEFSVYGTKDGRISIAGIT 417

Query: 338 AAKCEYLADAIID 300
           +     LA AI +
Sbjct: 418 SQNVGRLAQAIYE 430



>pir|T40653|T40653 aspartate transaminase (EC 2.6.1.1) SPBC725.01,
           mitochondrial [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC725_1720386 S.pombe
           chromosome II cosmid c725.
          Length = 437

 Score =  184 bits (466), Expect = 3e-45
 Identities = 87/192 (45%), Positives = 131/192 (68%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KNH    D+AYQGFASG    DA + R+FAS  + +L+ QS++KN+GLY ER G  +++
Sbjct: 240 KKNHFALLDMAYQGFASGDFARDAYATRLFASSNVPMLLCQSFAKNMGLYGERAGCFSIL 299

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + A+ AAR++SQ K L R +YSNPP++GARI  +++ NP L  +W  E+  M+ R+KS+
Sbjct: 300 ANDAEEAARIESQTKILIRALYSNPPVNGARIANHILSNPALREQWAGEVVGMSERLKSM 359

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ L + L    K+   W  I  QIGMF +TGLN  Q + ++ ++HIY+TK+GRIS++GL
Sbjct: 360 RKALRNILEKDLKNKHSWKHITDQIGMFCYTGLNPQQVDVLAKQYHIYLTKNGRISISGL 419

Query: 341 SAAKCEYLADAI 306
           + +   Y A+AI
Sbjct: 420 NTSNVRYFAEAI 431



>gb:BC067312_2554674 Xenopus tropicalis Xr-406-prov protein, mRNA
           (cDNA clone MGC:76052 IMAGE:5307244), complete cds.
          Length = 411

 Score =  183 bits (465), Expect = 3e-45
 Identities = 93/190 (48%), Positives = 124/190 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASGSLD DA +VR F S+G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 218 PFFDSAYQGFASGSLDKDAWAVRFFVSQGFELFCAQSFSKNFGLYNERVGNLTVVGKDCD 277

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
             ARV SQ++++ R  +SNPP  GARIVA  +  PELF+EW+  ++ MA R+  +R +L 
Sbjct: 278 NVARVLSQMEKIVRTTWSNPPSQGARIVATTLNTPELFDEWRDNVKTMAERVLLMRAELK 337

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I+ QIGMFS+TGLN  Q E +  + HIY+   GRI++ GL+    
Sbjct: 338 SRLEALKTPG-TWNHIVNQIGMFSYTGLNPKQVEYLIKEKHIYLMASGRINMCGLTTKNL 396

Query: 326 EYLADAIIDS 297
           +Y+A +I ++
Sbjct: 397 DYVAQSIYEA 406



>gb:BC045269_2549116 Xenopus laevis Aspartate aminotransferase, mRNA
           (cDNA clone MGC:52828 IMAGE:4884635), complete cds.
          Length = 411

 Score =  183 bits (465), Expect = 3e-45
 Identities = 93/190 (48%), Positives = 124/190 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASGSLD DA +VR F S+G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 218 PFFDSAYQGFASGSLDKDAWAVRFFVSQGFELFCAQSFSKNFGLYNERVGNLTVVGKDGD 277

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
             ARV SQ++++ R  +SNPP  GARIVA  +  PELF+EW+  ++ MA R+  +R +L 
Sbjct: 278 NVARVLSQMEKIVRTTWSNPPSQGARIVATTLNTPELFDEWRDNVKTMAERVLLMRAELK 337

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I+ QIGMFS+TGLN  Q E +  + HIY+   GRI++ GL+    
Sbjct: 338 SRLEALKTPG-TWNHIVNQIGMFSYTGLNPKQVEYLIKEKHIYLMASGRINMCGLTTKNI 396

Query: 326 EYLADAIIDS 297
           +Y+A +I ++
Sbjct: 397 DYVAQSIYEA 406



>pir|JT0439|JT0439 aspartate transaminase (EC 2.6.1.1), cytosolic -
           rat>gb:RATCASPAT_2131713 Rattus norvegicus mRNA for
           cytosolic aspartate aminotransferase, complete cds.
          Length = 413

 Score =  183 bits (465), Expect = 3e-45
 Identities = 94/187 (50%), Positives = 123/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG L+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 220 PFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKEHD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + NPELF EWK  ++ MA RI ++R +L 
Sbjct: 280 SVLRVLSQMEKIVRITWSNPPAQGARIVATTLSNPELFKEWKGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W+ I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLMPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>pir|S29028|S29028 aspartate transaminase (EC 2.6.1.1) (clone 8C7) -
           human>gb:BC061877_2104731 Rattus norvegicus glutamate
           oxaloacetate transaminase 1, mRNA (cDNA clone MGC:72537
           IMAGE:5599273), complete cds.
          Length = 413

 Score =  183 bits (465), Expect = 3e-45
 Identities = 94/187 (50%), Positives = 123/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG L+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 220 PFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKEHD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + NPELF EWK  ++ MA RI ++R +L 
Sbjct: 280 SVLRVLSQMEKIVRITWSNPPAQGARIVATTLSNPELFKEWKGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W+ I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLMPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>gb:BT020856_1436214 Bos taurus glutamic-oxaloacetic transaminase 1,
           soluble (aspartate aminotransferase 1) (GOT1), mRNA,
           complete cds.
          Length = 413

 Score =  182 bits (463), Expect = 6e-45
 Identities = 94/187 (50%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASGSL+ DA ++R F S G EL  AQS+S N GLY ER+G + VV    D
Sbjct: 220 PFFDSAYQGFASGSLEKDAWAIRYFVSEGFELFCAQSFSXNFGLYNERVGNLTVVAKEPD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +PELFNEW   ++ MA RI ++R +L 
Sbjct: 280 SILRVLSQMEKIVRITWSNPPAQGARIVARTLSDPELFNEWTGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWNHITEQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           EY+A +I
Sbjct: 399 EYVATSI 405



>pir|I46006|S21560 aspartate transaminase (EC 2.6.1.1) -
           bovine>gb:BTCASPATM_1436956 B.taurus mRNA for cytosolic
           aspartate aminotransferase.
          Length = 413

 Score =  182 bits (463), Expect = 6e-45
 Identities = 94/187 (50%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQ FASGSL+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 220 PFFDSAYQAFASGSLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +PELFNEW   ++ MA RI ++R +L 
Sbjct: 280 SILRVLSQMEKIVRITWSNPPAQGARIVARTLSDPELFNEWTGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWNHITEQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           EY+A +I
Sbjct: 399 EYVATSI 405



>sp|P33097|AATC_BOVIN Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-1).
          Length = 412

 Score =  182 bits (463), Expect = 6e-45
 Identities = 94/187 (50%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQ FASGSL+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 219 PFFDSAYQAFASGSLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPD 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +PELFNEW   ++ MA RI ++R +L 
Sbjct: 279 SILRVLSQMEKIVRITWSNPPAQGARIVARTLSDPELFNEWTGNVKTMADRILTMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 339 ARLEALKTPG-TWNHITEQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNL 397

Query: 326 EYLADAI 306
           EY+A +I
Sbjct: 398 EYVATSI 404



>gb:BC002057_2088831 Mus musculus glutamate oxaloacetate
           transaminase 1, soluble, mRNA (cDNA clone MGC:6100
           IMAGE:3489628), complete cds.>gb:MUSASPATC_2125184 Mouse
           cytosolic aspartate aminotransferase isoenzyme mRNA,
           complete cds, clone pmcAspAT-1.
          Length = 413

 Score =  182 bits (461), Expect = 1e-44
 Identities = 93/187 (49%), Positives = 124/187 (66%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG L+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV   +D
Sbjct: 220 PFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +PELF EWK  ++ MA RI ++R +L 
Sbjct: 280 SVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W+ I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>sp|P05201|AATC_MOUSE Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-1).
          Length = 412

 Score =  182 bits (461), Expect = 1e-44
 Identities = 93/187 (49%), Positives = 124/187 (66%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG L+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV   +D
Sbjct: 219 PFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESD 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +PELF EWK  ++ MA RI ++R +L 
Sbjct: 279 SVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W+ I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 339 ARLEALKTPG-TWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNL 397

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 398 DYVATSI 404



>gb:RATASPATB_2131536 Rat aspartate aminotransferase mRNA, complete
           cds.
          Length = 413

 Score =  181 bits (460), Expect = 1e-44
 Identities = 93/187 (49%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG L+ DA ++R F S G EL   QS+SKN GLY ER+G + VV    D
Sbjct: 220 PFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCPQSFSKNFGLYNERVGNLTVVGKEHD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + NPELF EWK  ++ MA RI ++R +L 
Sbjct: 280 SVLRVLSQMEKIVRITWSNPPAQGARIVATTLSNPELFKEWKGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W+ I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLMPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>pir|A30138|XNPGDC aspartate transaminase (EC 2.6.1.1), cytosolic -
           pig>gb:PIGCASPAT_1443077 Pig (Sus scrofa) cytosolic
           aspartate aminotransferase (cAspAT) mRNA, complete cds.
          Length = 413

 Score =  181 bits (460), Expect = 1e-44
 Identities = 93/187 (49%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 220 PFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +PELF+EW   ++ MA RI S+R +L 
Sbjct: 280 SILRVLSQMEKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWNHITDQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>sp|P13221|AATC_RAT Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-1).
          Length = 412

 Score =  181 bits (460), Expect = 1e-44
 Identities = 93/187 (49%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG L+ DA ++R F S G EL   QS+SKN GLY ER+G + VV    D
Sbjct: 219 PFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCPQSFSKNFGLYNERVGNLTVVGKEHD 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + NPELF EWK  ++ MA RI ++R +L 
Sbjct: 279 SVLRVLSQMEKIVRITWSNPPAQGARIVATTLSNPELFKEWKGNVKTMADRILTMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W+ I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 339 ARLEALKTPG-TWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLMPSGRINMCGLTTKNL 397

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 398 DYVATSI 404



>sp|P00503|AATC_PIG Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-1).
          Length = 412

 Score =  181 bits (460), Expect = 1e-44
 Identities = 93/187 (49%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 219 PFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPD 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +PELF+EW   ++ MA RI S+R +L 
Sbjct: 279 SILRVLSQMEKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 339 ARLEALKTPG-TWNHITDQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNL 397

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 398 DYVATSI 404



>pir|S01076|S01076 aspartate transaminase (EC 2.6.1.1), cytosolic -
           mouse>gb:MMASPAT1_2114215 Mouse aspartate
           aminotransferase (AspAT)(EC 2.6.1.1) gene 5'flank and
           exon 1 (joined CDS).
          Length = 413

 Score =  180 bits (456), Expect = 4e-44
 Identities = 93/187 (49%), Positives = 123/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG L+ DA ++R F S G EL  AQS+SKN GLY ER+G + VV   +D
Sbjct: 220 PFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESD 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ+++  R  +SNPP  GARIVA  + +PELF EWK  ++ MA RI ++R +L 
Sbjct: 280 SVLRVLSQMEKNVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W+ I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 340 ARLEALKTPG-TWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>pir|S05583|XNCHDC aspartate transaminase (EC 2.6.1.1), cytosolic -
           chicken>gb:GGASPAT_2572929 Chicken mRNA for cytosolic
           aspartate aminotransferase (EC 2.6.1.1).
          Length = 412

 Score =  179 bits (455), Expect = 5e-44
 Identities = 94/187 (50%), Positives = 120/187 (64%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASGSLD DA +VR F S G EL  AQS+SKN GLY ER+G ++VV    D
Sbjct: 219 PFFDSAYQGFASGSLDKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDED 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
              RV SQ++++ R  +SNPP  GARIVA  + +P+LF EWK  ++ MA R+  +R +L 
Sbjct: 279 NVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E M  + HIY+   GRI++ GL+    
Sbjct: 339 SRLESLGTPG-TWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNL 397

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 398 DYVAKSI 404



>sp|P08906|AATC_HORSE Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-1).>pir|A26341|A26341 aspartate
           transaminase (EC 2.6.1.1), cytosolic - horse
          Length = 412

 Score =  179 bits (455), Expect = 5e-44
 Identities = 94/187 (50%), Positives = 121/187 (64%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+LD DA +VR F S G EL  AQS+SKN GLY ER+G + VV    D
Sbjct: 219 PFFDSAYQGFASGNLDRDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPD 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  RV SQ++++ R  +SNPP  GARIVA  + +P LF EW   ++ MA RI S+R +L 
Sbjct: 279 SILRVLSQMQKIVRITWSNPPAQGARIVAFTLSDPGLFKEWTGNVKTMADRILSMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I +QIGMFSFTGLN  Q E + N+ HIY+   GRI++ GL+    
Sbjct: 339 ARLEALKTPG-TWNHITEQIGMFSFTGLNPKQVEYLVNQKHIYLLPSGRINMCGLTTKNL 397

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 398 DYVATSI 404



>sp|P00504|AATC_CHICK Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-1).
          Length = 411

 Score =  179 bits (455), Expect = 5e-44
 Identities = 94/187 (50%), Positives = 120/187 (64%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASGSLD DA +VR F S G EL  AQS+SKN GLY ER+G ++VV    D
Sbjct: 218 PFFDSAYQGFASGSLDKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDED 277

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
              RV SQ++++ R  +SNPP  GARIVA  + +P+LF EWK  ++ MA R+  +R +L 
Sbjct: 278 NVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELR 337

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E M  + HIY+   GRI++ GL+    
Sbjct: 338 SRLESLGTPG-TWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNL 396

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 397 DYVAKSI 403



>gb:BC047800_2549887 Danio rerio zgc:55996, mRNA (cDNA clone
           MGC:55996 IMAGE:3819704), complete cds.
          Length = 410

 Score =  179 bits (454), Expect = 6e-44
 Identities = 94/198 (47%), Positives = 126/198 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           KN   FFD AYQGFASG L+ DA +VR F S+G EL  AQS+SKN GLY ER+G + VV 
Sbjct: 213 KNLFAFFDSAYQGFASGDLEKDAWAVRYFVSQGFELFCAQSFSKNFGLYNERVGNLTVVA 272

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
              D   RV SQ++++ R  +SNPP  GAR+VA  +  PELF EWK  ++ MA R+  +R
Sbjct: 273 KDQDNVNRVLSQMEKIVRITWSNPPSQGARLVAITLNTPELFAEWKANVKTMADRVLLMR 332

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
            +L + L      G  W  I +QIGMFSFTGLN  Q E M  + HIY+   GRI++ GL+
Sbjct: 333 AQLKEKLKALGTPG-TWEHITEQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLT 391

Query: 338 AAKCEYLADAIIDSYYNV 285
           +   +Y+A++I ++   V
Sbjct: 392 SKNIDYVAESIHEAVTKV 409



>gb:AF326989_1262833 Trypanosoma brucei aspartate aminotransferase
           gene, complete cds.
          Length = 403

 Score =  178 bits (452), Expect = 1e-43
 Identities = 92/194 (47%), Positives = 133/194 (68%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  IPFFD AYQGFASGSLD DA ++R FA RG+E+L+AQS+SKN+GLYAER+G I+ V
Sbjct: 204 ERKLIPFFDSAYQGFASGSLDEDAYAIRHFAKRGMEMLLAQSFSKNMGLYAERVGVISAV 263

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            S A     V+S+L+ +AR  YS PP+HGARI   V+ + EL  EW+QE++ M  R++S+
Sbjct: 264 VSDASRKEAVRSRLEVIARSYYSTPPVHGARIAHLVMSDKELRAEWEQELKEMVNRVRSM 323

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ +Y+ L +K  +   W  I+ Q GMFS+ GL++ Q E +  K  +++   GR +LA L
Sbjct: 324 RQGVYEGL-MKLGTPGTWEHIINQKGMFSYMGLSRPQCERLCEK-RVFVLPVGRANLAAL 381

Query: 341 SAAKCEYLADAIID 300
           + +  ++L  +I D
Sbjct: 382 TPSTMDFLVKSIDD 395



>gb:CR860603_1184664 Pongo pygmaeus mRNA; cDNA DKFZp459L2119 (from
           clone DKFZp459L2119).
          Length = 413

 Score =  177 bits (449), Expect = 2e-43
 Identities = 91/187 (48%), Positives = 121/187 (64%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G E   AQS+SKN GLY ER+G + VV    +
Sbjct: 220 PFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPE 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
              RV SQ++++ R  +SNPP  GARIVA+ + NPELF EW   ++ MA RI ++R +L 
Sbjct: 280 GILRVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E + N+ HIY+   GRI+++GL+    
Sbjct: 340 ARLEALKTPG-TWNHITDQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINVSGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>pir|S29027|S29027 aspartate transaminase (EC 2.6.1.1) (clone H10B1)
           - human>gb:AF052153_1879213 Homo sapiens clone 24441
           cytosolic aspartate aminotransferase mRNA, partial
           cds.>gb:AL391684_1926998 Human DNA sequence from clone
           RP11-441O15 on chromosome 10 Contains the CNNM1 gene for
           cyclin M1, the GOT1 gene for glutamic-oxaloacetic
           transaminase 1, soluble (aspartate aminotransferase 1),
           a novel gene and two CpG islands, complete
           sequence.>gb:BC000498_1966775 Homo sapiens
           glutamic-oxaloacetic transaminase 1, soluble (aspartate
           aminotransferase 1), mRNA (cDNA clone MGC:8411
           IMAGE:2820849), complete cds.>gb:HSGOT9_2013546 Homo
           sapiens glutamate oxaloacetate transaminase (GOT1) gene,
           exon 9 and complete cds.>gb:HUMASAM_2029389 Human
           cytosolic aspartate aminotransferase mRNA, complete cds.
          Length = 413

 Score =  176 bits (446), Expect = 5e-43
 Identities = 90/187 (48%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G E   AQS+SKN GLY ER+G + VV    +
Sbjct: 220 PFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPE 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  +V SQ++++ R  +SNPP  GARIVA+ + NPELF EW   ++ MA RI ++R +L 
Sbjct: 280 SILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E + N+ HIY+   GRI+++GL+    
Sbjct: 340 ARLEALKTPG-TWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>pir|S13035|S13035 aspartate transaminase (EC 2.6.1.1) - human
          Length = 412

 Score =  176 bits (446), Expect = 5e-43
 Identities = 90/187 (48%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G E   AQS+SKN GLY ER+G + VV    +
Sbjct: 219 PFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPE 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  +V SQ++++ R  +SNPP  GARIVA+ + NPELF EW   ++ MA RI ++R +L 
Sbjct: 279 SILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E + N+ HIY+   GRI+++GL+    
Sbjct: 339 ARLEALKTPG-TWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNL 397

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 398 DYVATSI 404



>sp|P17174|AATC_HUMAN Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A) (Glutamate oxaloacetate
           transaminase-1).
          Length = 412

 Score =  176 bits (446), Expect = 5e-43
 Identities = 90/187 (48%), Positives = 122/187 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G E   AQS+SKN GLY ER+G + VV    +
Sbjct: 219 PFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPE 278

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
           +  +V SQ++++ R  +SNPP  GARIVA+ + NPELF EW   ++ MA RI ++R +L 
Sbjct: 279 SILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELR 338

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E + N+ HIY+   GRI+++GL+    
Sbjct: 339 ARLEALKTPG-TWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNL 397

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 398 DYVATSI 404



>gb:CR861057_1185081 Pongo pygmaeus mRNA; cDNA DKFZp459F1115 (from
           clone DKFZp459F1115).
          Length = 413

 Score =  175 bits (444), Expect = 9e-43
 Identities = 90/187 (48%), Positives = 121/187 (64%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G E   AQS+SKN GLY ER+G + VV    +
Sbjct: 220 PFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPE 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
              RV SQ++++ R  +S+PP  GARIVA+ + NPELF EW   ++ MA RI ++R +L 
Sbjct: 280 GILRVLSQMEKIVRITWSDPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
             L      G  W  I  QIGMFSFTGLN  Q E + N+ HIY+   GRI+++GL+    
Sbjct: 340 ARLEALKTPG-TWNHITDQIGMFSFTGLNPKQVEYLINEKHIYLLPSGRINVSGLTTKNL 398

Query: 326 EYLADAI 306
           +Y+A +I
Sbjct: 399 DYVATSI 405



>gb:AF411604_1268878 Brugia malayi aspartate aminotransferase mRNA,
           complete cds.
          Length = 404

 Score =  175 bits (443), Expect = 1e-42
 Identities = 89/200 (44%), Positives = 131/200 (65%), Gaps = 1/200 (0%)
 Frame = -1

Query: 881 EKNHI-PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINV 705
           ++ H+ PFFD+AYQGFASG LDADA +VR F  +GLE+  AQS++KN GLY ER+G + V
Sbjct: 205 KRRHLFPFFDLAYQGFASGDLDADAWAVRYFVEQGLEMFCAQSFAKNFGLYNERVGNLTV 264

Query: 704 VCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKS 525
           V S     A +KSQ+  + R  +SNPP HGARIV  ++ +P +  +W   ++ M+ RIK 
Sbjct: 265 VASDPLVLASIKSQMSLVIRSNWSNPPSHGARIVHMILTSPSMCAQWHDAIKTMSSRIKD 324

Query: 524 VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           +R  L ++L      G  W  I +QIGMFSF GLN  Q +++  K+ +++ K+GRI++ G
Sbjct: 325 MRYALRNNLEKLGTPG-TWEHITQQIGMFSFIGLNTEQVDHLIKKYKVFLLKNGRINVCG 383

Query: 344 LSAAKCEYLADAIIDSYYNV 285
           L+    EY+A AI ++  N+
Sbjct: 384 LNPENVEYVAKAINETINNI 403



>gb:BT001324_1356097 Drosophila melanogaster AT16867 full insert
           cDNA.
          Length = 448

 Score =  174 bits (442), Expect = 2e-42
 Identities = 91/192 (47%), Positives = 119/192 (61%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K   P FD AYQGFASG  D DA + R F  RG EL + QS++KN GLY ER G + VV
Sbjct: 239 KKKLFPLFDSAYQGFASGDPDRDAWAARYFVQRGFELFICQSFAKNFGLYCERTGNLTVV 298

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +    A V SQL  L R  YSNPP +GARIV+ V+  PEL  EW   ++ M+ RI+ +
Sbjct: 299 QKNGATKAAVHSQLTLLIRGQYSNPPAYGARIVSKVLNTPELRKEWMASIQAMSSRIREM 358

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L      G  W  I+ QIGMFS+TGLN++    + +++HIY+ K GRIS++GL
Sbjct: 359 RTALRDKLVALGTPG-TWDHIVNQIGMFSYTGLNESHVRVLIDQYHIYLLKTGRISMSGL 417

Query: 341 SAAKCEYLADAI 306
           +    EY+A AI
Sbjct: 418 NKGNVEYVAKAI 429



>gb:AY339650_1320839 Drosophila melanogaster aminotransferase
           (CG8430) mRNA, complete cds.
          Length = 416

 Score =  174 bits (442), Expect = 2e-42
 Identities = 91/192 (47%), Positives = 119/192 (61%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K   P FD AYQGFASG  D DA + R F  RG EL + QS++KN GLY ER G + VV
Sbjct: 207 KKKLFPLFDSAYQGFASGDPDRDAWAARYFVQRGFELFICQSFAKNFGLYCERTGNLTVV 266

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +    A V SQL  L R  YSNPP +GARIV+ V+  PEL  EW   ++ M+ RI+ +
Sbjct: 267 QKNGATKAAVHSQLTLLIRGQYSNPPAYGARIVSKVLNTPELRKEWMASIQAMSSRIREM 326

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L      G  W  I+ QIGMFS+TGLN++    + +++HIY+ K GRIS++GL
Sbjct: 327 RTALRDKLVALGTPG-TWDHIVNQIGMFSYTGLNESHVRVLIDQYHIYLLKTGRISMSGL 385

Query: 341 SAAKCEYLADAI 306
           +    EY+A AI
Sbjct: 386 NKGNVEYVAKAI 397



>gb:AE013599_1132139 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003808_1225593 Drosophila melanogaster
           chromosome 2R, section 42 of 74 of the complete
           sequence.>gb:AY061313_1293116 Drosophila melanogaster
           LD23191 full length cDNA.
          Length = 416

 Score =  174 bits (440), Expect = 3e-42
 Identities = 91/192 (47%), Positives = 119/192 (61%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K   P FD AYQGFASG  D DA + R F  RG EL + QS++KN GLY ER G + VV
Sbjct: 207 KKKLFPLFDSAYQGFASGDPDRDAWAARYFVQRGFELFICQSFAKNFGLYCERTGNLAVV 266

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +    A V SQL  L R  YSNPP +GARIV+ V+  PEL  EW   ++ M+ RI+ +
Sbjct: 267 QKNGATKAAVHSQLTLLIRGQYSNPPAYGARIVSKVLNTPELRKEWMASIQAMSSRIREM 326

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L      G  W  I+ QIGMFS+TGLN++    + +++HIY+ K GRIS++GL
Sbjct: 327 RTALRDKLVALGTPG-TWDHIVNQIGMFSYTGLNESHVRVLIDQYHIYLLKTGRISMSGL 385

Query: 341 SAAKCEYLADAI 306
           +    EY+A AI
Sbjct: 386 NKGNVEYVAKAI 397



>gb:AE013599_1132138 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003808_1225592 Drosophila melanogaster
           chromosome 2R, section 42 of 74 of the complete
           sequence.
          Length = 437

