BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7051
         (836 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:NBE504729_1688166 Nicotiana benthamiana mRNA for bromodomain-...   276   3e-73   
gb:NBE504730_1688167 Nicotiana benthamiana mRNA for bromodomain-...   275   8e-73   
gb:NTA504731_1691423 Nicotiana tabacum mRNA for bromodomain-cont...   273   2e-72   
gb:NTA504732_1691424 Nicotiana tabacum mRNA for bromodomain-cont...   270   2e-71   
gb:STU504728_1723096 Solanum tuberosum mRNA for bromodomain-cont...   265   8e-70   
gb:LES249592_1684505 Lycopersicon esculentum mRNA for PSTVd RNA-...   263   4e-69   
gb:BT008626_1639837 Arabidopsis thaliana clone RAFL09-89-N13 (R1...    70   6e-11   
gb:AB026639_1517089 Arabidopsis thaliana genomic DNA, chromosome...    70   6e-11   
pir|T49984|T49984 bromodomain protein-like - Arabidopsis thalian...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:BC074685_2558179 Xenopus tropicalis dual specificity phosphat...    39   0.093   
gb:AC117176_1208046 Dictyostelium discoideum chromosome 2 map 50...    37   0.35    
gb:AF222717_1252569 Plasmodium falciparum clone 3D7 myosin PfM-C...    37   0.60    
gb:PFMAL13_1191344 Plasmodium falciparum 3D7 chromosome 13, *** ...    37   0.60    
gb:AE014188_968054 Plasmodium falciparum 3D7 chromosome 12, comp...    36   0.79    
gb:BC077967_2560612 Xenopus laevis MGC80995 protein, mRNA (cDNA ...    35   1.3     
gb:BC046393_2099199 Mus musculus zinc finger protein 217, mRNA (...    35   2.3     
gb:CR380948_1649237 Candida glabrata strain CBS138 chromosome B ...    35   2.3     
pir|G95940|G95940 probable xanthine dehydrogenase (EC 1.1.1.204)...    35   2.3     Sinorhizobium meliloti
sp|P56222|PO32_RAT|PO32_RAT POU domain, class 3, transcription factor 2 (...    34   3.0     Rattus norvegicus [brown rat]
gb:AL732455_2504415 Zebrafish DNA sequence from clone CH211-225J...    34   3.9     
gb:CR382137_1670547 Debaryomyces hansenii chromosome E of strain...    34   3.9     
gb:PFA929351_1392981 Plasmodium falciparum strain 3D7, chromosom...    33   5.1     
gb:AJ719487_2501674 Gallus gallus mRNA for hypothetical protein,...    33   6.7     
gb:HS273N12_1997839 Human DNA sequence from clone RP1-273N12 on ...    33   6.7     
gb:BC051699_1984626 Homo sapiens POU domain, class 3, transcript...    33   6.7     
gb:AE017347_1758000 Cryptococcus neoformans var. neoformans JEC2...    33   6.7     
gb:YSCZIP1A_1730942 Saccharomyces cerevisiae ZIP1 protein gene, ...    33   6.7     
gb:YSCDDR48A_1728805 S.cerevisiae DDR48 gene.                          33   6.7     
gb:PFMAL3P2_1394451 Plasmodium falciparum MAL3P2, complete seque...    33   6.7     
pir|T51260|T51260 hypothetical protein T8M16_50 - Arabidopsis th...    33   6.7     Arabidopsis thaliana [mouse-ear cress]
pir|S29334|S29334 transcription factor Brn-2 [validated] - human...    33   6.7     Homo sapiens [man]
pir|A49447|A49447 transcription factor Brn-2 - rat                     33   6.7     Rattus norvegicus [brown rat]
pir|S55120|HHBYD8 heat shock protein DDR48 - yeast (Saccharomyce...    33   6.7     
sp|P31111|ZIP1_YEAST|ZIP1_YEAST Synaptonemal complex protein ZIP1.>pir|S701...    33   6.7     Saccharomyces cerevisiae [brewer's yeast]
sp|P31360|PO32_MOUSE|PO32_MOUSE POU domain, class 3, transcription factor 2...    33   6.7     Mus musculus [mouse]
sp|P20265|PO32_HUMAN|PO32_HUMAN POU domain, class 3, transcription factor 2...    33   6.7     Homo sapiens [man]
sp|P18899|DR48_YEAST|DR48_YEAST DDR48 stress protein (DNA damage-responsive...    33   6.7     Saccharomyces cerevisiae [brewer's yeast]
gb:NC3H10_1688525 Neurospora crassa DNA linkage group V Cosmid c...    33   8.7     
gb:AE016959_1022826 Oryza sativa (japonica cultivar-group) chrom...    33   8.7     
gb:AE014186_938131 Plasmodium falciparum 3D7 chromosome 11 compl...    33   8.7     
gb:AY596297_633987 Haloarcula marismortui ATCC 43049 chromosome ...    33   8.7     
pir|T48727|T48727 retinoblastoma binding protein 2 related prote...    33   8.7     Neurospora crassa


>gb:NBE504729_1688166 Nicotiana benthamiana mRNA for
           bromodomain-containing RNA-binding protein 1 (brp1
           gene).
          Length = 615

 Score =  276 bits (707), Expect = 3e-73
 Identities = 144/204 (70%), Positives = 160/204 (78%), Gaps = 6/204 (2%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSSN--PKKKQKHFHQAANGRPND 413
           MASAVLASRNESSWAQSG AGGGFMGKTPYSH HLNP+SN  PKKKQK FH A+NGR ND
Sbjct: 1   MASAVLASRNESSWAQSGGAGGGFMGKTPYSHTHLNPNSNPKPKKKQKQFHHASNGRQND 60

Query: 414 DSPVVTQTASDDAYSFNQRPIES----NGLNFGGYLTYNITSYTKSELNELRKRLVSELE 581
           +SP VTQTASDDAYSFNQRPIES    +GLN GGY+TYN+ SY K+EL+ELR RLV+ELE
Sbjct: 61  ESPAVTQTASDDAYSFNQRPIESSTNVDGLNLGGYMTYNVASYNKTELHELRSRLVAELE 120

Query: 582 QIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKSXXX 761
           QIR+LKDRIESG  ST  +NPRSHGKSKKLS NKR    GS+KDP+K  NGVDN      
Sbjct: 121 QIRSLKDRIESGQLST--SNPRSHGKSKKLSGNKRATPSGSSKDPKKLPNGVDNRNFGNP 178

