BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7048
         (645 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB196698_1529694 Daucus carota DcNLP gene for nucellin-like p...   206   3e-52   
gb:AK118764_1816726 Arabidopsis thaliana At4g33490 mRNA for puta...   175   5e-43   
gb:AY086376_1571425 Arabidopsis thaliana clone 24738 mRNA, compl...   175   5e-43   
pir|T06000|T06000 aspartic proteinase homolog F17M5.250 - Arabid...   175   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AP004888_1846669 Oryza sativa (japonica cultivar-group) genom...   142   4e-33   
gb:AP003575_1831154 Oryza sativa (japonica cultivar-group) genom...   132   7e-30   
gb:AY115563_1578815 Zea mays nucellin-like aspartic protease mRN...   126   4e-28   
pir|F96505|F96505 probable nucellin [imported] - Arabidopsis tha...   125   6e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AF308691_1784822 Oryza sativa nucellin-like protein (OSAP1) g...   121   1e-26   
gb:AY062662_1565318 Arabidopsis thaliana nucellin-like protein (...   118   8e-26   
gb:AY043217_1560979 Oryza sativa aspartyl proteinase (Asp1) mRNA...   118   1e-25   
gb:AY043216_1560978 Oryza sativa aspartyl proteinase (Asp1) gene...   118   1e-25   
pir|B96804|B96804 nucellin-like protein, 27671-25467 [imported] ...   115   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AE005173_892848 Arabidopsis thaliana chromosome 1, bottom arm...   109   5e-23   
pir|T06213|T06213 probable aspartic proteinase (EC 3.4.23.-) - b...    96   7e-19   Hordeum vulgare [barley]
pir|T04372|T04372 protein EEA1 - barley>gb:AF017430_1761550 Hord...    94   2e-18   Hordeum vulgare [barley]
gb:AP003811_1833697 Oryza sativa (japonica cultivar-group) genom...    82   6e-15   
gb:AP004585_1841901 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
pir|D86385|D86385 hypothetical protein F2J7.6 - Arabidopsis thal...    71   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP005065_1847445 Oryza sativa (japonica cultivar-group) genom...    70   2e-11   
gb:AP005065_1847447 Oryza sativa (japonica cultivar-group) genom...    70   3e-11   
gb:OSJN00013_1693275 Oryza sativa genomic DNA, chromosome 4, BAC...    70   4e-11   
gb:ATAC018363_1543693 Arabidopsis thaliana chromosome III BAC F1...    70   4e-11   
gb:AB026661_1517394 Arabidopsis thaliana genomic DNA, chromosome...    70   4e-11   
gb:AP005393_1850992 Oryza sativa (japonica cultivar-group) genom...    69   7e-11   
gb:AP005392_1850977 Oryza sativa (japonica cultivar-group) genom...    69   7e-11   
gb:CQ974046_1455432 Sequence 5 from Patent WO2004113520.               68   1e-10   
gb:AP006164_1861182 Oryza sativa (japonica cultivar-group) genom...    67   2e-10   
gb:AP003344_1828372 Oryza sativa (japonica cultivar-group) genom...    67   2e-10   
gb:AY080874_1568558 Arabidopsis thaliana putative chloroplast nu...    67   2e-10   
gb:AB026658_1517372 Arabidopsis thaliana genomic DNA, chromosome...    67   2e-10   
gb:AP002913_1823914 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
gb:OSJN00129_1695367 Oryza sativa genomic DNA, chromosome 4, BAC...    67   3e-10   
pir|B86193|B86193 hypothetical protein [imported] - Arabidopsis ...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AP005393_1850995 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
gb:OSJN00021_1693429 Oryza sativa genomic DNA, chromosome 4, BAC...    66   4e-10   
pir|E96676|E96676 hypothetical protein T23K8.15 [imported] - Ara...    65   8e-10   Arabidopsis thaliana [mouse-ear cress]
pir|C84783|C84783 probable proteinase [imported] - Arabidopsis t...    65   1e-09   Arabidopsis thaliana [mouse-ear cress]
pir|E86440|E86440 probable chloroplast nucleoid DNA binding prot...    64   3e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY092970_1574924 Arabidopsis thaliana unknown protein (At1g08...    63   4e-09   
gb:AB114915_1527503 Nepenthes gracilis nep2 mRNA for aspartic pr...    63   4e-09   
gb:AY088528_1573546 Arabidopsis thaliana clone 7567 mRNA, comple...    62   6e-09   
gb:AC006580_1534488 Arabidopsis thaliana chromosome 2 clone F23E...    62   6e-09   
pir|T08860|T08860 hypothetical protein A_TM017A05.8 - Arabidopsi...    62   6e-09   Arabidopsis thaliana [mouse-ear cress]
pir|C86143|C86143 hypothetical protein F6F3.10 - Arabidopsis tha...    62   6e-09   Arabidopsis thaliana [mouse-ear cress]
pir|E84860|E84860 hypothetical protein At2g42980 [imported] - Ar...    62   6e-09   Arabidopsis thaliana [mouse-ear cress]
pir|B84556|B84556 hypothetical protein At2g17760 [imported] - Ar...    62   6e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY069886_1566629 Arabidopsis thaliana putative chloroplast nu...    62   8e-09   
gb:AE005172_889828 Arabidopsis thaliana chromosome 1, top arm co...    62   8e-09   
pir|T47313|T47313 hypothetical protein T32A11.120 - Arabidopsis ...    62   8e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AP004891_1846727 Oryza sativa (japonica cultivar-group) genom...    62   1e-08   
pir|T02706|T02706 hypothetical protein At2g03200 [imported] - Ar...    62   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP003292_1827426 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
gb:AY075656_1567795 Arabidopsis thaliana AT5g10770/T30N20_40 mRN...    61   2e-08   
pir|T50786|T50786 nucleoid DNA-binding protein cnd41-like protei...    61   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AY243479_1592423 Arabidopsis thaliana CDR1 mRNA, complete cds.      60   2e-08   
gb:AP003616_1831469 Oryza sativa (japonica cultivar-group) genom...    60   3e-08   
gb:AP004040_1836747 Oryza sativa (japonica cultivar-group) genom...    60   4e-08   
gb:AC136216_1742995 Oryza sativa (japonica cultivar-group) chrom...    60   4e-08   
gb:AC105260_1737887 Oryza sativa (japonica cultivar-group) chrom...    60   4e-08   
gb:OSJN00083_1694585 Oryza sativa genomic DNA, chromosome 4, BAC...    60   4e-08   
gb:BT003814_1636945 Arabidopsis thaliana clone C105394 unknown p...    59   5e-08   
gb:ATF24M12_1549974 Arabidopsis thaliana DNA chromosome 3, BAC c...    59   5e-08   
pir|E96671|E96671 hypothetical protein F13O11.13 [imported] - Ar...    59   5e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T45766|T45766 hypothetical protein F24M12.390 - Arabidopsis ...    59   5e-08   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00021_1693426 Oryza sativa genomic DNA, chromosome 4, BAC...    59   7e-08   
gb:AC005313_1532547 Arabidopsis thaliana chromosome 2 clone T18E...    59   7e-08   
gb:AP003846_1834158 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
gb:AP003504_1830005 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
pir|F84679|F84679 hypothetical protein At2g28010 [imported] - Ar...    59   9e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AB114914_1527502 Nepenthes gracilis nep1 mRNA for aspartic pr...    58   1e-07   
gb:AP004758_1844545 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
pir|T45858|T45858 hypothetical protein F3A4.130 - Arabidopsis th...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP006164_1861170 Oryza sativa (japonica cultivar-group) genom...    57   2e-07   
gb:AP002524_1822386 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
pir|T47790|T47790 hypothetical protein F17J16.130 - Arabidopsis ...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BT015344_1642172 Arabidopsis thaliana At5g22850 gene, complet...    57   4e-07   
gb:AC005170_1532294 Arabidopsis thaliana chromosome 2 clone T29E...    57   4e-07   
gb:AB005243_1509532 Arabidopsis thaliana genomic DNA, chromosome...    57   4e-07   
gb:AP004774_1844838 Oryza sativa (japonica cultivar-group) genom...    56   5e-07   
pir|T01996|T01996 nucleoid DNA-binding protein cnd41, chloroplas...    56   5e-07   Nicotiana tabacum [American tobacco]
gb:AP004040_1836748 Oryza sativa (japonica cultivar-group) genom...    56   6e-07   
gb:AP001313_1821180 Arabidopsis thaliana genomic DNA, chromosome...    56   6e-07   
gb:AP004040_1836743 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP006753_1862862 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AP003811_1833698 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AB008267_1510437 Arabidopsis thaliana genomic DNA, chromosome...    55   1e-06   
gb:AP006149_1860977 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AF083666_1766898 Arabidopsis thaliana clone sps3 unknown mRNA.      54   2e-06   
pir|T50785|T50785 nucleoid DNA-binding protein cnd41-like protei...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP006753_1862863 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AP005420_1851518 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AB026442S2_1516991 Nicotiana sylvestris gene for 41 kD chloro...    54   2e-06   
gb:AP003564_1830874 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
pir|T50012|T50012 hypothetical protein T31P16.70 - Arabidopsis t...    54   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AB109206_1526817 Oryza sativa (japonica cultivar-group) genom...    53   4e-06   