 Score =  174 bits (440), Expect = 3e-42
 Identities = 91/192 (47%), Positives = 119/192 (61%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K   P FD AYQGFASG  D DA + R F  RG EL + QS++KN GLY ER G + VV
Sbjct: 228 KKKLFPLFDSAYQGFASGDPDRDAWAARYFVQRGFELFICQSFAKNFGLYCERTGNLAVV 287

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +    A V SQL  L R  YSNPP +GARIV+ V+  PEL  EW   ++ M+ RI+ +
Sbjct: 288 QKNGATKAAVHSQLTLLIRGQYSNPPAYGARIVSKVLNTPELRKEWMASIQAMSSRIREM 347

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D L      G  W  I+ QIGMFS+TGLN++    + +++HIY+ K GRIS++GL
Sbjct: 348 RTALRDKLVALGTPG-TWDHIVNQIGMFSYTGLNESHVRVLIDQYHIYLLKTGRISMSGL 406

Query: 341 SAAKCEYLADAI 306
           +    EY+A AI
Sbjct: 407 NKGNVEYVAKAI 418



>gb:AY529105_1333193 Leishmania donovani strain MHOM/SD/90/D83
           glutamate oxaloacetate gene, partial
           cds.>gb:AY529106_1333194 Leishmania donovani strain
           MHOM/BD/97/LDON glutamate oxaloacetate gene, partial
           cds.>gb:AY529108_1333196 Leishmania donovani strain
           MHOM/SD/90/D75 glutamate oxaloacetate gene, partial
           cds.>gb:AY529111_1333199 Leishmania donovani strain
           MHOM/ET/67/HU3 glutamate oxaloacetate gene, partial
           cds.>gb:AY529112_1333200 Leishmania donovani strain
           MHOM/NP/02/NEP2 glutamate oxaloacetate gene, partial
           cds.>gb:AY529114_1333202 Leishmania donovani strain
           MHOM/NP/02/NEP5 glutamate oxaloacetate gene, partial
           cds.
          Length = 373

 Score =  173 bits (439), Expect = 3e-42
 Identities = 92/199 (46%), Positives = 131/199 (65%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H  FFD AYQG+ASGSLD DA + R+FA RG+E+L+AQS+SKN+GLY+ER G ++++ 
Sbjct: 175 KRHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLL 234

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                 A VKS +  L R  Y+ PP HGAR+   ++ N EL  EW+ E+  MA RI+++R
Sbjct: 235 KDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMR 294

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + +YD L L+ ++   W  ++ QIGMFSF GL+KAQ E   N  +I++T  GR ++AGL+
Sbjct: 295 RTVYDEL-LRLQTPGSWEHVINQIGMFSFLGLSKAQCEYCQNH-NIFITLSGRANMAGLT 352

Query: 338 AAKCEYLADAIIDSYYNVS 282
                 LA  I D+  NV+
Sbjct: 353 HETALMLAQTINDAVRNVN 371



>gb:AY529107_1333195 Leishmania donovani strain MHOM/SD/90/2828
           glutamate oxaloacetate gene, partial cds.
          Length = 373

 Score =  173 bits (438), Expect = 5e-42
 Identities = 92/199 (46%), Positives = 131/199 (65%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H  FFD AYQG+ASGSLD DA + R+FA RG+E+L+AQS+SKN+GLY+ER G ++++ 
Sbjct: 175 KRHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLL 234

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                 A VKS +  L R  Y+ PP HGAR+   ++ N EL  EW+ E+  MA RI+++R
Sbjct: 235 KDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMR 294

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + +YD L L+ ++   W  ++ QIGMFSF GL+KAQ E   N  +I++T  GR ++AGL+
Sbjct: 295 RTVYDEL-LRLQTPGSWEHVINQIGMFSFLGLSKAQCEYCQNH-NIFITLSGRANVAGLT 352

Query: 338 AAKCEYLADAIIDSYYNVS 282
                 LA  I D+  NV+
Sbjct: 353 HETALMLAQTINDAVRNVN 371



>gb:AF326990_1262834 Trypanosoma brucei aspartate aminotransferase
           gene, complete cds; nuclear gene for mitochondrial
           product.
          Length = 390

 Score =  173 bits (438), Expect = 5e-42
 Identities = 86/191 (45%), Positives = 130/191 (68%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           +NHIPF D+AY  FA+G LD DA   R        L+VAQS+SKN GLY  R GA+++  
Sbjct: 196 RNHIPFVDMAYPSFATGQLDYDAFVPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHLST 255

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +SA+ A R+ SQL  L RPMYSNPP++GA +V++++ +P+L   WK+E++ M+ RI  VR
Sbjct: 256 ASAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVR 315

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           ++L   L     S  DW+ I +Q+GM ++TGL + Q E + +++HIYMT +GR +++GL+
Sbjct: 316 KRLVSELKACG-SVHDWSHIERQVGMMAYTGLTREQVELLRSEYHIYMTLNGRAAVSGLN 374

Query: 338 AAKCEYLADAI 306
           +   EY++ AI
Sbjct: 375 STNVEYVSQAI 385



>gb:AY529109_1333197 Leishmania donovani strain MHOM/SD/90/2655
           glutamate oxaloacetate gene, partial
           cds.>gb:AY529110_1333198 Leishmania infantum strain
           MCAN/ES/98/LEM-935 glutamate oxaloacetate gene, partial
           cds.>gb:AY529116_1333204 Leishmania donovani strain
           MHOM/SD/97/LEM3435 glutamate oxaloacetate gene, partial
           cds.
          Length = 373

 Score =  172 bits (437), Expect = 6e-42
 Identities = 92/199 (46%), Positives = 131/199 (65%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H  FFD AYQG+ASGSLD DA + R+FA RG+E+L+AQS+SKN+GLY+ER G ++++ 
Sbjct: 175 KRHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLL 234

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                 A VKS +  L R  Y+ PP HGAR+   ++ N EL  EW+ E+  MA RI+++R
Sbjct: 235 KYKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMR 294

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + +YD L L+ ++   W  ++ QIGMFSF GL+KAQ E   N  +I++T  GR ++AGL+
Sbjct: 295 RTVYDEL-LRLQTPGSWEHVINQIGMFSFLGLSKAQCEYCQNH-NIFITLSGRANMAGLT 352

Query: 338 AAKCEYLADAIIDSYYNVS 282
                 LA  I D+  NV+
Sbjct: 353 HETALMLAQTINDAVRNVN 371



>gb:AF416601_1269288 Leishmania mexicana broad specificity
           aminotransferase gene, partial cds.
          Length = 412

 Score =  172 bits (435), Expect = 1e-41
 Identities = 91/199 (45%), Positives = 129/199 (64%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K+H  FFD AYQG+ASGSLD DA + R+FA RG+E+L+AQS+SKN+GLY+ER G ++++ 
Sbjct: 214 KHHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLL 273

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                 A VKS +  L R  Y+ PP HGAR+   ++ N EL  EW+ E+  MA RI+++R
Sbjct: 274 KDKTKRADVKSVMDSLIRAEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMR 333

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + +YD L      G+ W  ++ QIGMFSF GL+K Q E   N  +I++T  GR ++AGL+
Sbjct: 334 RTVYDELLRLQTPGR-WEHVINQIGMFSFLGLSKEQCEYCQNH-NIFITLSGRANIAGLT 391

Query: 338 AAKCEYLADAIIDSYYNVS 282
                 LA  I D+  NV+
Sbjct: 392 HETALMLAQTINDAVRNVN 410



>gb:NSU581792_156264 Neisseria subflava dedA gene (partial), manB
           gene, folP gene, tyrB gene and cyt5 gene, strain
           ATCC19243.
          Length = 397

 Score =  171 bits (433), Expect = 2e-41
 Identities = 86/190 (45%), Positives = 128/190 (67%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G LD+DA ++R      L L V+ S+SKNL LY ER+G ++VVC + 
Sbjct: 207 IPFMDIAYQGFG-GDLDSDAYAIRKAVEMDLPLFVSNSFSKNLSLYGERVGGLSVVCPNK 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + A  V  QLK   R +YS+PP HGA I A+V+ NPEL+  W+ E+ +M  RI+++RQKL
Sbjct: 266 EEAELVFGQLKFTVRRIYSSPPAHGAYIAADVMNNPELYALWQNEVYVMRDRIRAMRQKL 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           YD L+ +    +D+T+ +KQ GMFS+TGL+  Q   + +++ +Y+   GR+ +AGL+A+ 
Sbjct: 326 YDVLTAQIPD-RDFTYFIKQRGMFSYTGLSVEQVRRLRDEFAVYLLDSGRMCVAGLNASN 384

Query: 329 CEYLADAIID 300
             Y+ADA  +
Sbjct: 385 IAYVADAFAE 394



>gb:AY529113_1333201 Leishmania donovani strain MHOM/NP/02/NEP3
           glutamate oxaloacetate gene, partial cds.
          Length = 373

 Score =  171 bits (432), Expect = 2e-41
 Identities = 91/199 (45%), Positives = 130/199 (65%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H  FF  AYQG+ASGSLD DA + R+FA RG+E+L+AQS+SKN+GLY+ER G ++++ 
Sbjct: 175 KRHQVFFGSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLL 234

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                 A VKS +  L R  Y+ PP HGAR+   ++ N EL  EW+ E+  MA RI+++R
Sbjct: 235 KDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMR 294

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + +YD L L+ ++   W  ++ QIGMFSF GL+KAQ E   N  +I++T  GR ++AGL+
Sbjct: 295 RTVYDEL-LRLQTPGSWEHVINQIGMFSFLGLSKAQCEYCQNH-NIFITLSGRANMAGLT 352

Query: 338 AAKCEYLADAIIDSYYNVS 282
                 LA  I D+  NV+
Sbjct: 353 HETALMLAQTINDAVRNVN 371



>gb:AE004969_61123 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 396

 Score =  171 bits (432), Expect = 2e-41
 Identities = 86/193 (44%), Positives = 126/193 (65%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGF +G L+ DA  +R+F     ELL+A SYSKN G+Y ER+GA  +V
Sbjct: 204 EKGWLPLFDFAYQGFGNG-LEEDAYGLRVFLKHNTELLIASSYSKNFGMYNERVGAFTLV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
               + AAR  SQ+K + R +YSNP  HGA  +A V+ N +L  +W  E++ M GRIK++
Sbjct: 263 AEDEETAARAHSQIKTIIRTLYSNPASHGANTIALVLKNDDLKAQWIAELDEMRGRIKAM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQK  + L  K  S +D+ FI++Q GMFSF+GL   Q + + N++ IY  + GRI++AG+
Sbjct: 323 RQKFVELLKAKG-STQDFDFIIEQNGMFSFSGLTPEQVDRLKNEFAIYAVRSGRINVAGI 381

Query: 341 SAAKCEYLADAII 303
           +    +YL ++I+
Sbjct: 382 TDDNIDYLCESIV 394



>gb:AE016827_342660 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 420

 Score =  170 bits (430), Expect = 4e-41
 Identities = 87/189 (46%), Positives = 127/189 (67%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +P FD AYQG A+G L+ DA  +R FA    ELLVA S+SKN GLY+ER+GA  +V  +A
Sbjct: 231 LPLFDFAYQGLANG-LEEDAVGLRTFAETHRELLVASSFSKNFGLYSERVGAFTLVADNA 289

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D AA   +Q+K + R +YSNP  HGAR VA V+ NPEL  EW+ E+  M  RIK +R++L
Sbjct: 290 DVAAVALTQIKSIIRTLYSNPSAHGARTVATVLANPELRKEWEDELTSMRDRIKQMRKQL 349

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            + L  +  + +D+++I+ Q GMFSF+GL   Q + +  ++ IY  + GRI++AG++ A 
Sbjct: 350 VELLK-EFGAQEDFSYIIDQKGMFSFSGLTAEQVDRLKEEFAIYAVRSGRINVAGITEAN 408

Query: 329 CEYLADAII 303
             YLA++I+
Sbjct: 409 IRYLAESIV 417



>gb:AY529115_1333203 Leishmania donovani strain MHOM/SD/91/D1809
           glutamate oxaloacetate gene, partial cds.
          Length = 373

 Score =  169 bits (429), Expect = 5e-41
 Identities = 91/199 (45%), Positives = 127/199 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H  FFD AYQG+ASGSLD DA + R+FA RG+E+L+AQS+SKN+GLY+ER G ++++ 
Sbjct: 175 KRHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLL 234

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
                 A VKS +  L R  Y+ PP HGAR+   ++ N EL  EW+ E+  MA RI+++R
Sbjct: 235 KYKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMR 294

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + +YD L      G  W  ++ QIGMFSF GL+KAQ E   N  +I++T  GR ++A L+
Sbjct: 295 RTVYDELPRLQTPG-SWEHVINQIGMFSFLGLSKAQCEYCQNH-NIFITLSGRANMADLT 352

Query: 338 AAKCEYLADAIIDSYYNVS 282
                 LA  I D+  NV+
Sbjct: 353 HETALMLAQTINDAVRNVN 371



>gb:AE016918_357343 Chromobacterium violaceum ATCC 12472 section 9
           of 16 of the complete genome.>gb:AE016825_1042497
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 402

 Score =  169 bits (429), Expect = 5e-41
 Identities = 87/192 (45%), Positives = 131/192 (68%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E++ +PF D+AYQGFA G +DADA +VR+FA+  L+  VA S+SK+  LY ER+GA++++
Sbjct: 207 ERSLVPFLDMAYQGFADG-IDADALAVRLFAASNLQFFVASSFSKSFSLYGERVGALSII 265

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            ++ D + RV SQLKR+ R  YSNPPIHGA IVA V+ +P L  +W++E+  M  RI+ +
Sbjct: 266 TAAKDESVRVLSQLKRVIRTNYSNPPIHGAAIVAAVLSSPALRAQWEEELAGMRDRIRDM 325

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L +++  +  +  D++FI  Q GMFS+TGL+ AQ + +  ++ IY    GRI LA L
Sbjct: 326 RLALLEAIKAQGVA-VDFSFITAQRGMFSYTGLSAAQVDRLREEFGIYAVSTGRICLAAL 384

Query: 341 SAAKCEYLADAI 306
           ++    Y+A AI
Sbjct: 385 NSKNVGYVASAI 396



>pir|C81188|C81188 aspartate transaminase (EC 2.6.1.1) NMB0540
           [similarity] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002409_46000 Neisseria meningitidis
           serogroup B strain MC58 section 51 of 206 of the
           complete genome.>gb:AE002098_896113 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 397

 Score =  169 bits (428), Expect = 7e-41
 Identities = 86/193 (44%), Positives = 125/193 (64%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGF +G L+ DA  +R+F     ELL+A SYSKN G+Y ER+GA  +V
Sbjct: 204 EKGWLPLFDFAYQGFGNG-LEEDAYGLRVFLKHNTELLIASSYSKNFGMYNERVGAFTLV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
               + AAR  SQ+K + R +YSNP  HGA  +A V+ N +L  +W  E++ M GRIK++
Sbjct: 263 AEDEETAARAHSQVKTIIRTLYSNPASHGANTIALVLKNDDLKAQWIAELDEMRGRIKAM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQK    L  K  S +++ FI+KQ GMFSF+GL   Q + + N++ IY  + GRI++AG+
Sbjct: 323 RQKFVGLLKAKGAS-QNFDFIIKQNGMFSFSGLTPEQVDRLKNEFAIYAVRSGRINVAGI 381

Query: 341 SAAKCEYLADAII 303
           +    +YL ++I+
Sbjct: 382 TDNNIDYLCESIV 394



>gb:AF395205_1267736 Aedes aegypti aspartate aminotransferase mRNA,
           complete cds.
          Length = 408

 Score =  169 bits (427), Expect = 9e-41
 Identities = 93/200 (46%), Positives = 126/200 (63%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK   PFFD AYQGFASG  + DA +VR F  RG ELL AQS++KN GLY ERIG + +V
Sbjct: 207 EKKLFPFFDSAYQGFASGDPNKDAFAVRYFVERGFELLCAQSFAKNFGLYNERIGNLTIV 266

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
                  A V SQ+  L R MYSNPP  G+RIV  V+ +  L  EW + ++ M+ RI ++
Sbjct: 267 QKDESTKAAVASQITLLIRGMYSNPPAFGSRIVNLVLNDATLRAEWMECIQTMSSRIITM 326

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ LYD L +  K+   W  I +QIGMFS+TGLN+ Q + +  ++ IY+ K GRIS+ GL
Sbjct: 327 RKALYDEL-VALKTPGTWEHITQQIGMFSYTGLNEKQVDILIKEFSIYLLKTGRISMCGL 385

Query: 341 SAAKCEYLADAIIDSYYNVS 282
           +    +Y+A AI ++    S
Sbjct: 386 TENNVKYVAKAIHEAVTRAS 405



>gb:BX908798_829625 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 406

 Score =  168 bits (425), Expect = 1e-40
 Identities = 86/188 (45%), Positives = 122/188 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPFFD+AYQGF    L+ DA  +R FAS G E+L+A S+SKN GLY ER+G + VV S  
Sbjct: 216 IPFFDIAYQGFGK-DLELDAQPIRYFASEGHEMLIAYSFSKNFGLYGERVGFLTVVTSQQ 274

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
                + SQLK L R  YSNPP+ GARIV+ ++ +PEL  EWK E++ M  R+  +R+  
Sbjct: 275 KQIPSIASQLKVLIRANYSNPPLQGARIVSTILSSPELTEEWKIELKNMRDRVVEMRKTF 334

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
             SL +K +  K+  ++ +QIG+F F GLN +Q   +  ++ IY+  DGRI++AGL+   
Sbjct: 335 IASLLVKGED-KNLNYLQQQIGLFGFCGLNYSQVNRLRKEFAIYIPSDGRINIAGLNTQN 393

Query: 329 CEYLADAI 306
            EY+ +AI
Sbjct: 394 IEYVVNAI 401



>pir|B81915|B81915 aspartate transaminase (EC 2.6.1.1) NMA0719
           [similarity] - Neisseria meningitidis (strain Z2491
           serogroup A)>gb:NMA3Z2491_153660 Neisseria meningitidis
           serogroup A strain Z2491 complete genome; segment
           3/7.>gb:AX300361_1465468 Sequence 187 from Patent
           WO0185772.
          Length = 397

 Score =  168 bits (425), Expect = 1e-40
 Identities = 85/193 (44%), Positives = 125/193 (64%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGF +G L+ DA  +R+F     ELL+A SYSKN G+Y ER+GA  +V
Sbjct: 204 EKGWLPLFDFAYQGFGNG-LEEDAYGLRVFLKHNTELLIASSYSKNFGMYNERVGAFTLV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
                 AAR  SQ+K + R +YSNP  HGA  +A V+ N +L  +W  E++ M GRIK++
Sbjct: 263 AEDEATAARAHSQVKTIIRTLYSNPASHGANTIALVLKNDDLKAQWIAELDEMRGRIKAM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQK  + L  K  + +D+ FI++Q GMFSF+GL   Q + + N++ IY  + GRI++AG+
Sbjct: 323 RQKFVELLKAKGAT-QDFDFIIEQNGMFSFSGLTPEQVDRLKNEFAIYAVRSGRINVAGI 381

Query: 341 SAAKCEYLADAII 303
           +    +YL ++I+
Sbjct: 382 TDDNIDYLCESIV 394



>gb:BX571864_786607 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 6/17.
          Length = 396

 Score =  167 bits (423), Expect = 2e-40
 Identities = 89/193 (46%), Positives = 123/193 (63%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R+FA    EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPIFDFAYQGFAKG-LNEDAEGLRIFAKNHNELIVASSYSKNFGLYNERVGACTIV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            S +D A +  SQ K + R  YSNPP HGA IV  ++ N +L   W+QE+  M  RI+ +
Sbjct: 262 ASDSDTAEKAFSQAKAIIRANYSNPPAHGASIVTTILSNEDLKAAWEQELTTMRERIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+ Q GMFSF+GL K Q E + +++ IY    GRI++AGL
Sbjct: 322 RQLFVNTLQEKG-AKQDFSFIISQNGMFSFSGLTKEQVERLRDEFGIYAVSSGRINVAGL 380

Query: 341 SAAKCEYLADAII 303
           +      L +AI+
Sbjct: 381 TLENMAPLCEAIV 393



>gb:AF147795_483382 Pseudomonas aeruginosa integration host factor
           beta-subunit (himD), complete cds; O-antigen
           biosynthesis locus, tRNA-Asn gene, complete sequence;
           and aromatic-amino-acid aminotransferase (tyrB) gene,
           complete cds.
          Length = 398

 Score =  166 bits (420), Expect = 6e-40
 Identities = 82/192 (42%), Positives = 128/192 (66%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H+PF D+AYQGF +G ++ DA++VR+FA  GL   V+ S+SK+  LY ER+GA+++V 
Sbjct: 206 KGHVPFLDIAYQGFGNG-IEEDAAAVRLFAQSGLSFFVSSSFSKSFSLYGERVGALSIVT 264

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            S D +ARV SQ+KR+ R  YSNPP HGA +V++V+ +PEL   W+QE+  M  RI+ +R
Sbjct: 265 ESRDESARVLSQVKRVIRTNYSNPPTHGASVVSSVLNSPELRALWEQELGEMRDRIRDMR 324

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             + + L+    + +D++F+ +Q GMFS++GL   Q E +  ++ IY    GRI +A L+
Sbjct: 325 LAMVEQLAAHG-AKRDFSFVGRQRGMFSYSGLTADQVERLKTEFGIYAVSTGRICVAALN 383

Query: 338 AAKCEYLADAII 303
            +  E +  AI+
Sbjct: 384 KSNLETITKAIV 395



>gb:CR555306_108497 Azoarcus sp. EbN1 complete genome.
          Length = 401

 Score =  166 bits (420), Expect = 6e-40
 Identities = 85/188 (45%), Positives = 127/188 (67%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PF D+AYQGFA G ++ DA +VR+F++ GL+  V+ S+SK+  LY ER+GA+++V +  
Sbjct: 210 VPFLDMAYQGFADG-IEPDAVAVRLFSASGLQFFVSSSFSKSFSLYGERVGALSIVTADK 268

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A RV SQ+KR+ R  YSNPP HG  +VA V+  PEL   W+ E+  M  RI+++R  L
Sbjct: 269 DEAGRVLSQVKRVIRTNYSNPPTHGGAVVAAVLNAPELRQMWEDELAGMRDRIRAMRVGL 328

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            +SL     + +D++F+++Q GMFS+TGL+ AQ E + N++ IY    GRI LA L++  
Sbjct: 329 VESLKGAGVA-QDFSFVIEQRGMFSYTGLSAAQVEQLKNEFGIYAVSTGRICLAALNSRN 387

Query: 329 CEYLADAI 306
             Y+A AI
Sbjct: 388 IGYVAKAI 395



>sp|P72173|AAT_PSEAE Aspartate aminotransferase (EC 2.6.1.1)
           (Transaminase A) (AspAT).>pir|B83252|B83252 probable
           amino acid aminotransferase PA3139 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004738_57375
           Pseudomonas aeruginosa PAO1, section 299 of 529 of the
           complete genome.>gb:AE004091_971475 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 398

 Score =  166 bits (420), Expect = 6e-40
 Identities = 82/192 (42%), Positives = 128/192 (66%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H+PF D+AYQGF +G ++ DA++VR+FA  GL   V+ S+SK+  LY ER+GA+++V 
Sbjct: 206 KGHVPFLDIAYQGFGNG-IEEDAAAVRLFAQSGLSFFVSSSFSKSFSLYGERVGALSIVT 264

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            S D +ARV SQ+KR+ R  YSNPP HGA +V++V+ +PEL   W+QE+  M  RI+ +R
Sbjct: 265 ESRDESARVLSQVKRVIRTNYSNPPTHGASVVSSVLNSPELRALWEQELGEMRDRIRDMR 324

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             + + L+    + +D++F+ +Q GMFS++GL   Q E +  ++ IY    GRI +A L+
Sbjct: 325 LAMVEQLAAHG-AKRDFSFVGRQRGMFSYSGLTADQVERLKTEFGIYAVSTGRICVAALN 383

Query: 338 AAKCEYLADAII 303
            +  E +  AI+
Sbjct: 384 KSNLETITKAIV 395



>pir|H81054|H81054 aromatic-amino-acid transaminase (EC 2.6.1.57)
           NMB1678 [similarity] - Neisseria meningitidis (strain
           MC58 serogroup B)>gb:AE002518_47080 Neisseria
           meningitidis serogroup B strain MC58 section 160 of 206
           of the complete genome.>gb:AE002098_897193 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 397

 Score =  166 bits (419), Expect = 7e-40
 Identities = 84/190 (44%), Positives = 127/190 (66%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G LD+DA +VR      L L V+ S+SKNL LY ER+G ++VVC + 
Sbjct: 207 IPFMDIAYQGFG-GDLDSDAYAVRKAVEMELPLFVSNSFSKNLSLYGERVGGLSVVCPNK 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + A  V  QLK   R +YS+PP HGA I A+V+ +PEL+  W+ E+ MM  RI+++RQKL
Sbjct: 266 EEADLVFGQLKFTVRRIYSSPPAHGAYIAADVMNSPELYALWQNEVYMMRDRIRAMRQKL 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           YD L+ +  + +D+T+ +KQ GMF +TGL+  Q   + +++ +Y+   GR+ +AGL+ + 
Sbjct: 326 YDVLTAQIPN-RDFTYFIKQRGMFGYTGLSVEQVRRLRDEFAVYLLDSGRMCVAGLNTSN 384