Query: 762 XXXXXXXXXXLENMMKDCRQILLK 833
                     +ENMMK+CRQ+L K
Sbjct: 179 GGVGVKGIIGMENMMKECRQVLGK 202



>gb:NBE504730_1688167 Nicotiana benthamiana mRNA for
           bromodomain-containing RNA-binding protein 2 (brp2
           gene).
          Length = 613

 Score =  275 bits (703), Expect = 8e-73
 Identities = 143/204 (70%), Positives = 160/204 (78%), Gaps = 6/204 (2%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSS--NPKKKQKHFHQAANGRPND 413
           MASAVLASRNESSWAQSG AGGGFMGKTPYSH HLNP+S  NPKKKQK FH A+NG  ND
Sbjct: 1   MASAVLASRNESSWAQSGGAGGGFMGKTPYSHTHLNPNSNPNPKKKQKQFHHASNGCHND 60

Query: 414 DSPVVTQTASDDAYSFNQRPIES----NGLNFGGYLTYNITSYTKSELNELRKRLVSELE 581
           + P VTQTASDDAYSFNQRPIES    +GLN GGY+TYN+ SY+K+EL++LR RLV+ELE
Sbjct: 61  ELPAVTQTASDDAYSFNQRPIESSANVDGLNLGGYMTYNVASYSKTELHDLRSRLVAELE 120

Query: 582 QIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKSXXX 761
           QIRNLKDRIESG  ST  +NPRSHGKSKKLS NKRP   GS+KDP+K  NGVDN      
Sbjct: 121 QIRNLKDRIESGQLST--SNPRSHGKSKKLSGNKRPTPSGSSKDPKKLPNGVDNRNFGNP 178

Query: 762 XXXXXXXXXXLENMMKDCRQILLK 833
                     +ENMMK+CRQ+L K
Sbjct: 179 GGGGVKGIIGMENMMKECRQVLGK 202



>gb:NTA504731_1691423 Nicotiana tabacum mRNA for
           bromodomain-containing RNA-binding protein 1 (brp1
           gene).
          Length = 617

 Score =  273 bits (699), Expect = 2e-72
 Identities = 144/205 (70%), Positives = 159/205 (77%), Gaps = 7/205 (3%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSS--NPKKKQKHFHQAANGRPND 413
           MA AVLASRNESSWAQSG AGGGFMGKTPYSH HLNP+S  NPKKKQK FH A+NGR ND
Sbjct: 1   MAFAVLASRNESSWAQSGGAGGGFMGKTPYSHTHLNPNSNPNPKKKQKQFHHASNGRHND 60

Query: 414 DSPVVTQTASDDAYSFNQRPIES----NGLNFGGYLTYNITSYTKSELNELRKRLVSELE 581
           +SP VTQTASDDAYSFNQRPIES    +GLN GGY+TYN+ SY K+EL+ELR RLV+ELE
Sbjct: 61  ESPAVTQTASDDAYSFNQRPIESSTNVDGLNLGGYMTYNVASYNKTELHELRSRLVAELE 120

Query: 582 QIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVK-SXX 758
           QIRNLKDRIESG  ST  +NPRSHGKSKKLS NKRP   GS+KD +K  NGVDN      
Sbjct: 121 QIRNLKDRIESGQLST--SNPRSHGKSKKLSGNKRPTPSGSSKDRKKLLNGVDNRNFGNP 178

Query: 759 XXXXXXXXXXXLENMMKDCRQILLK 833
                      +ENMMK+CRQ+L K
Sbjct: 179 GGGGGVKGIIGMENMMKECRQVLAK 203



>gb:NTA504732_1691424 Nicotiana tabacum mRNA for
           bromodomain-containing RNA-binding protein 2 (brp2
           gene).
          Length = 616

 Score =  270 bits (690), Expect = 2e-71
 Identities = 143/204 (70%), Positives = 156/204 (76%), Gaps = 6/204 (2%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSS--NPKKKQKHFHQAANGRPND 413
           MASAVLASRNESSWAQSG AGGGFMGKTPYSH  LNP+S  NPKKKQK FH A+NGR  D
Sbjct: 1   MASAVLASRNESSWAQSGGAGGGFMGKTPYSHTQLNPNSNPNPKKKQKQFHHASNGRLTD 60

Query: 414 DSPVVTQTASDDAYSFNQRPIES----NGLNFGGYLTYNITSYTKSELNELRKRLVSELE 581
           +SP VTQTASDDAYSFNQRPIES    +GLN GGY+TYN  SY K+EL+ELR RLV+ELE
Sbjct: 61  ESPAVTQTASDDAYSFNQRPIESSTNVDGLNLGGYMTYNXASYNKTELHELRSRLVAELE 120

Query: 582 QIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKSXXX 761
           QIRNLKDRIESG  ST  +NPRSHGKSKKLS NKRP   GS+KDP+K  NGVDN      
Sbjct: 121 QIRNLKDRIESGQLST--SNPRSHGKSKKLSGNKRPTPSGSSKDPKKLPNGVDNRNFGNP 178

Query: 762 XXXXXXXXXXLENMMKDCRQILLK 833
                      ENMMK+C Q+L K
Sbjct: 179 GGGGVKGIIGKENMMKECTQVLGK 202



>gb:STU504728_1723096 Solanum tuberosum mRNA for
           bromodomain-containing RNA-binding protein 1 (brp1
           gene).
          Length = 602

 Score =  265 bits (677), Expect = 8e-70
 Identities = 139/204 (68%), Positives = 155/204 (75%), Gaps = 6/204 (2%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSSNP--KKKQKHFHQAANGRPND 413
           MASAVLASRNESSWAQSG AGGGFMGKTP+SH  LNP+ NP  KKKQK FH  +NGR  D
Sbjct: 1   MASAVLASRNESSWAQSGGAGGGFMGKTPFSHTQLNPNHNPNPKKKQKQFHHTSNGRHID 60

Query: 414 DSPVVTQTASDDAYSFNQRPIES----NGLNFGGYLTYNITSYTKSELNELRKRLVSELE 581
           +SP VTQTASDDAYSFNQRPIES    +GLNFGGYLT+N+ SY K E+NELR RL++E+E
Sbjct: 61  ESPAVTQTASDDAYSFNQRPIESTTNVDGLNFGGYLTFNVVSYNKGEVNELRSRLLAEVE 120

