BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7199
         (1064 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AE005172_889733 Arabidopsis thaliana chromosome 1, top arm co...   153   6e-36   
gb:AP003279_1827125 Oryza sativa (japonica cultivar-group) genom...   150   5e-35   
gb:AP006162_1861129 Oryza sativa (japonica cultivar-group) genom...   127   4e-28   
gb:AP004587_1841952 Oryza sativa (japonica cultivar-group) genom...   127   5e-28   
gb:BT020351_1642746 Arabidopsis thaliana At5g23950 gene, complet...   115   1e-24   
gb:AB005244_1509568 Arabidopsis thaliana genomic DNA, chromosome...   115   1e-24   
gb:AY088839_1573848 Arabidopsis thaliana clone 96748 mRNA, compl...    69   2e-10   
gb:ATAC016829_1543633 Arabidopsis thaliana chromosome III BAC T6...    67   5e-10   
pir|A84507|A84507 hypothetical protein At2g13350 [imported] - Ar...    64   4e-09   Arabidopsis thaliana [mouse-ear cress]
pir|G85015|G85015 hypothetical protein AT4g01200 [imported] - Ar...    61   3e-08   Arabidopsis thaliana [mouse-ear cress]
pir|A84744|A84744 hypothetical protein At2g33320 [imported] - Ar...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
pir|H86177|H86177 hypothetical protein [imported] - Arabidopsis ...    54   7e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP003291_1827418 Oryza sativa (japonica cultivar-group) genom...    53   1e-05   
gb:AP004120_1837887 Oryza sativa (japonica cultivar-group) genom...    49   2e-04   
gb:AP003255_1826431 Oryza sativa (japonica cultivar-group) genom...    49   2e-04   
pir|T51602|T51602 shock protein SRC2 homolog [imported] - Arabid...    47   5e-04   Arabidopsis thaliana [mouse-ear cress]
pir|G86222|G86222 hypothetical protein [imported] - Arabidopsis ...    47   5e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AX380795_1466737 Sequence 10 from Patent WO0200697.                 47   9e-04   
pir|T00746|T00746 hypothetical protein At2g40820 [imported] - Ar...    47   9e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T02471|T02471 hypothetical protein At2g45760 [imported] - Ar...    47   9e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY262052_1593666 Arabidopsis thaliana hypothetical protein At...    46   0.001   
pir|T07080|T07080 shock protein SRC2 - soybean>gb:AB000130_15082...    42   0.027   Glycine max [soybeans]
gb:AP004305_1839913 Oryza sativa (japonica cultivar-group) genom...    39   0.18    
gb:SRCPKCSR_1398059 S.raphanus mRNA for serine/threonine protein...    39   0.18    
pir|C24664|KIBOGC protein kinase C (EC 2.7.1.-) gamma - bovine (...    37   0.68    
sp|P10829|KPCG_RABIT|KPCG_RABIT Protein kinase C, gamma type (EC 2.7.1.37) ...    37   0.68    Oryctolagus cuniculus [domestic rabbit]
sp|P05128|KPCG_BOVIN|KPCG_BOVIN Protein kinase C, gamma type (EC 2.7.1.37) ...    37   0.68    Bos taurus [bovine]
gb:HUMPKG_2035687 Human (clone lambda-hPKC-gamma6) protein kinas...    37   0.88    
gb:HSPKCG_2019590 H.sapiens mRNA for protein kinase C gamma (par...    37   0.88    
sp|P05697|KPCG_MOUSE|KPCG_MOUSE Protein kinase C, gamma type (EC 2.7.1.37) ...    37   0.88    Mus musculus [mouse]
sp|P05129|KPCG_HUMAN|KPCG_HUMAN Protein kinase C, gamma type (EC 2.7.1.37) ...    37   0.88    Homo sapiens [man]
gb:AP005465_1852324 Oryza sativa (japonica cultivar-group) genom...    36   1.2     
gb:AE017343_1755554 Cryptococcus neoformans var. neoformans JEC2...    36   1.2     
gb:BT001293_1356066 Drosophila melanogaster AT10318 full insert ...    36   1.2     
gb:AE014297_1141688 Drosophila melanogaster chromosome 3R, compl...    36   1.2     
gb:CR380956_1652358 Candida glabrata strain CBS138 chromosome J ...    35   2.0     
gb:AK173131_2070065 Mus musculus mRNA for mKIAA1207 protein.           35   2.6     
gb:CR382135_1668207 Debaryomyces hansenii chromosome C of strain...    35   2.6     
gb:CVA005377_1375979 Calliphora vicina cDNA encoding for eye-spe...    35   2.6     
gb:AK087302_1174891 Mus musculus 0 day neonate lung cDNA, RIKEN ...    35   2.6     
gb:AK087176_1174871 Mus musculus 0 day neonate lung cDNA, RIKEN ...    35   2.6     
gb:AK086107_1174662 Mus musculus 15 days embryo head cDNA, RIKEN...    35   2.6     
gb:AK031666_1162543 Mus musculus 13 days embryo male testis cDNA...    35   2.6     
pir|T06657|T06657 hypothetical protein T6G15.100 - Arabidopsis t...    35   2.6     Arabidopsis thaliana [mouse-ear cress]
gb:AF081347_2190825 Echovirus 34 strain DN-19 capsid protein VP1...    35   3.4     
gb:AF544228_1810453 Gossypium hirsutum phospholipase D delta iso...    35   3.4     
gb:AY138251_1582280 Gossypium hirsutum phospholipase D delta iso...    35   3.4     
gb:TRU459419_2580966 Takifugu rubripes cacng5 gene, prkca gene a...    34   5.7     
gb:AY876913_2392682 Human enterovirus Hangzhou13-02, complete ge...    34   5.7     
gb:AY876912_2392681 Human enterovirus Ningbo3-02, complete genome.     34   5.7     
gb:CR382131_1664609 Yarrowia lipolytica chromosome E of strain C...    34   5.7     
gb:AY237652_1592191 Yarrowia lipolytica putative actin-interacti...    34   5.7     
gb:BA000040_728598 Bradyrhizobium japonicum USDA 110 DNA, comple...    34   5.7     
pir|T30332|T30332 avirulence protein - Pseudomonas syringae>gb:P...    34   5.7     Pseudomonas syringae
gb:BT011755_1641277 Arabidopsis thaliana At3g47220 gene, complet...    33   7.5     
pir|T45658|T45658 1-phosphatidylinositol-4,5-bisphosphate phosph...    33   7.5     Arabidopsis thaliana [mouse-ear cress]
gb:BC065530_1986865 Homo sapiens methyl-CpG binding domain prote...    33   9.8     
gb:AK093078_1913861 Homo sapiens cDNA FLJ35759 fis, clone TESTI2...    33   9.8     
gb:AK056399_1911727 Homo sapiens cDNA FLJ31837 fis, clone NT2RP7...    33   9.8     
gb:AB067474_1870782 Homo sapiens mRNA for KIAA1887 protein, part...    33   9.8     
gb:AB024031_1515751 Arabidopsis thaliana genomic DNA, chromosome...    33   9.8     
sp|Q96DN6|MBD6_HUMAN|MBD6_HUMAN Methyl-CpG binding domain protein 6.              33   9.8     Homo sapiens [man]


>gb:AE005172_889733 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC022464_1539026 Genomic sequence
           for Arabidopsis thaliana BAC F22G5 from chromosome I,
           complete sequence.>gb:AY054646_1563300 Arabidopsis
           thaliana similar to SRC2 (At1g07310; F22G5.35) mRNA,
           complete cds.>gb:AY081489_1568749 Arabidopsis thaliana
           similar to SRC2 dbj|BAA19769 (At1g07310) mRNA, complete
           cds.
          Length = 352

 Score =  153 bits (386), Expect = 6e-36
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 2/129 (1%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL 256
           D+ VTVVSAKHLKNVNWR+GDLKPYV+L++D D  L+T+SDDS S KPVWNER  +PLT 
Sbjct: 8   DLVVTVVSAKHLKNVNWRNGDLKPYVVLYLDQDHPLSTRSDDSSSIKPVWNERITLPLTR 67