Query: 329 CEYLADAIID 300
            +Y+A A  +
Sbjct: 385 TDYVARAFAE 394



>pir|G81821|G81821 aromatic-amino-acid transaminase (EC 2.6.1.57)
           NMA1937 [similarity] - Neisseria meningitidis (strain
           Z2491 serogroup A)>gb:NMA6Z2491_154813 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 6/7.
          Length = 397

 Score =  165 bits (418), Expect = 9e-40
 Identities = 84/190 (44%), Positives = 126/190 (66%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G LD+DA +VR      L L V+ S+SKNL LY ER+G ++VVC + 
Sbjct: 207 IPFMDIAYQGFG-GDLDSDAYAVRKAVEMELPLFVSNSFSKNLSLYGERVGGLSVVCPNK 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + A  V  QLK   R +YS+PP HGA I A+V+ +PEL+  W+ E+ MM  RI+++RQKL
Sbjct: 266 EEADLVFGQLKFTVRRIYSSPPAHGAYIAADVMNSPELYALWQNEVYMMRDRIRAMRQKL 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           YD L+ +    +D+T+ +KQ GMF +TGL+  Q   + +++ +Y+   GR+ +AGL+ + 
Sbjct: 326 YDVLTAQIPD-RDFTYFIKQRGMFGYTGLSVEQVRRLRDEFAVYLLDSGRMCVAGLNTSN 384

Query: 329 CEYLADAIID 300
            +Y+A A  +
Sbjct: 385 TDYVARAFAE 394



>pir|T29856|T29856 probable aspartate transaminase (EC 2.6.1.1)
           T01C8.4 [similarity] - Caenorhabditis
           elegans>gb:U58726_1405208 Caenorhabditis elegans cosmid
           T01C8, complete sequence.
          Length = 357

 Score =  165 bits (418), Expect = 9e-40
 Identities = 84/195 (43%), Positives = 127/195 (65%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +KN   FF +A QG ASG  DADA +VR F  +GLE++V+QS+SKN GLY +R+G++ V+
Sbjct: 159 QKNLFTFFHIADQGLASGDADADAWAVRFFVEQGLEMIVSQSFSKNFGLYNDRVGSLTVI 218

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            +     A +KSQL  +    +SNPP +GARIV  ++ +P+   +W+  ++MMA RIK  
Sbjct: 219 VNKPSHIANLKSQLTLVNVSNFSNPPAYGARIVHEILKSPKYREQWQNSIKMMAFRIKKT 278

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+L   L++   SGK W  I +Q G+FS+TGL   Q +++     IY+  DGRI++ GL
Sbjct: 279 RQELIRELNMLQTSGK-WDRITQQSGLFSYTGLTPCQVDHLIAHHKIYLLSDGRINICGL 337

Query: 341 SAAKCEYLADAIIDS 297
           + +  +Y+A AI D+
Sbjct: 338 NMSNLDYVARAIDDT 352



>pir|T37507|T37507 aspartate transaminase (EC 2.6.1.1), cytosolic
           SPAC10F6.13c [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC10F6_1716310 S.pombe
           chromosome I cosmid c10F6.
          Length = 409

 Score =  165 bits (417), Expect = 1e-39
 Identities = 82/190 (43%), Positives = 124/190 (65%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           + H+  FD+AYQGFASG L+ D+ ++  F     +  V QS++KN+GLY ER G ++ V 
Sbjct: 212 RKHLVVFDIAYQGFASGDLNRDSWALNEFVKYNKDFFVCQSFAKNMGLYGERTGCMHYVA 271

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
             A    +V SQL  + R   SNPP +GARI A ++ +P+LF EW+Q+++ M+ RI  +R
Sbjct: 272 KDASTKNKVLSQLCIVQRNTISNPPAYGARIAAEILNSPQLFAEWEQDLKTMSSRIIEMR 331

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           ++L DSL +  K+   W  I +QIGMFSFTGL  AQ +    ++H+Y + +GRIS+AGL+
Sbjct: 332 KRLRDSL-VALKTPGSWDHITQQIGMFSFTGLTPAQVQFCQERYHLYFSANGRISMAGLN 390

Query: 338 AAKCEYLADA 309
            +  E++A A
Sbjct: 391 NSNVEHVAQA 400



>gb:AL646062_545938 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 6/19.
          Length = 398

 Score =  164 bits (416), Expect = 2e-39
 Identities = 87/193 (45%), Positives = 126/193 (65%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  IPF D+AYQGFA G +  D  +V +FA  GL+  V+ S+SK+  LY ER+GA+++V 
Sbjct: 206 KQLIPFLDMAYQGFADG-IAQDGLAVSLFAESGLQFFVSSSFSKSFSLYGERVGALSIVT 264

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +S D AARV SQ+KR+ R  YSNPP HG  +VA+V+ +PEL   W+QE+  M  RIKS+R
Sbjct: 265 TSKDEAARVMSQVKRVIRTNYSNPPTHGGTVVASVLTSPELRAMWEQELGEMRDRIKSMR 324

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L D L+ K     D++F+  Q GMFS++GL+ AQ + + N+  IY    GRI +A L+
Sbjct: 325 HALVDKLAAKGVK-TDFSFVKAQRGMFSYSGLSAAQVDRLRNEHGIYAVSTGRICVAALN 383

Query: 338 AAKCEYLADAIID 300
           +   + + +AI +
Sbjct: 384 SHNIDAVVNAIAE 396



>gb:CR382135_1667955 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 431

 Score =  164 bits (414), Expect = 3e-39
 Identities = 84/201 (41%), Positives = 128/201 (63%), Gaps = 9/201 (4%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLV---------AQSYSKNLGLYA 729
           +K   P  D+AYQGFASG+   D   +R    R  EL+V          QS++KN+GLY 
Sbjct: 232 QKQLFPLVDMAYQGFASGNPYKDIGLIR----RLNELVVNGDISTYALCQSFAKNMGLYG 287

Query: 728 ERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEME 549
           ER G+I++V  SA+ +  ++SQLK+L RP+YS+PPIHG++IV  +  +  L+N W  +++
Sbjct: 288 ERTGSISIVTESAEHSTAIESQLKKLIRPIYSSPPIHGSKIVETIFADESLYNSWLSDLD 347

Query: 548 MMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTK 369
            +  R+ +VR KLY+ L   DKS  +W  +LKQ GMF +TGL+  Q   +  K+ +Y T+
Sbjct: 348 QVVSRLNTVRTKLYEKL---DKSNYNWDHLLKQRGMFVYTGLSAEQVIELREKYSVYATE 404

Query: 368 DGRISLAGLSAAKCEYLADAI 306
           DGR S++G++    +YLADA+
Sbjct: 405 DGRFSISGINDNNVDYLADAM 425



>gb:AF326988_1262832 Crithidia fasciculata aspartate
           aminotransferase gene, complete cds.
          Length = 405

 Score =  164 bits (414), Expect = 3e-39
 Identities = 88/198 (44%), Positives = 125/198 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H  FFD AYQG+ASGSLD DA + R+F  +G++ ++AQS+SKN+GLY ER G ++VV 
Sbjct: 210 KKHQVFFDSAYQGYASGSLDEDAFAARLFVKKGVQFILAQSFSKNMGLYNERTGTLSVVL 269

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            + + AA VK+ L  L R  YSNPP HGAR+V  V+ + EL  EW+ E+  MA RI+++R
Sbjct: 270 RNPERAAAVKTHLDLLIRANYSNPPAHGARLVHLVLSDKELRKEWEAELAEMANRIRTMR 329

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             +YD L      G  W  I+ QIGMFSF GL+K Q +   +  ++++   GR ++AGL+
Sbjct: 330 HTVYDELKRLGTPG-TWEHIINQIGMFSFLGLSKEQCQYCQDH-NVFILLSGRANMAGLT 387

Query: 338 AAKCEYLADAIIDSYYNV 285
                 LA  I ++   V
Sbjct: 388 HDTALMLARTIDEAVRTV 405



>gb:AE004969_61008 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 397

 Score =  163 bits (413), Expect = 4e-39
 Identities = 83/190 (43%), Positives = 125/190 (65%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G LD+DA +VR      L L V+ S+SKNL LY ER+G ++VVC + 
Sbjct: 207 IPFMDIAYQGFG-GDLDSDAYAVRKAVEMDLPLFVSNSFSKNLSLYGERVGGLSVVCPNK 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + A  V  QLK   R +YS+PP HGA I A+V+ + EL+  W+ E+ MM  RI+++RQKL
Sbjct: 266 EEADLVFGQLKFTVRRIYSSPPAHGAYIAADVMNSSELYALWQNEVYMMRDRIRAMRQKL 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           Y  L+ +    +D+T+ +KQ GMF +TGL+  Q   + +++ +Y+   GR+ +AGL+ + 
Sbjct: 326 YGVLTARIPD-RDFTYFIKQRGMFGYTGLSVGQVRRLRDEFAVYLLDSGRMCVAGLNTSN 384

Query: 329 CEYLADAIID 300
             Y+ADA+ +
Sbjct: 385 ITYVADALAE 394



>sp|Q22067|AATC_CAEEL Probable aspartate aminotransferase,
           cytoplasmic (EC 2.6.1.1) (Transaminase A) (Glutamate
           oxaloacetate transaminase-1).>pir|T29857|T29857 probable
           aspartate transaminase (EC 2.6.1.1) T01C8.5 [similarity]
           - Caenorhabditis elegans>gb:U58726_1405209
           Caenorhabditis elegans cosmid T01C8, complete sequence.
          Length = 408

 Score =  163 bits (412), Expect = 5e-39
 Identities = 83/191 (43%), Positives = 121/191 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           KN   FFD+AYQGFASG   ADA ++R F  +G+E++V+QS++KN GLY ER+G + VV 
Sbjct: 208 KNLFTFFDIAYQGFASGDPAADAWAIRYFVDQGMEMVVSQSFAKNFGLYNERVGNLTVVV 267

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           ++    A  +SQ+  + R  +SNPP HGARIV  V+  P    +W Q ++ M+ RIK +R
Sbjct: 268 NNPAVIAGFQSQMSLVIRANWSNPPAHGARIVHKVLTTPARREQWNQSIQAMSSRIKQMR 327

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L   L      G  W  I++QIGMFS+TGL  AQ +++     +++ +DGRI++ GL+
Sbjct: 328 AALLRHLMDLGTPG-TWDHIIQQIGMFSYTGLTSAQVDHLIANHKVFLLRDGRINICGLN 386

Query: 338 AAKCEYLADAI 306
               EY+A AI
Sbjct: 387 TKNVEYVAKAI 397



>gb:BX640443_814922 Bordetella bronchiseptica strain RB50, complete
           genome; segment 7/16.
          Length = 400

 Score =  162 bits (411), Expect = 6e-39
 Identities = 83/191 (43%), Positives = 124/191 (64%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           +N +PF D+AYQGF  G L+ DA+ VRMFA+  L + ++ S+SK+  LY ER+GA+ VV 
Sbjct: 207 RNLVPFLDIAYQGFGEG-LEQDAAVVRMFAALDLTMFISSSFSKSFSLYGERVGALTVVA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            S D AARV SQLKR+ R  YSNPP HG  +V+ V+  PELF  W+ E+  M  RI+ +R
Sbjct: 266 GSKDEAARVLSQLKRVIRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMR 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           ++L + +  +  + +D++F+L Q GMFS++GL  AQ + +  +  IY    GRI +A L+
Sbjct: 326 KELVEKIKAQGVA-QDFSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALN 384

Query: 338 AAKCEYLADAI 306
           +   + +A  I
Sbjct: 385 SRNIDAVAAGI 395



>gb:BX640429_810276 Bordetella parapertussis strain 12822, complete
           genome; segment 7/14.
          Length = 400

 Score =  162 bits (411), Expect = 6e-39
 Identities = 83/191 (43%), Positives = 124/191 (64%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           +N +PF D+AYQGF  G L+ DA+ VRMFA+  L + ++ S+SK+  LY ER+GA+ VV 
Sbjct: 207 RNLVPFLDIAYQGFGEG-LEQDAAVVRMFAALDLTMFISSSFSKSFSLYGERVGALTVVA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            S D AARV SQLKR+ R  YSNPP HG  +V+ V+  PELF  W+ E+  M  RI+ +R
Sbjct: 266 GSKDEAARVLSQLKRVIRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMR 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           ++L + +  +  + +D++F+L Q GMFS++GL  AQ + +  +  IY    GRI +A L+
Sbjct: 326 KELVEKIKAQGVA-QDFSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALN 384

Query: 338 AAKCEYLADAI 306
           +   + +A  I
Sbjct: 385 SRNIDAVAAGI 395



>gb:BX640416_806209 Bordetella pertussis strain Tohama I, complete
           genome; segment 6/12.
          Length = 400

 Score =  162 bits (411), Expect = 6e-39
 Identities = 83/191 (43%), Positives = 124/191 (64%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           +N +PF D+AYQGF  G L+ DA+ VRMFA+  L + ++ S+SK+  LY ER+GA+ VV 
Sbjct: 207 RNLVPFLDIAYQGFGEG-LEQDAAVVRMFAALDLTMFISSSFSKSFSLYGERVGALTVVA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            S D AARV SQLKR+ R  YSNPP HG  +V+ V+  PELF  W+ E+  M  RI+ +R
Sbjct: 266 GSKDEAARVLSQLKRVIRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMR 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           ++L + +  +  + +D++F+L Q GMFS++GL  AQ + +  +  IY    GRI +A L+
Sbjct: 326 KELVEKIKTQGVA-QDFSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALN 384

Query: 338 AAKCEYLADAI 306
           +   + +A  I
Sbjct: 385 SRNIDAVAAGI 395



>gb:BX571966_793591 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_868185
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 399

 Score =  161 bits (408), Expect = 1e-38
 Identities = 84/188 (44%), Positives = 123/188 (65%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PF D+AYQGF   S++ADA++VR+FA+  L + V+ S+SK+  LY ER+GA++++  S 
Sbjct: 209 VPFLDIAYQGFGE-SIEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSK 267

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D AARV SQLKR+ R  YSNPP HG  IVA V+ +PEL   W QE+  M  RI+++R  L
Sbjct: 268 DEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGL 327

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            + L       +D++FI  Q GMFS++GL  AQ + +  ++ IY    GRI +A L+   
Sbjct: 328 VERLKAAGIE-RDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRN 386

Query: 329 CEYLADAI 306
            + +A+AI
Sbjct: 387 LDVVANAI 394



>gb:AE016781_331401 Pseudomonas putida KT2440 section 8 of 21 of the
           complete genome.>gb:AE015451_946478 Pseudomonas putida
           KT2440 complete genome.
          Length = 398

 Score =  161 bits (407), Expect = 2e-38
 Identities = 82/193 (42%), Positives = 125/193 (64%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H+PF D+AYQGF  G  + DA +VR+FA  GLE  V+ S+SK+  LY ER+GA+++V 
Sbjct: 206 KGHVPFLDMAYQGFGDGIAE-DAFAVRLFAESGLEFFVSSSFSKSFSLYGERVGALSIVT 264

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +S D + RV SQ+KR+ R  YSNPP HGA IVA V+ + EL   W+ E+  M  RI  +R
Sbjct: 265 ASKDESTRVLSQVKRVIRTTYSNPPTHGATIVATVLNSAELRQMWETELAEMRERIHGMR 324

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           +++  SL  +  + +D++F+ +Q+GMFS++GL   Q   + N + IY    GRI++A L+
Sbjct: 325 KQMV-SLLAEYGANRDFSFVGRQVGMFSYSGLTVEQVTRLKNDFGIYALDTGRIAVAALN 383

Query: 338 AAKCEYLADAIID 300
            +    +  AI++
Sbjct: 384 QSNIHVVTKAIVE 396



>gb:CR555306_105714 Azoarcus sp. EbN1 complete genome.
          Length = 404

 Score =  160 bits (404), Expect = 4e-38
 Identities = 81/188 (43%), Positives = 119/188 (63%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF   +LD DA + R  A  G+   V+ S+SKNL  Y ER G ++VVC  A
Sbjct: 207 IPFLDIAYQGFGD-NLDDDAYAARAMADAGVSFFVSNSFSKNLSFYGERCGGLSVVCQDA 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           D A RV  QLK   R  YS+PP+HG R+ A V+ +  L  EW  E+  M  RIK++R+KL
Sbjct: 266 DEAERVLGQLKFTVRRNYSSPPVHGGRVAAAVMNDAGLHEEWVGEVRGMRERIKAMREKL 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           ++ LS     G+D+++ +KQ GMFS+TGL   Q + +  ++ +Y+ + GR+ +AGL+   
Sbjct: 326 HEVLS-STLPGRDFSYFVKQRGMFSYTGLTPEQVDRLREEFAVYVVQSGRMCVAGLNRGN 384

Query: 329 CEYLADAI 306
            +Y+A A+
Sbjct: 385 VDYVAKAM 392



>gb:AE015676_316723 Shewanella oneidensis MR-1 section 225 of 457 of
           the complete genome.>gb:AE014299_952320 Shewanella
           oneidensis MR-1 complete genome.
          Length = 397

 Score =  159 bits (402), Expect = 7e-38
 Identities = 89/193 (46%), Positives = 125/193 (64%), Gaps = 1/193 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K  +P FD AYQGF +G ++ DA+ +R+ AS+  ELLVA S+SKN GLY ERIGA+ VV
Sbjct: 204 DKQLVPLFDFAYQGFGTG-IEEDAAGLRLVASKVPELLVANSFSKNFGLYNERIGAVTVV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +AD A R  SQ+KR  R  YSNPP HGA IV+ ++ +  L   W QE+  M  RI  +
Sbjct: 263 AHNADEAVRAFSQVKRTIRANYSNPPAHGALIVSTILSDAALKALWVQELTEMRERIALM 322

Query: 521 RQKLYDSLSLKDKS-GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           R       SLKD+   +D++FI +Q GMFSF+GLNK+Q   + +++ +Y+   GRIS+AG
Sbjct: 323 RTLFVQ--SLKDEGVTQDFSFISRQNGMFSFSGLNKSQVARLKDEFGVYIVGSGRISVAG 380

Query: 344 LSAAKCEYLADAI 306
           ++ A    +  AI
Sbjct: 381 MTKANMPAICKAI 393



>gb:AE006099_215509 Pasteurella multocida subsp. multocida str. Pm70
           section 66 of 204 of the complete
           genome.>gb:AE004439_1118239 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 396

 Score =  159 bits (402), Expect = 7e-38
 Identities = 85/192 (44%), Positives = 121/192 (63%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA+G L+ DA  +R FA    ELLVA SYSKN GLY+ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFANG-LEEDAFGLRTFAKNHKELLVASSYSKNFGLYSERVGAFTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +   AA   +Q+K + R +YSNP  HGA  V+ V+ + +L  EW+ E+  M  RIK +
Sbjct: 262 AETEQIAATALTQVKTIIRTLYSNPASHGATTVSMVLKDSQLRAEWENELTEMRERIKQM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +  + L     S +D++FI+ Q GMFSF GLN AQ + +  ++ IY  + GRI++AG+
Sbjct: 322 RSQFVELLK-AFASEQDFSFIIDQNGMFSFCGLNPAQMDRLKEEFAIYAVRSGRINVAGI 380

Query: 341 SAAKCEYLADAI 306
           +     YL ++I
Sbjct: 381 TEQNIRYLCESI 392



>sp|P58661|AAT_SALTY Aspartate aminotransferase (EC 2.6.1.1)
           (Transaminase A) (AspAT).>gb:AE008743_242704 Salmonella
           typhimurium LT2, section 49 of 220 of the complete
           genome.>gb:AE006468_999786 Salmonella typhimurium LT2,
           complete genome.
          Length = 396

 Score =  159 bits (402), Expect = 7e-38
 Identities = 86/193 (44%), Positives = 121/193 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R FA+   EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFARG-LEEDAEGLRAFAALHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + A+   R  SQ+K   R  YSNPP HGA IVA ++ N  L   W+QE+  M  RI+ +
Sbjct: 262 AADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSNDALRAIWEQELTDMRQRIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+KQ GMFSF+GL K Q   +  ++ +Y    GR+++AG+
Sbjct: 322 RQLFVNTLQEKG-ANRDFSFIIKQNGMFSFSGLTKDQVLRLREEFGVYAVASGRVNVAGM 380

Query: 341 SAAKCEYLADAII 303
           +      L +AI+
Sbjct: 381 TPDNMAPLCEAIV 393



>sp|Q56114|AAT_SALTI Aspartate aminotransferase (EC 2.6.1.1)
           (Transaminase A) (AspAT).>pir|AD0616|AD0616 aspartate
           aminotransferase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)>gb:AE016840_346018
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           section 7 of 16 of the complete
           genome.>gb:AL627268_541243 Salmonella enterica serovar
           Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 4/20.>gb:AE014613_983350 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 396

 Score =  159 bits (402), Expect = 7e-38
 Identities = 86/193 (44%), Positives = 121/193 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R FA+   EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFARG-LEEDAEGLRAFAALHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + A+   R  SQ+K   R  YSNPP HGA IVA ++ N  L   W+QE+  M  RI+ +
Sbjct: 262 AADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSNDALRAIWEQELTDMRQRIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+KQ GMFSF+GL K Q   +  ++ +Y    GR+++AG+
Sbjct: 322 RQLFVNTLQEKG-ANRDFSFIIKQNGMFSFSGLTKDQVLRLREEFGVYAVASGRVNVAGM 380

Query: 341 SAAKCEYLADAII 303
           +      L +AI+
Sbjct: 381 TPDNMAPLCEAIV 393



>gb:CP000026_76600 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 396

 Score =  159 bits (401), Expect = 9e-38
 Identities = 86/193 (44%), Positives = 121/193 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R FA+   EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFARG-LEEDAEGLRAFAALHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + A+   R  SQ+K   R  YSNPP HGA IVA ++ N  L   W+QE+  M  RI+ +
Sbjct: 262 AADAETVDRAFSQMKSAIRANYSNPPAHGASIVATILSNDVLRAIWEQELTDMRQRIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+KQ GMFSF+GL K Q   +  ++ +Y    GR+++AG+
Sbjct: 322 RQLFVNTLQEKG-ANRDFSFIIKQNGMFSFSGLTKDQVLRLREEFGVYAVASGRVNVAGM 380

Query: 341 SAAKCEYLADAII 303
           +      L +AI+
Sbjct: 381 TPDNMAPLCEAIV 393



>gb:AY168853_594397 Pseudomonas putida aromatic amino acid
           aminotransferase (tatA) gene, complete cds.
          Length = 398

 Score =  158 bits (400), Expect = 1e-37
 Identities = 82/193 (42%), Positives = 123/193 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H+PF D+AYQGF  G  + DA +VR+FA  GLE  V+ S+SK+  LY ER+GA+++V 
Sbjct: 206 KGHVPFLDMAYQGFGDGIAE-DAFAVRLFAESGLEFFVSSSFSKSFSLYGERVGALSIVT 264

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            + D + RV SQ+KR+ R  YSNPP HGA IVA V+ + EL   W+ E+  M  RI  +R
Sbjct: 265 GNKDESTRVLSQVKRVIRTTYSNPPTHGATIVATVLNSDELRQMWEAELGEMRQRIHGMR 324

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q++  SL  +  + +D++F+ +Q GMFS++GL   Q   + N + IY    GRI++A L+
Sbjct: 325 QQMV-SLLAEYGAKRDFSFVGRQAGMFSYSGLTVEQVARLKNDFGIYALDTGRIAVAALN 383

Query: 338 AAKCEYLADAIID 300
            +    +  AI++
Sbjct: 384 QSNIHVVTKAIVE 396



>gb:AE016758_325107 Escherichia coli CFT073 section 4 of 18 of the
           complete genome.>gb:AE014075_955691 Escherichia coli
           CFT073 complete genome.
          Length = 396

 Score =  158 bits (400), Expect = 1e-37
 Identities = 84/193 (43%), Positives = 121/193 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R FA+   EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFARG-LEEDAEGLRAFAALHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + ++   R  SQ+K   R  YSNPP HGA +VA ++ N  L   W+QE+  M  RI+ +
Sbjct: 262 AADSETVERAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+KQ GMFSF+GL K Q   +  ++ +Y    GR+++AG+
Sbjct: 322 RQLFVNTLQEKG-ANRDFSFIIKQNGMFSFSGLTKEQVLRLRQEFGVYAVASGRVNVAGM 380

Query: 341 SAAKCEYLADAII 303
           +      L +AI+
Sbjct: 381 TPDNMAPLCEAIV 393



>pir|A85619|A85619 aspartate aminotransferase [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>pir|C90755|C90755 aspartate aminotransferase
           [imported] - Escherichia coli  (strain O157:H7,
           substrain RIMD 0509952)>gb:AE005174_65346 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:BA000007_659023
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 396