Query: 582 QIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKSXXX 761
           QIRNLKDRIESG  STT  NPRS GKSKKLS NKRP   GS+KDP+K  NGV+N      
Sbjct: 121 QIRNLKDRIESGQLSTT--NPRSQGKSKKLSGNKRPTPSGSSKDPKKLPNGVENRNFGNP 178

Query: 762 XXXXXXXXXXLENMMKDCRQILLK 833
                      E+MMK+CRQIL K
Sbjct: 179 VGGGGVKAIGTESMMKECRQILAK 202



>gb:LES249592_1684505 Lycopersicon esculentum mRNA for PSTVd
           RNA-biding protein, Virp1, clone
           Virp1a.>gb:LES249593_1684506 Lycopersicon esculentum
           mRNA for PSTVd RNA-biding protein, Virp1, clone
           Virp1b.>gb:LES249594_1684507 Lycopersicon esculentum
           mRNA for PSTVd RNA-biding protein, Virp1, clone
           Virp1c.>gb:LES249595_1684508 Lycopersicon esculentum
           mRNA for PSTVd RNA-biding protein, Virp1, clone
           Virp1d.>gb:AF190891_1775452 Lycopersicon esculentum
           PSTVd RNA-binding protein Virp1a mRNA, complete
           cds.>gb:AF190892_1775453 Lycopersicon esculentum PSTVd
           RNA-binding protein Virp1b mRNA, complete
           cds.>gb:AF190893_1775454 Lycopersicon esculentum PSTVd
           RNA-binding protein Virp1c mRNA, complete
           cds.>gb:AF190894_1775455 Lycopersicon esculentum PSTVd
           RNA-binding protein Virp1d mRNA, complete cds.
          Length = 602

 Score =  263 bits (671), Expect = 4e-69
 Identities = 139/204 (68%), Positives = 154/204 (75%), Gaps = 6/204 (2%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSSNP--KKKQKHFHQAANGRPND 413
           MASAVLASRNESSWAQSG AGGGFMGKTPYSH  LNP+ NP  KKKQK FH  +NGR  D
Sbjct: 1   MASAVLASRNESSWAQSGGAGGGFMGKTPYSHTQLNPNHNPNPKKKQKQFHHTSNGRHMD 60

Query: 414 DSPVVTQTASDDAYSFNQRPIES----NGLNFGGYLTYNITSYTKSELNELRKRLVSELE 581
           DSP VTQTASDDAYSFNQRPIES    +GLNFGGYLT+N+ SY K+E+NELR RL++E+E
Sbjct: 61  DSPAVTQTASDDAYSFNQRPIESTTNVDGLNFGGYLTFNVVSYNKAEVNELRSRLMAEVE 120

Query: 582 QIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKSXXX 761
           QIRNLKDRIESG  STT  NPRS GKSKK S NKRP   GS+KD +K  NGV+N      
Sbjct: 121 QIRNLKDRIESGQLSTT--NPRSQGKSKKQSGNKRPTPSGSSKDLKKLPNGVENRNFGNP 178

Query: 762 XXXXXXXXXXLENMMKDCRQILLK 833
                      E+MMK+CRQIL K
Sbjct: 179 GGVDGVKAIGTESMMKECRQILAK 202



>gb:BT008626_1639837 Arabidopsis thaliana clone RAFL09-89-N13
           (R19946) unknown protein (At5g65630) mRNA, complete cds.
          Length = 590

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 63/204 (30%), Positives = 87/204 (42%), Gaps = 33/204 (16%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGK--------TPYSHPHLNPSSNPKKKQKHFHQAA 395
           MA AV A+ NE S+ +    G  FM K           + P  NP+ NP     +F ++ 
Sbjct: 1   MAPAVFATLNEPSYQEQ--CGAVFMRKFTNQSVTENTNNLPLFNPNPNP-----NFERSN 53

Query: 396 NGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKRLVSE 575
           + +  DDS                         FG Y T+N+  YT S+L EL+KR  SE
Sbjct: 54  SSKQCDDSS-----------------------EFGSYATFNLAGYTSSQLRELKKRFTSE 90

Query: 576 LEQIRNLKDRIESGHFST---------------TVNN---------PRSHGKSKKLSANK 683
           L+QIR L++RIESG F T                +NN         P+   + K +S  K
Sbjct: 91  LKQIRILRERIESGTFETQQGYTIPEVPAVRSAPLNNFTGEKNDLGPKKKKQKKNVSGLK 150

Query: 684 RPMSFG-SNKDPEKFCNGVDNVKS 752
           R   FG S+ + EK   G+ N  S
Sbjct: 151 RSNQFGPSDPESEKLLAGMLNTCS 174



>gb:AB026639_1517089 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21L13.
          Length = 643

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 63/204 (30%), Positives = 87/204 (42%), Gaps = 33/204 (16%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGK--------TPYSHPHLNPSSNPKKKQKHFHQAA 395
           MA AV A+ NE S+ +    G  FM K           + P  NP+ NP     +F ++ 
Sbjct: 56  MAPAVFATLNEPSYQEQ--CGAVFMRKFTNQSVTENTNNLPLFNPNPNP-----NFERSN 108

Query: 396 NGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKRLVSE 575
           + +  DDS                         FG Y T+N+  YT S+L EL+KR  SE
Sbjct: 109 SSKQCDDSS-----------------------EFGSYATFNLAGYTSSQLRELKKRFTSE 145

Query: 576 LEQIRNLKDRIESGHFST---------------TVNN---------PRSHGKSKKLSANK 683
           L+QIR L++RIESG F T                +NN         P+   + K +S  K
Sbjct: 146 LKQIRILRERIESGTFETQQGYTIPEVPAVRSAPLNNFTGEKNDLGPKKKKQKKNVSGLK 205

Query: 684 RPMSFG-SNKDPEKFCNGVDNVKS 752
           R   FG S+ + EK   G+ N  S
Sbjct: 206 RSNQFGPSDPESEKLLAGMLNTCS 229



>pir|T49984|T49984 bromodomain protein-like - Arabidopsis
           thaliana>gb:ATF12B17_1548319 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F12B17 (ESSA project).
          Length = 678

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 66/210 (31%), Positives = 89/210 (42%), Gaps = 12/210 (5%)
 Frame = +3

Query: 240 MASAVLASRNESSWAQSGDAGGGFMGK---TPYSHPHLNPSSNPKKKQKHFHQAANGRPN 410
           MA AVLA+ NE  +   G  G  FM K    P S    NP  NP           N  PN
Sbjct: 76  MAPAVLANLNEPLFL--GQCGAVFMRKYTNQPLSGDINNPLFNP-----------NPNPN 122