pir|H84679|H84679 hypothetical protein At2g28030 [imported] - Ar...    53   5e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T08979|T08979 hypothetical protein F6G3.60 - Arabidopsis tha...    52   9e-06   Arabidopsis thaliana [mouse-ear cress]
pir|C84682|C84682 hypothetical protein At2g28220 [imported] - Ar...    52   9e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T45765|T45765 hypothetical protein F24M12.380 - Arabidopsis ...    52   9e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AY039899_1560413 Arabidopsis thaliana AT3g61820/F15G16_210 mR...    52   1e-05   
pir|T47974|T47974 hypothetical protein F15G16.210 - Arabidopsis ...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY090445_1574134 Arabidopsis thaliana At1g79720/F19K16_30 mRN...    51   1e-05   
gb:AY088536_1573554 Arabidopsis thaliana clone 7650 mRNA, comple...    51   1e-05   
pir|B96828|B96828 probable aspartyl proteinase, 105611-106921 [i...    51   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP003216_1825398 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:OSJN00013_1693276 Oryza sativa genomic DNA, chromosome 4, BAC...    51   2e-05   
pir|T08980|T08980 hypothetical protein F6G3.70 - Arabidopsis tha...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP006753_1862867 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:BT002746_1636349 Arabidopsis thaliana clone C105368 unknown p...    50   4e-05   
pir|T45764|T45764 hypothetical protein F24M12.370 - Arabidopsis ...    50   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023639 Oryza sativa (japonica cultivar-group) chrom...    49   6e-05   
gb:AP004040_1836744 Oryza sativa (japonica cultivar-group) genom...    49   7e-05   
gb:AY536047_1612315 Fagopyrum esculentum aspartic protease-like ...    49   7e-05   
gb:AC074196_1541248 Oryza sativa chromosome 10 BAC OSJNBa0040D23...    49   7e-05   
gb:AE016959_1023651 Oryza sativa (japonica cultivar-group) chrom...    49   7e-05   
gb:AE016959_1023650 Oryza sativa (japonica cultivar-group) chrom...    49   7e-05   
gb:AP003458_1829828 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
pir|T10194|T10194 hypothetical protein F25G13.10 - Arabidopsis t...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023647 Oryza sativa (japonica cultivar-group) chrom...    48   2e-04   
gb:AY088920_1573928 Arabidopsis thaliana clone 99625 mRNA, compl...    47   2e-04   
gb:AB025630_1516552 Arabidopsis thaliana genomic DNA, chromosome...    47   2e-04   
gb:AE016959_1023645 Oryza sativa (japonica cultivar-group) chrom...    47   2e-04   
pir|F96686|F96686 unknown protein F15E12.7 [imported] - Arabidop...    47   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP006164_1861185 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AY070426_1566822 Arabidopsis thaliana unknown protein (At3g12...    47   3e-04   
gb:AB024033_1515784 Arabidopsis thaliana genomic DNA, chromosome...    47   3e-04   
gb:AP003457_1829791 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AE016959_1023644 Oryza sativa (japonica cultivar-group) chrom...    47   4e-04   
gb:OSJN00123_1695270 Oryza sativa genomic DNA, chromosome 4, BAC...    46   5e-04   
gb:BT003834_1636963 Arabidopsis thaliana clone RAFL15-11-N13 (R2...    45   8e-04   
gb:AB019224_1514045 Arabidopsis thaliana genomic DNA, chromosome...    45   8e-04   
pir|A84680|A84680 hypothetical protein At2g28040 [imported] - Ar...    45   8e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP004585_1841902 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
pir|T48240|T48240 hypothetical protein T7H20.240 - Arabidopsis t...    45   0.001   Arabidopsis thaliana [mouse-ear cress]
pir|T04698|T04698 hypothetical protein F4B14.150 - Arabidopsis t...    45   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:AP006064_1860791 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:AE016959_1023642 Oryza sativa (japonica cultivar-group) chrom...    45   0.001   
gb:AP003335_1828166 Oryza sativa (japonica cultivar-group) genom...    44   0.002   
gb:AC091774_1735050 Oryza sativa chromosome 6 BAC OJ1540_H01 gen...    44   0.003   
gb:OSJN00092_1694767 Oryza sativa genomic DNA, chromosome 4, BAC...    44   0.003   
gb:BX538352_1359028 Cryptosporidium parvum chromosome 6, complet...    44   0.003   
gb:AE016959_1023638 Oryza sativa (japonica cultivar-group) chrom...    44   0.003   
gb:AK118359_1816342 Arabidopsis thaliana At2g39710 mRNA for unkn...    42   0.007   
gb:AC003000_1530914 Arabidopsis thaliana chromosome 2 clone T5I7...    42   0.007   
pir|T01000|T01000 hypothetical protein At2g39710 [imported] - Ar...    42   0.007   Arabidopsis thaliana [mouse-ear cress]
gb:AP003240_1826050 Oryza sativa (japonica cultivar-group) genom...    42   0.012   
gb:AY088661_1573677 Arabidopsis thaliana clone 8987 mRNA, comple...    42   0.012   
pir|T47599|T47599 nucleoid DNA-binding-like protein - Arabidopsi...    42   0.012   Arabidopsis thaliana [mouse-ear cress]
gb:AP003457_1829804 Oryza sativa (japonica cultivar-group) genom...    41   0.015   
gb:AP003456_1829754 Oryza sativa (japonica cultivar-group) genom...    41   0.015   
gb:AF370291_1792176 Arabidopsis thaliana unknown protein (At1g09...    41   0.015   
pir|D86231|D86231 hypothetical protein [imported] - Arabidopsis ...    41   0.015   Arabidopsis thaliana [mouse-ear cress]
gb:AC135207_1742049 Oryza sativa (japonica cultivar-group) chrom...    41   0.020   
gb:AP003919_1835235 Oryza sativa (japonica cultivar-group) genom...    40   0.026   
gb:AY584109_1339155 Plasmodium vivax isolate KOR 21 aspartic pro...    40   0.026   
gb:AY584090_1339136 Plasmodium vivax isolate KOR 1 aspartic prot...    40   0.026   
gb:BC089070_2566036 Xenopus tropicalis cDNA clone MGC:107756 IMA...    40   0.034   
gb:PFMAL13_1191311 Plasmodium falciparum 3D7 chromosome 13, *** ...    40   0.034   
gb:OSJN00082_1694563 Oryza sativa genomic DNA, chromosome 4, BAC...    40   0.045   
gb:AY507155_1610023 Botryotinia fuckeliana aspartic proteinase p...    40   0.045   
gb:AB045892_1520469 Nepenthes alata NaAP2 mRNA for aspartic prot...    39   0.058   
gb:ETE293829_1384941 Eimeria tenella mRNA for aspartyl proteinas...    39   0.058   
gb:AE016959_1023648 Oryza sativa (japonica cultivar-group) chrom...    39   0.058   
pir|S35971|S35971 aspartic proteinase - Eimeria acervulina>gb:EA...    39   0.058   Eimeria acervulina
sp|P16476|PEPE_CHICK|PEPE_CHICK Embryonic pepsinogen precursor (EC 3.4.23.-...    39   0.058   Gallus gallus [bantam]
gb:BC075134_2558247 Xenopus laevis hypothetical protein LOC44372...    39   0.076   
gb:RCHRCAPAA_1703371 Rhizopus chinensis (clone 36c6) rhizopuspep...    39   0.099   
gb:ATU51036_1557064 Arabidopsis thaliana aspartic proteinase mRN...    39   0.099   
gb:AB010697_1511205 Arabidopsis thaliana genomic DNA, chromosome...    39   0.099   
gb:AE016959_1023646 Oryza sativa (japonica cultivar-group) chrom...    39   0.099   
pir|F86253|F86253 hypothetical protein [imported] - Arabidopsis ...    39   0.099   Arabidopsis thaliana [mouse-ear cress]
pir|A41415|A41415 rhizopuspepsin (EC 3.4.23.21) I - Rhizopus chi...    39   0.099   Rhizopus microsporus var. chinensis
sp|Q800A0|CATE_RANCA|CATE_RANCA Cathepsin E precursor (EC 3.4.23.34).>gb:AB...    39   0.099   Rana catesbeiana [bullfrog]
gb:BC061433_2553207 Xenopus tropicalis hypothetical protein MGC7...    38   0.13    
gb:AP004368_1840906 Oryza sativa (japonica cultivar-group) genom...    38   0.13    
gb:AC120987_1740015 Oryza sativa (japonica cultivar-group) chrom...    38   0.13    
sp|P25796|CATE_CAVPO|CATE_CAVPO Cathepsin E precursor (EC 3.4.23.34).>pir|A...    38   0.13    Cavia porcellus [guinea pig]
gb:AB179548_2466900 Takifugu rubripes CTSD1 mRNA for cathepsin D...    38   0.17    
gb:MMU9840_2124221 Mus musculus cathepsin E gene, exon 1, partial.     38   0.17    
gb:MMCATHEPE_2114425 M.musculus gene encoding cathepsin E.             38   0.17    
gb:ATT19K4_1554809 Arabidopsis thaliana DNA chromosome 4, BAC cl...    38   0.17    
sp|P70269|CATE_MOUSE|CATE_MOUSE Cathepsin E precursor (EC 3.4.23.34).>gb:BC...    38   0.17    Mus musculus [mouse]
sp|P55956|ASP3_CAEEL|ASP3_CAEEL Aspartic protease 3 precursor (EC 3.4.23.-)...    38   0.17    Caenorhabditis elegans [roundworm]
gb:CHAJ7878_2568700 Chionodraco hamatus mRNA for cathepsin D.          37   0.22    
gb:AB179549_2466901 Takifugu rubripes CTSD2 mRNA for cathepsin D...    37   0.22    
gb:AY054167_1562989 Arabidopsis thaliana AT4g16560/dl4305c mRNA,...    37   0.22    
gb:AB047247_1408438 Suncus murinus pgnC mRNA for pepsinogen C, c...    37   0.22    
pir|F71432|F71432 hypothetical protein - Arabidopsis thaliana>gb...    37   0.22    Arabidopsis thaliana [mouse-ear cress]
gb:AB188676_2049773 Octodon degus PgC mRNA for pepsinogen C, par...    37   0.29    
gb:AF082029_1766571 Hemerocallis hybrid cultivar senescence-asso...    37   0.29    
gb:BX842625_1643833 Neurospora crassa DNA linkage group I BAC cl...    37   0.29    
gb:BC088063_2565575 Xenopus tropicalis hypothetical LOC496913, m...    37   0.38    
sp|P43232|CAR5_RHINI|CAR5_RHINI Rhizopuspepsin 5 precursor (EC 3.4.23.21) (...    37   0.38    Rhizopus niveus
gb:AJ586914_1811853 Physcomitrella patens mRNA for putative vacu...    36   0.49    