 Score =  158 bits (400), Expect = 1e-37
 Identities = 84/193 (43%), Positives = 121/193 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R FA+   EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFARG-LEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + ++   R  SQ+K   R  YSNPP HGA +VA ++ N  L   W+QE+  M  RI+ +
Sbjct: 262 AADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+KQ GMFSF+GL K Q   +  ++ +Y    GR+++AG+
Sbjct: 322 RQLFVNTLQEKG-ANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGM 380

Query: 341 SAAKCEYLADAII 303
           +      L +AI+
Sbjct: 381 TPDNMAPLCEAIV 393



>sp|P00509|AAT_ECOLI Aspartate aminotransferase (EC 2.6.1.1)
           (Transaminase A) (ASPAT).>pir|A00598|XNECD aspartate
           transaminase (EC 2.6.1.1) aspC [validated] - Escherichia
           coli (strain K-12)>gb:D90730_121728 Escherichia coli K12
           genomic DNA. (20.9 - 21.3 min).>gb:D90731_121734
           Escherichia coli K12 genomic DNA. (21.2 - 21.5
           min).>gb:ECASPC_125100 E. coli aspC gene for aspartate
           aminotransferase.>gb:ECASPCG_125101 E. coli aspC gene
           for aspartate aminotransferase.>gb:U00096_200003
           Escherichia coli K-12 MG1655 complete genome.
          Length = 396

 Score =  158 bits (400), Expect = 1e-37
 Identities = 84/193 (43%), Positives = 121/193 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R FA+   EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFARG-LEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + ++   R  SQ+K   R  YSNPP HGA +VA ++ N  L   W+QE+  M  RI+ +
Sbjct: 262 AADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+KQ GMFSF+GL K Q   +  ++ +Y    GR+++AG+
Sbjct: 322 RQLFVNTLQEKG-ANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGM 380

Query: 341 SAAKCEYLADAII 303
           +      L +AI+
Sbjct: 381 TPDNMAPLCEAIV 393



>gb:BX950851_841279 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 396

 Score =  157 bits (398), Expect = 2e-37
 Identities = 83/192 (43%), Positives = 122/192 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  +P FD AYQGFA G ++ DA  +R+FA++  EL+V  SYSKN GLY ER+GA  +V 
Sbjct: 204 KGWLPLFDFAYQGFARG-IEEDAEGLRLFAAKHAELIVCSSYSKNFGLYNERVGACTLVA 262

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           + A  A +  SQ+K   R  YSNPP HGA IVA ++GN  L   W+QE+  M  RI+ +R
Sbjct: 263 ADAATADKAFSQVKAAIRANYSNPPSHGATIVATILGNDALKAIWEQELTAMRERIQRMR 322

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q   ++L  K  + +D++FI+ Q GMFSF+GL K Q   + +++ +Y    GR+++AG++
Sbjct: 323 QLFVNTLQEKG-AQQDFSFIINQNGMFSFSGLTKEQVLRLRDEFGVYAVNSGRVNVAGMT 381

Query: 338 AAKCEYLADAII 303
                 L +AI+
Sbjct: 382 PENMAPLCEAIV 393



>gb:AF183931_486407 Aeromonas hydrophila putative ATP-dependent
           helicase (dinG), outer membrane protein porin II
           (ompII), and aspartate amino-transferase (aspC) genes,
           complete cds.
          Length = 396

 Score =  157 bits (398), Expect = 2e-37
 Identities = 85/188 (45%), Positives = 124/188 (65%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +P FD AYQGFA G ++ DA  +R+FA    ELLVA S+SKN GLY ER+GA  +V ++ 
Sbjct: 207 LPLFDFAYQGFARG-IEEDAEGLRIFAECHDELLVASSFSKNFGLYNERVGAFTLVSATK 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
             A    +Q+K + R  YSNPP HGA +V  +V +P L+ EW +E+  M  RI+ +R+ L
Sbjct: 266 AIADVAFTQVKTVIRANYSNPPSHGAAVVTTIVSDPALYVEWVEEVAAMRVRIREMRELL 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            + L+    S +D++FI +Q GMFSF+GL+K Q E + +++ IY+   GRIS+AG++ A 
Sbjct: 326 VEKLAALGVS-QDFSFIREQNGMFSFSGLSKDQVEQLKSEFAIYIVGSGRISVAGITRAN 384

Query: 329 CEYLADAI 306
            + L DAI
Sbjct: 385 IDPLCDAI 392



>gb:AE016863_351592 Pseudomonas syringae pv. tomato str. DC3000
           section 8 of 21 of the complete
           genome.>gb:AE016853_1036767 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 398

 Score =  157 bits (398), Expect = 2e-37
 Identities = 79/191 (41%), Positives = 126/191 (65%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H+PF D+AYQGF  G +  DA +VR+FA  GL    + S+SK+L LY ER+GA++++ 
Sbjct: 206 KGHVPFLDMAYQGFGQG-IQEDALAVRLFAESGLTFFASSSFSKSLSLYGERVGALSIIT 264

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            S +  ARV SQ+KR+ R  YSNPP HGA I A V+ +P L   W++E+  M  RI+ +R
Sbjct: 265 ESKEETARVLSQVKRVIRTNYSNPPTHGAIISAAVLNDPALRAMWEEELGEMRVRIQGMR 324

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           + + + L+  + +G+D++F+ +Q GMFS++GL  AQ++ + +++ IY    GRI +A L+
Sbjct: 325 KAMVERLA-DNPAGQDFSFVGRQCGMFSYSGLTAAQAQRLRSEFGIYALDTGRICVAALN 383

Query: 338 AAKCEYLADAI 306
               + + +AI
Sbjct: 384 QKNIDAVCEAI 394



>gb:AE013598_293717 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 416

 Score =  157 bits (396), Expect = 3e-37
 Identities = 83/193 (43%), Positives = 128/193 (66%), Gaps = 1/193 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLE-LLVAQSYSKNLGLYAERIGAINV 705
           E+N  PF D+AYQGF  G ++ADA +VR+ A+ G++  +VA SYSK+  LY ER+GA++V
Sbjct: 221 ERNLFPFVDIAYQGFDKG-IEADAHAVRLLAAEGIDSYVVASSYSKSFSLYGERVGALSV 279

Query: 704 VCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKS 525
           V ++A  A  V+SQ+KR+ R +YS+P  HGA +VA V+ +PEL + W+QE+  M  RI +
Sbjct: 280 VSATAAEAKAVQSQVKRIIRTIYSSPSTHGAALVAGVLTSPELRDVWEQELTEMRERIHA 339

Query: 524 VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           +R  L + L+       ++ FI +Q GMFS++GL K Q + + +++ IY    GRI +A 
Sbjct: 340 LRAGLVEKLA--TLGAPEFEFIQRQAGMFSYSGLTKTQMDRLRDEFAIYAVGTGRICVAA 397

Query: 344 LSAAKCEYLADAI 306
           LS    +Y+A A+
Sbjct: 398 LSQRNLDYVAQAV 410



>gb:AE011635_275088 Xanthomonas axonopodis pv. citri str. 306,
           section 13 of 469 of the complete
           genome.>gb:AE008923_916863 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 400

 Score =  157 bits (396), Expect = 3e-37
 Identities = 84/193 (43%), Positives = 128/193 (66%), Gaps = 1/193 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLE-LLVAQSYSKNLGLYAERIGAINV 705
           E+N  PF D+AYQGF  G ++ADA +VR+ A+ G++  +VA SYSK+  LY ER+GA++V
Sbjct: 205 ERNLFPFVDIAYQGFDKG-IEADAYAVRLLAAEGIDSYVVASSYSKSFSLYGERVGALSV 263

Query: 704 VCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKS 525
           V ++A  A  V+SQ+KR+ R +YS+P  HGA +VA V+ +PEL + W+QE+  M  RI S
Sbjct: 264 VSATAAEAKAVQSQVKRIIRTIYSSPSTHGAALVAGVLTSPELRDLWEQELTEMRERIHS 323

Query: 524 VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           +R  L + L+       ++ FI +Q GMFS++GL K Q + + +++ IY    GRI +A 
Sbjct: 324 LRAGLVEKLA--TLGAPEFDFIQRQAGMFSYSGLTKTQVDRLRDEFAIYAVGTGRICVAA 381

Query: 344 LSAAKCEYLADAI 306
           LS    +Y+A A+
Sbjct: 382 LSQRNLDYVAQAV 394



>gb:AE005674_70507 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016981_370888 Shigella flexneri 2a str.
           2457T section 4 of 16 of the complete
           genome.>gb:AE014073_995638 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 396

 Score =  157 bits (396), Expect = 3e-37
 Identities = 83/193 (43%), Positives = 121/193 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G L+ DA  +R FA+   EL+VA SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGFARG-LEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            + ++   R  SQ+K   R  YSNPP HGA +VA ++ N  L   W+QE+  M  RI+ +
Sbjct: 262 AADSEIVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ   ++L  K  + +D++FI+KQ GMFSF+GL K Q   +  ++ +Y    GR+++AG+
Sbjct: 322 RQLFVNTLQEKG-ANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGM 380

Query: 341 SAAKCEYLADAII 303
           +      L ++I+
Sbjct: 381 TPDNMAPLCESIV 393



>gb:CR378670_95703 Photobacterium profundum SS9; segment 8/12.
          Length = 396

 Score =  156 bits (395), Expect = 4e-37
 Identities = 87/182 (47%), Positives = 120/182 (65%), Gaps = 1/182 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G ++ DA  +R+FA +  ELLVA S+SKN GLY ER+GA  +V
Sbjct: 203 EKKLLPMFDFAYQGFAVG-VEEDAQGLRIFAEQCSELLVASSFSKNFGLYNERVGAFTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +A+ AA   SQ+K +AR +YSNPP HGA IV  ++ +  L NEW+QE+  M  RI+ +
Sbjct: 262 GKNAEQAATAFSQVKSIARVIYSNPPAHGAAIVTLILNDEALRNEWEQEVADMRNRIQEM 321

Query: 521 RQKLYDSLSLKDKS-GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           R       +LKD     D++FI +Q GMFSF+GLNK Q   +  ++ IY+   GRIS+AG
Sbjct: 322 RTLFVQ--TLKDCGVDADFSFIERQNGMFSFSGLNKDQVNRLKEEFGIYIVGSGRISVAG 379

Query: 344 LS 339
           ++
Sbjct: 380 MT 381



>gb:AE017154_392829 Haemophilus ducreyi strain 35000HP section 4 of
           6 of the complete genome.>gb:AE017143_1027091
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 396

 Score =  156 bits (394), Expect = 6e-37
 Identities = 84/193 (43%), Positives = 119/193 (61%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQG A+G LD DA  +R FA    ELL+A SYSKN GLY ER+GA  +V
Sbjct: 203 EKGWLPLFDFAYQGLANG-LDEDAYGLRAFAKNHKELLIASSYSKNFGLYNERVGAFTLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +A+ A    +Q+K + R +YSNP  HGA  V  V+ + +L   W  E+  M  RIK++
Sbjct: 262 AENAEIANNAFTQIKSIIRVLYSNPAAHGAHTVTTVLADDQLRANWIAELSEMRDRIKTM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R K+   L+ K  + KD++FI  Q GMFSF+GL   Q + + +++ IY  + GRI++AGL
Sbjct: 322 RTKMVQLLAEKG-AKKDFSFISDQNGMFSFSGLTATQVDRLRDEFAIYAVRSGRINVAGL 380

Query: 341 SAAKCEYLADAII 303
           +    E   DA++
Sbjct: 381 TDDNIEAFCDAVV 393



>gb:CR522870_99462 Desulfotalea psychrophila LSv54 chromosome.
          Length = 398

 Score =  156 bits (394), Expect = 6e-37
 Identities = 82/195 (42%), Positives = 126/195 (64%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+N IPF D AYQGF  G+ + D  ++ + A  G++  VA S+SKN G+Y ER GAI VV
Sbjct: 203 ERNWIPFLDFAYQGFGVGTSE-DRCAIELCAEAGIDFFVASSFSKNFGMYNERTGAITVV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            ++  +AA   S LK+  R +YSNPP HG  + A ++ +PEL++ W+QE++ M  RI ++
Sbjct: 262 AANQASAAVALSHLKKTIRVVYSNPPAHGGLVAATILSDPELYDLWQQELQDMRERIIAM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L + LS +    +D++FI +Q GMFSF+GL+      +  +  IY+   GRI+LAGL
Sbjct: 322 RVALVEGLSSRGVD-QDFSFITEQSGMFSFSGLSDEIVAWLRKEKSIYVVGGGRINLAGL 380

Query: 341 SAAKCEYLADAIIDS 297
           +A+  +Y+ DAI ++
Sbjct: 381 TASNIDYVCDAIAEA 395



>gb:BA000031_707360 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 414

 Score =  155 bits (393), Expect = 8e-37
 Identities = 81/192 (42%), Positives = 124/192 (64%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGFA G ++ DA+ +R+FA    E+LVA S+SKN GLY ER+GA  +V
Sbjct: 221 EKKLLPLFDFAYQGFAKG-VEEDAAGLRIFAKYNKEILVASSFSKNFGLYNERVGAFTLV 279

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             S + A    SQ+K + R +YSNPP HG+ +V +++ N EL  EW+ E++ M  RI+ +
Sbjct: 280 AESEEVATTAFSQVKAIIRSIYSNPPAHGSAVVTHILNNKELRAEWEAEVQEMRDRIQEM 339

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ L+ +   ++    D++FI +Q GMFSF+GL+K Q   + +++ IY+   GRIS+AG+
Sbjct: 340 RE-LFVATLKEEGVDADFSFIERQNGMFSFSGLSKEQVNRLKDEFAIYIVGSGRISVAGM 398

Query: 341 SAAKCEYLADAI 306
           + +    L   I
Sbjct: 399 TKSNMGPLCKGI 410



>gb:AE016875_354677 Pseudomonas syringae pv. tomato str. DC3000
           section 20 of 21 of the complete
           genome.>gb:AE016853_1039852 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 399

 Score =  155 bits (393), Expect = 8e-37
 Identities = 81/192 (42%), Positives = 120/192 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++  I F D+AYQGF  G +D DA ++R  A  G+  LV+ S+SK   LY ER+G ++VV
Sbjct: 204 DRQLIAFLDIAYQGFGKG-IDEDAYAIRAMADAGITTLVSNSFSKIFSLYGERVGGLSVV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C    +AA V  QLK   R  YS+PP HGA +V+ V+  P+L ++W  E+E M  RI  +
Sbjct: 263 CEDTASAANVFGQLKATVRRNYSSPPAHGAFLVSRVLNTPQLRDQWLSEVETMRLRIIDM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L   L+ K  +G+D++FIL+Q GMFS+TGL   Q + + +   IYM + GR+ +AGL
Sbjct: 323 RSRLVSVLAQK-VAGRDFSFILRQSGMFSYTGLTPQQVDELKDVHGIYMLRSGRVCMAGL 381

Query: 341 SAAKCEYLADAI 306
           +    + + DAI
Sbjct: 382 NERNIDKVCDAI 393



>gb:AE012104_279372 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 12 of 460 of the complete
           genome.>gb:AE008922_912654 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 400

 Score =  155 bits (391), Expect = 1e-36
 Identities = 83/193 (43%), Positives = 128/193 (66%), Gaps = 1/193 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLEL-LVAQSYSKNLGLYAERIGAINV 705
           E+N  PF D+AYQGF  G ++ADA +VR+ A+ G++  +VA SYSK+  LY ER+GA++V
Sbjct: 205 ERNLFPFVDIAYQGFDKG-IEADAYAVRLLAAEGIDTYVVASSYSKSFSLYGERVGALSV 263

Query: 704 VCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKS 525
           V ++A  A  V+SQ+KR+ R +YS+P  HGA +VA V+ +PEL + W+QE+  M  RI +
Sbjct: 264 VSATAAEAKAVQSQVKRIIRTIYSSPSTHGAALVAGVLTSPELRDVWEQELTEMRERIHA 323

Query: 524 VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           +R  L   L+       ++ FI +Q GMFS++GL K+Q + + +++ IY    GRI +A 
Sbjct: 324 LRAGLVAKLAA--LGAPEFEFIQRQAGMFSYSGLTKSQVDRLRDEFAIYAVGTGRICVAA 381

Query: 344 LSAAKCEYLADAI 306
           LS    +Y+A A+
Sbjct: 382 LSQRNLDYVAQAV 394



>gb:AE012553_283481 Xylella fastidiosa Temecula1, section 1 of 9 of
           the complete genome.>gb:AE009442_960057 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 400

 Score =  154 bits (390), Expect = 2e-36
 Identities = 81/194 (41%), Positives = 124/194 (63%), Gaps = 1/194 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLE-LLVAQSYSKNLGLYAERIGAINV 705
           E+  +P  D+AYQGF  G +DADA ++R+ A  G+   +VA SYSK+  LY ER+G +++
Sbjct: 205 ERQLLPCIDLAYQGFNQG-IDADAYAIRLLAEEGISNYVVANSYSKSFSLYGERVGGLSI 263

Query: 704 VCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKS 525
           V S+ + A  ++SQ+KR+ R +YS+PP HGA +VA V+ + EL   W+QE+  M  RI  
Sbjct: 264 VASNTEQAQAIQSQVKRIIRTIYSSPPAHGAYLVAGVLNSHELRTLWEQELTQMRERIHG 323

Query: 524 VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           +R  L     LK     ++ FI +Q GMFS++GL+K Q + + +++ IY    GRI +A 
Sbjct: 324 LRAGLV--ARLKALGAPEFDFIQRQAGMFSYSGLSKIQVDRLRDEFGIYAVSSGRICVAA 381

Query: 344 LSAAKCEYLADAII 303
           LS  K EY+A A++
Sbjct: 382 LSQHKLEYVAQAVV 395



>sp|P44425|AAT_HAEIN Aspartate aminotransferase (EC 2.6.1.1)
           (Transaminase A) (ASPAT).>pir|I64132|I64132 aspartate
           transaminase (EC 2.6.1.1) - Haemophilus influenzae
           (strain Rd KW20)>gb:U32835_205276 Haemophilus influenzae
           Rd KW20 section 150 of 163 of the complete
           genome.>gb:L42023_1097825 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 396

 Score =  154 bits (390), Expect = 2e-36
 Identities = 81/189 (42%), Positives = 122/189 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +P FD AYQG A+G LD DA  +R FA+   ELLVA S+SKN GLY ER+GA  +V  +A
Sbjct: 207 LPLFDFAYQGLANG-LDEDAYGLRAFAANHKELLVASSFSKNFGLYNERVGAFTLVAENA 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + A+   +Q+K + R +YSNP  HG   VA V+ + +L  EW+ E+  M  RIK +R  L
Sbjct: 266 EIASTSLTQVKSIIRTLYSNPASHGGATVATVLNDAQLRQEWENELTEMRERIKKMRH-L 324

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +  L  +  + +D++FI++Q GMFSF+GL   Q + + N++ IY  + GRI++AG++   
Sbjct: 325 FVQLLKEYGAEQDFSFIIEQNGMFSFSGLTGEQVDRLKNEFAIYAVRSGRINVAGITEDN 384

Query: 329 CEYLADAII 303
             YL ++I+
Sbjct: 385 IRYLCESIV 393



>gb:AF326991_1262835 Giardia intestinalis aspartate aminotransferase
           gene, complete cds.
          Length = 427

 Score =  154 bits (389), Expect = 2e-36
 Identities = 88/208 (42%), Positives = 124/208 (59%), Gaps = 13/208 (6%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK HI FFD AYQGFA+GS +ADA +VRMF   G+E+LVAQS+SKN GLY ERIG ++VV
Sbjct: 212 EKKHIAFFDSAYQGFATGSFEADAFAVRMFVDAGVEVLVAQSFSKNFGLYGERIGCLHVV 271

Query: 701 CSSADA--------AARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEM 546
            +  +         +A + S +    R  +S   IHGA IV  +V +  L   +   ++ 
Sbjct: 272 HAGVEGSVEKNKALSAAMVSGMTLQIRKTWSMSAIHGAYIVQVIVHDKRLLQMFYDNVKE 331

Query: 545 MAGRIKSVRQKLYDSLSLKDKSGK----DWTFILKQIGMFSFTGLNKAQSENMSNKWHIY 378
           M+ RI  +R  L+ SL+ +   G      W  IL  IGMF+FTGL     + +  KW IY
Sbjct: 332 MSARIHRMRSLLHASLAKRKTPGPGSKGTWDHILTAIGMFTFTGLTPEHVDYLKEKWSIY 391

Query: 377 MTK-DGRISLAGLSAAKCEYLADAIIDS 297
           + K  GR+S+ GL+ + C+Y+A+AI D+
Sbjct: 392 LVKAGGRMSMCGLTESNCDYVAEAIHDA 419



>gb:BX571966_794057 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_868030
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 400

 Score =  154 bits (389), Expect = 2e-36
 Identities = 84/188 (44%), Positives = 118/188 (62%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PF D+AYQGF +G L ADA ++R  A RG+   VA S+SKN  LY ER+GA++V+C  A
Sbjct: 207 LPFVDMAYQGFGAG-LAADAFAIRELARRGMPAFVANSFSKNFSLYGERVGALSVICEDA 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
            AAARV  QL    R  YSNPP  GA+IVA V+  P L  +W++E+  M  RI  +R  +
Sbjct: 266 AAAARVLGQLAGAVRSNYSNPPTCGAKIVAQVLTTPALRAQWEEELAAMCRRIAKMRSAI 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
           +D L       +  T  +KQ GMF++TGL +AQ E +  +  +Y+ + GR+ +AGL+ A 
Sbjct: 326 HDGLR-AHVPAEALTRYVKQRGMFTYTGLTEAQVECLREQHGVYVLRSGRMCVAGLNEAN 384

Query: 329 CEYLADAI 306
              +ADAI
Sbjct: 385 VGIVADAI 392



>gb:AE013879_301054 Yersinia pestis KIM section 279 of 415 of the
           complete genome.>gb:AE017131_387003 Yersinia pestis
           biovar Medievalis str. 91001 section 5 of 16 of the
           complete genome.>gb:AE009952_931237 Yersinia pestis KIM
           complete genome.>gb:AE017042_1143569 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 401

 Score =  153 bits (387), Expect = 4e-36
 Identities = 81/192 (42%), Positives = 122/192 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  +P FD AYQGFA+G L+ DA  +R+FA+   EL+V  SYSKN GLY ER+GA  +V 
Sbjct: 209 KGWLPLFDFAYQGFANG-LEEDAQGLRIFAATHQELIVCSSYSKNFGLYNERVGACTLVA 267

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           + ++ A    SQ+K + R  YSNPP HGA +VA ++ N  L   W+QE+  M  RI+ +R
Sbjct: 268 ADSNVADTAFSQVKAVIRANYSNPPAHGASVVATILSNAALRAIWEQELTDMRQRIQRMR 327

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q   ++L  K  + +D++FI+ Q GMFSF+GL K Q   + +++ +Y    GR+++AG++
Sbjct: 328 QLFVNTLQEKG-AQQDFSFIINQNGMFSFSGLTKEQVLRLRDEFAVYAVNSGRVNVAGMT 386

Query: 338 AAKCEYLADAII 303
                 L +AI+
Sbjct: 387 PDNMAPLCEAIV 398



>pir|AD0172|AD0172 aspartate transaminase (EC 2.6.1.1) [imported] -
           Yersinia pestis (strain CO92)>gb:AJ414148_523232
           Yersinia pestis strain CO92 complete genome; segment
           8/20.>gb:BX936398_836079 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.
          Length = 396

 Score =  153 bits (387), Expect = 4e-36
 Identities = 81/192 (42%), Positives = 122/192 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  +P FD AYQGFA+G L+ DA  +R+FA+   EL+V  SYSKN GLY ER+GA  +V 
Sbjct: 204 KGWLPLFDFAYQGFANG-LEEDAQGLRIFAATHQELIVCSSYSKNFGLYNERVGACTLVA 262

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           + ++ A    SQ+K + R  YSNPP HGA +VA ++ N  L   W+QE+  M  RI+ +R
Sbjct: 263 ADSNVADTAFSQVKAVIRANYSNPPAHGASVVATILSNAALRAIWEQELTDMRQRIQRMR 322

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           Q   ++L  K  + +D++FI+ Q GMFSF+GL K Q   + +++ +Y    GR+++AG++
Sbjct: 323 QLFVNTLQEKG-AQQDFSFIINQNGMFSFSGLTKEQVLRLRDEFAVYAVNSGRVNVAGMT 381

Query: 338 AAKCEYLADAII 303
                 L +AI+
Sbjct: 382 PDNMAPLCEAIV 393



>pir|S71928|S71928 aromatic-amino-acid transaminase (EC 2.6.1.57) -
           Salmonella typhimurium>gb:STTYRB_193692 S.typhimurium
           tyrB gene.
          Length = 397

 Score =  152 bits (385), Expect = 6e-36
 Identities = 80/187 (42%), Positives = 122/187 (65%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G +D DA  +R  AS GL  LV+ S+SK   LY ER+G ++VVC  A
Sbjct: 208 IPFLDIAYQGFGAG-MDDDAYVIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVVCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + AARV  QLK   R +YS+PP  GA++VA V+G+  L   W  E++ M  RI S+RQ L
Sbjct: 267 EIAARVLGQLKATVRRIYSSPPCFGAQVVATVLGDEALKAGWLAEVDAMRNRIISMRQTL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              L+  +   +++ ++L+Q GMFS+TGL++ Q + + +++ +Y+   GR+ +AGL+A+ 
Sbjct: 327 VKELT-AEMPDRNFDYLLQQRGMFSYTGLSEEQVDRLRDEFGVYLIASGRMCVAGLNASN 385