Query: 411 DDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKRLVSELEQIR 590
             S          AY  N      +   +G Y+++++  YT ++L EL+KRL SELE++R
Sbjct: 123 SIS----------AYGNNSSKHFDDSSAYGDYVSFDLDGYTSNQLRELKKRLNSELEEVR 172

Query: 591 NLKDRIESGHF---STTVNNPRSHGKS------KKLSANKRPMSFGSNKDPEKFCNGVDN 743
            L++RIESG F   S      RS          KK    K+ +  G  K    F     +
Sbjct: 173 FLRERIESGTFVSGSVYTTQARSFAGETNDVGVKKTKTKKKKIGHG-QKRSNPFATDEPS 231

Query: 744 VKSXXXXXXXXXXXXXLENMMKDCRQILLK 833
           +K              L++MM  C QIL+K
Sbjct: 232 LK--RHVALDLMSEKVLKSMMTTCGQILVK 259



>gb:BC074685_2558179 Xenopus tropicalis dual specificity phosphatase
           11 (RNA/RNP complex 1-interacting), mRNA (cDNA clone
           MGC:69257 IMAGE:5308134), complete cds.
          Length = 553

 Score = 39.3 bits (90), Expect = 0.093
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 6/117 (5%)
 Frame = +3

Query: 351 SSNPKKKQK---HFHQAANGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTYNI 521
           SS+PK  Q      ++  +G+ +       Q ASD  +S N  P++ N L FG   TYN+
Sbjct: 414 SSHPKSVQNFTAEMYKTDSGKTDTQRQFQYQHASD--FSTNMAPLDRNELRFGERQTYNL 471

Query: 522 TSYTKSELNELRKRLVSEL---EQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANK 683
            S   +  NEL++ L  +    ++I  L  R E      T++  R  G S  +S  K
Sbjct: 472 NSNIPTSRNELQQLLEMQARSRQEIPGLYQR-EREVALGTLHGQRIDGLSDVISGKK 527



>gb:AC117176_1208046 Dictyostelium discoideum chromosome 2 map
            5018074-5200947 strain AX4, complete sequence.
          Length = 1125

 Score = 37.4 bits (85), Expect = 0.35
 Identities = 41/179 (22%), Positives = 73/179 (40%), Gaps = 17/179 (9%)
 Frame = +3

Query: 207  NHKNSASTLQFMASAVLASRNESSWAQSGDA-GGGFMGKTPYSHPHL-NPSSNPKKKQKH 380
            N  NS STL       L   N SS   S    GGG   K+  S P++ +P  +P      
Sbjct: 889  NMSNSTSTLSSSGQHQLERANSSSSITSAAGIGGGSNSKSSTSPPNVVSPYISPSTSFNS 948

Query: 381  FHQAANGRPNDDS--------------PVVTQTASDDAYSFNQRPIESNGLNFGGYLTY- 515
              + +N + N++S              P++  +   ++ + N     ++  N     +  
Sbjct: 949  LTELSNHQNNNNSNNNNNNNNNIDTSAPMIVDSHQYNSGNSNSNSNSNSNSNSSSKSSSP 1008

Query: 516  NITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPM 692
            NIT +TK  LNEL+ R +    + R+L+  +       T    + HG+  +   ++ P+
Sbjct: 1009 NITDFTKLSLNELKDRYIKVKGEKRSLQIDLHRYQSEFT----KKHGRKVQFVEDRVPV 1063



>gb:AF222717_1252569 Plasmodium falciparum clone 3D7 myosin PfM-C
            gene, partial cds.
          Length = 2067

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 23/83 (27%), Positives = 38/83 (45%)
 Frame = +3

Query: 504  YLTYNITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANK 683
            Y+  N+T      LN+   +LVS L QI++  + + +      +NN  S+G S KL  N 
Sbjct: 1212 YIKQNVT------LNDKYNKLVSLLGQIKDTNNNVYNDVLINNINNYHSNGMSNKLLLNN 1265

Query: 684  RPMSFGSNKDPEKFCNGVDNVKS 752
                  +N +   F   + N+ S
Sbjct: 1266 YNNYHNNNNNNNNFFKNLTNLSS 1288



>gb:PFMAL13_1191344 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 2160

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 23/83 (27%), Positives = 38/83 (45%)
 Frame = +3

Query: 504  YLTYNITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANK 683
            Y+  N+T      LN+   +LVS L QI++  + + +      +NN  S+G S KL  N 
Sbjct: 1282 YIKQNVT------LNDKYNKLVSLLGQIKDTNNNVYNDVLINNINNYHSNGMSNKLLLNN 1335

Query: 684  RPMSFGSNKDPEKFCNGVDNVKS 752
                  +N +   F   + N+ S
Sbjct: 1336 YNNYHNNNNNNNNFFKNLTNLSS 1358



>gb:AE014188_968054 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014848_1229446 Plasmodium
           falciparum 3D7 chromosome 12, section 5 of 9 of the
           complete sequence.
          Length = 767

 Score = 36.2 bits (82), Expect = 0.79
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 1/101 (0%)
 Frame = +3

Query: 363 KKKQKHFHQA-ANGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTYNITSYTKS 539
           KKKQK F++   N +  D+ P+   T   +  S  QR I+   LNF    T    +YT S
Sbjct: 552 KKKQKSFYEIYTNNKSIDNLPITRITVQREICSI-QREIDK--LNFDKKKTNVNDTYTLS 608

Query: 540 ELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKS 662
           +LN     L  ++  +R   D+    H +   N+  +  K+
Sbjct: 609 KLNNQINELTKKINILRGNLDKARKNHAAMKSNDQFAQEKN 649



>gb:BC077967_2560612 Xenopus laevis MGC80995 protein, mRNA (cDNA
           clone MGC:80995 IMAGE:5542002), complete cds.
          Length = 1199

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 28/117 (23%), Positives = 47/117 (40%), Gaps = 1/117 (0%)
 Frame = +3

Query: 333 HPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLT 512
           HP ++P  +      H H      P+   P V  T        +Q P     +    +  
Sbjct: 107 HPSMHPPPHVAHYMHHPHALLPHPPHPVYPPVPATGEIPPQFIHQHPPPPPHI----FQD 162