gb:RCHRHIZ_1703374 Rhizopus microsporus var. chinensis rhizopusp...    36   0.49    
gb:RCHPEP_1703366 Rhizopus chinensis rhizopuspepsin isozyme pI 5...    36   0.49    
gb:AB188678_1411106 Monodelphis domestica PgC mRNA for pepsinoge...    36   0.49    
pir|JC7573|JC7573 pepsinogen C - African clawed frog>gb:AB045379...    36   0.49    Xenopus laevis [clawed frog]
pir|S66466|S66466 cathepsin E (EC 3.4.23.34) precursor (clone pT...    36   0.49    Rattus norvegicus [brown rat]
pir|A26681|A26681 rhizopuspepsin (EC 3.4.23.21) II precursor - R...    36   0.49    Rhizopus microsporus var. chinensis
sp|P06026|CARP_RHICH|CARP_RHICH Rhizopuspepsin precursor (EC 3.4.23.21).>gb...    36   0.49    Rhizopus microsporus var. chinensis
gb:AB103479_2465049 Xenopus laevis mRNA for cathepsin D, complet...    36   0.64    
gb:HUMPEPC9_2035576 Human pepsinogen C gene, exon 9, clone cosHP...    36   0.64    
gb:AC108501_1738496 Oryza sativa (japonica cultivar-group) chrom...    36   0.64    
gb:CR382130_1663016 Yarrowia lipolytica chromosome D of strain C...    36   0.64    
gb:CR382130_1662358 Yarrowia lipolytica chromosome D of strain C...    36   0.64    
pir|S19683|PEMQCJ gastricsin (EC 3.4.23.3) precursor - Japanese ...    36   0.64    
sp|P03955|PEPC_MACFU|PEPC_MACFU Gastricsin precursor (EC 3.4.23.3) (Pepsino...    36   0.64    Macaca fuscata fuscata
sp|P20142|PEPC_HUMAN|PEPC_HUMAN Gastricsin precursor (EC 3.4.23.3) (Pepsino...    36   0.64    Homo sapiens [man]
sp|Q64411|PEPC_CAVPO|PEPC_CAVPO Gastricsin precursor (EC 3.4.23.3) (Pepsino...    36   0.64    Cavia porcellus [guinea pig]
sp|O04057|ASPR_CUCPE|ASPR_CUCPE Aspartic proteinase precursor (EC 3.4.23.-)...    36   0.64    Cucurbita pepo
gb:BC072252_2556506 Xenopus laevis MGC82347 protein, mRNA (cDNA ...    35   0.84    
gb:AF115925_2474823 Hynobius leechii cathepsin D mRNA, complete ...    35   0.84    
gb:BC062002_2104778 Rattus norvegicus cathepsin E, mRNA (cDNA cl...    35   0.84    
gb:AB045891_1520468 Nepenthes alata NaAP1 mRNA for aspartic prot...    35   0.84    
gb:AB047249_1408440 Rhinolophus ferrumequinum pgnC mRNA for peps...    35   0.84    
gb:CEU34889_1368509 Caenorhabditis elegans aspartic protease (Ce...    35   0.84    
pir|T29412|T29412 hypothetical protein F21F8.3 - Caenorhabditis ...    35   0.84    Caenorhabditis elegans [roundworm]
sp|Q9N2D3|PEPC_CALJA|PEPC_CALJA Gastricsin precursor (EC 3.4.23.3) (Pepsino...    35   0.84    Callithrix jacchus [common marmoset]
sp|P16228|CATE_RAT|CATE_RAT Cathepsin E precursor (EC 3.4.23.34).>pir|S66...    35   0.84    Rattus norvegicus [brown rat]
sp|Q05744|CATD_CHICK|CATD_CHICK Cathepsin D precursor (EC 3.4.23.5).>pir|I5...    35   0.84    Gallus gallus [bantam]
gb:AP003681_1831917 Oryza sativa (japonica cultivar-group) genom...    35   1.1     
gb:AP003286_1827279 Oryza sativa (japonica cultivar-group) genom...    35   1.1     
gb:CR382132_1666068 Yarrowia lipolytica chromosome F of strain C...    35   1.1     
gb:CAPRA_1645107 Candida albicans gene for aspartyl proteinase (...    35   1.1     
gb:AF192330_1415864 Bos taurus pregnancy-associated glycoprotein...    35   1.1     
gb:AF020510_1411850 Bos taurus pregnancy-associated glycoprotein...    35   1.1     
gb:AB099092_1410415 Bos taurus mRNA for similar to pregnancy-ass...    35   1.1     
gb:AB099072_1410395 Bos taurus mRNA for similar to aspartic prot...    35   1.1     
gb:AB099069_1410392 Bos taurus mRNA for similar to aspartic prot...    35   1.1     
gb:AB099002_1410325 Bos taurus mRNA for similar to aspartic prot...    35   1.1     
gb:AB098984_1410307 Bos taurus mRNA for similar to aspartic prot...    35   1.1     
gb:AB098961_1410284 Bos taurus mRNA for similar to pregnancy-ass...    35   1.1     
gb:AB098894_1410217 Bos taurus mRNA for similar to aspartic prot...    35   1.1     
gb:AB098892_1410215 Bos taurus mRNA for similar to aspartic prot...    35   1.1     
gb:AB047248_1408439 Sorex unguiculatus pgnC mRNA for pepsinogen ...    35   1.1     
gb:AC116918_1206373 Dictyostelium discoideum chromosome 2 map 61...    35   1.1     
pir|T29692|T29692 hypothetical protein T18H9.2 - Caenorhabditis ...    35   1.1     Caenorhabditis elegans [roundworm]
pir|S03433|S03433 candidapepsin (EC 3.4.23.24) precursor - yeast...    35   1.1     Candida albicans
sp|Q28057|PAG2_BOVIN|PAG2_BOVIN Pregnancy-associated glycoprotein 2 precurs...    35   1.1     Bos taurus [bovine]
gb:BT007637_2150569 Synthetic construct Homo sapiens cathepsin D...    35   1.4     
gb:BX571818_1991856 Human DNA sequence from clone RP11-38J22 on ...    35   1.4     
gb:AP003286_1827280 Oryza sativa (japonica cultivar-group) genom...    35   1.4     
gb:AF162132_1773469 Coccidioides immitis aspartyl proteinase (PE...    35   1.4     
gb:BOASPPR_1633735 B.oleracea mRNA for aspartic protease.              35   1.4     
gb:AB045893_1520470 Nepenthes alata NaAP3 mRNA for aspartic prot...    35   1.4     
gb:AY792822_1433902 Sus scrofa cathepsin D protein mRNA, partial...    35   1.4     
gb:AY509872_1430694 Odocoileus virginianus pregnancy-associated ...    35   1.4     
gb:AB099067_1410390 Bos taurus mRNA for similar to aspartic prot...    35   1.4     
gb:AB082936_1409244 Canis familiaris PgnB mRNA for pepsinogen B,...    35   1.4     
gb:AY583214_1339040 Toxoplasma gondii toxomepsin 2 mRNA, complet...    35   1.4     
gb:CR858646_1182806 Pongo pygmaeus mRNA; cDNA DKFZp469J0315 (fro...    35   1.4     
gb:BX248360_763366 Corynebacterium diphtheriae gravis NCTC13129,...    35   1.4     
pir|T07915|T07915 probable aspartic proteinase (EC 3.4.23.-) 1 -...    35   1.4     Brassica napus [oilseed rape]
pir|JC7272|JC7272 aspartic proteinase (EC 3.4.23.-) - common sun...    35   1.4     Helianthus annuus
pir|A42038|A34401 cathepsin E (EC 3.4.23.34) precursor - human>g...    35   1.4     
pir|A92425|KHPGD cathepsin D (EC 3.4.23.5) - pig                       35   1.4     
sp|P43159|CATE_RABIT|CATE_RABIT Cathepsin E precursor (EC 3.4.23.34).>pir|S...    35   1.4     Oryctolagus cuniculus [domestic rabbit]
sp|P14091|CATE_HUMAN|CATE_HUMAN Cathepsin E precursor (EC 3.4.23.34).             35   1.4     Homo sapiens [man]
sp|P00795|CATD_PIG|CATD_PIG Cathepsin D (EC 3.4.23.5).                          35   1.4     Sus scrofa [pigs]
sp|P07339|CATD_HUMAN|CATD_HUMAN Cathepsin D precursor (EC 3.4.23.5).>pir|A2...    35   1.4     Homo sapiens [man]
gb:BC062032_2104808 Rattus norvegicus cathepsin D, mRNA (cDNA cl...    34   1.9     
gb:CR380959_1653744 Candida glabrata strain CBS138 chromosome M ...    34   1.9     
gb:NAM245458_1390647 Necator americanus mRNA for necepsin I (ncp...    34   1.9     
gb:AF420068_1269479 Clonorchis sinensis aspartic protease mRNA, ...    34   1.9     
gb:BX572596_800589 Rhodopseudomonas palustris CGA009 complete ge...    34   1.9     
pir|C38302|C38302 pepsin (EC 3.4.23.-) II-2/3 precursor - rabbit       34   1.9     Oryctolagus cuniculus [domestic rabbit]
sp|P28713|PEP4_RABIT|PEP4_RABIT Pepsin II-4 precursor (EC 3.4.23.1) (Pepsin...    34   1.9     Oryctolagus cuniculus [domestic rabbit]
sp|P27821|PEP2_RABIT|PEP2_RABIT Pepsin II-2/3 precursor (EC 3.4.23.1) (Peps...    34   1.9     Oryctolagus cuniculus [domestic rabbit]
sp|Q805F2|CTE2_XENLA|CTE2_XENLA Cathepsin E2 precursor (EC 3.4.23.34).>gb:A...    34   1.9     Xenopus laevis [clawed frog]
sp|Q805F3|CTE1_XENLA|CTE1_XENLA Cathepsin E1 precursor (EC 3.4.23.34).>gb:A...    34   1.9     Xenopus laevis [clawed frog]
sp|P24268|CATD_RAT|CATD_RAT Cathepsin D precursor (EC 3.4.23.5).>pir|S131...    34   1.9     Rattus norvegicus [brown rat]
sp|P10977|CARV_CANAL|CARV_CANAL Vacuolar aspartic protease precursor (EC 3....    34   1.9     Candida albicans
sp|P10602|CAR1_RHINI|CAR1_RHINI Rhizopuspepsin 1 precursor (EC 3.4.23.21) (...    34   1.9     Rhizopus niveus
gb:AY102037_2143888 Mus musculus transgenic synthetic renin 2/1d...    34   2.4     
gb:MUSRENIN_2129861 Mus musculus renin mRNA, complete cds.             34   2.4     
gb:BC011473_2091441 Mus musculus renin 2 tandem duplication of R...    34   2.4     
gb:AP003833_1833980 Oryza sativa (japonica cultivar-group) genom...    34   2.4     
gb:AE017341_1754580 Cryptococcus neoformans var. neoformans JEC2...    34   2.4     
gb:GCU43775_1679818 Glomerella cingulata secreted aspartic prote...    34   2.4     
gb:FNE345096_1679096 Filobasidiella neoformans mRNA for macrofag...    34   2.4     
gb:CR382129_1661488 Yarrowia lipolytica chromosome C of strain C...    34   2.4     
gb:BX842595_1643624 Neurospora crassa DNA linkage group II BAC c...    34   2.4     
gb:A75536_1450611 Sequence 3 from Patent WO9400579.>gb:CR382124_...    34   2.4     
gb:AB055312_1408687 Bos taurus cat-D mRNA for cathepsin D, parti...    34   2.4     
gb:SJU90750_1397663 Schistosoma japonicum aspartic protease prec...    34   2.4     
gb:SCMASPR_1397177 Schistosoma japonicum aspartic proteinase pre...    34   2.4     
gb:CEL009861_1365734 Caenorhabditis elegans mRNA for aspartic pr...    34   2.4     
pir|T45033|T45033 hypothetical protein Y39B6B.g [imported] - Cae...    34   2.4     
pir|A39314|A39314 gastricsin (EC 3.4.23.3) precursor - bullfrog>...    34   2.4     