Query: 329 CEYLADA 309
              +A A
Sbjct: 386 VHRVAKA 392



>gb:CP000026_78695 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 397

 Score =  152 bits (384), Expect = 8e-36
 Identities = 80/187 (42%), Positives = 121/187 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G +D DA ++R  AS GL  LV+ S+SK   LY ER+G ++VVC  A
Sbjct: 208 IPFLDIAYQGFGAG-MDEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVVCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + AARV  QLK   R +YS+PP  GA++VA V+G+  L   W  E++ M  RI S+RQ L
Sbjct: 267 EIAARVLGQLKATVRRIYSSPPCFGAQVVATVLGDEALKASWLAEVDAMRTRIISMRQTL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              L   +   +++ ++L+Q GMFS+TGL++   E + +++ +Y+   GR+ +AGL+A+ 
Sbjct: 327 VKELK-AEMPDRNFDYLLQQRGMFSYTGLSEELVERLRDEFGVYLIASGRMCVAGLNASN 385

Query: 329 CEYLADA 309
              +A A
Sbjct: 386 VHRVAKA 392



>pir|A82217|A82217 transaminase (EC 2.6.1.-) [similarity] - Vibrio
           cholerae  (strain N16961 serogroup O1)>gb:AE004209_51682
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, section 117 of 251 of the complete
           chromosome.>gb:AE003852_1052456 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 413

 Score =  152 bits (384), Expect = 8e-36
 Identities = 83/192 (43%), Positives = 120/192 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K  +P FD AYQGFASG ++ DA+ +R+FA    E+LVA S+SKN GLY ER+GA  +V
Sbjct: 220 DKGLLPLFDFAYQGFASG-VEEDAAGLRIFAKYNSEILVASSFSKNFGLYNERVGAFTLV 278

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             S   A    SQ+K + R +YSNPP HGA +V  ++ NPEL  EW+ E+  M  RI+ +
Sbjct: 279 APSTTVAETAFSQVKAIIRSIYSNPPAHGAAVVTYILNNPELRAEWEAEVAEMRERIQEM 338

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R    ++L  +     D++FI +Q GMFSF+GL+K Q   + ++  IY+   GRIS+AG+
Sbjct: 339 RVLFVNTLK-EVGVDADFSFIERQNGMFSFSGLSKEQVARLKSELGIYIVGSGRISVAGM 397

Query: 341 SAAKCEYLADAI 306
           + +    L   I
Sbjct: 398 TKSNMLPLCQGI 409



>sp|P74861|TYRB_SALTY Aromatic-amino-acid aminotransferase (EC
           2.6.1.57) (AROAT) (ARAT).>gb:AE008898_245845 Salmonella
           typhimurium LT2, section 202 of 220 of the complete
           genome.>gb:AE006468_1002927 Salmonella typhimurium LT2,
           complete genome.
          Length = 397

 Score =  152 bits (384), Expect = 8e-36
 Identities = 80/187 (42%), Positives = 121/187 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G +D DA  +R  AS GL  LV+ S+SK   LY ER+G ++VVC  A
Sbjct: 208 IPFLDIAYQGFGAG-MDDDAYVIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVVCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + AARV  QLK   R +YS+PP  GA++VA V+G+  L   W  E++ M  RI S+RQ L
Sbjct: 267 EIAARVLGQLKATVRRIYSSPPCFGAQVVATVLGDEALKAGWLAEVDAMRNRIISMRQTL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              L   +   +++ ++L+Q GMFS+TGL++ Q + + +++ +Y+   GR+ +AGL+A+ 
Sbjct: 327 VKELK-AEMPDRNFDYLLQQRGMFSYTGLSEEQVDRLRDEFGVYLIASGRMCVAGLNASN 385

Query: 329 CEYLADA 309
              +A A
Sbjct: 386 VHRVAKA 392



>gb:AE016911_355292 Chromobacterium violaceum ATCC 12472 section 2
           of 16 of the complete genome.>gb:AE016825_1040446
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 397

 Score =  151 bits (382), Expect = 1e-35
 Identities = 79/187 (42%), Positives = 118/187 (63%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G L+ DA ++R  A  G+  LV+ S+SK   LY ER G ++VVC +A
Sbjct: 208 IPFLDIAYQGFGAG-LEEDAYAIRAMADAGIAFLVSNSFSKIFSLYGERCGGLSVVCETA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
             AA V  QLK   R  YS+PP HGAR++A V+ +PEL   W  E+  M  RI+++R  L
Sbjct: 267 AEAALVSGQLKATVRRNYSSPPTHGARVIATVLNDPELKALWVSEVNEMRERIQAMRGVL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              L  +    +D+ +++ Q GMFS+TG ++AQ + +  ++ +Y+   GR+ +AGL+AA 
Sbjct: 327 VQVLK-EALPERDFGYLVNQRGMFSYTGFSQAQVDKLREQFAVYLVGSGRMCVAGLNAAN 385

Query: 329 CEYLADA 309
             Y+A A
Sbjct: 386 APYVAQA 392



>gb:CR926063_1185570 Pongo pygmaeus mRNA; cDNA DKFZp459D0410 (from
           clone DKFZp459D0410).
          Length = 368

 Score =  150 bits (379), Expect = 3e-35
 Identities = 77/150 (51%), Positives = 98/150 (65%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PFFD AYQGFASG+L+ DA ++R F S G E   AQS+SKN GLY ER+G + VV    +
Sbjct: 220 PFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPE 279

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
              RV SQ++++ R  +SNPP  GARIVA+ + NPELF EW   ++ MA RI ++R +L 
Sbjct: 280 GILRVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELR 339

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNK 417
             L      G  W  I  QIGMFSFTGLN+
Sbjct: 340 ARLEALKTPG-TWNHITDQIGMFSFTGLNR 368



>gb:AE016804_336880 Vibrio vulnificus CMCP6 chromosome I section 8
           of 11 of the complete sequence.>gb:AE016795_1046604
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 399

 Score =  150 bits (379), Expect = 3e-35
 Identities = 80/192 (41%), Positives = 119/192 (61%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K  +P FD AYQGFA G ++ DA  +R FA    E+LVA S+SKN GLY ER+GA  +V
Sbjct: 206 DKGLLPLFDFAYQGFAKG-VEEDAQGLRTFAKFNKEILVASSFSKNFGLYNERVGAFTLV 264

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             S + A    SQ+K + R +YSNPP HG+ +V +++ +  L  EW+ E+  M  RI+ +
Sbjct: 265 AESQEIAETAFSQVKAIIRSIYSNPPAHGSAVVTHILNDAALRAEWEAEVAEMRDRIQEM 324

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+    +L  ++    D++FI +Q GMFSF+GLNK Q   +  ++ IY+   GRIS+AG+
Sbjct: 325 RELFVTTLK-EEGVAADFSFIQRQNGMFSFSGLNKDQVARLKEEFAIYIVGSGRISVAGM 383

Query: 341 SAAKCEYLADAI 306
           + +    L  AI
Sbjct: 384 TKSNMGPLCKAI 395



>gb:AE016848_348074 Salmonella enterica subsp. enterica serovar
           Typhi Ty2, section 15 of 16 of the complete
           genome.>gb:AE014613_985406 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, complete genome.
          Length = 397

 Score =  150 bits (378), Expect = 4e-35
 Identities = 79/187 (42%), Positives = 120/187 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G +D DA ++R  AS GL  LV+ S+SK   LY E +G ++VVC  A
Sbjct: 208 IPFLDIAYQGFGAG-MDEDAYAIRAIASAGLPALVSNSFSKIFSLYGECVGGLSVVCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + AARV  QLK   R +YS+PP  GA++VA V+G+  L   W  E++ M  RI S+RQ L
Sbjct: 267 EIAARVLGQLKATVRRIYSSPPCFGAQVVATVLGDEALKASWLAEVDAMRTRIISMRQTL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              L   +   +++ ++L+Q GMFS+TGL+  Q + + +++ +Y+   GR+ +AGL+A+ 
Sbjct: 327 VKELK-AEMPDRNFDYLLQQRGMFSYTGLSAEQVDRLRDEFGVYLIASGRMCVAGLNASN 385

Query: 329 CEYLADA 309
              +A A
Sbjct: 386 VHRVAKA 392



>pir|C82855|C82855 aromatic-amino-acid transaminase (EC 2.6.1.57)
           tyrB XF0036 [similarity] - Xylella fastidiosa (strain
           9a5c)>gb:AE003858_47678 Xylella fastidiosa 9a5c, section
           4 of 229 of the complete genome.>gb:AE003849_1114888
           Xylella fastidiosa 9a5c, complete genome.
          Length = 400

 Score =  150 bits (378), Expect = 4e-35
 Identities = 79/194 (40%), Positives = 123/194 (63%), Gaps = 1/194 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLE-LLVAQSYSKNLGLYAERIGAINV 705
           E+  +P  D+AYQGF  G +DADA ++R+ A  G+   +VA SYSK+  LY ER+G +++
Sbjct: 205 ERQLLPCIDLAYQGFNQG-IDADAYAIRLLAEEGISNYVVANSYSKSFSLYGERVGGLSI 263

Query: 704 VCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKS 525
           V S+ + A  ++SQ+KR+ R +YS+P  HGA +VA V+ + EL   W+QE+  M  RI  
Sbjct: 264 VASNTEQAQAIQSQVKRIIRTIYSSPSAHGAYLVAGVLNSHELRTLWEQELTQMRERIHG 323

Query: 524 VRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           +R  L   L+       ++ FI +Q GMFS++GL+K Q + + +++ IY    GRI +A 
Sbjct: 324 LRAGLVARLTA--LGAPEFDFIQRQAGMFSYSGLSKIQVDRLRDEFGIYAVSSGRICVAA 381

Query: 344 LSAAKCEYLADAII 303
           LS  K EY+A A++
Sbjct: 382 LSQHKLEYVAQAVV 395



>pir|AG1016|AG1016 aromatic-amino-acid transaminase (EC 2.6.1.57) -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AL627282_544447 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 18/20.
          Length = 397

 Score =  150 bits (378), Expect = 4e-35
 Identities = 79/187 (42%), Positives = 120/187 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G +D DA ++R  AS GL  LV+ S+SK   LY E +G ++VVC  A
Sbjct: 208 IPFLDIAYQGFGAG-MDEDAYAIRAIASAGLPALVSNSFSKIFSLYGECVGGLSVVCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + AARV  QLK   R +YS+PP  GA++VA V+G+  L   W  E++ M  RI S+RQ L
Sbjct: 267 EIAARVLGQLKATVRRIYSSPPCFGAQVVATVLGDEALKASWLAEVDAMRTRIISMRQTL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              L   +   +++ ++L+Q GMFS+TGL+  Q + + +++ +Y+   GR+ +AGL+A+ 
Sbjct: 327 VKELK-AEMPDRNFDYLLQQRGMFSYTGLSAEQVDRLRDEFGVYLIASGRMCVAGLNASN 385

Query: 329 CEYLADA 309
              +A A
Sbjct: 386 VHRVAKA 392



>gb:AE016819_1749046 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 419

 Score =  149 bits (377), Expect = 5e-35
 Identities = 88/200 (44%), Positives = 120/200 (60%), Gaps = 9/200 (4%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLEL---LVAQSYSKNLGLYAERIGAIN 708
           + H   FD AYQGFASGSL  DA ++R    R  E+   LV QS++KN+G+Y ER+GA++
Sbjct: 209 REHTVLFDSAYQGFASGSLARDAYALRAGLRRLAEVTPVLVCQSFAKNIGMYGERVGALH 268

Query: 707 VVC------SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEM 546
           VV       S A   A V SQL  + R   SNPP +GA+IV  V+  PEL  +WK++M  
Sbjct: 269 VVLPRQPAESLAHVKAAVLSQLSHITRSELSNPPAYGAKIVTKVLTTPELAAQWKKDMIT 328

Query: 545 MAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKD 366
           M+ RI  +R+ L D L      G +W  I++Q GMFS+TGL K     M   + IYM   
Sbjct: 329 MSSRIARMRRVLRDRLVELGTPG-NWDHIVQQCGMFSYTGLTKEMVARMEKDFAIYMVSS 387

Query: 365 GRISLAGLSAAKCEYLADAI 306
           GRIS+AGL+ +   ++A+AI
Sbjct: 388 GRISIAGLNDSNVGHVANAI 407



>gb:BA000037_722922 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 399

 Score =  149 bits (377), Expect = 5e-35
 Identities = 80/192 (41%), Positives = 120/192 (62%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K  +P FD AYQGFA G ++ DA  +R FA    E+LVA S+SKN GLY ER+GA  +V
Sbjct: 206 DKGLLPLFDFAYQGFAKG-VEEDAQGLRTFAKFNKEILVASSFSKNFGLYNERVGAFTLV 264

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             S + A    SQ+K + R +YSNPP HG+ +V +++ +  L  EW+ E+  M  RI+ +
Sbjct: 265 AESQEIAETAFSQVKAIIRSIYSNPPAHGSAVVTHILNDAALRAEWEAEVAEMRDRIQEM 324

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ L+ +   ++    D++FI +Q GMFSF+GLNK Q   +  ++ IY+   GRIS+AG+
Sbjct: 325 RE-LFVATLKEEGVAADFSFIERQNGMFSFSGLNKDQVARLKEEFAIYIVGSGRISVAGM 383

Query: 341 SAAKCEYLADAI 306
           + +    L  AI
Sbjct: 384 TKSNMGPLCKAI 395



>gb:CR382134_1667077 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 406

 Score =  149 bits (375), Expect = 9e-35
 Identities = 76/187 (40%), Positives = 113/187 (60%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           P FD+AYQGF+SG  D DA  VR F  + LE LV QS+SKN+GLY+ER G ++ V    D
Sbjct: 212 PVFDIAYQGFSSGDKDVDAWPVRYFYEQNLEFLVCQSFSKNMGLYSERAGCLHAVVQDTD 271

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
               V+SQL  L R   S  P +GARI + ++  P L N+W QE+  +  R+K++R+++ 
Sbjct: 272 YVPNVQSQLVALFRSECSFAPAYGARIASIIINEPGLENQWGQEVSDVTTRLKNIRKQIL 331

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
           D        GK W  ++KQ G+F ++GL+  Q++ +    HIY T  GR+++AGL+ +  
Sbjct: 332 DKFLELGTPGK-WDHVVKQQGLFWYSGLSPEQNDKLIEDHHIYSTSIGRVNIAGLNESSV 390

Query: 326 EYLADAI 306
           +    AI
Sbjct: 391 DKFVGAI 397



>gb:CP000020_871664 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 399

 Score =  149 bits (375), Expect = 9e-35
 Identities = 80/180 (44%), Positives = 115/180 (63%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  +P FD AYQGFA G ++ DA+ +R FA    ELLVA S+SKN GLY ER+GA  +V 
Sbjct: 207 KGLLPLFDFAYQGFAKG-VEEDAAGLRTFAQYCPELLVASSFSKNFGLYNERVGAFTLVA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
             A  AA   SQ+K + R +YSNPP HGA +V +++ +  L  EW+QE+  M  RI+ +R
Sbjct: 266 KDATVAADAFSQVKAIIRSIYSNPPAHGAAVVTHILNDDALRAEWEQEVAEMRDRIQEMR 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
                +L  +     D++FI +Q GMFSF+GL+K Q   + +++ IY+   GRIS+AG++
Sbjct: 326 TLFVTTLK-EQGVDADFSFIERQNGMFSFSGLSKEQVNRLKDEFAIYIVGSGRISVAGMT 384



>gb:BX248585_764028 Blochmannia floridanus complete genome; segment
           2/3.
          Length = 406

 Score =  149 bits (375), Expect = 9e-35
 Identities = 83/200 (41%), Positives = 122/200 (61%), Gaps = 4/200 (2%)
 Frame = -1

Query: 881 EKNH-IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINV 705
           EKN  IP FD+AYQGF +G L  D   + MF     EL+V  SYSKN GLY ER+GA  +
Sbjct: 207 EKNRWIPLFDLAYQGFDNG-LQEDLIGLHMFCKNNPELIVCNSYSKNFGLYNERVGACTI 265

Query: 704 VCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKS 525
           +  + + A  V SQL+   R +YSNPP HGA IV+ ++ N  L   W++E++ M   IK+
Sbjct: 266 ITENNNHADCVLSQLRATIRAIYSNPPAHGAAIVSTILQNKTLRFIWEKELKNMRDHIKN 325

Query: 524 VRQKLYDSLSLKDKS---GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRIS 354
           +R+ L+++L+    S    +D++FI  Q GMF++ GLN  Q   +  +  IY+   GR++
Sbjct: 326 MRKLLFNTLNKYKNSKVINQDFSFINNQKGMFAYIGLNSNQVIKLREELGIYLVDSGRLN 385

Query: 353 LAGLSAAKCEYLADAIIDSY 294
           LAGLS    +Y+ +AI + Y
Sbjct: 386 LAGLSHKNIDYICNAICNLY 405



>gb:AF074934_476754 Klebsiella pneumoniae tyrosine aminotransferase
           (tyrB) gene, complete cds.
          Length = 397

 Score =  149 bits (375), Expect = 9e-35
 Identities = 76/189 (40%), Positives = 119/189 (62%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G L+ DA ++R  AS G+ +LV+ S+SK   LY ER+G ++VVC  +
Sbjct: 208 IPFLDIAYQGFGGG-LEEDAYAIRAIASAGMPMLVSNSFSKIFSLYGERVGGLSVVCEDS 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + A RV  QLK   R  YS+PP  GA++VA V+ +  L   W+ E++ M   I ++RQ L
Sbjct: 267 ETAGRVLGQLKATVRRNYSSPPSFGAQVVATVLNDAALKATWQAEVDAMRAHILTMRQAL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            D+L  +   G    ++LKQ GMFS+TG + AQ + + +++ +Y+   GR+ +AGL++  
Sbjct: 327 VDALQ-QVAPGSKVDYLLKQRGMFSYTGFSAAQVDRLRDEFGVYLIASGRMRVAGLNSRN 385

Query: 329 CEYLADAII 303
            + +A A +
Sbjct: 386 VQQVAKAFV 394



>gb:AE005674_73735 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016989_373072 Shigella flexneri 2a str.
           2457T section 12 of 16 of the complete
           genome.>gb:AE014073_997822 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 397

 Score =  149 bits (375), Expect = 9e-35
 Identities = 79/187 (42%), Positives = 121/187 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF++G ++ DA ++R  AS GL  LV+ S+SK   LY ER+G ++V+C  A
Sbjct: 208 IPFLDIAYQGFSAG-MEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVLCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +AA RV  QLK   R  YS+PP  GA++VA V+ +  L   W  E+E M  RI ++RQ+L
Sbjct: 267 EAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLAEVEEMRTRILAMRQEL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              LS  +   +++ ++L Q GMFS+TGL+ AQ + +  ++ +Y+   GR+ +AGL+ A 
Sbjct: 327 VKVLS-TEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASGRMCVAGLNTAN 385

Query: 329 CEYLADA 309
            + +A A
Sbjct: 386 VQRVAKA 392



>gb:BX294155_772095 Pirellula sp. strain 1 complete genome; segment
           23/24.
          Length = 397

 Score =  148 bits (374), Expect = 1e-34
 Identities = 80/192 (41%), Positives = 117/192 (60%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  IP  D AYQGF  G LD DA  VR    +  E +V  S+SKN GLY+ER+G   +V
Sbjct: 203 EKKLIPLLDFAYQGFGEG-LDEDAIGVRTILRQMDEAIVCSSFSKNFGLYSERVGTACLV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             SA+      SQLKR+ R  YSNPP HG  IVA V+ +  L   W +E+  M  RI S+
Sbjct: 262 SGSAETTKAALSQLKRVVRANYSNPPRHGGAIVATVLADEGLTQMWHEELAEMRTRIASL 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R++  D ++      +D++F+L Q GMFSF+GL+  Q + + ++  +Y+   GRI++AG+
Sbjct: 322 RKQFVDGMAATGVD-QDFSFLLDQKGMFSFSGLSPMQVDQLRSEHGVYLVGSGRINVAGM 380

Query: 341 SAAKCEYLADAI 306
           + +K E+L +A+
Sbjct: 381 NESKMEWLCNAV 392



>pir|H86098|H86098 tyrosine aminotransferase, tyrosine repressible
           [imported] - Escherichia coli (strain O157:H7, substrain
           EDL933)>pir|D91258|D91258 tyrosine aminotransferase
           [imported] - Escherichia coli  (strain O157:H7,
           substrain RIMD 0509952)>gb:AE005174_69251 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:BA000007_663048
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 397

 Score =  148 bits (374), Expect = 1e-34
 Identities = 79/187 (42%), Positives = 120/187 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G ++ DA ++R  AS GL  LV+ S+SK   LY ER+G ++V+C  A
Sbjct: 208 IPFLDIAYQGFGAG-MEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVLCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +AA RV  QLK   R  YS+PP  GA++VA V+ +  L   W  E+E M  RI ++RQ+L
Sbjct: 267 EAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLAEVEEMRTRILAMRQEL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              LS  +   +++ ++L Q GMFS+TGL+ AQ + +  ++ +Y+   GR+ +AGL+ A 
Sbjct: 327 VKVLS-TEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASGRMCVAGLNTAN 385

Query: 329 CEYLADA 309
            + +A A
Sbjct: 386 VQRVAKA 392



>sp|P04693|TYRB_ECOLI Aromatic-amino-acid aminotransferase (EC
           2.6.1.57) (AROAT) (ARAT).>pir|A30379|XNECY
           aromatic-amino-acid transaminase (EC 2.6.1.57) tyrB
           [validated] - Escherichia coli (strain
           K-12)>gb:ECOTYRBA_130554 E.coli K12 tyrB gene encoding
           aminotransferase, complete cds.>gb:ECOUW89_131585 E.
           coli chromosomal region from 89.2 to 92.8
           minutes.>gb:ECTYRB_132950 E. coli tyr B gene for
           aromatic aminotransferase.>gb:U00096_203018 Escherichia
           coli K-12 MG1655 complete genome.>gb:A01447_1446547
           E.coli tyrB gene.>gb:A06770_1446976 Artificial sequence
           for tyr B gene.
          Length = 397

 Score =  148 bits (374), Expect = 1e-34
 Identities = 79/187 (42%), Positives = 120/187 (64%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G ++ DA ++R  AS GL  LV+ S+SK   LY ER+G ++V+C  A
Sbjct: 208 IPFLDIAYQGFGAG-MEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +AA RV  QLK   R  YS+PP  GA++VA V+ +  L   W  E+E M  RI ++RQ+L
Sbjct: 267 EAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLAEVEEMRTRILAMRQEL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              LS  +   +++ ++L Q GMFS+TGL+ AQ + +  ++ +Y+   GR+ +AGL+ A 
Sbjct: 327 VKVLS-TEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASGRMCVAGLNTAN 385

Query: 329 CEYLADA 309
            + +A A
Sbjct: 386 VQRVAKA 392



>gb:BX640440_813834 Bordetella bronchiseptica strain RB50, complete
           genome; segment 4/16.
          Length = 399

 Score =  148 bits (373), Expect = 2e-34
 Identities = 82/192 (42%), Positives = 115/192 (59%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  I F D+AYQGF  G LD DA +VR  A  G+  +VA S+SKN  LY ER G ++VV
Sbjct: 203 ERGLIAFVDMAYQGFGDG-LDDDAYAVRAIAEAGVTCVVANSFSKNFSLYGERCGGLSVV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C +A+ A  V  QL    R +YSNPP HGARIVA V+G P L   W+ E+  M  RI+++
Sbjct: 262 CETAEQAGCVLGQLTSTIRAIYSNPPTHGARIVAQVLGTPALRQSWEAELGAMRERIQAM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ ++D L+ + +      + L Q GMF++TGL   Q E +     +Y+ + GR+ +AGL
Sbjct: 322 RRAIHDGLAGRVEPRMLQRY-LSQRGMFTYTGLGAEQVETLRRDQGVYLLRSGRMCVAGL 380

Query: 341 SAAKCEYLADAI 306
           +       ADAI
Sbjct: 381 NRDNVAVAADAI 392



>gb:BX640419_807258 Bordetella pertussis strain Tohama I, complete
           genome; segment 9/12.
          Length = 399

 Score =  148 bits (373), Expect = 2e-34
 Identities = 82/192 (42%), Positives = 115/192 (59%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  I F D+AYQGF  G LD DA +VR  A  G+  +VA S+SKN  LY ER G ++VV
Sbjct: 203 ERGLIAFVDMAYQGFGDG-LDDDAYAVRALAEAGVTCVVANSFSKNFSLYGERCGGLSVV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C +A+ A  V  QL    R +YSNPP HGARIVA V+G P L   W+ E+  M  RI+++
Sbjct: 262 CETAEQAGCVLGQLTSTIRAIYSNPPTHGARIVAQVLGTPALRQSWEAELGAMRERIQAM 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ ++D L+ + +      + L Q GMF++TGL   Q E +     +Y+ + GR+ +AGL
Sbjct: 322 RRAIHDGLAGRVEPRMLQRY-LSQRGMFTYTGLGAEQVETLRRDQGVYLLRSGRMCVAGL 380