Query: 257 PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ--LKAFQLRRPSGRPQG 430
              ES+L +E+FHS  S+  K LVG++R PL  L+   G      + + +L RPSGRPQG
Sbjct: 68  SVHESVLNIEVFHSNSSDLAKTLVGSVRFPLARLIDSDGSMIPELINSLELVRPSGRPQG 127

Query: 431 KIRLKIAVR 457
           KIRLK+A++
Sbjct: 128 KIRLKLAIK 136



>gb:AP003279_1827125 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0529E05.
          Length = 327

 Score =  150 bits (378), Expect = 5e-35
 Identities = 75/146 (51%), Positives = 102/146 (69%), Gaps = 13/146 (8%)
 Frame = +2

Query: 62  PAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFV 241
           P K+ D++VTVVS KHLKNVNWR GDL+ YV+ ++DP RR AT+ DD G  KP WNER V
Sbjct: 44  PLKAIDLEVTVVSGKHLKNVNWRRGDLRAYVVAYLDPSRRAATRPDDVGGCKPAWNERVV 103

Query: 242 VPLTLPPQES------LLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDS-------GDST 382
           +P  LPP  S      LL++++FHS PS++PKPLVG+ R PL+DL+  +         ++
Sbjct: 104 LP--LPPHLSPHDPSLLLSLDVFHSKPSDSPKPLVGSARSPLRDLLFSTNPNPSPDSPAS 161

Query: 383 QLKAFQLRRPSGRPQGKIRLKIAVRK 460
            L    L RPSGRPQGK+R+++A+R+
Sbjct: 162 ALITLPLLRPSGRPQGKLRIRLALRE 187



>gb:AP006162_1861129 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1331F11.
          Length = 290

 Score =  127 bits (319), Expect = 4e-28
 Identities = 66/185 (35%), Positives = 107/185 (57%), Gaps = 17/185 (9%)
 Frame = +2

Query: 65  AKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV 244
           A  Y+V+VTV SA+ LKNVNWR+GDLKPY ++WID   + +T+ D   +  P W+++  V
Sbjct: 3   ASRYEVEVTVASARDLKNVNWRNGDLKPYAVVWIDDGAKCSTRVDLDNADNPTWDDKLTV 62

Query: 245 PLTLPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRR 409
           P  LPP     +++L +++ H+  ++  KPLVG+ R+PL+D++ D+G   +  ++ +L+R
Sbjct: 63  P--LPPSTRLDDAVLYLDVVHANATDGVKPLVGSARLPLRDVLADTGIGARASRSLRLKR 120

Query: 410 PSGRPQGKIRLKIAVRKIQEY------------QIXXXXXXXXXXXXXXXXTRDYGAYNP 553
           PSGRP G++ +++AVR+ + Y            Q                    YG   P
Sbjct: 121 PSGRPHGRLEVRVAVREPKRYYDPSPAYPAPYHQQSSRDPYAYGNTTTGGYGYAYGGAPP 180

Query: 554 APYSS 568
           APYS+
Sbjct: 181 APYSA 185



>gb:AP004587_1841952 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0543D10.
          Length = 291

 Score =  127 bits (318), Expect = 5e-28
 Identities = 60/138 (43%), Positives = 98/138 (71%), Gaps = 5/138 (3%)
 Frame = +2

Query: 74  YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT 253
           Y+V+VTV SA+ LKNVNWR+GDLKPY +LW+D   + +T+ D   +  P W+++  +P  
Sbjct: 5   YEVEVTVSSARDLKNVNWRNGDLKPYAVLWVDDGAKCSTRVDLDNADNPNWDDKLTLP-- 62

Query: 254 LPP----QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQL-KAFQLRRPSG 418
           LPP     ++LL +++ H+  +E  KPLVG+ R+PL+D++ D+G   ++ ++ +L+RPSG
Sbjct: 63  LPPSSRLDDALLYLDVVHANAAEGVKPLVGSARLPLRDVLDDAGVGARVSRSLRLKRPSG 122

Query: 419 RPQGKIRLKIAVRKIQEY 472
           RPQG++ L++AVR+   Y
Sbjct: 123 RPQGRLDLRLAVRESARY 140



>gb:BT020351_1642746 Arabidopsis thaliana At5g23950 gene, complete
           cds.
          Length = 219

 Score =  115 bits (289), Expect = 1e-24
 Identities = 56/132 (42%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL 256
           +V+VT+ SAK +KNVNWR+G  KPY ++WIDP  + +T+ D+ G+T   WNE FV+   L
Sbjct: 7   EVEVTISSAKDIKNVNWRNGPNKPYAVVWIDPKFKSSTRVDEDGNTCTTWNETFVI--AL 64

Query: 257 PP---QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPSGRP 424
           PP    +  + + I H+   E  KPL+G+  + L+D++ D G     +K  +L+RPSGRP
Sbjct: 65  PPANDDDDKVYINIVHAGREENTKPLIGSAHLSLRDVIDDVGFGVPFMKTLKLKRPSGRP 124

Query: 425 QGKIRLKIAVRK 460
           QGK+ + + VR+
Sbjct: 125 QGKLDVTVTVRE 136



>gb:AB005244_1509568 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRO11.
          Length = 235

 Score =  115 bits (289), Expect = 1e-24
 Identities = 56/132 (42%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTL 256
           +V+VT+ SAK +KNVNWR+G  KPY ++WIDP  + +T+ D+ G+T   WNE FV+   L
Sbjct: 23  EVEVTISSAKDIKNVNWRNGPNKPYAVVWIDPKFKSSTRVDEDGNTCTTWNETFVI--AL 80

Query: 257 PP---QESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQ-LKAFQLRRPSGRP 424
           PP    +  + + I H+   E  KPL+G+  + L+D++ D G     +K  +L+RPSGRP
Sbjct: 81  PPANDDDDKVYINIVHAGREENTKPLIGSAHLSLRDVIDDVGFGVPFMKTLKLKRPSGRP 140

Query: 425 QGKIRLKIAVRK 460
           QGK+ + + VR+
Sbjct: 141 QGKLDVTVTVRE 152



>gb:AY088839_1573848 Arabidopsis thaliana clone 96748 mRNA, complete
           sequence.
          Length = 391

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/142 (33%), Positives = 77/142 (54%), Gaps = 17/142 (11%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPLT 253
           +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D S    P+WNE+FV  + 
Sbjct: 11  LEINLISAQDLAPVS---RNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVN 67

Query: 254 ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV---------DSG---DSTQL 388
              L    S + +EI+ +  ++    LVGT+ + L DL           D G   ++ +L
Sbjct: 68  DKILDVDASAIVIEIYAAAWAK--DALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRL 125

Query: 389 KAFQLRRPSGRPQGKIRLKIAV 454
              Q+RRPSGR QG +RL IA+
Sbjct: 126 VTLQIRRPSGRLQGFLRLGIAL 147



>gb:ATAC016829_1543633 Arabidopsis thaliana chromosome III BAC T6K12
           genomic sequence, complete sequence.
          Length = 353

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/142 (33%), Positives = 77/142 (54%), Gaps = 17/142 (11%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWI--DPDRRLATKSDDSGSTKPVWNERFVVPLT 253
           +++ ++SA+ L  V+    ++K Y + WI  DP R+L T+ D S    P+WNE+FV  + 
Sbjct: 11  LEINLISAQDLAPVS---RNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVN 67

Query: 254 ---LPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV---------DSG---DSTQL 388
              L    S + +EI+ +  ++    LVGT+ + L DL           D G   ++ +L
Sbjct: 68  DKILYVDASAIVIEIYAAAWAK--DALVGTVNVLLSDLFAPWSGFGDGNDGGGGNNNMRL 125