Query: 513 YNITSYTKSELNELRKRLVSELEQIRN-LKDRIESGHFSTTVNNPRSHGKSKKLSAN 680
            +  S+T+    +  +R +   EQ+R  LKDR  SGH +  +N+P        ++AN
Sbjct: 163 QDARSHTRQSFIQRDERAIKMQEQLRKRLKDRQISGHSNNKLNSPPPSPHKAHIAAN 219



>gb:BC046393_2099199 Mus musculus zinc finger protein 217, mRNA
           (cDNA clone IMAGE:4953275), partial cds.
          Length = 212

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
 Frame = +3

Query: 291 GDAGGG--FMGKTPYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSP 422
           G AGG     GK P SH HL+ S   K+  ++F    + RPND  P
Sbjct: 167 GHAGGSPALEGKRPVSHQHLSNSMLQKRSYENFIGNTHYRPNDKKP 212



>gb:CR380948_1649237 Candida glabrata strain CBS138 chromosome B
           complete sequence.
          Length = 438

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 4/99 (4%)
 Frame = +3

Query: 444 DDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKR---LVSELEQIRNLKDRIES 614
           +D+ S   + +    +N  G  +   T    SEL ELR R   L S+L++  +    I+S
Sbjct: 315 NDSLSQEYQSLNKELMNMQGQKSNPPTDELNSELTELRTRVRTLESQLQEKSSADTNIQS 374

Query: 615 G-HFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFC 728
           G   S + + P S G S  L   K P+        E +C
Sbjct: 375 GAQASQSPSQPESSGSSSSLPVYKPPVKVDPAAGRELWC 413



>pir|G95940|G95940 probable xanthine dehydrogenase (EC 1.1.1.204)
           [imported] - Sinorhizobium meliloti (strain 1021)
           magaplasmid pSymB>gb:RME591985_165439 Sinorhizobium
           meliloti 1021 complete pSymB.
          Length = 777

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = +3

Query: 327 YSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD-AYSFNQRPIESNGLNFGG 503
           Y +P++   S P K     + A  G       V  +   +D AY+  + P+E   LNF G
Sbjct: 332 YFYPNVRLRSRPLKTNTVSNTAFRGFGGPQGMVGGERMVEDVAYALGKDPLEIRKLNFYG 391

Query: 504 YLTYNITSYTKSELNELRKRLVSELE 581
               N+T Y ++  + +  R++ ELE
Sbjct: 392 GEGRNLTPYHQTVEDNIIGRIIEELE 417



>sp|P56222|PO32_RAT POU domain, class 3, transcription factor 2
           (Nervous-system specific octamer-binding transcription
           factor N-Oct-3) (Brain-specific homeobox/POU domain
           protein 2) (Brain-2) (Brn-2 protein).
          Length = 445

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 14/129 (10%)
 Frame = +3

Query: 324 PYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD----AYSFNQRPIESN-- 485
           P+SHPH  P   P  +    H  A+  P+ D    T   SDD    A  F QR I+    
Sbjct: 233 PHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPT---SDDLEQFAKQFKQRRIKLGFT 289

Query: 486 ----GLNFGGYL--TYNITSYTKSELNELRKRLVSELEQIRN--LKDRIESGHFSTTVNN 641
               GL  G      ++ T+  + E  +L  + + +L+ + N  L++   S    T+++ 
Sbjct: 290 QADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDK 349

Query: 642 PRSHGKSKK 668
             S G+ +K
Sbjct: 350 IASQGRKRK 358



>gb:AL732455_2504415 Zebrafish DNA sequence from clone CH211-225J17 in
            linkage group 7 Contains part of a novel gene for a zinc
            finger protein, complete sequence.
          Length = 1385

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 6/130 (4%)
 Frame = +3

Query: 207  NHKNSASTLQFMASAVLASRNESSWAQSGDAGGGFMGKTPYSHPH-LNPSSNPKKKQKHF 383
            ++KNS  T  F    VL    +       D  GG M    ++ P  L+P    +++++H 
Sbjct: 854  HNKNSGGTGVFARPDVLRGVFKGMMPSGLDFRGGQMLPHQWAPPGMLSPRDRDRERERHG 913

Query: 384  HQAANGRPNDDSPVVTQTASDDAYSFNQ-----RPIESNGLNFGGYLTYNITSYTKSELN 548
                    N  SP    +A+D   SF+      + +  NG+NF G L   + S+  S + 
Sbjct: 914  PGPEPTTENMKSPEGPGSAADSPASFSDLGRAYQSMVGNGVNFQGSLQAFMDSFVLSSMK 973

Query: 549  ELRKRLVSEL 578
            + ++   S+L
Sbjct: 974  KEKEMRESQL 983



>gb:CR382137_1670547 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 494

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 24/102 (23%), Positives = 39/102 (38%)
 Frame = +3

Query: 147 VHVPPIHVFYAT*KRSISPPNHKNSASTLQFMASAVLASRNESSWAQSGDAGGGFMGKTP 326
           V++PP+ +F +         N K +AS   F +     + N  +   S +         P
Sbjct: 48  VNLPPVEIFISNGVTYTFTLNGKAAASPTTFTSVYTDNNDNNDNNNDSDNENDDNNNNAP 107

Query: 327 YSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDDA 452
                   S++P     +   AA   P DD+P  T +  DDA
Sbjct: 108 AQTAAATTSASPTNNGGNDSPAAANSPQDDTPAATNSPQDDA 149



>gb:PFA929351_1392981 Plasmodium falciparum strain 3D7, chromosome
           5, segment 1/4.
          Length = 1527

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 27/140 (19%), Positives = 63/140 (45%), Gaps = 3/140 (2%)
 Frame = +3

Query: 342 LNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTYNI 521
           +  S   KKK+K  +   N   N+D       +S+D YS ++  ++ N   +  ++   +
Sbjct: 531 IEESVQKKKKKKKTNNNNNNNNNNDDDNNENNSSEDQYS-SEFTLKDNNNYYDDHMNMIL 589

Query: 522 TSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTV---NNPRSHGKSKKLSANKRPM 692
           TS   +E N++    +++ + +R ++  I +   S +    NN +   +   +S + +  
Sbjct: 590 TSNECNEPNKINYNNLNDSDNVRPIEGDIMNNPMSLSTHINNNDKKKLRRSSMSGSLKTY 649

Query: 693 SFGSNKDPEKFCNGVDNVKS 752
           +  + K+     N  +N+ S
Sbjct: 650 NSYNFKNMTSINNRDNNLNS 669



>gb:AJ719487_2501674 Gallus gallus mRNA for hypothetical protein,
           clone 2m10.
          Length = 398