pir|T08973|T08973 probable serine/threonine-specific protein kin...    34   2.4     
sp|P00796|RENS_MOUSE|RENS_MOUSE Renin 2 precursor (EC 3.4.23.15) (Angiotens...    34   2.4     
sp|Q9MZS8|CATD_SHEEP|CATD_SHEEP Cathepsin D precursor (EC 3.4.23.5) (Fragme...    34   2.4     
sp|P80209|CATD_BOVIN|CATD_BOVIN Cathepsin D precursor (EC 3.4.23.5).              34   2.4     
sp|P43231|CAR2_RHINI|CAR2_RHINI Rhizopuspepsin 2 precursor (EC 3.4.23.21) (...    34   2.4     
gb:AF156787_2477657 Pleuronectes americanus pepsinogen A form II...    33   3.2     
gb:AB188675_2049772 Myocastor coypus PgC mRNA for pepsinogen C, ...    33   3.2     
gb:AF083789_1767019 Arabidopsis thaliana clone sps864 unknown mRNA.    33   3.2     
gb:AE017341_1754387 Cryptococcus neoformans var. neoformans JEC2...    33   3.2     
gb:AC136217_1743020 Oryza sativa (japonica cultivar-group) chrom...    33   3.2     
gb:AC120986_1739997 Oryza sativa (japonica cultivar-group) chrom...    33   3.2     
gb:POS417035_1701047 Pleurotus ostreatus partial mRNA for putati...    33   3.2     
gb:NCB8L3_1690364 Neurospora crassa DNA linkage group V BAC cont...    33   3.2     
gb:AY507156_1610024 Botryotinia fuckeliana aspartic proteinase p...    33   3.2     
gb:AY070453_1566837 Arabidopsis thaliana putative aspartic prote...    33   3.2     
gb:AB074195_1523242 Aspergillus oryzae pepE mRNA for pepsinogen,...    33   3.2     
gb:AB070857_1522707 Glycine max soyAP2 mRNA for aspartic protein...    33   3.2     
pir|E96649|E96649 hypothetical protein F19K23.21 [imported] - Ar...    33   3.2     
pir|S49349|S49349 cyprosin (EC 3.4.23.-) - cardoon>gb:CCCYPRSN_1...    33   3.2     
pir|JC7575|JC7575 pepsinogen A - bullfrog>gb:AB045376_2462125 Ra...    33   3.2     
sp|Q03699|CAR3_RHINI|CAR3_RHINI Rhizopuspepsin 3 precursor (EC 3.4.23.21) (...    33   3.2     
sp|P42210|ASPR_HORVU|ASPR_HORVU Phytepsin precursor (EC 3.4.23.40) (Asparti...    33   3.2     
sp|Q42456|APR1_ORYSA|APR1_ORYSA Aspartic proteinase oryzasin 1 precursor (E...    33   3.2     
gb:BC056836_2552019 Danio rerio zgc:63831, mRNA (cDNA clone MGC:...    33   4.2     
gb:AF240776_2060332 Mus musculus pepsinogen F (Pepf) mRNA, compl...    33   4.2     
gb:VCCYNA_1727009 V.cardunculus mRNA for cynarase.                     33   4.2     
gb:OSJN00196_1696544 Oryza sativa genomic DNA, chromosome 4, BAC...    33   4.2     
gb:CR382128_1660346 Yarrowia lipolytica chromosome B of strain C...    33   4.2     
gb:CCA237674_1645729 Cynara cardunculus mRNA for preprocardosin B.     33   4.2     
gb:CCA132884_1645723 Cynara cardunculus mRNA for preprocardosin A.     33   4.2     
gb:AY278218_1594514 Paracoccidioides brasiliensis aspartyl prote...    33   4.2     
gb:AX647799_1472527 Sequence 1991 from Patent EP1270724.               33   4.2     
gb:AF191333_1415853 Capra hircus pregnancy-associated glycoprote...    33   4.2     
gb:AF191326_1415846 Capra hircus pregnancy-associated glycoprote...    33   4.2     
gb:U41746_1404206 Caenorhabditis elegans cosmid T18H9, complete ...    33   4.2     
gb:U41746_1404205 Caenorhabditis elegans cosmid T18H9, complete ...    33   4.2     
gb:AK089294_1175882 Mus musculus B6-derived CD11 +ve dendritic c...    33   4.2     
gb:AK004109_1152233 Mus musculus 18-day embryo whole body cDNA, ...    33   4.2     
pir|T12049|T12049 cyprosin (EC 3.4.23.-) - cardoon (fragment)          33   4.2     
sp|P04073|PEPC_RAT|PEPC_RAT Gastricsin precursor (EC 3.4.23.3) (Pepsinoge...    33   4.2     
sp|P28712|PEP1_RABIT|PEP1_RABIT Pepsin II-1 precursor (EC 3.4.23.1) (Pepsin...    33   4.2     
sp|P40782|CYP1_CYNCA|CYP1_CYNCA Cyprosin precursor (EC 3.4.23.-) (Fragment).      33   4.2     
sp|P18242|CATD_MOUSE|CATD_MOUSE Cathepsin D precursor (EC 3.4.23.5).>pir|I4...    33   4.2     
gb:MUSREN1D_2129855 Mouse renin (Ren-1-d) gene, complete cds.          33   5.4     
gb:MMREN2_2117175 Mouse Ren1 gene for renin (exon 1).                  33   5.4     
gb:AB188677_2049774 Mus caroli PgC mRNA for pepsinogen C, partia...    33   5.4     
gb:AK097517_1914896 Homo sapiens cDNA FLJ40198 fis, clone TESTI2...    33   5.4     
gb:SC8358_1705622 S.cerevisiae chromosome IV cosmid 8358.              33   5.4     
gb:OSJN00279_1697868 Oryza sativa genomic DNA, chromosome 4, BAC...    33   5.4     
gb:BX908789_1644456 Neurospora crassa DNA linkage group VII BAC ...    33   5.4     
gb:AB044078_1520049 Aspergillus oryzae opsB mRNA for aspartic pr...    33   5.4     
gb:AX884714_1480167 Sequence 577 from Patent EP1033401.                33   5.4     
gb:A44438_1449152 Sequence 1 from Patent EP0655497.>gb:ANU03278_...    33   5.4     
gb:AB098928_1410251 Bos taurus mRNA for similar to aspartic prot...    33   5.4     
gb:AF454831_1272648 Apriona germari cathepsin D mRNA, complete cds.    33   5.4     
gb:AK008959_1154872 Mus musculus adult male stomach cDNA, RIKEN ...    33   5.4     
gb:AK008886_1154837 Mus musculus adult male stomach cDNA, RIKEN ...    33   5.4     
pir|S57971|S57971 aspartic proteinase MKC7 (EC 3.4.23.-) - yeast...    33   5.4     
pir|T08449|T08449 hypothetical protein F22O6.120 - Arabidopsis t...    33   5.4     
pir|JC4870|JC4870 pepsin A (EC 3.4.23.1) precursor - soft-shelle...    33   5.4     
sp|P06281|RENI_MOUSE|RENI_MOUSE Renin 1 precursor (EC 3.4.23.15) (Angiotens...    33   5.4     
sp|P53379|MKC7_YEAST|MKC7_YEAST Aspartic proteinase MKC7 precursor (EC 3.4....    33   5.4     
sp|Q01294|CARP_NEUCR|CARP_NEUCR Vacuolar protease A precursor (EC 3.4.23.-)...    33   5.4     
gb:AE016816_1746834 Ashbya gossypii (= Eremothecium gossypii) AT...    32   7.1     
gb:AY361913_1602551 Botryotinia fuckeliana aspartic proteinase p...    32   7.1     
gb:BTNM1E34_1437262 Bovine gene for aspartyl protease NM1 exons ...    32   7.1     
gb:AY509867_1430689 Odocoileus virginianus pregnancy-associated ...    32   7.1     
gb:AY509866_1430688 Odocoileus virginianus pregnancy-associated ...    32   7.1     
gb:AB047246_1408437 Canis familiaris pgnA mRNA for pepsinogen A,...    32   7.1     
gb:AB047245_1408436 Rhinolophus ferrumequinum pgnA mRNA for peps...    32   7.1     
gb:AB047244_1408435 Sorex unguiculatus pgnA mRNA for pepsinogen ...    32   7.1     
gb:AB047243_1408434 Suncus murinus pgnA mRNA for pepsinogen A, c...    32   7.1     
gb:AF079402_1239503 Haemonchus contortus pepsinogen (Pep1) gene,...    32   7.1     
gb:AY850316_1180286 Magnaporthe grisea vacuolar protease A-like ...    32   7.1     
gb:AE014187_939120 Plasmodium falciparum 3D7 chromosome 14 compl...    32   7.1     
pir|S03266|S03266 aspartic proteinase (EC 3.4.23.-) (clone NM1) ...    32   7.1     
gb:PSI9838_2578499 Podarcis sicula mRNA for ovarian Cathepsin D.       32   9.3     
gb:AB025284_2461085 Gallus gallus cPgC gene for pepsinogen C, co...    32   9.3     
gb:AB025282_2461083 Gallus gallus cPgC mRNA for pepsinogen C, co...    32   9.3     
gb:RNO251687_2135515 Rattus norvegicus mRNA for pepsinogen F pro...    32   9.3     
gb:AK127601_1916820 Homo sapiens cDNA FLJ45698 fis, clone FEBRA2...    32   9.3     
gb:AFU132504_1810922 Aspergillus fumigatus pep2 gene, exons 1-4....    32   9.3     
gb:AF522873_1808071 Leptosphaeria maculans aspartyl proteinase, ...    32   9.3     
gb:AF259982_1781461 Ipomoea batatas putative aspartic protease m...    32   9.3     
gb:TCA313385_1724860 Theobroma cacao mRNA for aspartic proteinas...    32   9.3     
gb:OSJN00206_1696703 Oryza sativa genomic DNA, chromosome 4, BAC...    32   9.3     
gb:CR382131_1664317 Yarrowia lipolytica chromosome E of strain C...    32   9.3     
gb:AX884115_1479605 Sequence 19020 from Patent EP1074617.              32   9.3     
gb:SSU14406_1445632 Sus scrofa preprochymosin mRNA, partial cds.       32   9.3     
gb:CDR131677_1438012 Camelus dromedarius mRNA for chymosin.            32   9.3     
gb:AF192332_1415866 Bos taurus pregnancy-associated glycoprotein...    32   9.3     
gb:AB099034_1410357 Bos taurus mRNA for similar to pregnancy-ass...    32   9.3     
gb:OVU81605_1391513 Onchocerca volvulus aspartic protease mRNA, ...    32   9.3     
gb:DMSEG0001_1380150 Drosophila melanogaster sequence EG0001 (in...    32   9.3     
gb:AB078420_1197828 Brugia malayi asp-2 mRNA for aspartic protea...    32   9.3     
gb:AE014298_1123698 Drosophila melanogaster chromosome X, comple...    32   9.3     
pir|T18480|T18480 hypothetical protein MAL3P4.14_mal3D13a3 - mal...    32   9.3     
pir|T18479|T18479 hypothetical protein MAL3P4.14_mal3D13a5 - mal...    32   9.3     
pir|S47096|S47096 cynarase (EC 3.4.23.-) - cardoon                     32   9.3     
pir|T18475|T18475 hypothetical protein C0495w - malaria parasite...    32   9.3     
pir|I47176|I47176 chymosin (EC 3.4.23.4) precursor - pig (fragment)    32   9.3     
pir|JE0371|JE0371 pepsin C (EC 3.4.23.-) precursor - chicken           32   9.3     
pir|T18481|T18481 hypothetical protein MAL3P4.14 - malaria paras...    32   9.3     
sp|Q9DEX3|CATD_CLUHA|CATD_CLUHA Cathepsin D precursor (EC 3.4.23.5).>gb:AF3...    32   9.3     
sp|Q03700|CAR4_RHINI|CAR4_RHINI Rhizopuspepsin 4 precursor (EC 3.4.23.21) (...    32   9.3     


