BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7289
         (1022 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T48824|T48824 hypothetical protein 68B2.80 [imported] - Neur...    35   1.8     Neurospora crassa


>pir|T48824|T48824 hypothetical protein 68B2.80 [imported] -
           Neurospora crassa>gb:NC68B2_1688677 Neurospora crassa
           DNA linkage group V Cosmid contig 68B2.
          Length = 525

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 35/147 (23%), Positives = 64/147 (43%), Gaps = 7/147 (4%)
 Frame = -3

Query: 753 ANPMDKTSKEKKMIGTHG*LVKEDSERAE*VHRRNMFTESPCNISSRR*HNETHQSIGPA 574
           A   ++  + K+ +GT G ++ E++E       RN  +E P  +      +E  +  G  
Sbjct: 190 AREKEEKKRSKRKVGTDGIMIDEEAEALAEEQLRNYRSEKPARVGGINVASEASEWDGST 249

Query: 573 TAYYSLIYTTT----TAYTREINFCSQEKYLQGRSFAQCSEGPNLNKFVSVR*MGKKDRR 406
              +S + T+T    +  T E+    QEK  +  S  +  E     K        +++RR
Sbjct: 250 NPSWSGVGTSTVDSGSTVTSEL-IKHQEKRERSPSKKERDEERAARKEAE-----RRERR 303

Query: 405 EVK*TVKQRSREL---LNEERSKETKR 334
           E +   ++R REL    N ER +E ++
Sbjct: 304 EQRERERERDRELGRDRNPEREREKEK 330


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 954,020,102
Number of Sequences: 1806583
Number of extensions: 18430945
Number of successful extensions: 37883
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 36497
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37869
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 76560446500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)