Query: 341 SAAKCEYLADAI 306
           +       ADAI
Sbjct: 381 NRDNVAVAADAI 392



>gb:AE016770_328995 Escherichia coli CFT073 section 16 of 18 of the
           complete genome.>gb:AE014075_959579 Escherichia coli
           CFT073 complete genome.
          Length = 411

 Score =  147 bits (371), Expect = 3e-34
 Identities = 79/187 (42%), Positives = 118/187 (63%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF +G ++ DA ++R  AS GL  LV+ S+SK   LY ER+G ++V+C  A
Sbjct: 222 IPFLDIAYQGFGAG-MEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVLCEDA 280

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +AA RV  QLK   R  YS+PP  GA++VA V+ +  L   W  E+E M  RI ++RQ+L
Sbjct: 281 EAAGRVLGQLKATVRRNYSSPPNFGAKVVAAVLNDEALKASWLAEVEEMRTRILAMRQEL 340

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              LS  +   +++ ++L Q GMFS+TGL  AQ + +  ++ +Y+   GR+ +AGL+A  
Sbjct: 341 VKVLS-TEMPERNFDYLLNQRGMFSYTGLRTAQVDRLREEFGVYLIASGRMCVAGLNAQN 399

Query: 329 CEYLADA 309
              +A A
Sbjct: 400 VHRVAKA 406



>gb:MSMASPC_150556 Moraxella sp. maspC gene.
          Length = 397

 Score =  147 bits (370), Expect = 3e-34
 Identities = 79/194 (40%), Positives = 117/194 (60%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E    P  D+AYQGF S SL+ DA  +R+ A    EL++  S SKN GLY ERIGA +++
Sbjct: 202 EVGFTPLVDIAYQGFGS-SLEEDARGLRILADAVEELIICSSCSKNFGLYRERIGACSLI 260

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
              +  A    S L  + R +YS PP HGA IV  ++ + EL   W QE++ M  RI  +
Sbjct: 261 AKDSATADISNSVLLSVVRSIYSMPPAHGADIVNTILSSTELTQMWHQELDEMRSRINGL 320

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R ++ ++L+ KD   +D++FI +Q GMFSF G+NK Q   +  ++ IY+    R+++AG+
Sbjct: 321 RTQIKETLATKD-IAQDFSFIERQHGMFSFLGINKEQITRLQKEYGIYIVGSSRVNVAGV 379

Query: 341 SAAKCEYLADAIID 300
           S A  EY A+A+ D
Sbjct: 380 SDANIEYFANAVAD 393



>gb:CR382137_1669690 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 420

 Score =  145 bits (366), Expect = 1e-33
 Identities = 77/197 (39%), Positives = 121/197 (61%), Gaps = 5/197 (2%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFA-SRGLE--LLVAQSYSKNLGLYAERIGAI 711
           +  H+  +D AYQGFASG+LD D  +VR+   S+ L+  +++ QS++KN G+Y ER+GAI
Sbjct: 212 KNEHLALYDSAYQGFASGNLDNDGFAVRLAVDSKKLKTPIVICQSFAKNCGMYGERVGAI 271

Query: 710 NVVCSSADAAAR--VKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAG 537
           +V+ +  D +    +KSQL +L R   SNPP +GA++VA ++ + EL  +W+ ++  M+ 
Sbjct: 272 HVIPAENDKSLNNAIKSQLNKLTRSEISNPPAYGAKVVATILTDSELRQQWEDDLVTMSS 331

Query: 536 RIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRI 357
           RI  +R +L D L+ +  +  +W  I+ Q GMFSFTGL       +     IY+   GR 
Sbjct: 332 RINKMRTRLRDLLTNQYSTPGNWDHIVSQSGMFSFTGLTPDMVSRLEKNHGIYLVSSGRA 391

Query: 356 SLAGLSAAKCEYLADAI 306
           S+AGL+    E +A AI
Sbjct: 392 SVAGLNDGNVEQVAKAI 408



>gb:CR382126_1659140 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 421

 Score =  145 bits (366), Expect = 1e-33
 Identities = 79/198 (39%), Positives = 118/198 (59%), Gaps = 10/198 (5%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLE---LLVAQSYSKNLGLYAERIGAINVVC 699
           IP FD AYQGFASGSL  DA +VR+   +  E   + + QS++KN+G+Y ER G I+++ 
Sbjct: 212 IPLFDSAYQGFASGSLTNDAFAVRLGVKKFAESAPIFICQSFAKNVGMYGERCGCIHLIV 271

Query: 698 SSADAAARVK-------SQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMA 540
              ++   V        SQ+ ++ R   SNPP +GA+IVA ++ N EL  +W ++M  M+
Sbjct: 272 PRQESNVNVSTITKAVASQISKITRSEVSNPPAYGAKIVAKILNNAELTEQWHKDMVTMS 331

Query: 539 GRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGR 360
            RI  +R  L D L L+ ++  +W  I+ Q GMFS+TGL K   E +  +  +YM   GR
Sbjct: 332 QRITKMRHSLRDKL-LELQTPGNWDHIVNQCGMFSYTGLTKPMVERLEKEHGVYMVASGR 390

Query: 359 ISLAGLSAAKCEYLADAI 306
            S+AGL+    E++A AI
Sbjct: 391 ASIAGLNEKNVEHVAKAI 408



>gb:BX950851_842405 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 397

 Score =  145 bits (366), Expect = 1e-33
 Identities = 76/191 (39%), Positives = 121/191 (63%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++  IPF D+AYQGF  G ++ DA ++R  AS G+  L+A S+SK   LY+ER+G ++VV
Sbjct: 204 QRELIPFMDIAYQGFGLG-IEQDAYAIRAVASAGVPALIANSFSKIFSLYSERVGGLSVV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C  AD+A RV  QLK   R  YS+PP  GA++V+ V+ + +L  +WK E+E M  RI S+
Sbjct: 263 CDDADSAQRVLGQLKATVRRNYSSPPNFGAQVVSKVLNDVQLNADWKAEVEEMRTRILSM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ+L  +L       ++  ++L Q GMFS+TG +  Q + +  ++ +Y+   GR+ +AGL
Sbjct: 323 RQELVSALK-NALPNRNVDYLLTQRGMFSYTGFSPEQVDRLREEFGVYLIASGRMCMAGL 381

Query: 341 SAAKCEYLADA 309
           + +  + +A A
Sbjct: 382 NHSNVQRVAAA 392



>gb:BX571966_795473 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 405

 Score =  145 bits (366), Expect = 1e-33
 Identities = 75/188 (39%), Positives = 118/188 (62%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           I F D+AYQGF  G LD DA  +R  A  GL + V+ S+SKN  LY ER G +++ C++ 
Sbjct: 207 IAFLDIAYQGFGDG-LDDDAWPIRAMADAGLPVFVSHSFSKNFSLYGERCGGLSIACANE 265

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
             AARV SQ++   R +YS+PP+HGAR+V+ V+ +P L  +W +++  M  RIK +R  L
Sbjct: 266 REAARVLSQIQAGVRRVYSSPPLHGARLVSTVLNDPALARQWDRDVAAMRARIKRMRTAL 325

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
              L+ +   G  + ++++Q GMFS+TGL   + + +     +Y+ + GR  +AGLS A 
Sbjct: 326 AARLAAR-VPGASFDYLVEQRGMFSYTGLAPHEVDALREHDGVYLLRSGRACIAGLSDAN 384

Query: 329 CEYLADAI 306
            +++A+AI
Sbjct: 385 VDHVANAI 392



>gb:CR382134_1667044 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 403

 Score =  144 bits (364), Expect = 2e-33
 Identities = 71/189 (37%), Positives = 120/189 (63%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK  +P FD AYQGF SG +  DA  +R++ ++GL+ LV QS+SKNLGLY+ER+GA++VV
Sbjct: 205 EKKIMPVFDSAYQGFGSGDIAVDAKPIRLYYAKGLQFLVCQSFSKNLGLYSERVGALHVV 264

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
                 A  V  QL+ + R   S+ P +GAR+   +  +P+L  +W+ ++  +  R+   
Sbjct: 265 VCEKKLAEIVSDQLRSIFRRECSSAPAYGARLAVIIANDPKLTEQWRNDLRTIYKRLVDK 324

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L+D L +K ++   +  +L Q G+F F+GL+K Q + +  ++HI++  +GR+++AGL
Sbjct: 325 RIELHD-LLIKYQTPGSFDHLLNQNGLFWFSGLSKVQCKLLVEEYHIFIPSNGRVNIAGL 383

Query: 341 SAAKCEYLA 315
           + +   Y A
Sbjct: 384 NNSNIHYFA 392



>gb:CR380956_1652179 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 419

 Score =  144 bits (363), Expect = 2e-33
 Identities = 77/198 (38%), Positives = 121/198 (61%), Gaps = 8/198 (4%)
 Frame = -1

Query: 875 NHIPFFDVAYQGFASGSLDADASSVRMFASRGLE---LLVAQSYSKNLGLYAERIGAINV 705
           +HIP FD AYQGFASG L+ DA ++R   ++  +   + VAQS++KN+G+Y ER+G +++
Sbjct: 213 DHIPLFDSAYQGFASGDLERDAYAIRYTINQLRDCAPIFVAQSFAKNVGMYGERVGCLHL 272

Query: 704 VCSS-----ADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMA 540
           V  +           + SQL R+ R   S PP +GA++V+ +   PEL  +W Q++  M+
Sbjct: 273 VLPAQKEDIVPIKDAITSQLSRIIRSEISTPPAYGAKVVSKIFTTPELKEQWYQDLVTMS 332

Query: 539 GRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGR 360
            RI SVR +L D L+  +  G +W  I++Q GMFSFTGL    ++ +  +  +YM   GR
Sbjct: 333 SRIISVRTRLRDLLAEYNTPG-NWDHIVQQCGMFSFTGLTPEMTKRLETEHAVYMVPTGR 391

Query: 359 ISLAGLSAAKCEYLADAI 306
            S+AGL+    +++A AI
Sbjct: 392 ASVAGLNTGNVQHVAKAI 409



>gb:AE016787_333004 Pseudomonas putida KT2440 section 14 of 21 of
           the complete genome.>gb:AE015451_948081 Pseudomonas
           putida KT2440 complete genome.
          Length = 398

 Score =  144 bits (363), Expect = 2e-33
 Identities = 76/187 (40%), Positives = 117/187 (62%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGFA G ++ DA ++R  A  G+  LV+ S+SK   LY ER+G ++VVC   
Sbjct: 208 IPFLDIAYQGFAEGLVE-DAYAIREMARAGVPCLVSNSFSKIFSLYGERVGGLSVVCDDE 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
             A  V  QLK   R  YS+PP  GA++VA V+ +  L  +W +E+E+M  RI  +RQ L
Sbjct: 267 ATAQSVLGQLKATVRRNYSSPPNFGAQLVAGVLSDAGLNAQWAEEVEVMRKRILDMRQAL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            D+L++    G+D+ F L+Q GMFS+TG +  Q   + +++ +Y+   GR+ ++GL  A 
Sbjct: 327 VDALAVL-LPGQDFQFFLRQRGMFSYTGFSVEQVRRLRDEFGVYLIDSGRVCMSGLRPAN 385

Query: 329 CEYLADA 309
            + +A+A
Sbjct: 386 LQRVAEA 392



>pir|AD0040|AD0040 aromatic-amino-acid transaminase (EC 2.6.1.57)
           [imported] - Yersinia pestis (strain
           CO92)>gb:AE013660_298909 Yersinia pestis KIM section 60
           of 415 of the complete genome.>gb:AE017128_386324
           Yersinia pestis biovar Medievalis str. 91001 section 2
           of 16 of the complete genome.>gb:AJ414142_522176
           Yersinia pestis strain CO92 complete genome; segment
           2/20.>gb:AE009952_929092 Yersinia pestis KIM complete
           genome.>gb:AE017042_1142890 Yersinia pestis biovar
           Medievalis str. 91001 complete genome.
          Length = 397

 Score =  144 bits (362), Expect = 3e-33
 Identities = 76/191 (39%), Positives = 122/191 (63%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  IPF D+AYQGF +G L+ DA ++R  A+ GL  L++ S+SK   LY ER+G ++VV
Sbjct: 204 ERELIPFLDIAYQGFGAG-LNEDAYAIRAMAAVGLPCLISNSFSKIFSLYNERVGGLSVV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C S +AA RV  QLK   R  YS+PP  GA++V+ V+ +  L  +W+ E+E M  RI  +
Sbjct: 263 CESDEAAGRVLGQLKATVRRNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L ++L       +++ ++L+Q GMFS+TG ++AQ E++  ++ +Y+   GR+ +AG+
Sbjct: 323 RHTLVEALK-ASLPERNFDYLLQQRGMFSYTGFSEAQVESLREEFGVYLIASGRMCMAGV 381

Query: 341 SAAKCEYLADA 309
           +    E +A A
Sbjct: 382 NHQNVEQVAVA 392



>pir|S64854|S64854 aspartate transaminase (EC 2.6.1.1), cytosolic
           YLR027c [validated] - yeast (Saccharomyces
           cerevisiae)>gb:SCYLR027C_1713429 S.cerevisiae chromosome
           XII reading frame ORF YLR027c.
          Length = 432

 Score =  143 bits (361), Expect = 4e-33
 Identities = 80/198 (40%), Positives = 114/198 (57%), Gaps = 7/198 (3%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFA---SRGLELLVAQSYSKNLGLYAERIGAIN 708
           KNHI  FD AYQGFA+G LD DA +VR+     S    + V QS++KN G+Y ER+G  +
Sbjct: 223 KNHIALFDTAYQGFATGDLDKDAYAVRLGVEKLSTVSPVFVCQSFAKNAGMYGERVGCFH 282

Query: 707 VVCSSADAAARVK----SQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMA 540
           +  +       +K    SQL ++ R   SNPP +GA+IVA ++  PEL  +W ++M  M+
Sbjct: 283 LALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMS 342

Query: 539 GRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGR 360
            RI  +R  L D L +K  +  +W  I+ Q GMFSFTGL     + +     +Y+   GR
Sbjct: 343 SRITKMRHALRDHL-VKLGTPGNWDHIVNQCGMFSFTGLTPQMVKRLEETHAVYLVASGR 401

Query: 359 ISLAGLSAAKCEYLADAI 306
            S+AGL+    EY+A AI
Sbjct: 402 ASIAGLNQGNVEYVAKAI 419



>sp|P23542|AATC_YEAST Aspartate aminotransferase, cytoplasmic (EC
           2.6.1.1) (Transaminase A).
          Length = 417

 Score =  143 bits (361), Expect = 4e-33
 Identities = 80/198 (40%), Positives = 114/198 (57%), Gaps = 7/198 (3%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFA---SRGLELLVAQSYSKNLGLYAERIGAIN 708
           KNHI  FD AYQGFA+G LD DA +VR+     S    + V QS++KN G+Y ER+G  +
Sbjct: 208 KNHIALFDTAYQGFATGDLDKDAYAVRLGVEKLSTVSPVFVCQSFAKNAGMYGERVGCFH 267

Query: 707 VVCSSADAAARVK----SQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMA 540
           +  +       +K    SQL ++ R   SNPP +GA+IVA ++  PEL  +W ++M  M+
Sbjct: 268 LALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMS 327

Query: 539 GRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGR 360
            RI  +R  L D L +K  +  +W  I+ Q GMFSFTGL     + +     +Y+   GR
Sbjct: 328 SRITKMRHALRDHL-VKLGTPGNWDHIVNQCGMFSFTGLTPQMVKRLEETHAVYLVASGR 386

Query: 359 ISLAGLSAAKCEYLADAI 306
            S+AGL+    EY+A AI
Sbjct: 387 ASIAGLNQGNVEYVAKAI 404



>gb:BX936398_835022 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 397

 Score =  143 bits (360), Expect = 5e-33
 Identities = 75/191 (39%), Positives = 121/191 (63%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  IPF D+AYQGF +G L+ DA ++R  A+ GL  L++ S+SK   LY ER+G ++VV
Sbjct: 204 ERELIPFLDIAYQGFGAG-LNEDAYAIRAMAAAGLPCLISNSFSKIFSLYNERVGGLSVV 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C S +AA RV  QLK   R  YS+PP  GA++V+ V+ +  L  +W+ E+E M  RI  +
Sbjct: 263 CESDEAAGRVLGQLKATVRRNYSSPPNFGAQVVSKVLNDTVLRAQWQAEVEQMRLRILDM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L ++L       +++ ++L+Q GMFS+TG ++AQ + +  ++ +Y+   GR+ +AG+
Sbjct: 323 RHTLVEALK-ASLPERNFDYLLQQRGMFSYTGFSEAQVDRLREEFGVYLIASGRMCMAGV 381

Query: 341 SAAKCEYLADA 309
           +    E +A A
Sbjct: 382 NHQNVEQVAVA 392



>gb:AE015681_316779 Shewanella oneidensis MR-1 section 230 of 457 of
           the complete genome.>gb:AE014299_952376 Shewanella
           oneidensis MR-1 complete genome.
          Length = 396

 Score =  141 bits (356), Expect = 1e-32
 Identities = 79/192 (41%), Positives = 112/192 (58%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+   P  D+AYQGF  G +D DA  VR  A+    +++  S SKN GLY ERIG+ +VV
Sbjct: 203 EQGFTPLIDMAYQGFGDG-VDIDAYGVRKMAAAVDNMILCSSCSKNFGLYRERIGSCSVV 261

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
              A+ A   +S L  + R +YS PP HGA IV  ++G+ EL  EW  E+++M  RI   
Sbjct: 262 AKDANTANIAQSVLLYVVRCLYSMPPAHGAAIVETILGSKELTQEWLDELKVMRDRINGN 321

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L + L     + +D++FI +Q GMFSF G+N  Q   +  ++ IYM    RIS+AG+
Sbjct: 322 RAILVEKLKANGVA-RDFSFIARQKGMFSFLGVNPEQVARLQKEFSIYMVGSSRISIAGI 380

Query: 341 SAAKCEYLADAI 306
           S    +YLA +I
Sbjct: 381 SEDNVDYLAQSI 392



>gb:CR380950_1649733 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 418

 Score =  139 bits (350), Expect = 7e-32
 Identities = 75/198 (37%), Positives = 116/198 (58%), Gaps = 8/198 (4%)
 Frame = -1

Query: 875 NHIPFFDVAYQGFASGSLDADASSVRMFASRGLE---LLVAQSYSKNLGLYAERIGAINV 705
           +H+  FD AYQGFASG LD DA +VR+   +      + V QS++KN+G+Y ER+G  ++
Sbjct: 210 DHLALFDSAYQGFASGDLDKDAFAVRLGVEKLASTSPIFVCQSFAKNVGMYGERVGCFHL 269

Query: 704 VCSSADA-----AARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMA 540
           +    +A      + + SQ+  + R   SN P +GA+IV+ ++  PEL  +W ++M  M+
Sbjct: 270 ILPKQNANLAPIKSAITSQISSIIRSEVSNSPAYGAKIVSKILNTPELTKQWHEDMVTMS 329

Query: 539 GRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGR 360
            RIK +R  L D L +K  +   W  I++Q GMFSFTGL     + +  +  +Y+   GR
Sbjct: 330 SRIKEMRIALRDHL-VKLGTPGTWDHIVEQCGMFSFTGLTPEMVKRLEVQHAVYLVSSGR 388

Query: 359 ISLAGLSAAKCEYLADAI 306
            S+AGL++   EY A AI
Sbjct: 389 ASIAGLNSGNVEYTAKAI 406



>gb:AY659111_2148121 Synthetic construct Peudomonas aeruginosa clone
           FLH038620.01F PA0870 gene, partial cds.
          Length = 400

 Score =  138 bits (348), Expect = 1e-31
 Identities = 77/188 (40%), Positives = 117/188 (62%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +P  D AYQGF  G L+ DA +VR+FA    E+LV  S SKN GLY +R+GA+ V   +A
Sbjct: 208 LPLIDFAYQGFGDG-LEEDAWAVRLFAGELPEVLVTSSCSKNFGLYRDRVGALIVCAQNA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +    ++SQL  LAR ++S PP HGA +VA ++G+ EL   W++E+E M  RI S+R  L
Sbjct: 267 EKLTDLRSQLAFLARNLWSTPPAHGAEVVAAILGDSELKGLWQEEVEGMRSRIASLRIGL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            ++L+    + + +  +  Q GMFS+TGL+  Q   + ++  +Y+   GR ++AGL A +
Sbjct: 327 VEALAPHGLAER-FAHVGAQRGMFSYTGLSPQQVARLRDEHAVYLVSSGRANVAGLDARR 385

Query: 329 CEYLADAI 306
            + LA AI
Sbjct: 386 LDRLAQAI 393



>sp|P43336|PHHC_PSEAE Aromatic-amino-acid aminotransferase (EC
           2.6.1.57).>pir|D83535|D83535 aromatic amino acid
           aminotransferase PA0870 [imported] - Pseudomonas
           aeruginosa (strain PAO1)>gb:AE004522_55106 Pseudomonas
           aeruginosa PAO1, section 83 of 529 of the complete
           genome.>gb:AE004091_969206 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 399

 Score =  138 bits (348), Expect = 1e-31
 Identities = 77/188 (40%), Positives = 117/188 (62%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +P  D AYQGF  G L+ DA +VR+FA    E+LV  S SKN GLY +R+GA+ V   +A
Sbjct: 208 LPLIDFAYQGFGDG-LEEDAWAVRLFAGELPEVLVTSSCSKNFGLYRDRVGALIVCAQNA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +    ++SQL  LAR ++S PP HGA +VA ++G+ EL   W++E+E M  RI S+R  L
Sbjct: 267 EKLTDLRSQLAFLARNLWSTPPAHGAEVVAAILGDSELKGLWQEEVEGMRSRIASLRIGL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            ++L+    + + +  +  Q GMFS+TGL+  Q   + ++  +Y+   GR ++AGL A +
Sbjct: 327 VEALAPHGLAER-FAHVGAQRGMFSYTGLSPQQVARLRDEHAVYLVSSGRANVAGLDARR 385

Query: 329 CEYLADAI 306
            + LA AI
Sbjct: 386 LDRLAQAI 393



>gb:AY762327_1350285 Trypanosoma cruzi putative aspartate
           aminotransferase mRNA, partial cds.
          Length = 229

 Score =  137 bits (346), Expect = 2e-31
 Identities = 64/120 (53%), Positives = 90/120 (75%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPFFD AYQG+A+GSLD DA S+R+FA +G+E+L+AQSYSKN+GLYAER+G  ++V ++ 
Sbjct: 110 IPFFDSAYQGYATGSLDNDAYSIRLFARQGMEMLLAQSYSKNMGLYAERVGVCSIVTANP 169

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
             A  +KSQL+ + R  YS PP HGAR+   V+ +PEL   W+QE+ +M+ R+  +RQ L
Sbjct: 170 KKAPLIKSQLETIVRSQYSTPPAHGARVAYLVLSDPELRAGWEQELRVMSTRVLEMRQAL 229



>gb:BA000021_686870 Wigglesworthia glossinidia endosymbiont of
           Glossina brevipalpis DNA, complete genome.
          Length = 398

 Score =  137 bits (346), Expect = 2e-31
 Identities = 73/180 (40%), Positives = 104/180 (57%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  IP FD AYQGF++G  D D   +++F     E +V  S+SKN  LY ER+G  N + 
Sbjct: 204 KKWIPIFDSAYQGFSNGLKD-DVFGIKIFLKYINEFVVCNSFSKNFSLYNERVGTCNFIT 262

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            +   A+ V SQL+ + R  YSNPP HGA I+  +    +LFN WK E+  M  RIK +R
Sbjct: 263 KNKKHASNVFSQLRSIIRVNYSNPPAHGANIINVIFSKKDLFNLWKSELNEMRNRIKQIR 322

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
               D+L  K  + K++ FI  Q GMFSF GLN+    ++ N + IY+   GR++ A ++
Sbjct: 323 SLFADTL-FKINNKKNFNFIKNQHGMFSFIGLNRKNVMDLRNNFRIYVIDSGRLNFAAIT 381



>gb:BX571873_789212 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 15/17.
          Length = 399

 Score =  137 bits (344), Expect = 4e-31
 Identities = 71/190 (37%), Positives = 115/190 (60%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  +PF D+AYQG A G ++ DA ++R  A+ GL  LV+ S+SK   +Y ER+G ++V+
Sbjct: 204 ERELLPFLDIAYQGLADG-MEKDAYAIRAMATAGLPCLVSNSFSKIFSMYGERVGGLSVI 262

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
           C       RV  QLK   R +YS+PP  GA++VA V+ +P L  +W  E+E M  RI  +
Sbjct: 263 CDDEQTKERVLGQLKAGVRRVYSSPPSFGAQVVAKVLTDPALKAQWLTEVEHMRLRILEM 322

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R  L D+L       K++ + LKQ GMFS+TG ++ Q + +  ++ +Y+  +GR+ +AG+
Sbjct: 323 RTVLVDALKTA-LPEKNFEYFLKQRGMFSYTGFSQKQVDRLRQEFAVYLVGNGRVCMAGV 381