>gb:AB196698_1529694 Daucus carota DcNLP gene for nucellin-like
           protein, complete cds.
          Length = 426

 Score =  206 bits (524), Expect = 3e-52
 Identities = 88/151 (58%), Positives = 104/151 (68%)
 Frame = +3

Query: 189 DRHQKWWKWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLPLYGNVYPNGFYFAQ 368
           D+ Q WWKW                                 +VLPLYGNVYP+G+Y  Q
Sbjct: 28  DQQQSWWKWFSSGASSSVVSSVGSS-----------------VVLPLYGNVYPSGYYHVQ 70

Query: 369 VDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCASLHVG 548
            +IG PP+PYF+DPDTGSDLTWLQCDAPC+ CT APHPLY+P NDLV+CKDP+CASLH  
Sbjct: 71  FNIGQPPKPYFLDPDTGSDLTWLQCDAPCIQCTPAPHPLYQPTNDLVVCKDPICASLHPD 130

Query: 549 DYTCESPTQCDYDVEYADGGSSLGVLVNDVF 641
           +Y C+ P QCDY+VEYADGGSS+GVLVND+F
Sbjct: 131 NYRCDDPDQCDYEVEYADGGSSIGVLVNDLF 161



>gb:AK118764_1816726 Arabidopsis thaliana At4g33490 mRNA for
           putative nucellin, complete cds, clone: RAFL21-10-K10.
          Length = 413

 Score =  175 bits (444), Expect = 5e-43
 Identities = 75/111 (67%), Positives = 93/111 (83%), Gaps = 1/111 (0%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct: 34  VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP 93

Query: 495 NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct: 94  SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS 144



>gb:AY086376_1571425 Arabidopsis thaliana clone 24738 mRNA, complete
           sequence.
          Length = 425