Query: 389 KAFQLRRPSGRPQGKIRLKIAV 454
              Q+RRPSGR QG +RL +A+
Sbjct: 126 VTLQIRRPSGRLQGFLRLGVAL 147



>pir|A84507|A84507 hypothetical protein At2g13350 [imported] -
           Arabidopsis thaliana>gb:AC006446_1534308 Arabidopsis
           thaliana chromosome 2 clone F15O11 map PRI, complete
           sequence.>gb:AC007209_1535562 Arabidopsis thaliana
           chromosome 2 clone F14O4 map PR1, complete
           sequence.>gb:BT005348_1638288 Arabidopsis thaliana
           At2g13350 mRNA, complete cds.>gb:AK118570_1816539
           Arabidopsis thaliana At2g13350 mRNA for unknown protein,
           complete cds, clone: RAFL19-80-F03.
          Length = 401

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 4/129 (3%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPL--- 250
           +++ ++SA+ L  V      +K Y I WIDP+R+L T+ D++G T P WN++FV  L   
Sbjct: 10  LELNIISAQELAPVA---RCMKTYAIAWIDPERKLTTRVDNTGGTSPTWNDKFVFRLDEE 66

Query: 251 TLPPQESLLAVEIFHSVPSETPKPL-VGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQ 427
            L    S++ +EI+        K + VGT++  + DLV  S  + +    ++ R SGRP 
Sbjct: 67  ALYDATSIVVIEIY---ALHWFKDIHVGTVQALISDLVSPS-SAMRFVTLEVLRASGRPH 122

Query: 428 GKIRLKIAV 454
           G + + + +
Sbjct: 123 GLLNIAVGL 131



>pir|G85015|G85015 hypothetical protein AT4g01200 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV3_1544806 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           3.>gb:AY080883_1568566 Arabidopsis thaliana unknown
           protein (At4g01200) mRNA, complete
           cds.>gb:AY114050_1578461 Arabidopsis thaliana unknown
           protein (At4g01200) mRNA, complete cds.
          Length = 250

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/134 (28%), Positives = 68/134 (50%), Gaps = 4/134 (2%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVV---PL 250
           +++ ++SA+ LK    +   L+ Y  +W+D   +L T+ D  GS  P+WN++FV    P 
Sbjct: 7   LEINLISAQGLKEPTGKLRRLQTYASVWVDSSSKLRTRIDRIGSENPIWNDKFVFQVSPE 66

Query: 251 TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDST-QLKAFQLRRPSGRPQ 427
            L  + S +++EI+          L+GT+R  + + +  +      L A Q+RRPSG+  
Sbjct: 67  FLSSETSGVSIEIY--AVGYLRDHLIGTVRFLVSNFLPTAAVKVPSLVALQIRRPSGKFH 124

Query: 428 GKIRLKIAVRKIQE 469
           G + +   V    E
Sbjct: 125 GVLNIAAMVMDASE 138



>pir|A84744|A84744 hypothetical protein At2g33320 [imported] -
           Arabidopsis thaliana>gb:AC002332_1530304 Arabidopsis
           thaliana chromosome 2 clone F4P9 map ve015, complete
           sequence.
          Length = 602

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 40/141 (28%), Positives = 70/141 (49%), Gaps = 16/141 (11%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT-- 253
           +++ ++SA+ L  V+ +   +K Y + W+  +R+L T+ D +G   P WN++FV  ++  
Sbjct: 10  LELNIISAQDLAPVSRK---MKTYAVAWVHSERKLTTRVDYTGGGNPTWNDKFVFRVSED 66

Query: 254 -LPPQESLLAVEI-----FHSVPSETPKPLVGTLRIPLKDLVVDSGD--------STQLK 391
            L    S + VEI     F  V   T + L+  L  P +     S +          +  
Sbjct: 67  FLYADTSAVVVEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRSNEEYRRTPPPGMRFV 126

Query: 392 AFQLRRPSGRPQGKIRLKIAV 454
           A Q+RRPSGRPQG + + + +
Sbjct: 127 ALQVRRPSGRPQGILNIGVGI 147



>pir|H86177|H86177 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889474 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T1G11_1723600 Sequence of BAC T1G11 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 578

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 38/142 (26%), Positives = 68/142 (47%), Gaps = 17/142 (11%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLT-- 253
           +++ ++SA+ L  V  +    K Y + W+  +R+L T+ D +G T P WN++FV  +   
Sbjct: 8   LELNIISAQDLAPVARK---TKTYAVAWVHSERKLTTRVDYNGGTNPTWNDKFVFRVNEE 64

Query: 254 -LPPQESLLAVEI-----FHSVPSETPKPLVGTLRIPLKDLVVDSGDS---------TQL 388
            L    S + +EI     F  V   T + L+  L  P +     + ++          + 
Sbjct: 65  FLYADTSAVVIEIYALHWFRDVHVGTVRVLISNLIPPNRRPGYRTSNNEYRRTPPPGMRF 124

Query: 389 KAFQLRRPSGRPQGKIRLKIAV 454
            A Q+RR SGRPQG + + + +
Sbjct: 125 VALQVRRTSGRPQGILNIGVGL 146



>gb:AP003291_1827418 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0684E06.>gb:AP004364_1840788 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0445H04.
          Length = 296

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 46/142 (32%), Positives = 69/142 (48%), Gaps = 10/142 (7%)
 Frame = +2

Query: 47  AGARPPAKSYDVDVTVVSAKHLKNVNW-RHGDLKPYVILWIDPDRRLATKSDDSGSTKPV 223
           AG   P     ++VT++SA+ LK  +  R   L+ Y + W+D  RRL T+ D +G   P 
Sbjct: 10  AGLALPEGERILEVTLISAQGLKPPSGLRRRLLQAYAVAWVDAARRLQTRPDRAGGVDPE 69

Query: 224 WNER--FVVPLTLPPQESLLAVEI-FHSVPSE----TPKPLVGTLRIPLKD--LVVDSGD 376
           W+ER  F V       +S  AV +  ++ P+         LVG+ R  L D  L+     
Sbjct: 70  WHERLLFRVHEAALADDSRAAVTVEIYAAPAGGWHIGGDSLVGSARFLLGDHGLLSRPVG 129

Query: 377 STQLKAFQLRRPSGRPQGKIRL 442
           S  + A  +RRPSGR  G + +
Sbjct: 130 SPSMFAVGVRRPSGRVHGLLNV 151



>gb:AP004120_1837887 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1293_E04.
          Length = 285

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 43/139 (30%), Positives = 65/139 (46%), Gaps = 14/139 (10%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLP 259
           ++VTV+SA+ L     R      Y + W D   +L T  D +G   P WN+RF+  +   
Sbjct: 30  LEVTVISAQDLHRRLGRRVRAA-YAVAWADAAHKLRTGVDLAGGADPTWNDRFLFRV--- 85

Query: 260 PQESLLAVEIFHSVPSETPKP-------LVGTLRIPLKDLVVDSGDST------QLKAFQ 400
            +E+ L  +   +V  E   P       ++G  RI +   V  +  S       Q+ A Q
Sbjct: 86  -EEAFLRSDT-AAVTVEVRAPRRFGGDAVLGVTRIVVSTFVGSASSSARGTTGRQVAALQ 143

Query: 401 LRRP-SGRPQGKIRLKIAV 454
           LRRP S RPQG + + +AV
Sbjct: 144 LRRPRSLRPQGIVNVAVAV 162



>gb:AP003255_1826431 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0454H12.
          Length = 310

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 13/140 (9%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKP--YVILWIDPDRRLATKSDDSGSTKPVWNERFVVPL- 250
           V+  ++SA+ L     R   L P  + + WIDP+ +  TK D SG++   W  +F + + 
Sbjct: 6   VEFCIISARGLGR---RSTLLNPQWFSVAWIDPNSKYCTKIDASGNSDVNWGTKFSLSVD 62