Query: 341 SAAKCEYLAD 312
           +      +A+
Sbjct: 382 NHRNVARIAE 391



>gb:PSEPHHY_160861 Pseudomonas aeruginosa phenylalanine hydroxylase
           gene, complete cds.
          Length = 399

 Score =  136 bits (343), Expect = 5e-31
 Identities = 77/188 (40%), Positives = 116/188 (61%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +P  D AYQGF  G L+ DA +VR+FA    E+LV  S SKN GLY +R+GA+ V   +A
Sbjct: 208 LPLIDFAYQGFGDG-LEEDAWAVRLFAGELPEVLVTSSCSKNFGLYRDRVGALIVCAQNA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +    ++SQL  LAR ++S PP HGA +VA ++G+ EL   W++E+E M  RI S+R  L
Sbjct: 267 EKLTDLRSQLAFLARNLWSTPPAHGAEVVAAILGDSELKGLWQEEVEGMRSRIASLRIGL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            ++L+    + + +  +  Q GMFS+TGL+  Q   + ++  +Y+   GR ++AGL A +
Sbjct: 327 VEALAPHGLAER-FAHVGAQRGMFSYTGLSPQQVARLRDEHAVYLVSSGRANVAGLHARR 385

Query: 329 CEYLADAI 306
              LA AI
Sbjct: 386 LGRLAQAI 393



>gb:CR378677_97539 Photobacterium profundum SS9 chromosome 2;
           segment 3/7.
          Length = 393

 Score =  136 bits (342), Expect = 6e-31
 Identities = 75/189 (39%), Positives = 114/189 (60%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +PF D+AY GF  G L+ D + ++  A    E++VA S SKN GLY ER GA  V+  S 
Sbjct: 204 LPFVDIAYLGFGDG-LEQDGAGLKYMADNVEEMIVAASCSKNFGLYRERTGAAIVISDSL 262

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
             A + K ++ +LAR  Y+ PP HGA +VA ++ +  L   WKQE++ M  R+ S+R  L
Sbjct: 263 PEAQKAKGRILQLARASYTMPPDHGAALVATILTDDALTATWKQELDQMHKRLLSLRSGL 322

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
             + +++ +    + FI +  GMFS TGL+  Q E +  ++ IY   DGRI++AGL   +
Sbjct: 323 --TKAVRAQGSDAFNFIEQHKGMFSVTGLSPEQIERLRAEYGIYAVGDGRINIAGLQEQQ 380

Query: 329 CEYLADAII 303
            +YLA+A+I
Sbjct: 381 LDYLANALI 389



>gb:CR543861_102186 Acinetobacter sp. ADP1 complete genome.
          Length = 404

 Score =  135 bits (340), Expect = 1e-30
 Identities = 73/190 (38%), Positives = 111/190 (58%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G ++ DA ++R     GL  +V+ S+SK   LY ER+G +  VC  A
Sbjct: 208 IPFLDIAYQGFGDG-MEQDAYAIRALDQSGLNFIVSNSFSKIFSLYGERVGGLTFVCDDA 266

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           +AA     QLK   R +YS+PP  GA +V  V+ + EL  +W+ E++ M  RI  +R  L
Sbjct: 267 EAAQCTFGQLKATVRRIYSSPPTTGAWLVDQVLNDAELSQQWQNEVKEMRERILKMRIIL 326

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            D L+ K    +D+ +++ Q GMFS+TGL   Q + +   + IY+ + GRI +AGL+   
Sbjct: 327 RDELT-KALPDRDFNYLVDQKGMFSYTGLTADQVDTLREDYAIYLVRSGRICVAGLNMNN 385

Query: 329 CEYLADAIID 300
              +A A+ +
Sbjct: 386 VYIVAKAMAE 395



>gb:BA000038_724980 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 398

 Score =  134 bits (338), Expect = 2e-30
 Identities = 76/188 (40%), Positives = 110/188 (58%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PF D+AYQGF  G L+ DA  ++  A R  E+L+  S SKN GLY ER GA  V+  +A 
Sbjct: 208 PFVDIAYQGFGDG-LEEDAKGLQFMADRVEEMLITTSCSKNFGLYRERTGAAIVIGKNAK 266

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
            ++  K +L  LAR  Y+ PP HGA +V  ++ N EL   WKQE+  M  R+ ++RQ L 
Sbjct: 267 ESSNAKGKLLTLARSTYTMPPDHGAALVKTILQNVELTTTWKQELCEMQQRLLNLRQTLC 326

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
           + L  +  + + + FI    GMF+  G    Q   + +++ IY   DGRI++AGL+ A  
Sbjct: 327 NELRNQHNTSQ-FDFIESHKGMFTVLGFTPEQMGTLRDEYGIYGVGDGRINIAGLTEAHI 385

Query: 326 EYLADAII 303
            Y+ADAI+
Sbjct: 386 PYVADAIV 393



>gb:AE016809_338084 Vibrio vulnificus CMCP6 chromosome II section 2
           of 6 of the complete sequence.>gb:AE016796_1047808
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 395

 Score =  134 bits (338), Expect = 2e-30
 Identities = 76/188 (40%), Positives = 110/188 (58%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PF D+AYQGF  G L+ DA  ++  A R  E+L+  S SKN GLY ER GA  V+  +A 
Sbjct: 205 PFVDIAYQGFGDG-LEEDAKGLQFMADRVEEMLITTSCSKNFGLYRERTGAAIVIGKNAK 263

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
            ++  K +L  LAR  Y+ PP HGA +V  ++ N EL   WKQE+  M  R+ ++RQ L 
Sbjct: 264 ESSNAKGKLLTLARSTYTMPPDHGAALVKTILQNVELTTTWKQELCEMQQRLLNLRQTLC 323

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
           + L  +  + + + FI    GMF+  G    Q   + +++ IY   DGRI++AGL+ A  
Sbjct: 324 NELRNQHNTSQ-FDFIESHKGMFTVLGFTPEQMGTLRDEYGIYGVGDGRINIAGLTEAHI 382

Query: 326 EYLADAII 303
            Y+ADAI+
Sbjct: 383 PYVADAIV 390



>pir|T29709|T29709 probable aspartate transaminase (EC 2.6.1.1)
           C14E2.2 [similarity] - Caenorhabditis
           elegans>gb:U46671_1404452 Caenorhabditis elegans cosmid
           C14E2, complete sequence.
          Length = 364

 Score =  134 bits (337), Expect = 2e-30
 Identities = 74/191 (38%), Positives = 109/191 (57%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K   PFFD++YQG ASG   AD+ ++R F S G+EL VAQS++KNL     R+G + VV 
Sbjct: 164 KRLFPFFDISYQGCASGDPAADSWAIRHFVSDGIELFVAQSFAKNLFFTNPRLGNLTVVV 223

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           ++A     +KSQ+    R     P   GA IV  V+        W Q ++ ++ RIK +R
Sbjct: 224 NNAAVIPGIKSQMSLAIRINAFYPTAFGATIVHKVLSTSARREFWIQSIQQISSRIKQMR 283

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
             L+D LS     G  W  I++Q GMFS+TGL   Q +++     +++  DGRI+++GL+
Sbjct: 284 TALFDVLSALKTPG-SWDHIIRQTGMFSYTGLTSTQVDHLVRNHKVFLLSDGRINISGLN 342

Query: 338 AAKCEYLADAI 306
               EY+A AI
Sbjct: 343 MKNVEYVAKAI 353



>gb:CP000021_873034 Vibrio fischeri ES114 chromosome II, complete
           sequence.
          Length = 395

 Score =  133 bits (335), Expect = 4e-30
 Identities = 71/188 (37%), Positives = 112/188 (59%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G L+ADA+ +R  A R  ++ +A S SKN GLY ER GA  V+  + 
Sbjct: 204 IPFVDIAYQGFGDG-LEADAAGLRFMADRVPQMFIATSCSKNFGLYRERTGAAMVIAGNI 262

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
           + A   K++L ++AR  Y+ PP HGA IV  ++ + +L   W+ E++ M  R+  +R  L
Sbjct: 263 EIAMNAKAKLLQMARATYTMPPDHGAAIVGRILNDEQLTLSWRTELDEMQKRLVGLRTNL 322

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            ++L  + +S + + FI +  GMFS  G    Q  ++ ++  IY   DGRI++AG+    
Sbjct: 323 CEALRNETQS-ETFDFIEQHKGMFSVIGFTPEQMASLKSEHGIYAVGDGRINIAGMQEKH 381

Query: 329 CEYLADAI 306
            EY+A ++
Sbjct: 382 IEYIAKSV 389



>gb:AE016815_1746197 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 443

 Score =  130 bits (326), Expect = 4e-29
 Identities = 72/195 (36%), Positives = 112/195 (57%), Gaps = 7/195 (3%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLE--LLVAQSYSKNLGLYAERIGAINVV-- 702
           +P  D+AYQG  SG L ADA  +RM      +  L V  S++KN+GLY ER+G+++VV  
Sbjct: 250 VPIVDMAYQGLESGDLRADAYLLRMCLEHRWDNGLYVCHSFAKNMGLYGERVGSLSVVHP 309

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
                A A   SQLK + R  YS+PP +G+R+   V+  PE+  +W +++  M  R+ SV
Sbjct: 310 LGQFQAKAATDSQLKCIIRASYSSPPSYGSRVATTVLSVPEIKQQWHEDVHGMCNRLWSV 369

Query: 521 RQKLYDSLSLKDKSGKDWTFIL---KQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISL 351
           R  L++ L         W  ++    Q GMF +TG+     + +  K+ +Y+TKDGR+SL
Sbjct: 370 RCMLHEKLR--------WPKLIDSTSQHGMFYYTGIGPDAVDTLREKYSVYLTKDGRLSL 421

Query: 350 AGLSAAKCEYLADAI 306
           AG++    +Y+A A+
Sbjct: 422 AGINTGNVDYVARAL 436



>gb:BA000032_709476 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 398

 Score =  130 bits (326), Expect = 4e-29
 Identities = 75/187 (40%), Positives = 104/187 (55%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSAD 687
           PF D+AYQGF  G L+ADA  +R  A    E+L+  S SKN GLY ER GA  VV  +  
Sbjct: 208 PFVDIAYQGFGDG-LEADAKGLRYMADNVEEMLITTSCSKNFGLYRERTGAAIVVGKNTQ 266

Query: 686 AAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLY 507
                K +L  LAR  Y+ PP HGA +V  ++ +  L + WKQE+  M  R+ S+RQ L 
Sbjct: 267 DITNAKGKLLTLARSTYTMPPDHGAALVKTILQDANLTSVWKQELSEMQQRLVSLRQSLC 326

Query: 506 DSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKC 327
           + L   + +   + FI    GMF+  G ++ Q   +   + IY   DGRI++AGL+    
Sbjct: 327 NELR-NNHNTDQFDFIESHKGMFTVLGFSENQMAQLREDYGIYGVGDGRINIAGLTETHI 385

Query: 326 EYLADAI 306
            Y+ADAI
Sbjct: 386 PYVADAI 392



>gb:BC029504_1979526 Homo sapiens hypothetical protein MGC33309,
           mRNA (cDNA clone MGC:33309 IMAGE:5273324), complete cds.
          Length = 421

 Score =  129 bits (323), Expect = 1e-28
 Identities = 67/191 (35%), Positives = 106/191 (55%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K   PFFD+  QG  +  L+ D   ++ F S+G E   +QS SKN G+Y E +G + VV 
Sbjct: 206 KQIFPFFDIPCQGLYTSGLEEDTRILQYFVSQGFEFFCSQSLSKNFGIYDEGVGMLVVVA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            +      V SQL+ LA+ ++ NPP  GAR++ +++ NP L  EWKQ ++ +   I   +
Sbjct: 266 VNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSILCNPALLGEWKQSLKEVVENIMLTK 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           +K+ + L L    G  W  I +Q G   + GLN  Q E +  K HIY+ K+G+I+ + ++
Sbjct: 326 EKVKEKLQLLGTPG-SWGHITEQSGTHGYLGLNSQQVEYLVRKKHIYIPKNGQINFSCIN 384

Query: 338 AAKCEYLADAI 306
           A    Y+ + I
Sbjct: 385 ANNINYITEGI 395



>gb:CR382126_1658958 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 418

 Score =  129 bits (323), Expect = 1e-28
 Identities = 71/194 (36%), Positives = 121/194 (62%), Gaps = 7/194 (3%)
 Frame = -1

Query: 866 PFFDVAYQGFASGSLDADASSVRMFASRGLE--LLVAQSYSKNLGLYAERIGAINVVC-- 699
           P  D+AYQG  SG+L  DA  +RM         L V QS++KN+GLY ER+G+++VV   
Sbjct: 228 PIIDMAYQGMESGNLIQDAYLLRMCLEYEWPNGLFVCQSFAKNMGLYGERVGSLSVVVPP 287

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
           +  D  + + SQLK++ R +YS+PP +G+R+   V+ NP+L  +W  +++ M+ R+ +VR
Sbjct: 288 NPLDLKSTIDSQLKKIVRGIYSSPPGYGSRVANLVLSNPKLKQQWFVDVKNMSDRLWNVR 347

Query: 518 QKLYDSLSLKDKSGKDWTFIL---KQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLA 348
            ++++ L        +W  ++    Q GMF +TGLN  Q + +  ++ IY+T+DGR+SL+
Sbjct: 348 IQMHERL--------NWPNLVDFKTQHGMFYYTGLNPYQVQILQERYGIYLTEDGRMSLS 399

Query: 347 GLSAAKCEYLADAI 306
           G++    +YL D++
Sbjct: 400 GVNDGNIDYLCDSL 413



>gb:AX491305_1469531 Sequence 1 from Patent WO0229040.
          Length = 421

 Score =  129 bits (323), Expect = 1e-28
 Identities = 67/191 (35%), Positives = 106/191 (55%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K   PFFD+  QG  +  L+ D   ++ F S+G E   +QS SKN G+Y E +G + VV 
Sbjct: 206 KQIFPFFDIPCQGLYTSDLEEDTRILQYFVSQGFEFFCSQSLSKNFGIYDEGVGMLVVVA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            +      V SQL+ LA+ ++ NPP  GAR++ +++ NP L  EWKQ ++ +   I   +
Sbjct: 266 VNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSILCNPALLGEWKQSLKEVVENIMLTK 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           +K+ + L L    G  W  I +Q G   + GLN  Q E +  K HIY+ K+G+I+ + ++
Sbjct: 326 EKVKEKLQLLGTPG-SWGHITEQSGTHGYLGLNSQQVEYLVRKKHIYIPKNGQINFSCIN 384

Query: 338 AAKCEYLADAI 306
           A    Y+ + I
Sbjct: 385 ANNINYITEGI 395



>sp|P95468|TYRB_PARDE Aromatic-amino-acid aminotransferase (EC
           2.6.1.57) (AROAT) (ARAT).>pir|JC5197|JC5197
           aromatic-amino-acid transaminase (EC 2.6.1.57) -
           Paracoccus denitrificans>gb:PDTYRB_157681
           P.denitrificans tyrB gene.
          Length = 394

 Score =  129 bits (323), Expect = 1e-28
 Identities = 75/191 (39%), Positives = 111/191 (58%), Gaps = 1/191 (0%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +P  D+AYQGF  G L+ DA+  R+ ASR  E+L+A S SKN G+Y ER G +  +C+ A
Sbjct: 204 LPLIDLAYQGFGDG-LEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADA 262

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
                 +  +  L R  YS PP HGA+IV+ V+  PEL  +W  E+E +   +  +R++L
Sbjct: 263 ATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQL 322

Query: 509 YDSLSLKDKSGKD-WTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAA 333
             +  L+D SG D + F+ +  GMFS  G    Q + +  ++ IYM  D RI++AGL+  
Sbjct: 323 --AGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDN 380

Query: 332 KCEYLADAIID 300
               LA AII+
Sbjct: 381 TIPILARAIIE 391



>gb:BC052754_2101260 Mus musculus RIKEN cDNA 1700083M11 gene, mRNA
           (cDNA clone MGC:58486 IMAGE:6533656), complete cds.
          Length = 404

 Score =  128 bits (321), Expect = 2e-28
 Identities = 67/191 (35%), Positives = 103/191 (53%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K   PFFD+  QG ++G L+ D   ++ F S GLE   +QS SKN G+Y E +G + V  
Sbjct: 206 KQIFPFFDIPCQGLSTGDLEEDTKILQYFVSLGLEFFCSQSLSKNFGIYDEGVGILVVAA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            S      V SQL    + ++ NPP  GARI+ +++ NP LF EWKQ ++ +   +  ++
Sbjct: 266 LSNQHLLCVLSQLMDYVQALWGNPPATGARIITSILCNPALFGEWKQSLKGVVENMMLIK 325

Query: 518 QKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLS 339
           +K+ + L L    G  W  I +Q G   + GL   Q E +  K HIY+ K  RI+   ++
Sbjct: 326 EKVKEKLRLLGTPG-SWDHITRQSGTHGYLGLTYQQVEFLVKKKHIYLPKTSRINFTCIN 384

Query: 338 AAKCEYLADAI 306
           A   +Y+  +I
Sbjct: 385 ARNIDYITQSI 395



>pir|G82449|G82449 amino acid biosynthesis aminotransferase VCA0513
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004382_53646 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome II, section 39 of 93 of the
           complete chromosome.>gb:AE003853_1050592 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome II, complete
           chromosome.
          Length = 404

 Score =  126 bits (317), Expect = 5e-28
 Identities = 72/189 (38%), Positives = 106/189 (56%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           IPF D+AYQGF  G L+ DA  +R  A R  E+L+  S SKN GLY ER GA  V+  + 
Sbjct: 215 IPFVDIAYQGFGDG-LEQDAQGLRYMAERMEEMLITTSCSKNFGLYRERTGAAIVIGKNQ 273

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
                 + ++  LAR  Y+ PP HGA +V  V+ + +L   WKQE+  M  R+ ++R+ L
Sbjct: 274 QEVTNARGKMLTLARSTYTMPPDHGAALVKTVLRDEQLTAIWKQELSEMQQRLLTLRKNL 333

Query: 509 YDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAK 330
            + L     + + + FI    GMF+  G +  Q   +  ++ IY   DGRI++AGL+   
Sbjct: 334 CNELR-NQHNTRQFDFIESHRGMFTVLGFSAEQMGRLREEFAIYGVADGRINIAGLTEKD 392

Query: 329 CEYLADAII 303
             Y+A+AII
Sbjct: 393 IPYVANAII 401



>pir|H71620|H71620 aspartate transaminase (EC 2.6.1.1) PFB0200c
           [similarity] - malaria parasite (Plasmodium
           falciparum)>gb:AE001362_939279 Plasmodium falciparum 3D7
           chromosome 2 complete sequence.>gb:AE001380_1208590
           Plasmodium falciparum 3D7 chromosome 2 section 17 of 73
           of the complete sequence.
          Length = 405

 Score =  126 bits (316), Expect = 6e-28
 Identities = 67/194 (34%), Positives = 107/194 (55%), Gaps = 3/194 (1%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K H+  FD+AYQGF   +L+ D   +R F  + +   V QS+SKN+ LY ER GA+++VC
Sbjct: 206 KKHVIIFDIAYQGFGHTNLEEDVLLIRKFEEKNIAFSVCQSFSKNMSLYGERAGALHIVC 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
            + +    V + L  + R  YS+P IH  RI+  ++ N  L   W +E+  ++ RI + R
Sbjct: 266 KNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQLLNNQNLKLNWIKELSQLSQRITNNR 325

Query: 518 QKLYDSLSLKDKS---GKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLA 348
              ++ L    K      DW    KQ G+FSF  L    +E++    HIY+  +GRI+++
Sbjct: 326 ILFFNKLETYQKKYNLNYDWNVYKKQRGLFSFVPLLAKIAEHLKTH-HIYIINNGRINVS 384

Query: 347 GLSAAKCEYLADAI 306
           G++    +Y+AD I
Sbjct: 385 GITKNNVDYIADKI 398



>gb:BA000012_666281 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 394

 Score =  125 bits (314), Expect = 1e-27
 Identities = 75/194 (38%), Positives = 115/194 (59%), Gaps = 1/194 (0%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  +PF D+AYQGF  G L+ADA  +R+ A++  E++VA S SKN  +Y +R+GA  V+
Sbjct: 200 ERGLLPFVDIAYQGFGDG-LEADALGLRLLAAKVPEMVVASSCSKNFAVYRDRVGAAMVL 258

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
              +  A    SQ+   AR MYS PP HGA  V  V+ +  L  +W+ E+E M  R++ +
Sbjct: 259 ARDSAQADVAMSQMLSAARAMYSMPPDHGAAAVRIVLEDASLRADWEAELEEM--RLRML 316

Query: 521 RQKLYDSLSLKDKSGKD-WTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAG 345
           R ++  + +L+ +S  D + F+    GMFS  GL +AQ E +  +  +YM  D RI++AG
Sbjct: 317 RLRVAFAEALRRQSNSDRFDFVASHRGMFSRLGLTEAQVERLRAEHGVYMVGDSRINVAG 376

Query: 344 LSAAKCEYLADAII 303
           L     + LA AI+
Sbjct: 377 LPEDGMDALAKAIV 390



>gb:AE017345_1756781 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 529

 Score =  124 bits (311), Expect = 2e-27
 Identities = 65/192 (33%), Positives = 112/192 (58%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  IP   +A+QG +SG  + DA ++R     GL +++ Q++   +GLYA+    +++V
Sbjct: 227 EREMIPLVIMAFQGLSSGDTNRDAQALRFMVHEGLPVVLVQNFDATMGLYADSPSIVSIV 286

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +++   RV+SQL+ + R M+ +P   GA I   ++ + +L   W +EM +M+ R++S 
Sbjct: 287 TRNSEDKDRVESQLRAIGRGMWIHPSPWGAHIAHQILTDAKLHPSWLKEMRLMSDRLRSA 346

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R KLY  L  K K+  DW  I K  GM+    L  AQ+E ++ K HI++  DG  +L  L
Sbjct: 347 RSKLYMQLVDKLKTPGDWAHIKKANGMYCTALLPSAQTEALTAKHHIHLLPDGCFNLGSL 406

Query: 341 SAAKCEYLADAI 306
           +++K + L+ AI
Sbjct: 407 NSSKIDALSRAI 418



>gb:CR380957_1652883 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 453

 Score =  124 bits (311), Expect = 2e-27
 Identities = 70/200 (35%), Positives = 118/200 (59%), Gaps = 8/200 (4%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRM------FASRGLELLVAQSYSKNLGLYAERI 720
           E   IP  D+AYQG  SG L  DA  +R+      + S    L + QS++KN+GLY ER+
Sbjct: 249 ELGMIPIIDMAYQGLESGKLIDDAYLLRLCLDTSRYRSWDNGLYLCQSFAKNMGLYGERV 308

Query: 719 GAINVVCSSADAAAR--VKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEM 546
           G++++V        +  + SQLK++ R MYS+PP +G+R+   V+ N +L  +W  ++E 
Sbjct: 309 GSLSIVAPEHVPGVKEVLDSQLKQIIRSMYSSPPGYGSRVAKLVLSNDKLKYQWYSDVET 368

Query: 545 MAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKD 366
           M  R+KSVR+ +++ L  ++    +     +Q GMF FT L     + +  ++ IY+T D
Sbjct: 369 MVNRLKSVREMIHERLQWEEIVNFE-----QQHGMFYFTKLGPDIVKKLREQYSIYLTND 423

Query: 365 GRISLAGLSAAKCEYLADAI 306
           GR+SL+G++ +  +YL ++I
Sbjct: 424 GRMSLSGVNKSNVDYLCNSI 443



>sp|Q02636|ATTY_RHIME Tyrosine aminotransferase (EC 2.6.1.5)
           (L-tyrosine:2-oxoglutarate aminotransferase)
           (TAT).>pir|B47094|B47094 aromatic-amino-acid
           transaminase (EC 2.6.1.57) - Rhizobium
           meliloti>gb:RHMTATA_164002 Rhizobium meliloti tyrosine
           aminotransferase (tatA) gene, complete
           cds.>gb:SME591783_184325 Sinorhizobium meliloti 1021
           complete chromosome; segment 2/12.>gb:AF465790_513713
           Sinorhizobium meliloti strain JJ1c10 hypothetical
           protein gene, partial cds; and hypothetical conserved
           protein, tyrosine aminotransferase (tatA), hypothetical
           conserved protein, and hypothetical conserved protein
           genes, complete cds.
          Length = 389

 Score =  124 bits (311), Expect = 2e-27
 Identities = 76/189 (40%), Positives = 107/189 (56%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  +P  D+AYQGF  G LD D + +R       E LVA S SK+ GLY ER GAI   
Sbjct: 199 ERGLLPLVDLAYQGFGRG-LDQDVAGLRHLLGVVPEALVAVSCSKSFGLYRERAGAIFAR 257

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            SS  +A RV+S L  LAR  YS PP HGA +V  ++ +PEL  +W +E+E M  R+  +
Sbjct: 258 TSSTASADRVRSNLAGLARTSYSMPPDHGAAVVRTILDDPELRRDWTEELETMRLRMTGL 317