 Score =  175 bits (444), Expect = 5e-43
 Identities = 75/111 (67%), Positives = 93/111 (83%), Gaps = 1/111 (0%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct: 46  VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP 105

Query: 495 NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct: 106 SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS 156



>pir|T06000|T06000 aspartic proteinase homolog F17M5.250 -
           Arabidopsis thaliana>gb:ATCHRIV79_1547269 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           79.>gb:ATF17M5_1549028 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17M5 (ESSA project).
          Length = 420

 Score =  175 bits (444), Expect = 5e-43
 Identities = 75/111 (67%), Positives = 93/111 (83%), Gaps = 1/111 (0%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct: 24  VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP 83

Query: 495 NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct: 84  SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS 134



>gb:AP004888_1846669 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005751_1857182 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0072H09.
          Length = 573

 Score =  142 bits (359), Expect = 4e-33
 Identities = 61/107 (57%), Positives = 78/107 (72%), Gaps = 1/107 (0%)
 Frame = +3

Query: 318 VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN 497
           +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct: 190 LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA 249

Query: 498 NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
            + ++  KD LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct: 250 KEKIVPPKDLLCQELQGNQNYCETCKQCDYEIEYADRSSSMGVLARD 296



>gb:AP003575_1831154 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0528B02.>gb:AP005387_1850839 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0084K06.
          Length = 538

 Score =  132 bits (331), Expect = 7e-30
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 1/107 (0%)
 Frame = +3

Query: 318 VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN 497
           +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct: 146 LLPIRGNVFPDGQYYTSMYIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPE 205

Query: 498 N-DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
             ++V  +D  C  L       ++  QCDY++ YAD  SS+G+L  D
Sbjct: 206 KPNVVPPRDSYCQELQGNQNYGDTSKQCDYEITYADRSSSMGILARD 252



>gb:AY115563_1578815 Zea mays nucellin-like aspartic protease mRNA,
           partial cds.
          Length = 357

 Score =  126 bits (316), Expect = 4e-28
 Identities = 58/94 (61%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN-NDLVICKDPLCASLHVG- 548
           IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P  N LV C + LC +LH G 
Sbjct: 1   IGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPTANRLVPCANALCTALHSGQ 60

Query: 549 --DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
             +  C SP QCDY ++Y D  SS GVL+ND FS
Sbjct: 61  GSNNKCPSPKQCDYQIKYTDSASSQGVLINDSFS 94



>pir|F96505|F96505 probable nucellin [imported] - Arabidopsis
           thaliana>gb:AE005173_892615 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC074228_1541253 Arabidopsis thaliana
           chromosome 1 BAC T7O23 genomic sequence, complete
           sequence.
          Length = 405

 Score =  125 bits (314), Expect = 6e-28
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 2/111 (1%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +V PL GNV+P G+Y   + IG+PP+ +  D DTGSDLTW+QCDAPC  CT  P+  YKP
Sbjct: 35  VVFPLSGNVFPLGYYSVLMQIGSPPKAFQFDIDTGSDLTWVQCDAPCSGCTLPPNLQYKP 94

Query: 495 NNDLVICKDPLCASLHVGDYT-CESP-TQCDYDVEYADGGSSLGVLVNDVF 641
             +++ C +P+C +LH  +   C +P  QCDY+V+YAD GSS+G LV D F
Sbjct: 95  KGNIIPCSNPICTALHWPNKPHCPNPQEQCDYEVKYADQGSSMGALVTDQF 145



>gb:AF308691_1784822 Oryza sativa nucellin-like protein (OSAP1)
           gene, complete cds.>gb:AF308692_1784823 Oryza sativa
           nucellin-like protein (OSAP1) mRNA, complete cds.
          Length = 410

 Score =  121 bits (303), Expect = 1e-26
 Identities = 61/114 (53%), Positives = 74/114 (64%), Gaps = 4/114 (3%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +VL L+GNVYP G +F  ++IG+P + YF+D DTGS LTWLQCDAPC +C   PH LYKP
Sbjct: 24  VVLELHGNVYPIGHFFITMNIGDPAKSYFLDIDTGSTLTWLQCDAPCTNCNIVPHVLYKP 83

Query: 495 N-NDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               LV C D LC  L+        C S  QCDY ++Y D  SS+GVLV D FS
Sbjct: 84  TPKKLVTCADSLCTDLYTDLGKPKRCGSQKQCDYVIQYVD-SSSMGVLVIDRFS 136



>gb:AY062662_1565318 Arabidopsis thaliana nucellin-like protein
           (At1g77480; T5M16.7) mRNA, complete
           cds.>gb:BT001225_1635480 Arabidopsis thaliana
           nucellin-like protein (At1g77480) mRNA, complete cds.
          Length = 466

 Score =  118 bits (296), Expect = 8e-26
 Identities = 55/109 (50%), Positives = 74/109 (67%), Gaps = 2/109 (1%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct: 53  VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTKPRAKQYKP 112

Query: 495 NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVND 635
           N++ + C   LC+ L +  D  C  P  QCDY++ Y+D  SS+G LV D
Sbjct: 113 NHNTLPCSHILCSGLDLPQDRPCADPEDQCDYEIGYSDHASSIGALVTD 161



>gb:AY043217_1560979 Oryza sativa aspartyl proteinase (Asp1) mRNA,
           complete cds.
          Length = 411

 Score =  118 bits (295), Expect = 1e-25
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 4/114 (3%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +VL L+GNVYP G +F  ++I +P +PYF+D DTGS LTWLQCD PC++C K PH LYKP
Sbjct: 24  VVLELHGNVYPIGHFFVTMNISDPAKPYFLDIDTGSTLTWLQCDYPCINCNKVPHGLYKP 83

Query: 495 NNDLVI-CKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                + C +  CA L+        C    QC Y ++Y  GGSS+GVL+ D FS
Sbjct: 84  ELKYAVKCTEQRCADLYADLRKPMKCGPKNQCHYGIQYV-GGSSIGVLIVDSFS 136



>gb:AY043216_1560978 Oryza sativa aspartyl proteinase (Asp1) gene,
           complete cds.
          Length = 410

 Score =  118 bits (295), Expect = 1e-25
 Identities = 56/114 (49%), Positives = 73/114 (64%), Gaps = 4/114 (3%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +VL L+GNVYP G +F  ++I +P +PYF+D DTGS LTWLQCD PC++C K PH LYKP
Sbjct: 24  VVLELHGNVYPIGHFFVTMNISDPAKPYFLDIDTGSTLTWLQCDYPCINCNKVPHGLYKP 83

Query: 495 NNDLVI-CKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                + C +  CA L+        C    QC Y ++Y  GGSS+GVL+ D FS
Sbjct: 84  ELKYAVKCTEQRCADLYADLRKPMKCGPKNQCHYGIQYV-GGSSIGVLIVDSFS 136



>pir|B96804|B96804 nucellin-like protein, 27671-25467 [imported] -
           Arabidopsis thaliana>gb:AE005173_895271 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010704_1537017 Arabidopsis thaliana
           chromosome 1 BAC T5M16 genomic sequence, complete
           sequence.
          Length = 427

 Score =  115 bits (288), Expect = 6e-25
 Identities = 55/109 (50%), Positives = 74/109 (67%), Gaps = 2/109 (1%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           +V P+ GNVYP G+Y+  ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK     YKP
Sbjct: 53  VVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNGCTK-----YKP 107

Query: 495 NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVND 635
           N++ + C   LC+ L +  D  C  P  QCDY++ Y+D  SS+G LV D
Sbjct: 108 NHNTLPCSHILCSGLDLPQDRPCADPEDQCDYEIGYSDHASSIGALVTD 156



>gb:AE005173_892848 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC016041_1538078 Genomic sequence
           for Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.>gb:AY039998_1560501 Arabidopsis
           thaliana unknown protein (At1g49050) mRNA, complete
           cds.>gb:AF360182_1791137 Arabidopsis thaliana unknown
           protein (At1g49050) mRNA, complete cds.
          Length = 583

 Score =  109 bits (272), Expect = 5e-23
 Identities = 52/113 (46%), Positives = 70/113 (61%), Gaps = 5/113 (4%)
 Frame = +3

Query: 318 VLPLYGNVYPNGFYFAQVDIGNPP--RPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYK 491
           + P+ GNVYP+G Y+ ++ +G P   + Y +D DTGS+LTW+QCDAPC  C K  + LYK
Sbjct: 190 IFPVGGNVYPDGLYYTRILVGKPEDGQYYHLDIDTGSELTWIQCDAPCTSCAKGANQLYK 249

Query: 492 PNND-LVICKDPLCASLHVGDYT--CESPTQCDYDVEYADGGSSLGVLVNDVF 641
           P  D LV   +  C  +     T  CE+  QCDY++EYAD   S+GVL  D F
Sbjct: 250 PRKDNLVRSSEAFCVEVQRNQLTEHCENCHQCDYEIEYADHSYSMGVLTKDKF 302



>pir|T06213|T06213 probable aspartic proteinase (EC 3.4.23.-) -
           barley>gb:AY485643_1608491 Hordeum vulgare subsp.
           vulgare BAC 615K1, complete
           sequence.>gb:HVU87148_1682847 Hordeum vulgare nucellin
           mRNA, complete cds.>gb:HVU87149_1682848 Hordeum vulgare
           nucellin gene, complete cds.
          Length = 410