Query: 251 --TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-------VDSGDSTQLKAFQL 403
              +  Q+  L VE++   P    + L GT  I +K+           SG + +  +FQL
Sbjct: 63  EHDMSMQQMELTVEVYRREPVFLREHLQGTAVIQMKEYFDKFSQGKDPSGVTEETSSFQL 122

Query: 404 RR-PSGRPQGKIRLKIAVRK 460
           RR  S +P G + + I + K
Sbjct: 123 RRKKSDKPHGFVDISIRICK 142



>pir|T51602|T51602 shock protein SRC2 homolog [imported] -
           Arabidopsis thaliana>gb:ATH7586_1552950 Arabidopsis
           thaliana mRNA for src2-like protein.
          Length = 324

 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 6/126 (4%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLA--TKSDDSGSTKPVWNERFVVPL- 250
           +D+T++SA+ LK+V    G    Y ++ I+ D R    TK D    TKP W  +  + + 
Sbjct: 6   LDLTIISAEDLKDVQLI-GKQDLYAVVSINGDARTKQKTKVDKDCGTKPKWKHQMKLTVD 64

Query: 251 --TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-VDSGDSTQLKAFQLRRPSGR 421
                     L  EI    P    KP VG + +P+K+L+  + GD  +   + +R P+G+
Sbjct: 65  DAAARDNRLTLVFEIVADRPIAGDKP-VGEVSVPVKELLDQNKGDEEKTVTYAVRLPNGK 123

Query: 422 PQGKIR 439
            +G ++
Sbjct: 124 AKGSLK 129



>pir|G86222|G86222 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889910 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY045580_1561171 Arabidopsis thaliana
           At1g09070/F7G19_6 mRNA, complete
           cds.>gb:AY142027_1582864 Arabidopsis thaliana
           At1g09070/F7G19_6 mRNA, complete cds.>gb:F7G19_1678544
           Sequence of BAC F7G19 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 324

 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 6/126 (4%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLA--TKSDDSGSTKPVWNERFVVPL- 250
           +D+T++SA+ LK+V    G    Y ++ I+ D R    TK D    TKP W  +  + + 
Sbjct: 6   LDLTIISAEDLKDVQLI-GKQDLYAVVSINGDARTKQKTKVDKDCGTKPKWKHQMKLTVD 64

Query: 251 --TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV-VDSGDSTQLKAFQLRRPSGR 421
                     L  EI    P    KP VG + +P+K+L+  + GD  +   + +R P+G+
Sbjct: 65  DAAARDNRLTLVFEIVADRPIAGDKP-VGEVSVPVKELLDQNKGDEEKTVTYAVRLPNGK 123

Query: 422 PQGKIR 439
            +G ++
Sbjct: 124 AKGSLK 129



>gb:AX380795_1466737 Sequence 10 from Patent WO0200697.
          Length = 207

 Score = 46.6 bits (109), Expect = 9e-04
 Identities = 31/128 (24%), Positives = 65/128 (50%), Gaps = 2/128 (1%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLP 259
           +++ V+SA+ LK V+ +    K Y ++ ID ++  A+K D+ G + P+W +RF + + + 
Sbjct: 10  LEIEVISAEGLK-VDRKPLKKKTYSVVRID-EKSWASKVDELGGSYPIWKDRFDMEMPIN 67

Query: 260 PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRPQGK 433
                +++E+++          VG  +IP+ D +        L   +++LR   G   G 
Sbjct: 68  ASVRFISIEVYYRTSGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGDKCGI 127

Query: 434 IRLKIAVR 457
           + + I V+
Sbjct: 128 VNVSIMVK 135



>pir|T00746|T00746 hypothetical protein At2g40820 [imported] -
           Arabidopsis thaliana>gb:AC002409_1530700 Arabidopsis
           thaliana chromosome 2 clone T20B5 map CIC11C08, complete
           sequence.
          Length = 945

 Score = 46.6 bits (109), Expect = 9e-04
 Identities = 38/145 (26%), Positives = 69/145 (47%), Gaps = 15/145 (10%)
 Frame = +2

Query: 80  VDVTVVSAKHLK-NVNWRHGDLKP--YVILWIDPDRRLATKSDDSGSTKPVWNERFVVPL 250
           V++ ++SA+ L+  +      LK   Y + W+DP+ +  T  D S +  PVW  +F   L
Sbjct: 519 VEICMISARGLRVGIGIGSSLLKHQWYAVGWLDPEDKYCTTIDASRADNPVWRTKFATLL 578

Query: 251 ---TLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVV-----DSGDSTQLK---AF 397
              T+   +  L VE++   P    K L G+  + LK+ +       S     ++   ++
Sbjct: 579 DDSTIQDSKLALQVEVYSREPLFLRKRLHGSATVSLKEFLTKYKQQQSSSKAVIEETGSY 638

Query: 398 QLRRP-SGRPQGKIRLKIAVRKIQE 469
           QLR+  S +PQG + + I +   +E
Sbjct: 639 QLRKTNSSKPQGFVDVSIRISAERE 663



>pir|T02471|T02471 hypothetical protein At2g45760 [imported] -
           Arabidopsis thaliana>gb:AC004665_1531941 Arabidopsis
           thaliana chromosome 2 clone F4I18 map CIC02E07, complete
           sequence.
          Length = 279

 Score = 46.6 bits (109), Expect = 9e-04
 Identities = 31/128 (24%), Positives = 65/128 (50%), Gaps = 2/128 (1%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLP 259
           +++ V+SA+ LK V+ +    K Y ++ ID ++  A+K D+ G + P+W +RF + + + 
Sbjct: 10  LEIEVISAEGLK-VDRKPLKKKTYSVVRID-EKSWASKVDELGGSYPIWKDRFDMEMPIN 67

Query: 260 PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRPQGK 433
                +++E+++          VG  +IP+ D +        L   +++LR   G   G 
Sbjct: 68  ASVRFISIEVYYRTSGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGDKCGI 127

Query: 434 IRLKIAVR 457
           + + I V+
Sbjct: 128 VNVSIMVK 135



>gb:AY262052_1593666 Arabidopsis thaliana hypothetical protein
           At2g45760 mRNA, complete cds.
          Length = 207

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 31/128 (24%), Positives = 64/128 (50%), Gaps = 2/128 (1%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLP 259
           +++ V+SA+ LK V+ +    K Y +  ID ++  A+K D+ G + P+W +RF + + + 
Sbjct: 10  LEIEVISAEGLK-VDRKPLKKKTYSVXRID-EKSWASKVDELGGSYPIWKDRFDMEMPIN 67

Query: 260 PQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSGRPQGK 433
                +++E+++          VG  +IP+ D +        L   +++LR   G   G 
Sbjct: 68  ASVRFISIEVYYRTSGSGRDKNVGYAKIPVTDFMGGFAPQGHLNFLSYRLRDEYGDKCGI 127

Query: 434 IRLKIAVR 457
           + + I V+
Sbjct: 128 VNVSIMVK 135



>pir|T07080|T07080 shock protein SRC2 - soybean>gb:AB000130_1508294
           Soybean mRNA for SRC2, complete cds.
          Length = 290

 Score = 41.6 bits (96), Expect = 0.027
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 7/126 (5%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVN-WRHGDLKPYVILWIDP--DRRLATKSDDSGSTKPVWNE--RFVV 244
           +++ ++SAK +KNVN +   D+   V L  DP   +   T       + P WN   +F V
Sbjct: 8   LELNIISAKDIKNVNLFSKMDVYAAVSLSGDPLHPQGATTHVHKDAGSNPTWNYPVKFSV 67

Query: 245 PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLK--AFQLRRPSG 418
             +L  +E+ L++EI           ++GT+ +PL++L+ + GD +  +  ++Q+ + S 
Sbjct: 68  NESLA-KENRLSLEIKLISDRTLGDTVIGTVHVPLRELLDNPGDDSSFRQVSYQVMKQSR 126