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 3/78 (3%)
 Frame = +3

Query: 498 GGYLTYNITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSA 677
           GGY+  ++T     EL  +R+R    L  I+ LKD I     +  + N  S  + K +  
Sbjct: 5   GGYVPSDLTPEECQELENIRRRKQELLADIQRLKDEI--AEVTNEIENLGSTEERKNMQR 62

Query: 678 NKRPMSFGS---NKDPEK 722
           NK+ ++ G    N DP+K
Sbjct: 63  NKQ-VAMGRKKFNMDPKK 79



>gb:HS273N12_1997839 Human DNA sequence from clone RP1-273N12 on
           chromosome 6q16.1-16.3 Contains the FBXL4 gene for F-box
           and leucine-rich repeat protein 4 and the POU3F2 gene
           for POU domain class 3 transcription factor 2 and a CpG
           island, complete sequence.
          Length = 443

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 14/129 (10%)
 Frame = +3

Query: 324 PYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD----AYSFNQRPIESN-- 485
           P+SHPH  P   P  +    H  A+  P+ D    T   SDD    A  F QR I+    
Sbjct: 231 PHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPT---SDDLEQFAKQFKQRRIKLGFT 287

Query: 486 ----GLNFGGYL--TYNITSYTKSELNELRKRLVSELEQIRN--LKDRIESGHFSTTVNN 641
               GL  G      ++ T+  + E  +L  + + +L+ + N  L++   S    T+++ 
Sbjct: 288 QADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDK 347

Query: 642 PRSHGKSKK 668
             + G+ +K
Sbjct: 348 IAAQGRKRK 356



>gb:BC051699_1984626 Homo sapiens POU domain, class 3, transcription
           factor 2, mRNA (cDNA clone MGC:26417 IMAGE:4817001),
           complete cds.
          Length = 443

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 14/129 (10%)
 Frame = +3

Query: 324 PYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD----AYSFNQRPIESN-- 485
           P+SHPH  P   P  +    H  A+  P+ D    T   SDD    A  F QR I+    
Sbjct: 231 PHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPT---SDDLEQFAKQFKQRRIKLGFT 287

Query: 486 ----GLNFGGYL--TYNITSYTKSELNELRKRLVSELEQIRN--LKDRIESGHFSTTVNN 641
               GL  G      ++ T+  + E  +L  + + +L+ + N  L++   S    T+++ 
Sbjct: 288 QADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDK 347

Query: 642 PRSHGKSKK 668
             + G+ +K
Sbjct: 348 IAAQGRKRK 356



>gb:AE017347_1758000 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 912

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 10/101 (9%)
 Frame = +3

Query: 195 ISPPNHKNSASTLQFMASAVLASRNE--SSWAQSGDAGGGFMG--------KTPYSHPHL 344
           + P     ++  +  M+S+ L  R +  SS ++S D G  F G        +TP+ HPH 
Sbjct: 552 MDPMRRDGASQPVPIMSSSSLNPRGKKSSSVSRSRDRGHSFQGGVFPGEHGRTPFDHPHT 611

Query: 345 NPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDDAYSFNQ 467
               +P   +     A+  R +   P+ T  A + + +  Q
Sbjct: 612 LHLQDPPPPRSRSVSASRSRSSGHRPMFTFDAPELSRNLEQ 652



>gb:YSCZIP1A_1730942 Saccharomyces cerevisiae ZIP1 protein gene,
           complete cds.
          Length = 875

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +3

Query: 507 LTYNITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKR 686
           +T N+    +S+  EL ++ + ELE+I+N K    S   +     P    K    ++N  
Sbjct: 716 VTKNLQQKVQSQKRELEQK-IKELEEIKNHKRNEPSKKGTQNFTKPSDSPKKNATTSNLF 774

Query: 687 PMSFGSNKDPEKFCNGVDNV 746
           P +  +   P K C  VD++
Sbjct: 775 PNNSAAIHSPMKKCPKVDHI 794



>gb:YSCDDR48A_1728805 S.cerevisiae DDR48 gene.
          Length = 430

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 44/171 (25%), Positives = 65/171 (38%), Gaps = 6/171 (3%)
 Frame = +3

Query: 258 ASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSSNPKKKQK-HFHQAANGRPNDDSPVVTQ 434
           +++N+SS+  + D   G      Y       SSN KK      +  + G  NDDS     
Sbjct: 174 SNKNKSSYGSNNDDSYGSNNDDSYG------SSNKKKSSYGSSNNDSYGSNNDDSYGSNN 227

Query: 435 TAS-----DDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKRLVSELEQIRNLK 599
             S     DD+Y  + +   S G N       N  SY  S  N+       +     N K
Sbjct: 228 NDSYGSNNDDSYGSSNKKKSSYGSN-------NDDSYGSSNNNDSYGSNNDDSYGSSN-K 279

Query: 600 DRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKS 752
           ++   G  S   +   S+      S+NK+  S+GSN D     N  D+  S
Sbjct: 280 NKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNNDDSYGSNNDDSYGS 330



>gb:PFMAL3P2_1394451 Plasmodium falciparum MAL3P2, complete
           sequence.
          Length = 746

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 27/113 (23%), Positives = 44/113 (38%), Gaps = 3/113 (2%)
 Frame = +3

Query: 384 HQAANGRPND---DSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNEL 554
           HQ  N  P     D+  +  T     Y  N +    N  N+    T N T   +      
Sbjct: 571 HQDINQEPYTHIIDNKDIISTQKKKIYMTNMKQNNINMENYSSDTTSNDTIIYEENSKNS 630

Query: 555 RKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKD 713
               +++L    N+ +     HFS T+NNP +H   K ++ N   ++F  N +
Sbjct: 631 SLSDLTDLNINNNVSNNQHINHFSYTMNNPNNH-SIKTINQNNDNITFLYNSN 682



>pir|T51260|T51260 hypothetical protein T8M16_50 - Arabidopsis
           thaliana>gb:ATT8M16_1556486 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8M16.
          Length = 390

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 39/177 (22%), Positives = 69/177 (38%), Gaps = 14/177 (7%)
 Frame = +3

Query: 198 SPPNHKNSASTLQFMA-SAVLASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSSNPKKKQ 374
           SPP+     +T  F   S    SR     A + D      G      P  N S NPK  +
Sbjct: 7   SPPHDDGGDTTTAFRKPSNDGTSRKYRRRALADDGSSSSDGS-----PERNQSPNPKHSR 61