 Score = 95.5 bits (236), Expect = 7e-19
 Identities = 49/121 (40%), Positives = 69/121 (57%), Gaps = 11/121 (9%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC----TKAPHP 482
           I  PL GNVYP G ++A ++IG P +PYF+D DTGS+LTWL+C  P   C     + PHP
Sbjct: 24  IKFPLEGNVYPVGHFYATLNIGEPAKPYFLDVDTGSNLTWLECHHPVHGCKGCHPRPPHP 83

Query: 483 LYKP--NNDLVICKDPLCASLH-----VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF 641
            Y P   N  V+C  PLC ++      + + +   P +C Y+++Y  G S  G L  D+ 
Sbjct: 84  YYTPADGNLKVVCGSPLCVAVRRDVPGIPECSRNDPHRCHYEIQYVTGKSE-GDLATDII 142

Query: 642 S 644
           S
Sbjct: 143 S 143



>pir|T04372|T04372 protein EEA1 - barley>gb:AF017430_1761550 Hordeum
           vulgare EEA1 mRNA, complete cds.
          Length = 410

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 48/121 (39%), Positives = 69/121 (57%), Gaps = 11/121 (9%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC----TKAPHP 482
           I  PL GNVYP G ++A ++IG P +PYF+D DTGS+LTWL+C  P   C     + PHP
Sbjct: 24  INFPLEGNVYPVGHFYATLNIGEPAKPYFLDVDTGSNLTWLECHPPVHGCKGCHPRPPHP 83

Query: 483 LYKPNND--LVICKDPLCASLH-----VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF 641
            Y P +    V+C  PLC ++      + + +   P +C Y+++Y  G S  G L  D+ 
Sbjct: 84  YYTPADGKLKVVCGSPLCVAVRRDVPGIPECSRNDPHRCHYEIQYVTGKSE-GDLATDII 142

Query: 642 S 644
           S
Sbjct: 143 S 143



>gb:AP003811_1833697 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1131_E05.>gb:AP006753_1862868 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039D04.
          Length = 441

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 43/101 (42%), Positives = 50/101 (49%), Gaps = 5/101 (4%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL----VICKDP 524
           Y   + IG PP P     DTGSDL W QCDAPC  C   P PLY P        V C+ P
Sbjct: 92  YLVDIAIGTPPLPLTAVLDTGSDLIWTQCDAPCRRCFPQPAPLYAPARSATYANVSCRSP 151

Query: 525 LCASLHVGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS 644
           +C +L      C  P T C Y   Y DG S+ GVL  + F+
Sbjct: 152 MCQALQSPWSRCSPPDTGCAYYFSYGDGTSTDGVLATETFT 192



>gb:AP004585_1841901 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0470B03.
          Length = 448

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 42/102 (41%), Positives = 52/102 (50%), Gaps = 4/102 (3%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICK 518
           G Y   + IG PP  Y    DTGSDL W QC APCV C   P P ++P       LV C+
Sbjct: 90  GEYLMDLAIGTPPLRYTAMVDTGSDLIWTQC-APCVLCADQPTPYFRPARSATYRLVPCR 148

Query: 519 DPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
            PLCA+L      C   + C Y   Y D  S+ GVL ++ F+
Sbjct: 149 SPLCAALPYP--ACFQRSVCVYQYYYGDEASTAGVLASETFT 188



>pir|D86385|D86385 hypothetical protein F2J7.6 - Arabidopsis
           thaliana>gb:AE005172_891472 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY099724_1576749 Arabidopsis thaliana
           unknown protein (At1g25510) mRNA, complete
           cds.>gb:BT000294_1634572 Arabidopsis thaliana unknown
           protein (At1g25510) mRNA, complete
           cds.>gb:AC079281_1732441 Arabidopsis thaliana chromosome
           1 BAC F2J7 genomic sequence, complete sequence.
          Length = 483

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 4/100 (4%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN---- 500
           G    +G YF +V IG P R  ++  DTGSD+ WLQC  PC  C     P+++P++    
Sbjct: 140 GTTQGSGEYFTRVGIGKPAREVYMVLDTGSDVNWLQC-TPCADCYHQTEPIFEPSSSSSY 198

Query: 501 DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLG 620
           + + C  P C +L V +  C + T C Y+V Y DG  ++G
Sbjct: 199 EPLSCDTPQCNALEVSE--CRNAT-CLYEVSYGDGSYTVG 235



>gb:AP005065_1847445 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0046H03.>gb:AP005067_1847487 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0487H05.
          Length = 494

 Score = 70.1 bits (170), Expect(2) = 2e-11
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 12/119 (10%)
 Frame = +3

Query: 315 IVLPLYGN--VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH--- 479
           I LPL G+      G YF ++ IG P + Y+V  DTGSD+ W+ C   C  C +  +   
Sbjct: 74  IDLPLGGSGLATETGLYFTRIGIGTPAKRYYVQVDTGSDILWVNC-VSCDGCPRKSNLGI 132

Query: 480 --PLYKP----NNDLVICKDPLCASLHVGDY-TCESPTQCDYDVEYADGGSSLGVLVND 635
              +Y P    + +LV C    C + + G   +C S + C+Y + Y DG S+ G  V D
Sbjct: 133 ELTMYDPRGSQSGELVTCDQQFCVANYGGVLPSCTSTSPCEYSISYGDGSSTAGFFVTD 191



 Score = 20.4 bits (41), Expect(2) = 2e-11
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 202 NGGNGHLLALME 237
           +GG GHL AL E
Sbjct: 50  DGGEGHLSALRE 61



>gb:AP005065_1847447 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0046H03.>gb:AP005067_1847489 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0487H05.
          Length = 297

 Score = 70.1 bits (170), Expect(2) = 3e-11
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 12/119 (10%)
 Frame = +3

Query: 315 IVLPLYGN--VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH--- 479
           I LPL G+      G YF ++ IG P + Y+V  DTGSD+ W+ C   C  C +  +   
Sbjct: 74  IDLPLGGSGLATETGLYFTRIGIGTPAKRYYVQVDTGSDILWVNC-VSCDGCPRKSNLGI 132

Query: 480 --PLYKP----NNDLVICKDPLCASLHVGDY-TCESPTQCDYDVEYADGGSSLGVLVND 635
              +Y P    + +LV C    C + + G   +C S + C+Y + Y DG S+ G  V D
Sbjct: 133 ELTMYDPRGSQSGELVTCDQQFCVANYGGVLPSCTSTSPCEYSISYGDGSSTAGFFVTD 191



 Score = 20.4 bits (41), Expect(2) = 3e-11
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +1

Query: 202 NGGNGHLLALME 237
           +GG GHL AL E
Sbjct: 50  DGGEGHLSALRE 61



>gb:OSJN00013_1693275 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064H22, complete sequence.
          Length = 444

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 38/103 (36%), Positives = 49/103 (47%), Gaps = 4/103 (3%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           NG +   V IG P   Y    DTGSDL W QC  PCV C K   P++ P++      V C
Sbjct: 92  NGEFLMDVSIGTPALAYSAIVDTGSDLVWTQC-KPCVDCFKQSTPVFDPSSSSTYATVPC 150

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               C+ L      C S ++C Y   Y D  S+ GVL  + F+
Sbjct: 151 SSASCSDLPTS--KCTSASKCGYTYTYGDSSSTQGVLATETFT 191



>gb:ATAC018363_1543693 Arabidopsis thaliana chromosome III BAC F13E7
           genomic sequence, complete sequence.>gb:AY088014_1573038
           Arabidopsis thaliana clone 40409 mRNA, complete
           sequence.
          Length = 488

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 10/118 (8%)
 Frame = +3

Query: 315 IVLPLYGNVYPN--GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLY 488
           I +PL G+  P   G YFA++ +G P R + V  DTGSD+ W+ C A C+ C +    + 
Sbjct: 69  IDIPLGGDSQPESIGLYFAKIGLGTPSRDFHVQVDTGSDILWVNC-AGCIRCPRKSDLVE 127

Query: 489 KPNNDL--------VICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDV 638
               D+        V C D  C+ ++     C S + C Y + Y DG S+ G LV DV
Sbjct: 128 LTPYDVDASSTAKSVSCSDNFCSYVNQRS-ECHSGSTCQYVIMYGDGSSTNGYLVKDV 184



>gb:AB026661_1517394 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:T30G6.
          Length = 478

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 42/118 (35%), Positives = 60/118 (50%), Gaps = 11/118 (9%)
 Frame = +3

Query: 315 IVLPLYGNVYPN--GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC-----TKA 473
           I LPL G+   +  G YF ++ +G+PP+ Y+V  DTGSD+ W+ C APC  C        
Sbjct: 58  IDLPLGGDSRADSIGLYFTKIKLGSPPKEYYVQVDTGSDILWVNC-APCPKCPVKTDLGI 116

Query: 474 PHPLY----KPNNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
           P  LY       +  V C+D  C+ +   + TC +   C Y V Y DG +S G  + D
Sbjct: 117 PLSLYDSKTSSTSKNVGCEDDFCSFIMQSE-TCGAKKPCSYHVVYGDGSTSDGDFIKD 173