Query: 419 RPQGKI 436
           + +G +
Sbjct: 127 KSKGSL 132



>gb:AP004305_1839913 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0492E07.
          Length = 515

 Score = 38.9 bits (89), Expect = 0.18
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 5/126 (3%)
 Frame = +2

Query: 86  VTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQ 265
           VTVV A  LKN     G   PYVIL++ P  ++ TK  D  +  P WNE F  PL +  +
Sbjct: 266 VTVVKATSLKNKELI-GKSDPYVILYVRPMFKVKTKVIDD-NLNPEWNETF--PLIVEDK 321

Query: 266 ESLLAV-EIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQ----LRRPSGRPQG 430
           E+   + E++     +  K L G  ++ +  L  ++     LK  Q    L+    + +G
Sbjct: 322 ETQSVIFEVYDEDRLQQDKKL-GVAKLAVNSLQPEATSEITLKLQQSLDSLKIKDTKDRG 380

Query: 431 KIRLKI 448
            + L++
Sbjct: 381 TLHLQV 386



>gb:SRCPKCSR_1398059 S.raphanus mRNA for serine/threonine protein
           kinase (CPKCSR).
          Length = 756

 Score = 38.9 bits (89), Expect = 0.18
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 3/74 (4%)
 Frame = +2

Query: 80  VDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTK---PVWNERFVVPL 250
           ++V V  AK+L  ++  +G   PYV LW+  D + ATK       K   PVW E+F   L
Sbjct: 183 LEVVVKEAKNLPPMD-ANGLADPYVKLWLSDDPQKATKKKTETKMKTLNPVWGEKFSFNL 241

Query: 251 TLPPQESLLAVEIF 292
           T    +  L +E++
Sbjct: 242 TQGDLKRSLIIEVW 255



>pir|C24664|KIBOGC protein kinase C (EC 2.7.1.-) gamma - bovine
           (fragment)
          Length = 682

 Score = 37.0 bits (84), Expect = 0.68
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +2

Query: 71  SYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFV 241
           S ++ VTV  A++L  ++  +G   PYV L + PD R  TK        +  PVWNE FV
Sbjct: 155 SDEIHVTVGEARNLIPMD-PNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFV 213

Query: 242 VPLTLPPQESLLAVEIF 292
             L     E  L+VE++
Sbjct: 214 FNLKPGDVERRLSVEVW 230



>sp|P10829|KPCG_RABIT Protein kinase C, gamma type (EC 2.7.1.37)
           (PKC-gamma) (PKC-delta).>pir|A28708|KIRBGC protein
           kinase C (EC 2.7.1.-) gamma - rabbit>gb:RABPKC_1444069
           Rabbit protein kinase delta (PKC) mRNA, complete cds.
          Length = 697

 Score = 37.0 bits (84), Expect = 0.68
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +2

Query: 71  SYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFV 241
           S ++ VTV  A++L  ++  +G   PYV L + PD R  TK        +  PVWNE FV
Sbjct: 170 SDEIHVTVGEARNLIPMD-PNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFV 228

Query: 242 VPLTLPPQESLLAVEIF 292
             L     E  L+VE++
Sbjct: 229 FNLKPGDVERRLSVEVW 245



>sp|P05128|KPCG_BOVIN Protein kinase C, gamma type (EC 2.7.1.37)
           (PKC-gamma) (Fragment).>gb:BOVPKG_1435747 Bovine gamma
           type protein kinase C mRNA.
          Length = 682

 Score = 37.0 bits (84), Expect = 0.68
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +2

Query: 71  SYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFV 241
           S ++ VTV  A++L  ++  +G   PYV L + PD R  TK        +  PVWNE FV
Sbjct: 155 SDEIHVTVGEARNLIPMD-PNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFV 213

Query: 242 VPLTLPPQESLLAVEIF 292
             L     E  L+VE++
Sbjct: 214 FNLKPGDVERRLSVEVW 230



>gb:HUMPKG_2035687 Human (clone lambda-hPKC-gamma6) protein kinase
           C-gamma (PRKCG) mRNA, 5' end cds.
          Length = 317

 Score = 36.6 bits (83), Expect = 0.88
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFVVP 247
           ++ VTV  A++L  ++  +G   PYV L + PD R  TK        +  PVWNE FV  
Sbjct: 172 EIHVTVGEARNLIPMD-PNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFN 230

Query: 248 LTLPPQESLLAVEIF 292
           L     E  L+VE++
Sbjct: 231 LKPGDVERRLSVEVW 245



>gb:HSPKCG_2019590 H.sapiens mRNA for protein kinase C gamma
           (partial).
          Length = 536

 Score = 36.6 bits (83), Expect = 0.88
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFVVP 247
           ++ VTV  A++L  ++  +G   PYV L + PD R  TK        +  PVWNE FV  
Sbjct: 11  EIHVTVGEARNLIPMD-PNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFN 69

Query: 248 LTLPPQESLLAVEIF 292
           L     E  L+VE++
Sbjct: 70  LKPGDVERRLSVEVW 84



>sp|P05697|KPCG_MOUSE Protein kinase C, gamma type (EC 2.7.1.37)
           (PKC-gamma).>pir|A05105|KIRTGC protein kinase C (EC
           2.7.1.-) gamma - rat>pir|JN0548|JN0548 protein kinase C
           (EC 2.7.1.-) gamma - mouse>gb:BC089226_2110757 Rattus
           norvegicus protein kinase C, gamma, mRNA (cDNA clone
           MGC:105487 IMAGE:7319243), complete
           cds.>gb:MMPKCGMR_2116983 M.musculus mRNA for protein
           kinase C gamma.>gb:MUSPKCGA_2129657 Mouse protein kinase
           C-gamma mRNA, complete cds.>gb:RATPKCI_2133449 Rat
           protein kinase C type I mRNA, clone
           PKC-I.>gb:RNPKCG_2136218 Rat mRNA for protein kinase C
           gamma.
          Length = 697

 Score = 36.6 bits (83), Expect = 0.88
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +2

Query: 71  SYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDS---GSTKPVWNERFV 241
           S ++ +TV  A++L  ++  +G   PYV L + PD R  TK        +  PVWNE FV
Sbjct: 170 SDEIHITVGEARNLIPMD-PNGLSDPYVKLKLIPDPRNLTKQKTKTVKATLNPVWNETFV 228

Query: 242 VPLTLPPQESLLAVEIF 292
             L     E  L+VE++
Sbjct: 229 FNLKPGDVERRLSVEVW 245



>sp|P05129|KPCG_HUMAN Protein kinase C, gamma type (EC 2.7.1.37)
           (PKC-gamma).>pir|D24664|D24664 protein kinase C (EC
           2.7.1.-) gamma - human>gb:AF345987_1897737 Homo sapiens
           protein kinase C gamma (PKCG) mRNA, complete
           cds.>gb:BC047876_1984034 Homo sapiens protein kinase C,
           gamma, mRNA (cDNA clone MGC:57564 IMAGE:5764695),
           complete cds.
          Length = 697

 Score = 36.6 bits (83), Expect = 0.88
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFVVP 247
           ++ VTV  A++L  ++  +G   PYV L + PD R  TK        +  PVWNE FV  
Sbjct: 172 EIHVTVGEARNLIPMD-PNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFN 230

Query: 248 LTLPPQESLLAVEIF 292
           L     E  L+VE++
Sbjct: 231 LKPGDVERRLSVEVW 245



>gb:AP005465_1852324 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1136_F08.>gb:AP005479_1852633 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0045A07.
          Length = 1011

 Score = 36.2 bits (82), Expect = 1.2
 Identities = 29/108 (26%), Positives = 48/108 (44%), Gaps = 3/108 (2%)
 Frame = +2

Query: 134 GDLKPYVILWIDPDR-RLATKSDDSGSTKPVWNERFVVPLTLPPQ--ESLLAVEIFHSVP 304
           G   PYV +  D  + R A K  D     PVWNE+F   ++ P +  E  L   ++H+  
Sbjct: 23  GTCNPYVEIEFDDQKFRTAIKERD---INPVWNEQFYFNISDPSRLTEKDLEAYVYHANR 79

