BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7107
         (702 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP006533_1862343 Oryza sativa (japonica cultivar-group) genom...    32   8.3     


>gb:AP006533_1862343 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0085L11.
          Length = 195

 Score = 32.3 bits (72), Expect = 8.3
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -1

Query: 492 RNNLTAMMRRRPVDQKHASRTQQQHSAAKHPSMQPTP 382
           R NL+   RRRP+ ++   R QQQ + A+ P   P P
Sbjct: 63  RGNLSEEHRRRPLPRRRDCRPQQQRACARAPPGPPPP 99


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 529,279,234
Number of Sequences: 1806583
Number of extensions: 8655522
Number of successful extensions: 16480
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 16135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16476
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 40692000384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)