Query: 375 KHFH-------------QAANGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNFGGYLTY 515
           K                ++  GR   DS    + + DD Y + +     +G +       
Sbjct: 62  KDSEPVHVRKEDRWESDRSRYGRGGVDSHRHDRYSRDDNYGYKRDEYNRHGRD-----AR 116

Query: 516 NITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKR 686
           + +  ++   +  R+R+ +E  ++RN  DR     +S + +  +S+ K + LS+ +R
Sbjct: 117 STSRDSRGGRHSDRRRVETEYSRLRNDSDRSSHDKYSNSGHRVKSNEKGEDLSSGRR 173



>pir|S29334|S29334 transcription factor Brn-2 [validated] -
           human>gb:HSNOCTPOU_2019182 H.sapiens mRNA for N-Oct 3,
           N-Oct5a, and N-Oct 5b proteins.
          Length = 443

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 14/129 (10%)
 Frame = +3

Query: 324 PYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD----AYSFNQRPIESN-- 485
           P+SHPH  P   P  +    H  A+  P+ D    T   SDD    A  F QR I+    
Sbjct: 231 PHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPT---SDDLEQFAKQFKQRRIKLGFT 287

Query: 486 ----GLNFGGYL--TYNITSYTKSELNELRKRLVSELEQIRN--LKDRIESGHFSTTVNN 641
               GL  G      ++ T+  + E  +L  + + +L+ + N  L++   S    T+++ 
Sbjct: 288 QADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDK 347

Query: 642 PRSHGKSKK 668
             + G+ +K
Sbjct: 348 IAAQGRKRK 356



>pir|A49447|A49447 transcription factor Brn-2 - rat
          Length = 445

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 14/129 (10%)
 Frame = +3

Query: 324 PYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD----AYSFNQRPIESN-- 485
           P+SHPH  P   P  +    H  A+  P+ D    T   SDD    A  F QR I+    
Sbjct: 233 PHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPT---SDDLEQFAKQFKQRRIKLGFT 289

Query: 486 ----GLNFGGYL--TYNITSYTKSELNELRKRLVSELEQIRN--LKDRIESGHFSTTVNN 641
               GL  G      ++ T+  + E  +L  + + +L+ + N  L++   S    T+++ 
Sbjct: 290 QADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDK 349

Query: 642 PRSHGKSKK 668
             + G+ +K
Sbjct: 350 IAAQGRKRK 358



>pir|S55120|HHBYD8 heat shock protein DDR48 - yeast (Saccharomyces
           cerevisiae)>gb:S73336_1704482 FSP/DDR48=FSP
           [Saccharomyces cerevisiae=yeast, 747-31DU, Genomic, 2288
           nt].>gb:SC8010_1705394 S.cerevisiae chromosome XIII
           cosmid 8010.
          Length = 430

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 44/171 (25%), Positives = 65/171 (38%), Gaps = 6/171 (3%)
 Frame = +3

Query: 258 ASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSSNPKKKQK-HFHQAANGRPNDDSPVVTQ 434
           +++N+SS+  + D   G      Y       SSN KK      +  + G  NDDS     
Sbjct: 174 SNKNKSSYGSNNDDSYGSNNDDSYG------SSNKKKSSYGSSNNDSYGSNNDDSYGSNN 227

Query: 435 TAS-----DDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKRLVSELEQIRNLK 599
             S     DD+Y  + +   S G N       N  SY  S  N+       +     N K
Sbjct: 228 NDSYGSNNDDSYGSSNKKKSSYGSN-------NDDSYGSSNNNDSYGSNNDDSYGSSN-K 279

Query: 600 DRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKS 752
           ++   G  S   +   S+      S+NK+  S+GSN D     N  D+  S
Sbjct: 280 NKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNNDDSYGSNNDDSYGS 330



>sp|P31111|ZIP1_YEAST Synaptonemal complex protein
           ZIP1.>pir|S70115|S70115 ZIP1 protein - yeast
           (Saccharomyces cerevisiae)>gb:YSCD9819_1728758
           Saccharomyces cerevisiae chromosome IV cosmid 9819.
          Length = 875

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +3

Query: 507 LTYNITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKR 686
           +T N+    +S+  EL ++ + ELE+I+N K    S   +     P    K    ++N  
Sbjct: 716 VTKNLQQKVQSQKRELEQK-IKELEEIKNHKRNEPSKKGTQNFTKPSDSPKKNATTSNLF 774

Query: 687 PMSFGSNKDPEKFCNGVDNV 746
           P +  +   P K C  VD++
Sbjct: 775 PNNSAAIHSPMKKCPKVDHI 794



>sp|P31360|PO32_MOUSE POU domain, class 3, transcription factor 2
           (Nervous-system specific octamer-binding transcription
           factor N-Oct-3) (Brain-specific homeobox/POU domain
           protein 2) (Brain-2) (Brn-2 protein).>pir|S31224|S31224
           transcription factor Brn-2 - mouse>gb:MUSPOUDOMB_2129695
           Mouse brain-2 POU-domain protein, complete cds.
          Length = 445

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 14/129 (10%)
 Frame = +3

Query: 324 PYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD----AYSFNQRPIESN-- 485
           P+SHPH  P   P  +    H  A+  P+ D    T   SDD    A  F QR I+    
Sbjct: 233 PHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPT---SDDLEQFAKQFKQRRIKLGFT 289

Query: 486 ----GLNFGGYL--TYNITSYTKSELNELRKRLVSELEQIRN--LKDRIESGHFSTTVNN 641
               GL  G      ++ T+  + E  +L  + + +L+ + N  L++   S    T+++ 
Sbjct: 290 QADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDK 349

Query: 642 PRSHGKSKK 668
             + G+ +K
Sbjct: 350 IAAQGRKRK 358



>sp|P20265|PO32_HUMAN POU domain, class 3, transcription factor 2
           (Nervous-system specific octamer-binding transcription
           factor N-Oct-3) (Brain-specific homeobox/POU domain
           protein 2) (Brain-2) (Brn-2 protein).>gb:HUMNOCT_2035168
           Homo sapiens POU-domain transcription factor (N-Oct-3),
           complete cds.
          Length = 443

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 14/129 (10%)
 Frame = +3

Query: 324 PYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDD----AYSFNQRPIESN-- 485
           P+SHPH  P   P  +    H  A+  P+ D    T   SDD    A  F QR I+    
Sbjct: 231 PHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPT---SDDLEQFAKQFKQRRIKLGFT 287