Query: 305 SETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIRLKI 448
           +   K  +G +RI     V  S  +      + R    R +G++ L++
Sbjct: 80  ASNSKTCLGKVRISGTSFVSHSDATPLHYPLEKRTILSRARGELGLRV 127



>gb:AE017343_1755554 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 1545

 Score = 36.2 bits (82), Expect = 1.2
 Identities = 25/76 (32%), Positives = 36/76 (47%)
 Frame = +2

Query: 26   H*TVMATAGARPPAKSYDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDS 205
            H T +    +  P +   + VTV+SAK LK+   R G +KPYV +          K++  
Sbjct: 1376 HATTLPVGESASPQQPGTLGVTVISAKDLKSN--REGSVKPYVQIKAGGK---TVKTEHV 1430

Query: 206  GSTKPVWNERFVVPLT 253
              + P WNE F   LT
Sbjct: 1431 KGSAPEWNESFSFNLT 1446



>gb:BT001293_1356066 Drosophila melanogaster AT10318 full insert
           cDNA.
          Length = 520

 Score = 36.2 bits (82), Expect = 1.2
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 2/114 (1%)
 Frame = -2

Query: 478 NLVFLDLPDGDFESDLTLRTTGGAAELESFQLS*IARVDDQVLE--RNPKRTYQRLGGFG 305
           +L  L++P  DF+++LTL++   ++EL  ++   I  VD+QV     +P R YQ    F 
Sbjct: 18  DLATLEVPTNDFQNELTLQSM-LSSELRDYRNGLIETVDEQVTNPPYSPPRRYQEHEWF- 75

Query: 304 GDGVEDLDGEQRFLRRQRERDDETLVPDGFGRAGIVRFSGETAVGVNPEDDVRL 143
               +DL  E +   R     D  L  + FG      FS E    ++   D  L
Sbjct: 76  ----KDLPNELQKATRSTTESDSFLGTNLFGNYRKNCFSTEDIAIISARKDFEL 125



>gb:AE014297_1141688 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003759_1223681 Drosophila melanogaster
           chromosome 3R, section 97 of 118 of the complete
           sequence.
          Length = 769

 Score = 36.2 bits (82), Expect = 1.2
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 2/114 (1%)
 Frame = -2

Query: 478 NLVFLDLPDGDFESDLTLRTTGGAAELESFQLS*IARVDDQVLE--RNPKRTYQRLGGFG 305
           +L  L++P  DF+++LTL++   ++EL  ++   I  VD+QV     +P R YQ    F 
Sbjct: 24  DLATLEVPTNDFQNELTLQSM-LSSELRDYRNGLIETVDEQVTNPPYSPPRRYQEHEWF- 81

Query: 304 GDGVEDLDGEQRFLRRQRERDDETLVPDGFGRAGIVRFSGETAVGVNPEDDVRL 143
               +DL  E +   R     D  L  + FG      FS E    ++   D  L
Sbjct: 82  ----KDLPNELQKATRSTTESDSFLGTNLFGNYRKNCFSTEDIAIISARKDFEL 131



>gb:CR380956_1652358 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 1196

 Score = 35.4 bits (80), Expect = 2.0
 Identities = 35/131 (26%), Positives = 54/131 (41%)
 Frame = +2

Query: 86   VTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQ 265
            V V  A +LKN+  + G + PY  + ++  +R  T  D + +T PVWN    V LT P Q
Sbjct: 682  VFVNKASNLKNLE-KIGKIDPYAKILVNGIQRGRTDFD-AQTTNPVWNTGVYVALTSPNQ 739

Query: 266  ESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQGKIRLK 445
               L       V +      +G   I L D          L  +  +  S + QG++  K
Sbjct: 740  RITLEC---MDVETSNKDRTLGQFDIKLNDFF----QKNSLDRYDTKVDSTQRQGRLTAK 792

Query: 446  IAVRKIQEYQI 478
               + +  Y I
Sbjct: 793  KFSKGVVTYSI 803



>gb:AK173131_2070065 Mus musculus mRNA for mKIAA1207 protein.
          Length = 2078

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 4/97 (4%)
 Frame = +2

Query: 152 VILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQES----LLAVEIFHSVPSETPK 319
           ++  I  D +  TK  D+    PVWNE     L   P +S    ++ V+ F ++      
Sbjct: 34  IVSVIFKDEKKKTKKVDN-ELNPVWNEILEFDLRGIPLDSSSSLVIVVKDFETIGQNK-- 90

Query: 320 PLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG 430
            L+GT  + LKDL+ D   S   K   L    G+  G
Sbjct: 91  -LIGTATVSLKDLIGDQNRSLPYKQTSLLNEKGQDTG 126



>gb:CR382135_1668207 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 1201

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 24/91 (26%), Positives = 44/91 (48%)
 Frame = +2

Query: 86  VTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQ 265
           ++  SA+ LK  N+    L PY+       + LA  S    +++PVW+E   +P+    +
Sbjct: 398 ISAHSARGLKGFNYLGNTLDPYLTFGFQK-KVLAQTSVKDNTSRPVWDETVYIPVKSLSE 456

Query: 266 ESLLAVEIFHSVPSETPKPLVGTLRIPLKDL 358
              +AV  F+ +  +     VGT++  L+ L
Sbjct: 457 PLSIAVIDFNDIRKDKQ---VGTIQFDLEAL 484



>gb:CVA005377_1375979 Calliphora vicina cDNA encoding for
           eye-specific protein kinase C (ePKC).
          Length = 685

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%)
 Frame = +2

Query: 146 PYVILWIDPDRRLATKSDDSGSTK---PVWNERFVVPLTLPPQESLLAVEIF 292
           PYV + + PDR   TK       K   PV+NE F   +T P +E  L VE++
Sbjct: 214 PYVAVQLHPDRSGKTKKKTKTIQKNLNPVFNETFTFDITPPDREKRLLVEVW 265



>gb:AK087302_1174891 Mus musculus 0 day neonate lung cDNA, RIKEN
           full-length enriched library, clone:E030042N20
           product:MYOFERLIN (FER-1 LIKE PROTEIN 3) homolog [Homo
           sapiens], full insert sequence.
          Length = 435

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 4/97 (4%)
 Frame = +2

Query: 152 VILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQES----LLAVEIFHSVPSETPK 319
           ++  I  D +  TK  D+    PVWNE     L   P +S    ++ V+ F ++      
Sbjct: 23  IVSVIFKDEKKKTKKVDN-ELNPVWNEILEFDLRGIPLDSSSSLVIVVKDFETIGQNK-- 79

Query: 320 PLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG 430
            L+GT  + LKDL+ D   S   K   L    G+  G
Sbjct: 80  -LIGTATVSLKDLIGDQNRSLPYKQTSLLNEKGQDTG 115



>gb:AK087176_1174871 Mus musculus 0 day neonate lung cDNA, RIKEN
           full-length enriched library, clone:E030032B21
           product:MYOFERLIN (FER-1 LIKE PROTEIN 3) homolog [Homo
           sapiens], full insert sequence.
          Length = 388

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 4/97 (4%)
 Frame = +2

Query: 152 VILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQES----LLAVEIFHSVPSETPK 319
           ++  I  D +  TK  D+    PVWNE     L   P +S    ++ V+ F ++      
Sbjct: 23  IVSVIFKDEKKKTKKVDN-ELNPVWNEILEFDLRGIPLDSSSSLVIVVKDFETIGQNK-- 79

Query: 320 PLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG 430
            L+GT  + LKDL+ D   S   K   L    G+  G
Sbjct: 80  -LIGTATVSLKDLIGDQNRSLPYKQTSLLNEKGQDTG 115