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R+ L + L  + +S      +  Q GMFS   L++A+   +  +  IYM   GRI++AGL
Sbjct: 318 RRSLAEGLRTRWQS---LGAVADQEGMFSMLPLSEAEVMRLRTEHGIYMPASGRINIAGL 374

Query: 341 SAAKCEYLA 315
             A+   +A
Sbjct: 375 KTAEAAEIA 383



>pir|S37933|S37933 aspartate transaminase (EC 2.6.1.1) precursor,
           mitochondrial - yeast (Saccharomyces
           cerevisiae)>gb:SCHAPLAP_1708436 S.cerevisiae HAP4, AAT1,
           GFA1, LAP4 and MBR1 genes.>gb:SCYKL106W_1713082
           S.cerevisiae chromosome XI reading frame ORF YKL106w.
          Length = 451

 Score =  120 bits (300), Expect = 5e-26
 Identities = 66/211 (31%), Positives = 119/211 (56%), Gaps = 19/211 (9%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRM------FASRGLELLVAQSYSKNLGLYAERI 720
           E   +P  D+AYQG  SG+L  DA  +R+      + +    + + QS++KN+GLY ER+
Sbjct: 236 ELKMVPIVDMAYQGLESGNLLKDAYLLRLCLNVNKYPNWSNGIFLCQSFAKNMGLYGERV 295

Query: 719 GAINVVCSSA-------------DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPE 579
           G+++V+  +                   + SQLK++ R MYS+PP +G+R+V  V+ + +
Sbjct: 296 GSLSVITPATANNGKFNPLQQKNSLQQNIDSQLKKIVRGMYSSPPGYGSRVVNVVLSDFK 355

Query: 578 LFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENM 399
           L  +W ++++ M  R+  VRQ+++D L   D          +Q GMF +T  +  Q E +
Sbjct: 356 LKQQWFKDVDFMVQRLHHVRQEMFDRLGWPDLVN-----FAQQHGMFYYTRFSPKQVEIL 410

Query: 398 SNKWHIYMTKDGRISLAGLSAAKCEYLADAI 306
            N + +Y+T DGR+SL+G++ +  +YL +++
Sbjct: 411 RNNYFVYLTGDGRLSLSGVNDSNVDYLCESL 441



>gb:CP000031_87712 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 394

 Score =  119 bits (298), Expect = 8e-26
 Identities = 75/195 (38%), Positives = 107/195 (54%), Gaps = 1/195 (0%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K  +   D+AYQGF  G L+ DA   R+ AS   E L+A S SKN G+Y ER G +  V 
Sbjct: 201 KGLVAMIDIAYQGFGDG-LEEDAQGTRLVASSVKECLIAASCSKNFGVYRERTGLLMAVS 259

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVR 519
             +   A  ++ L  L R  YS PP HGAR+V  ++ +  L  +W  E+E +   +  +R
Sbjct: 260 QDSGQTALNQATLAFLNRQNYSFPPDHGARVVTTILNDDALRADWMAELEEIRLSMLGLR 319

Query: 518 QKLYDSLSLKDKSGKD-WTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           Q+L D   L+  SG D ++FI +  GMFS  G      E +  ++ IYM  D R+++AGL
Sbjct: 320 QQLAD--ELQRLSGSDRFSFIAQHRGMFSRIGAAPELVEKLRTEFGIYMVGDSRMNIAGL 377

Query: 341 SAAKCEYLADAIIDS 297
           +A     LA AIID+
Sbjct: 378 NAQTVPILAKAIIDA 392



>sp|Q01802|AATM_YEAST Aspartate aminotransferase, mitochondrial
           precursor (EC 2.6.1.1) (Transaminase
           A).>gb:SCAAT1A_1706440 S.cerevisiae AAT1 gene for
           mitochondrial aspartate aminotransferase.
          Length = 451

 Score =  118 bits (295), Expect = 2e-25
 Identities = 66/211 (31%), Positives = 118/211 (55%), Gaps = 19/211 (9%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRM------FASRGLELLVAQSYSKNLGLYAERI 720
           E   +P  D+AYQG  SG+L  DA  +R+      + +    + + QS++KN+GLY ER+
Sbjct: 236 ELKMVPIVDMAYQGLESGNLLKDAYLLRLCLNVNKYPNWSNGIFLCQSFAKNMGLYGERV 295

Query: 719 GAINVVCSSA-------------DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPE 579
           G+++V+  +                   + SQLK++ R MYS+PP +G+R+V  V+ + +
Sbjct: 296 GSLSVITPATANNGKFNPLQQKNSLQQNIDSQLKKIVRGMYSSPPGYGSRVVNVVLSDFK 355

Query: 578 LFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENM 399
           L  +W ++++ M  R+  VRQ+++D L   D          +Q GMF +T  +  Q E +
Sbjct: 356 LKQQWFKDVDFMVQRLHHVRQEMFDRLGWPDLVN-----FAQQHGMFYYTRFSPKQVEIL 410

Query: 398 SNKWHIYMTKDGRISLAGLSAAKCEYLADAI 306
            N   +Y+T DGR+SL+G++ +  +YL +++
Sbjct: 411 RNNSFVYLTGDGRLSLSGVNDSNVDYLCESL 441



>pir|A86583|A86583 aromatic AA aminotransferase [imported] -
           Chlamydophila pneumoniae (strain J138)>pir|B72042|B72042
           aromatic-amino-acid transaminase (EC 2.6.1.57) tyrB
           [similarity] - Chlamydophila pneumoniae (strain
           CWL029)>gb:AE001655_37591 Chlamydia pneumoniae section
           71 of 103 of the complete genome.>gb:AE002164_43493
           Chlamydophila pneumoniae AR39, section 1 of 94 of the
           complete genome.>gb:AE017159_394109 Chlamydophila
           pneumoniae TW-183, section 3 of 4 of the complete
           genome.>gb:BA000008_664110 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_885618
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_942148 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028371 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 395

 Score =  117 bits (293), Expect = 3e-25
 Identities = 64/196 (32%), Positives = 105/196 (53%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E+  IPFFD AYQGFA G ++ D   + +F S G  +LVA S SKN  LY ER+G   V 
Sbjct: 201 ERELIPFFDTAYQGFAHG-IELDRKPIEIFISEGNTVLVAASSSKNFALYGERVGYFAVH 259

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
            +  D   ++ S L+   R  YS+P   G  IV+ ++ NP L  EW+ E+  +   +  +
Sbjct: 260 STFTDELVKIHSFLEEKIRGEYSSPQRWGVEIVSTILSNPYLKEEWQSELNFIRESLGKM 319

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +     +L+  +G  + F+L Q G F++ G +  Q   +  +  +Y T  GR++L G+
Sbjct: 320 RTRFVQ--ALRKVAGHTFDFLLSQHGFFAYPGFSDKQVLFLREQHAVYTTAGGRMNLNGI 377

Query: 341 SAAKCEYLADAIIDSY 294
           +    +++  + I +Y
Sbjct: 378 TEKNIDHVVQSFIQAY 393



>gb:D67042_1674743 Oryza sativa (japonica cultivar-group) mRNA for
           aspartate aminotransferase, partial cds.
          Length = 132

 Score =  117 bits (292), Expect = 4e-25
 Identities = 58/126 (46%), Positives = 88/126 (69%)
 Frame = -1

Query: 683 AARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYD 504
           A  VKSQL+++ARPMYSNPP+HGA +V+ ++ +PEL + W +E++ MA RI  +R+ L +
Sbjct: 1   AVSVKSQLQQIARPMYSNPPVHGALVVSIILNDPELKSLWLKEVKGMADRIIGMRKALRE 60

Query: 503 SLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCE 324
           +L     S   W  I  QIGMF ++G+   Q   ++N++HIYMT++GRIS+AG++     
Sbjct: 61  NLEGLG-SPLSWDHITNQIGMFCYSGMTPEQVVRLTNEYHIYMTRNGRISMAGVTTGNVA 119

Query: 323 YLADAI 306
           YLA+AI
Sbjct: 120 YLANAI 125



>pir|T02971|T02971 probable aspartate transaminase (EC 2.6.1.1) -
           rice  (fragment)
          Length = 132

 Score =  117 bits (292), Expect = 4e-25
 Identities = 58/126 (46%), Positives = 88/126 (69%)
 Frame = -1

Query: 683 AARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYD 504
           A  VKSQL+++ARPMYSNPP+HGA +V+ ++ +PEL + W +E++ MA RI  +R+ L +
Sbjct: 1   AVSVKSQLQQIARPMYSNPPVHGALVVSIILNDPELKSLWLKEVKGMADRIIGMRKALRE 60

Query: 503 SLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCE 324
           +L     S   W  I  QIGMF ++G+   Q   ++N++HIYMT++GRIS+AG++     
Sbjct: 61  NLEGLG-SPLSWDHITNQIGMFCYSGMTPEQVVRLTNEYHIYMTRNGRISMAGVTTGNVA 119

Query: 323 YLADAI 306
           YLA+AI
Sbjct: 120 YLANAI 125



>gb:AF498406_516751 Pseudomonas aeruginosa serotype O15-ATCC
           putative O-antigen biosynthesis gene cluster, partial
           sequence.
          Length = 149

 Score =  115 bits (287), Expect = 1e-24
 Identities = 58/145 (40%), Positives = 93/145 (64%)
 Frame = -1

Query: 737 LYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQ 558
           LY ER+GA+++V  S D +ARV SQ+KR+ R  Y NPP HGA +V++V+ +PEL   W+Q
Sbjct: 3   LYGERVGALSIVTESRDESARVLSQVKRVIRTNYPNPPTHGASVVSSVLNSPELRALWEQ 62

Query: 557 EMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIY 378
           E+  M  RI+ +R  + + L+    + +D++F+ +Q GMFS++GL   Q E +  ++ IY
Sbjct: 63  ELGEMRDRIRDMRLAMVEQLAAHG-AKRDFSFVGRQRGMFSYSGLTADQVERLKTEFGIY 121

Query: 377 MTKDGRISLAGLSAAKCEYLADAII 303
               GRI +A L+ +  E +  AI+
Sbjct: 122 AVSTGRICVAALNKSNLETITKAIV 146



>gb:AF416331_509154 Ruegeria sp. PR1b plasmid pSD25, complete
           sequence.
          Length = 392

 Score =  110 bits (274), Expect = 5e-23
 Identities = 70/191 (36%), Positives = 100/191 (52%), Gaps = 1/191 (0%)
 Frame = -1

Query: 869 IPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVCSSA 690
           +   D+AY GF  G L+ DA   R  A    E L+A S SKN GLY ER GA+ V   + 
Sbjct: 202 VGMIDLAYLGFGDG-LEEDAWGTRHLAETLDECLIAVSCSKNFGLYRERAGALLVTARNP 260

Query: 689 DAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKL 510
              A  +  L  L R  YS PP HGARIV +++ +P L   W QE+  +   I ++R +L
Sbjct: 261 ALLAHTREVLAYLNRQAYSFPPDHGARIVTSILKDPALREVWTQELHGIRNSIAALRLQL 320

Query: 509 YDSLSLKDKSG-KDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAA 333
            ++ +  +K+G + + +I +  GMFS  G    Q   +  K  IYM  D R++ A LS  
Sbjct: 321 CNAFA--EKTGTRRFDYIREHKGMFSCLGATPEQVRTLRAKHGIYMVTDSRLNFASLSQQ 378

Query: 332 KCEYLADAIID 300
             E + DA+ D
Sbjct: 379 NVERIVDAVTD 389



>gb:AF470319_1802850 Musa acuminata aspartate aminotransferase 1
           mRNA, partial cds.>gb:AF470320_1802851 Musa acuminata
           aspartate aminotransferase 2 mRNA, partial cds.
          Length = 114

 Score =  107 bits (267), Expect = 3e-22
 Identities = 54/104 (51%), Positives = 76/104 (73%)
 Frame = -1

Query: 617 GARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMF 438
           GA IVA ++ + EL++EW  E++ MA RI ++RQ+L+D+L  +   G DW+ I+KQIGMF
Sbjct: 4   GAFIVATILKDRELYHEWTIELKAMADRIINMRQQLFDALRARGTPG-DWSHIIKQIGMF 62

Query: 437 SFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI 306
           +FTGLN  Q   M+ ++HIYMT DGRIS+AGLS+    +L DAI
Sbjct: 63  TFTGLNTEQVTFMTKEYHIYMTSDGRISMAGLSSKTVPHLVDAI 106



>gb:AE016994_374073 Chlamydophila caviae GPIC section 1 of 4 of the
           complete genome.>gb:AE015925_993752 Chlamydophila caviae
           GPIC complete genome.
          Length = 396

 Score =  105 bits (262), Expect = 1e-21
 Identities = 59/196 (30%), Positives = 100/196 (51%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E   +PFFD AY GF  G +  D   + +F   G  + VA   SKN  LY ER+G   V 
Sbjct: 201 EHQLLPFFDTAYLGFGRG-IKEDRRPIEIFIEVGNPVFVAACASKNFSLYGERVGYFAVH 259

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
               +   ++ S L+  AR  YS+PP HGA+IV+ ++ +  L  EW  E++ +   +   
Sbjct: 260 SKITEDLDKISSCLEEKARGEYSSPPRHGAKIVSTILSDASLKKEWLSELDTIRSSLGKT 319

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R +L    ++++  G  + FIL Q G F + G +  Q   + ++  IY T   R +L G+
Sbjct: 320 RARLVQ--AMRNHVGHSFDFILSQKGFFGYPGFSVEQVLFLRSEKGIYTTSGARFNLNGI 377

Query: 341 SAAKCEYLADAIIDSY 294
           +    ++++ +  ++Y
Sbjct: 378 TDKNIDHVSQSFAEAY 393



>gb:AE008692_240675 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 407

 Score =  103 bits (258), Expect = 3e-21
 Identities = 66/192 (34%), Positives = 100/192 (52%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           +K  +P  D+AYQG   G L+ D + +R  + +  E++V  S  KN GLY ER GAI V+
Sbjct: 220 QKGLLPVIDLAYQGLGDG-LEEDVAGLRWLSQQVDEMIVTYSCDKNFGLYRERTGAIFVL 278

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
             +A++   V+S L    R  +  PP HGA  V  ++ N  L++ W+ E+  M  RI   
Sbjct: 279 SQNAESRKIVQSNLIASTRTHWYMPPDHGAAAVRIILENEALYDSWQTELNAMQQRISGN 338

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           RQ L        K+   +  +L+Q GMFS   L+  Q + +  +  IYM   GRI++AGL
Sbjct: 339 RQSL-------AKADSYFAPLLQQKGMFSILPLSPEQIKKLRIENAIYMAPSGRINVAGL 391

Query: 341 SAAKCEYLADAI 306
           +    +    AI
Sbjct: 392 TPTTIDPFVKAI 403



>gb:AE002269_44603 Chlamydia muridarum Nigg section 1 of 85 of the
           complete genome.>gb:AE002160_1148743 Chlamydia muridarum
           Nigg, complete genome.
          Length = 400

 Score =  103 bits (257), Expect = 4e-21
 Identities = 60/181 (33%), Positives = 95/181 (52%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           ++  IPFFD+AY GFA+G ++ D   VR+    G+   VA S SKN  LY  R+G   VV
Sbjct: 201 DRGLIPFFDMAYLGFANGIVE-DRRPVRLCIEAGVATFVAGSCSKNFSLYGSRVGFFGVV 259

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
                  +R+ S L+   R  YS+P   G  IV +++ NP L  EW  E+  +   ++ +
Sbjct: 260 HQDKTDLSRILSFLEEQIRGEYSSPAREGVAIVTSILENPYLRQEWGLELNGIRQSLEEI 319

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R      +++++ +G  + FI  Q G F + G +K Q   +  +  IY T  GR +L G+
Sbjct: 320 RANFV--IAMREVAGHSFDFIASQKGFFGYPGFSKEQVVFLREELGIYTTAGGRFNLNGI 377

Query: 341 S 339
           +
Sbjct: 378 T 378



>gb:AY422172_1605163 Flammulina velutipes aspartate transaminase
           mRNA, partial cds.
          Length = 117

 Score =  101 bits (251), Expect = 2e-20
 Identities = 47/106 (44%), Positives = 76/106 (71%)
 Frame = -1

Query: 623 IHGARIVANVVGNPELFNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIG 444
           +HGARI + ++ + +L+  W+ E++ MA RI  +R +LYD+L  ++  G +W+ I KQIG
Sbjct: 5   LHGARIASTILRDEQLYKLWESEVKHMADRIIQMRDRLYDNLVGQNTPG-EWSHIKKQIG 63

Query: 443 MFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAI 306
           MFSFTGL + Q++ ++ K HIYMT DGRIS+AGL+    +Y ++++
Sbjct: 64  MFSFTGLTQPQTKALAEKAHIYMTADGRISMAGLNGNNIDYFSESV 109



>pir|A71490|A71490 aromatic-amino-acid transaminase (EC 2.6.1.57)
           tyrB [similarity] - Chlamydia trachomatis (serotype D,
           strain UW3/Cx)>gb:AE001334_34576 Chlamydia trachomatis
           D/UW-3/CX section 61 of 87 of the complete
           genome.>gb:AE001273_1098602 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 400

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 59/196 (30%), Positives = 96/196 (48%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           E++ IPFFD+AY GFASG ++ D   VR+    G+   VA   SK   LY  R+G    +
Sbjct: 201 ERDLIPFFDMAYLGFASG-IEEDRRPVRLCIEAGVTTFVAGGASKIFSLYGSRVGFFGAI 259

Query: 701 CSSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEWKQEMEMMAGRIKSV 522
                   R+ S L+   R  YS+P   G  IV +++ NP L  EW+ E+  +   ++ +
Sbjct: 260 HQDKLDLNRILSFLEEQIRGEYSSPAREGVAIVTSILSNPYLRQEWELELNGIRQSLEEI 319

Query: 521 RQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKDGRISLAGL 342
           R      +++++ +G  + FI  Q G F + G +K Q   +  +  IY T  GR +L G+
Sbjct: 320 RSSFV--IAMRNVAGHSFDFIASQKGFFGYPGFSKEQVLFLREELGIYTTAGGRFNLNGI 377

Query: 341 SAAKCEYLADAIIDSY 294
           +      +      +Y
Sbjct: 378 TDKNINRVTHGFAQAY 393



>gb:AY347851_1178009 Malus x domestica clone 12-2 aspartate
           transaminase mRNA, partial cds.
          Length = 205

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 44/83 (53%), Positives = 59/83 (71%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           EK H PF D+AYQGFASG  + D  ++R+F   G  + +AQSY+KN+GLY +R+G ++V+
Sbjct: 116 EKGHFPFLDMAYQGFASGDPERDTKAIRIFLEDGHLIGIAQSYAKNMGLYGQRVGCLSVL 175

Query: 701 CSSADAAARVKSQLKRLARPMYS 633
           C     A  VKSQL+ LARPMYS
Sbjct: 176 CEDEKQAVAVKSQLQMLARPMYS 198



>gb:BC079187_2107316 Rattus norvegicus cDNA clone MGC:94235
           IMAGE:7131193, complete cds.
          Length = 315

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 42/105 (40%), Positives = 60/105 (57%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVVC 699
           K   PFFD+  QG ++G L+ D+  ++ F S G E   +QS SKN G+Y E +G + V  
Sbjct: 206 KQIFPFFDIPCQGLSTGDLEEDSKFLQHFVSLGFEFFCSQSLSKNFGIYDEGVGILVVAA 265

Query: 698 SSADAAARVKSQLKRLARPMYSNPPIHGARIVANVVGNPELFNEW 564
            S      V SQL    + ++ NPP  GARI+ +++ NP LF EW
Sbjct: 266 LSNQHLLCVISQLMDYVQALWGNPPATGARIITSILCNPALFGEW 310



>gb:RATGOTA_2132374 Rat mitochondrial glutamic oxaloacetic
           transaminase mRNA, partial cds.
          Length = 51

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 33/50 (66%), Positives = 40/50 (80%)
 Frame = -1

Query: 749 KNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPIHGARIVA 600
           KN+GLY ER+GA  VVC  A+ A RV+SQLK L RP+YSNPP++GARI A
Sbjct: 1   KNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAA 50



>gb:AF233353_1416529 Ovis aries aspartate aminotransferase mRNA,
           partial cds; nuclear gene for mitochondrial product.
          Length = 147

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 33/61 (54%), Positives = 44/61 (72%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLYAERIGAINVV 702
           + N   FFD+AYQGFASG  + DA +VR F  +G+ + + QSY+KN+GLY ER+GA  VV
Sbjct: 86  KNNLFAFFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVV 145

Query: 701 C 699
           C
Sbjct: 146 C 146



>gb:AF462031_1801840 Tuber borchii aspartate aminotransferase mRNA,
           partial cds.
          Length = 59

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 27/43 (62%), Positives = 31/43 (72%)
 Frame = -1

Query: 881 EKNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSY 753
           +K H PFFD AYQGFASG L  DA +VR F  +G EL VAQS+
Sbjct: 17  KKRHFPFFDCAYQGFASGDLANDAWAVRYFIEQGFELCVAQSF 59



>gb:SEN237788_182048 Salmonella enterica tyrB (partial), aphA, yjbQ,
           yjbR and uvrA (partial) genes and ORFW.
          Length = 86

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 27/82 (32%), Positives = 51/82 (62%)
 Frame = -1

Query: 554 MEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYM 375
           ++ M  RI S+RQ L   L   +   +++ ++L+Q GMFS+TGL+  Q + + +++ +Y+
Sbjct: 1   VDAMRTRIISMRQTLVKELKA-EMPDRNFDYLLQQRGMFSYTGLSAEQVDRLRDEFGVYL 59

Query: 374 TKDGRISLAGLSAAKCEYLADA 309
              GR+ +AGL+A+    +A A
Sbjct: 60  IASGRMCVAGLNASNVHRVAKA 81



>gb:AK006984_1153795 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700083M11
           product:hypothetical PLP-dependent transferases
           structure containing protein, full insert sequence.
          Length = 264

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 22/49 (44%), Positives = 30/49 (61%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFASRGLELLVAQSYSKNLGLY 732
           K   PFFD+  QG ++G L+ D   ++ F S GLE   +QS SKN G+Y
Sbjct: 206 KQIFPFFDIPCQGLSTGDLEEDTKILQYFVSLGLEFFCSQSLSKNFGIY 254



>gb:AB047807_1520667 Arabidopsis thaliana YLS4 mRNA for aspartate
           aminotransferase (ASP3), partial cds.
          Length = 106

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 21/31 (67%), Positives = 24/31 (77%)
 Frame = -1

Query: 878 KNHIPFFDVAYQGFASGSLDADASSVRMFAS 786
           K  +PFFD AYQGFASGSLD DA  +RMF +
Sbjct: 76  KGLMPFFDSAYQGFASGSLDTDAKPIRMFVA 106



>gb:AE010545_264239 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 87 of 197 of the complete
           genome.>gb:AE009951_911407 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 415

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 45/166 (27%), Positives = 70/166 (42%), Gaps = 3/166 (1%)
 Frame = -1

Query: 785 RGLELLVAQSYSKNLGLYAERIGAINVVCSSADAAARVKSQLKRLARPMYSNPPIHGARI 606
           + +  + A S SK+L +Y  RIGA   V S  +     K  L    R  +SN P  G ++
Sbjct: 247 KNILFMYAFSLSKSLSIYGMRIGAQIAVSSDEEVIQEFKDALPFSCRTTWSNIPKGGMKL 306

Query: 605 VANVVGNPEL---FNEWKQEMEMMAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFS 435
            A ++ NPEL   F + KQ    +     ++  K     +LK    K   F+   +G   
Sbjct: 307 FATIMKNPELKANFLKEKQGYMNLLNERANIFLKEAKEENLKVLPYKSGFFVTVPVGETV 366

Query: 434 FTGLNKAQSENMSNKWHIYMTKDGRISLAGLSAAKCEYLADAIIDS 297
              +   +S+N+   + I      RI L  +   K + LA  I DS
Sbjct: 367 DKIIEDLESKNI---FVIKFDTGIRIGLCSVPKRKIKGLAKKIKDS 409



>gb:PAU62582_157188 Pseudomonas aeruginosa aromatic aminotransferase
           (phhC) gene, partial cds and penicillin-binding protein
           5 (pbpG) gene, complete cds.
          Length = 85

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 27/80 (33%), Positives = 45/80 (56%)
 Frame = -1

Query: 545 MAGRIKSVRQKLYDSLSLKDKSGKDWTFILKQIGMFSFTGLNKAQSENMSNKWHIYMTKD 366
           M  RI S+R  L ++L+    + + +  +  Q GMFS+TGL+  Q   + ++  +Y+   
Sbjct: 1   MRSRIASLRIGLVEALAPHGLAER-FAHVGAQRGMFSYTGLSPQQVARLRDEHAVYLVSS 59

Query: 365 GRISLAGLSAAKCEYLADAI 306
           GR ++AGL A +   LA AI
Sbjct: 60  GRANVAGLHARRLGRLAQAI 79


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 947,586,592
Number of Sequences: 1806583
Number of extensions: 20352945
Number of successful extensions: 59299
Number of sequences better than 10.0: 268
Number of HSP's better than 10.0 without gapping: 56494
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58919
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 61510113486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)