Query: 486 ----GLNFGGYL--TYNITSYTKSELNELRKRLVSELEQIRN--LKDRIESGHFSTTVNN 641
               GL  G      ++ T+  + E  +L  + + +L+ + N  L++   S    T+++ 
Sbjct: 288 QADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDK 347

Query: 642 PRSHGKSKK 668
             + G+ +K
Sbjct: 348 IAAQGRKRK 356



>sp|P18899|DR48_YEAST DDR48 stress protein (DNA damage-responsive
           protein 48) (DDRP 48) (YP 75) (Flocculent specific
           protein).
          Length = 429

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 44/171 (25%), Positives = 65/171 (38%), Gaps = 6/171 (3%)
 Frame = +3

Query: 258 ASRNESSWAQSGDAGGGFMGKTPYSHPHLNPSSNPKKKQK-HFHQAANGRPNDDSPVVTQ 434
           +++N+SS+  + D   G      Y       SSN KK      +  + G  NDDS     
Sbjct: 173 SNKNKSSYGSNNDDSYGSNNDDSYG------SSNKKKSSYGSSNNDSYGSNNDDSYGSNN 226

Query: 435 TAS-----DDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKRLVSELEQIRNLK 599
             S     DD+Y  + +   S G N       N  SY  S  N+       +     N K
Sbjct: 227 NDSYGSNNDDSYGSSNKKKSSYGSN-------NDDSYGSSNNNDSYGSNNDDSYGSSN-K 278

Query: 600 DRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSNKDPEKFCNGVDNVKS 752
           ++   G  S   +   S+      S+NK+  S+GSN D     N  D+  S
Sbjct: 279 NKSSYGSSSNDDSYGSSNNDDSYGSSNKKKSSYGSNNDDSYGSNNDDSYGS 329



>gb:NC3H10_1688525 Neurospora crassa DNA linkage group V Cosmid
           contig 3H10.
          Length = 1736

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 39/143 (27%), Positives = 54/143 (37%), Gaps = 2/143 (1%)
 Frame = +3

Query: 318 KTPYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDDAYSFNQRPIESN--GL 491
           +TP      +PS +P +       A NG   D    VT T   DA S    P++S    +
Sbjct: 288 QTPSDLRGESPSRHPTEA------AVNGHAKDSDRDVTMT---DAPSVPAPPVKSGFTAI 338

Query: 492 NFGGYLTYNITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKL 671
           N GG+   N      S    + + L    E I  L         S+  N P     +   
Sbjct: 339 NTGGFTAIN------SGFTSINRPLAPASEAITPL---------SSAKNTPEVRPSAAGS 383

Query: 672 SANKRPMSFGSNKDPEKFCNGVD 740
           S+ KR +SF S  D  K  + VD
Sbjct: 384 SSLKRQLSFDSTSDSAKKESSVD 406



>gb:AE016959_1022826 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017099_1752645
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 53 of 77 of the complete sequence.
          Length = 417

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +3

Query: 534 KSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKLSANKRPMSFGSN-- 707
           K  +N+L    V E E+++  +DRIES H S T NN +   KSK+    + P+    N  
Sbjct: 188 KWTVNKLISHCVQEEERLK--QDRIESAHLSMTSNNKKR--KSKEAVDVQPPLKKRENNC 243

Query: 708 -KDPEKFCNGVDNVK 749
            ++P  FC    ++K
Sbjct: 244 GEEPCYFCKKEGHMK 258



>gb:AE014186_938131 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014838_1228865 Plasmodium falciparum 3D7
            chromosome 11 section 3 of 8 of the complete sequence.
          Length = 2966

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)
 Frame = +3

Query: 354  SNPKKKQKHFHQAANGRPNDDSPVVTQTASDDAYSFNQRPIESNGLNF--GGYLTYNITS 527
            SN +   K+ +     R   DS  +    SDDAYS  Q+  E NG++   G  L  ++  
Sbjct: 2533 SNLRSYNKNMNNNHAQRDQYDSDTLNSEGSDDAYSSMQQNFEKNGIDSFKGKGLHVSLRE 2592

Query: 528  YTKSELNELRKRLVSELEQIRNLKD 602
                E+ E  K  +  L ++++ KD
Sbjct: 2593 RIIIEIMESAKNGIDGLLKLKDSKD 2617



>gb:AY596297_633987 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 776

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +3

Query: 426 VTQTASDDAYSFNQRPIESNGLNFGGYLTYNITSYTKSELNELRKRLVSELEQIRNLKDR 605
           VT T+ D A +F+ R  ++ G   G  +   + S +   L  L KR V  L+Q+R+  +R
Sbjct: 276 VTVTSLDTAQAFSVR--DTVGQTVGLLVLLALVSLSAVGL-VLGKRTVDPLKQLRDRAER 332

Query: 606 IESGHFSTTVNNPRS 650
           IE+G+F   ++  R+
Sbjct: 333 IEAGNFDVDLSTNRA 347



>pir|T48727|T48727 retinoblastoma binding protein 2 related protein
           [imported] - Neurospora crassa (fragment)
          Length = 1009

 Score = 32.7 bits (73), Expect = 8.7
 Identities = 39/143 (27%), Positives = 54/143 (37%), Gaps = 2/143 (1%)
 Frame = +3

Query: 318 KTPYSHPHLNPSSNPKKKQKHFHQAANGRPNDDSPVVTQTASDDAYSFNQRPIESN--GL 491
           +TP      +PS +P +       A NG   D    VT T   DA S    P++S    +
Sbjct: 296 QTPSDLRGESPSRHPTEA------AVNGHAKDSDRDVTMT---DAPSVPAPPVKSGFTAI 346

Query: 492 NFGGYLTYNITSYTKSELNELRKRLVSELEQIRNLKDRIESGHFSTTVNNPRSHGKSKKL 671
           N GG+   N      S    + + L    E I  L         S+  N P     +   
Sbjct: 347 NTGGFTAIN------SGFTSINRPLAPASEAITPL---------SSAKNTPEVRPSAAGS 391

Query: 672 SANKRPMSFGSNKDPEKFCNGVD 740
           S+ KR +SF S  D  K  + VD
Sbjct: 392 SSLKRQLSFDSTSDSAKKESSVD 414


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 830,085,807
Number of Sequences: 1806583
Number of extensions: 16620076
Number of successful extensions: 49169
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 43942
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48590
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55754781230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)