>gb:AK086107_1174662 Mus musculus 15 days embryo head cDNA, RIKEN
           full-length enriched library, clone:D930006D18
           product:MYOFERLIN (FER-1 LIKE PROTEIN 3) homolog [Homo
           sapiens], full insert sequence.
          Length = 921

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 4/97 (4%)
 Frame = +2

Query: 152 VILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQES----LLAVEIFHSVPSETPK 319
           ++  I  D +  TK  D+    PVWNE     L   P +S    ++ V+ F ++      
Sbjct: 23  IVSVIFKDEKKKTKKVDN-ELNPVWNEILEFDLRGIPLDSSSSLVIVVKDFETIGQNK-- 79

Query: 320 PLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG 430
            L+GT  + LKDL+ D   S   K   L    G+  G
Sbjct: 80  -LIGTATVSLKDLIGDQNRSLPYKQTSLLNEKGQDTG 115



>gb:AK031666_1162543 Mus musculus 13 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:6030476O14
           product:MYOFERLIN (FER-1 LIKE PROTEIN 3) homolog [Homo
           sapiens], full insert sequence.
          Length = 292

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 4/97 (4%)
 Frame = +2

Query: 152 VILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQES----LLAVEIFHSVPSETPK 319
           ++  I  D +  TK  D+    PVWNE     L   P +S    ++ V+ F ++      
Sbjct: 23  IVSVIFKDEKKKTKKVDN-ELNPVWNEILEFDLRGIPLDSSSSLVIVVKDFETIGQNK-- 79

Query: 320 PLVGTLRIPLKDLVVDSGDSTQLKAFQLRRPSGRPQG 430
            L+GT  + LKDL+ D   S   K   L    G+  G
Sbjct: 80  -LIGTATVSLKDLIGDQNRSLPYKQTSLLNEKGQDTG 115



>pir|T06657|T06657 hypothetical protein T6G15.100 - Arabidopsis
           thaliana>gb:ATCHRIV36_1545119 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 36.>gb:ATT6G15_1556295
           Arabidopsis thaliana DNA chromosome 4, BAC clone T6G15
           (ESSA project).
          Length = 805

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 134 GDLKPYVILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQESL 274
           G   PYV++  D D ++A      G+ +P WNE FV  + LPP + +
Sbjct: 90  GTSDPYVVM--DLDGQVAKSKTKWGTKEPKWNEDFVFNIKLPPAKKI 134



>gb:AF081347_2190825 Echovirus 34 strain DN-19 capsid protein VP1
           (VP1) gene, partial cds.
          Length = 305

 Score = 34.7 bits (78), Expect = 3.4
 Identities = 30/105 (28%), Positives = 46/105 (43%), Gaps = 3/105 (2%)
 Frame = +2

Query: 74  YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFVV 244
           +D+++T V  +     N  H   + Y I++I P     T  DD     S+ P     F  
Sbjct: 132 FDLEMTFVITERYHTSNTGHARNQVYQIMYIPPGAPRPTARDDYTWQSSSNP---SVFYT 188

Query: 245 PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDS 379
             + PP+ S+  V I ++          G  R+PLKD   DSGD+
Sbjct: 189 YGSAPPRMSIPYVGIANAYSHFYD----GFARVPLKDDTTDSGDT 229



>gb:AF544228_1810453 Gossypium hirsutum phospholipase D delta
           isoform (pldd) mRNA, complete cds.
          Length = 849

 Score = 34.7 bits (78), Expect = 3.4
 Identities = 36/149 (24%), Positives = 58/149 (38%), Gaps = 33/149 (22%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNW----------------------RHGDLK-----------PYVI 157
           D+D+T+V A+ L N+++                      + GD K           PYV 
Sbjct: 14  DLDLTIVEARRLPNMDFMVNHLRSCLTCEPCKSPAQTAAKEGDSKIRGHRKIITSDPYVT 73

Query: 158 LWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTL 337
           + + P   +A       S  P WNE F++PL  P  E  + V+      ++     +GT 
Sbjct: 74  VCL-PQATVARTRVLKNSQNPKWNEHFIIPLAHPVTELDINVKDNDLFGADA----IGTA 128

Query: 338 RIPLKDLVVDSGDSTQLKAFQLRRPSGRP 424
           +IP   +      +     F L  PSG+P
Sbjct: 129 KIPASRIATGEHITGW---FPLIGPSGKP 154



>gb:AY138251_1582280 Gossypium hirsutum phospholipase D delta
           isoform 1b mRNA, complete cds.
          Length = 849

 Score = 34.7 bits (78), Expect = 3.4
 Identities = 36/149 (24%), Positives = 58/149 (38%), Gaps = 33/149 (22%)
 Frame = +2

Query: 77  DVDVTVVSAKHLKNVNW----------------------RHGDLK-----------PYVI 157
           D+D+T+V A+ L N+++                      + GD K           PYV 
Sbjct: 14  DLDLTIVEARRLPNMDFMVNHLRSCLTCEPCKSPAQTAAKEGDSKIRGHRKIITSDPYVT 73

Query: 158 LWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGTL 337
           + + P   +A       S  P WNE F++PL  P  E  + V+      ++     +GT 
Sbjct: 74  VCL-PQATVARTRVLKNSQNPKWNEHFIIPLAHPVTELDINVKDNDLFGADA----IGTA 128

Query: 338 RIPLKDLVVDSGDSTQLKAFQLRRPSGRP 424
           +IP   +      +     F L  PSG+P
Sbjct: 129 KIPASRIATGEHITGW---FPLIGPSGKP 154



>gb:TRU459419_2580966 Takifugu rubripes cacng5 gene, prkca gene and
           putative LINE-like retrotransposon, cosmids C012B17 and
           C123B01.
          Length = 670

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
 Frame = +2

Query: 86  VTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDDS---GSTKPVWNERFVVPLTL 256
           VTV  A++L  ++  +G   PYV L I PD +  TK        S  P WNE F   L  
Sbjct: 173 VTVGEARNLIPMD-PNGLSDPYVKLKITPDPKNETKQKTRTIRSSLNPCWNESFTFKLKP 231

Query: 257 PPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLV 361
             ++  L+VE++      T    +G++   + +L+
Sbjct: 232 SDKDRRLSVEVW-DWDRTTRNDFMGSMSFGVSELI 265



>gb:AY876913_2392682 Human enterovirus Hangzhou13-02, complete genome.
          Length = 2214

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 74   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFVV 244
            +D+++T V  +     N  H   + Y +++I P     T  DD     S+ P     F  
Sbjct: 712  FDLEMTFVITERYYASNTGHARNQVYQLMYIPPGAPRPTAWDDYTWQSSSNP---SVFYT 768

Query: 245  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDS 379
              + PP+ S+  V I ++          G  R+PLKD  VDSGD+
Sbjct: 769  YGSAPPRMSIPYVGIANAYSHFYD----GFARVPLKDETVDSGDT 809



>gb:AY876912_2392681 Human enterovirus Ningbo3-02, complete genome.
          Length = 2214

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 74   YDVDVTVVSAKHLKNVNWRHGDLKPYVILWIDPDRRLATKSDD---SGSTKPVWNERFVV 244
            +D+++T V  +     N  H   + Y +++I P     T  DD     S+ P     F  
Sbjct: 712  FDLEMTFVITERYYASNTGHARNQVYQLMYIPPGAPRPTAWDDYTWQSSSNP---SVFYT 768

Query: 245  PLTLPPQESLLAVEIFHSVPSETPKPLVGTLRIPLKDLVVDSGDS 379
              + PP+ S+  V I ++          G  R+PLKD  VDSGD+
Sbjct: 769  YGSAPPRMSIPYVGIANAYSHFYD----GFARVPLKDETVDSGDT 809



>gb:CR382131_1664609 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 847

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = -2

Query: 451 GDFESDLTLRTTGGAAELESFQLS*IARVDDQVLERNPKRTYQRLGGFGG--DGVEDLDG 278
           G+F  +  L+ +GG AE E            Q LER  +R ++   G+GG  D ++DLDG
Sbjct: 771 GEFVGENKLKPSGGVAEAEK-----------QRLERE-QRVWREQFGYGGDEDDIDDLDG 818

Query: 277 EQRFLRRQRERDDET 233
           E +    +   ++E+
Sbjct: 819 ELQTASEEETDEEES 833



>gb:AY237652_1592191 Yarrowia lipolytica putative actin-interacting
           protein 3 (BUD6) gene, complete cds.
          Length = 847

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = -2

Query: 451 GDFESDLTLRTTGGAAELESFQLS*IARVDDQVLERNPKRTYQRLGGFGG--DGVEDLDG 278
           G+F  +  L+ +GG AE E            Q LER  +R ++   G+GG  D ++DLDG
Sbjct: 771 GEFVGENKLKPSGGVAEAEK-----------QRLERE-QRVWREQFGYGGDEDDIDDLDG 818

Query: 277 EQRFLRRQRERDDET 233
           E +    +   ++E+
Sbjct: 819 ELQTASEEETDEEES 833



>gb:BA000040_728598 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 388

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = -2

Query: 496 VASRRRNLVFLDLPDGDFESDLTLRTTGGAAELESFQLS*IARVD---DQVLERNPKRTY 326
           VA R R ++ LDL D    + +        A +E F+   + R+    + VL RNPK  Y
Sbjct: 78  VAGRGRKVIELDLKDKAAIAQVLDLLASADALVEGFRPGVMERLGLGPEMVLARNPKLVY 137

Query: 325 QRLGGFGGDG 296
            R+ G+G +G
Sbjct: 138 GRMTGWGQEG 147



>pir|T30332|T30332 avirulence protein - Pseudomonas
           syringae>gb:PSU97505_161941 Pseudomonas syringae
           avirulence protein (avrE) and avirulence protein (avrF)
           genes, complete cds.>gb:AF232004_490773 Pseudomonas
           syringae pv. tomato strain DC3000 Hrp pathogenicity
           island, complete sequence.
          Length = 1795

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%)
 Frame = +3

Query: 630 PTADTVIRTPTATPVTTPNHRRRLHGPGN--PPRQDRAPQWIMHS 758
           PTA  V   P A+ V TP ++ R  G  N  P    RAP+WI+ +
Sbjct: 72  PTAKNVKTPPPASNVATPRNKARESGFSNSSPQNTHRAPKWILRN 116



>gb:BT011755_1641277 Arabidopsis thaliana At3g47220 gene, complete
           cds.
          Length = 531

 Score = 33.5 bits (75), Expect = 7.5
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +2

Query: 155 ILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGT 334
           I  +  D ++   +  +   KP W E F  PLT  P  +L++ E++    S TP    G 
Sbjct: 437 IAGVPHDEKIMNTTVKNNEWKPTWGEEFTFPLTY-PDLALISFEVYDYEVS-TPDYFCGQ 494

Query: 335 LRIPLKDLV 361
             +P+ +L+
Sbjct: 495 TCLPVSELI 503



>pir|T45658|T45658 1-phosphatidylinositol-4,5-bisphosphate
           phosphodiesterase-like protein - Arabidopsis
           thaliana>gb:ATF13I12_1548483 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F13I12.
          Length = 513

 Score = 33.5 bits (75), Expect = 7.5
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = +2

Query: 155 ILWIDPDRRLATKSDDSGSTKPVWNERFVVPLTLPPQESLLAVEIFHSVPSETPKPLVGT 334
           I  +  D ++   +  +   KP W E F  PLT  P  +L++ E++    S TP    G 
Sbjct: 419 IAGVPHDEKIMNTTVKNNEWKPTWGEEFTFPLTY-PDLALISFEVYDYEVS-TPDYFCGQ 476

Query: 335 LRIPLKDLV 361
             +P+ +L+
Sbjct: 477 TCLPVSELI 485



>gb:BC065530_1986865 Homo sapiens methyl-CpG binding domain protein
           6, mRNA (cDNA clone MGC:70424 IMAGE:6152748), complete
           cds.
          Length = 1003

 Score = 33.1 bits (74), Expect = 9.8
 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 352 GPGRRLGRFN---STESFPAPPPLRSSSG*DPTQNRRPEDPGIPNSSSG 489
           GP    G FN   S    P PP L S S   P Q R P  P +P ++SG
Sbjct: 422 GPSHSDGSFNLLGSDAHLPPPPTLSSGS---PPQPRHPIQPSLPGTTSG 467



>gb:AK093078_1913861 Homo sapiens cDNA FLJ35759 fis, clone
           TESTI2004737.
          Length = 710

 Score = 33.1 bits (74), Expect = 9.8
 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 352 GPGRRLGRFN---STESFPAPPPLRSSSG*DPTQNRRPEDPGIPNSSSG 489
           GP    G FN   S    P PP L S S   P Q R P  P +P ++SG
Sbjct: 128 GPSHSDGSFNLLGSDAHLPPPPTLSSGS---PPQPRHPIQPSLPGTTSG 173



>gb:AK056399_1911727 Homo sapiens cDNA FLJ31837 fis, clone
           NT2RP7000069, weakly similar to MUCIN 1 PRECURSOR.
          Length = 1003

 Score = 33.1 bits (74), Expect = 9.8
 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 352 GPGRRLGRFN---STESFPAPPPLRSSSG*DPTQNRRPEDPGIPNSSSG 489
           GP    G FN   S    P PP L S S   P Q R P  P +P ++SG
Sbjct: 422 GPSHSDGSFNLLGSDAHLPPPPTLSSGS---PPQPRHPIQPSLPGTTSG 467



>gb:AB067474_1870782 Homo sapiens mRNA for KIAA1887 protein, partial
           cds.
          Length = 967

 Score = 33.1 bits (74), Expect = 9.8
 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 352 GPGRRLGRFN---STESFPAPPPLRSSSG*DPTQNRRPEDPGIPNSSSG 489
           GP    G FN   S    P PP L S S   P Q R P  P +P ++SG
Sbjct: 386 GPSHSDGSFNLLGSDAHLPPPPTLSSGS---PPQPRHPIQPSLPGTTSG 431



>gb:AB024031_1515751 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K6A12.>gb:AY056116_1563452 Arabidopsis
           thaliana AT5g50170/K6A12_3 mRNA, complete
           cds.>gb:BT009696_1640157 Arabidopsis thaliana
           At5g50170/K6A12_3 gene, complete cds.
          Length = 1027

 Score = 33.1 bits (74), Expect = 9.8
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 4/73 (5%)
 Frame = +2

Query: 209 STKPVWNERFVVPLTLPPQESLLAVEIFHSVPSE----TPKPLVGTLRIPLKDLVVDSGD 376
           ++ P+WNE FV  ++   +   + V I H    +        L+G +RIPL  +  +   
Sbjct: 37  TSSPIWNEEFVFRISDVDEGDDVVVSILHHEQQDHQSIVSTGLIGKVRIPLTSVAAEENQ 96

Query: 377 STQLKAFQLRRPS 415
           +     F + +PS
Sbjct: 97  TLLPTWFVIEKPS 109



>sp|Q96DN6|MBD6_HUMAN Methyl-CpG binding domain protein 6.
          Length = 1003

 Score = 33.1 bits (74), Expect = 9.8
 Identities = 20/49 (40%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 352 GPGRRLGRFN---STESFPAPPPLRSSSG*DPTQNRRPEDPGIPNSSSG 489
           GP    G FN   S    P PP L S S   P Q R P  P +P ++SG
Sbjct: 422 GPSHSDGSFNLLGSDAHLPPPPTLSSGS---PPQPRHPIQPSLPGTTSG 467


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 938,117,598
Number of Sequences: 1806583
Number of extensions: 17839725
Number of successful extensions: 53859
Number of sequences better than 10.0: 62
Number of HSP's better than 10.0 without gapping: 49418
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53672
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 81545777900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)