>gb:AP005393_1850992 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0488D02.
          Length = 441

 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 40/109 (36%), Positives = 53/109 (48%), Gaps = 8/109 (7%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL----V 509
           +  G Y   V IG+PPR +    DTGSDL W QC APC+ C + P P ++P        +
Sbjct: 83  FSEGEYLMDVGIGSPPRYFSAMIDTGSDLIWTQC-APCLLCVEQPTPYFEPAKSTSYASL 141

Query: 510 ICKDPLCASLHVGDYTCESP----TQCDYDVEYADGGSSLGVLVNDVFS 644
            C   +C +L+       SP      C Y   Y D  SS GVL N+ F+
Sbjct: 142 PCSSAMCNALY-------SPLCFQNACVYQAFYGDSASSAGVLANETFT 183



>gb:AP005392_1850977 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0463D04.>gb:AP005392_1850980 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0463D04.
          Length = 485

 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 4/102 (3%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICK 518
           G Y   V +G P + Y V  DTGSDL+W+QC  PC  C +   PL+ P+       V C 
Sbjct: 147 GNYVVSVGLGTPAKQYAVIFDTGSDLSWVQC-KPCADCYEQQDPLFDPSLSSTYAAVACG 205

Query: 519 DPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
            P C  L      C S ++C Y+V+Y D   + G LV D  +
Sbjct: 206 APECQELDASG--CSSDSRCRYEVQYGDQSQTDGNLVRDTLT 245



>gb:CQ974046_1455432 Sequence 5 from Patent WO2004113520.
          Length = 430

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 43/117 (36%), Positives = 53/117 (45%), Gaps = 12/117 (10%)
 Frame = +3

Query: 321 LPLYGNVYPN--GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH----- 479
           +PL GN  P     YF ++ IG PP+ Y+V  DTGSD+ W+ C A CV C K        
Sbjct: 7   MPLGGNGSPTDAALYFTKLSIGTPPQDYYVQVDTGSDILWVNC-AGCVRCPKKSSLGIDL 65

Query: 480 PLY----KPNNDLVICKDPLCAS-LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
            LY         LV C    C S  +     C+    C Y V Y DG S+ G  V D
Sbjct: 66  TLYDMKASSTGRLVTCDQDFCLSAFNAPASDCKVGNPCAYSVTYGDGSSTGGYFVRD 122



>gb:AP006164_1861182 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1386G10.
          Length = 486

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 40/103 (38%), Positives = 52/103 (50%), Gaps = 7/103 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPC---VHCTKAPHPLYKPNND----LVIC 515
           +   V +G P +P  +  DTGSDL+W+QC  PC    HC     PL+ P+       V C
Sbjct: 144 FVVAVGLGTPAQPSALIFDTGSDLSWVQCQ-PCGSSGHCHPQQDPLFDPSKSSTYAAVHC 202

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
            +P CA+   GD   E  T C Y V Y DG S+ GVL  D  +
Sbjct: 203 GEPQCAA--AGDLCSEDNTTCLYLVRYGDGSSTTGVLSRDTLA 243



>gb:AP003344_1828372 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0413G02.
          Length = 504

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 12/112 (10%)
 Frame = +3

Query: 336 NVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP---------HPLY 488
           N +  G YF +V +G+PP+ YFV  DTGSD+ W+ C +PC  C  +          +P  
Sbjct: 84  NPFMVGLYFTRVKLGSPPKEYFVQIDTGSDILWVAC-SPCTGCPSSSGLNIQLEFFNPDT 142

Query: 489 KPNNDLVICKDPLC-ASLHVGDYTCESP--TQCDYDVEYADGGSSLGVLVND 635
              +  + C D  C A+L   +  C++   + C Y   Y DG  + G  V+D
Sbjct: 143 SSTSSKIPCSDDRCTAALQTSEAVCQTSDNSPCGYTFTYGDGSGTSGYYVSD 194



>gb:AY080874_1568558 Arabidopsis thaliana putative chloroplast
           nucleoid DNA-binding protein (At3g18490) mRNA, complete
           cds.
          Length = 500

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 33/100 (33%), Positives = 53/100 (53%), Gaps = 4/100 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YF+++ +G P +  ++  DTGSD+ W+QC+ PC  C +   P++ P +      + C
Sbjct: 159 SGEYFSRIGVGTPAKDMYLVLDTGSDVNWIQCE-PCADCYQQSDPVFNPTSSSTYKSLTC 217

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
             P C+ L      C S  +C Y V Y DG  ++G L  D
Sbjct: 218 SAPQCSLLETS--ACRS-NKCLYQVSYGDGSFTVGELATD 254



>gb:AB026658_1517372 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MYF24.>gb:AY150497_1585062 Arabidopsis
           thaliana putative chloroplast nucleoid DNA-binding
           protein (At3g18490) mRNA, complete cds.
          Length = 500

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 33/100 (33%), Positives = 53/100 (53%), Gaps = 4/100 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YF+++ +G P +  ++  DTGSD+ W+QC+ PC  C +   P++ P +      + C
Sbjct: 159 SGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCE-PCADCYQQSDPVFNPTSSSTYKSLTC 217

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
             P C+ L      C S  +C Y V Y DG  ++G L  D
Sbjct: 218 SAPQCSLLETS--ACRS-NKCLYQVSYGDGSFTVGELATD 254



>gb:AP002913_1823914 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0480E02.
          Length = 504

 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 5/96 (5%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL----VIC 515
           +G YF++V +G+P R  ++  DTGSD+TW+QC  PC  C +   P++ P+       V C
Sbjct: 164 SGEYFSRVGVGSPARQLYMVLDTGSDVTWVQCQ-PCADCYQQSDPVFDPSLSTSYASVAC 222

Query: 516 KDPLCASLHVGDYTCESPT-QCDYDVEYADGGSSLG 620
            +P C  L      C + T  C Y+V Y DG  ++G
Sbjct: 223 DNPRCHDLDAA--ACRNSTGACLYEVAYGDGSYTVG 256



>gb:OSJN00129_1695367 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNba0093F12, complete
           sequence.>gb:OSJN00225_1697025 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0006A01, complete
           sequence.
          Length = 489

 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 41/117 (35%), Positives = 57/117 (48%), Gaps = 8/117 (6%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPP---RPYFVDPDTGSDLTWLQCDAPCVHCTK-APHP 482
           +++PLYG       Y  Q+ IG P     P +V  DTGSDL+W QC+ PC +C+   P+P
Sbjct: 108 LLVPLYGRPQGGSTYLVQLRIGTPTDRISPRYVLFDTGSDLSWTQCE-PCTNCSSFTPYP 166

Query: 483 LYKPNNDLVI----CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF 641
            + P+         C DP+C               C +   Y DGG+  G LV+DVF
Sbjct: 167 PHDPSKSRTFRRLSCFDPMCELCTAVVDGGGGSAGCLFRRRYGDGGAVSGELVSDVF 223



>pir|B86193|B86193 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889602 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T20M3_1723735 Sequence of BAC T20M3 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 388

 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 42/123 (34%), Positives = 58/123 (47%), Gaps = 15/123 (12%)
 Frame = +3

Query: 315 IVLPLYGNVYPN--GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH--- 479
           I LPL G   P+  G Y+A++ IG P + Y+V  DTGSD+ W+     C+ C + P    
Sbjct: 64  IDLPLGGTGRPDIPGLYYAKIGIGTPAKSYYVQVDTGSDIMWVN----CIQCKQCPRRST 119

Query: 480 -----PLY----KPNNDLVICKDPLCASLHVGDYT-CESPTQCDYDVEYADGGSSLGVLV 629
                 LY      +  LV C D  C  +  G  + C++   C Y   Y DG S+ G  V
Sbjct: 120 LGIELTLYNIDESDSGKLVSCDDDFCYQISGGPLSGCKANMSCPYLEIYGDGSSTAGYFV 179

Query: 630 NDV 638
            DV
Sbjct: 180 KDV 182



>gb:AP005393_1850995 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0488D02.
          Length = 453

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 36/101 (35%), Positives = 50/101 (49%), Gaps = 5/101 (4%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVICKDP 524
           Y   + +G PP+P     DTGSDL W QCD  C  C + P PL+ P    + + + C   
Sbjct: 98  YVLDLAVGTPPQPITALLDTGSDLIWTQCDT-CTACLRQPDPLFSPRMSSSYEPMRCAGQ 156

Query: 525 LCAS-LHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           LC   LH   ++C  P  C Y   Y DG ++LG    + F+
Sbjct: 157 LCGDILH---HSCVRPDTCTYRYSYGDGTTTLGYYATERFT 194



>gb:OSJN00021_1693429 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0008A08, complete sequence.
          Length = 494

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 39/121 (32%), Positives = 57/121 (47%), Gaps = 15/121 (12%)
 Frame = +3

Query: 321 LPLYGNVYPN--GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH----- 479
           +PL G   P   G Y+ ++ IG P + Y+V  DTGSD+ W+     C+ C + P      
Sbjct: 75  IPLGGLGLPTDTGLYYTEIGIGTPTKRYYVQVDTGSDILWVN----CISCDRCPRKSGLG 130

Query: 480 ---PLYKPNN----DLVICKDPLCASLHVGDYT-CESPTQCDYDVEYADGGSSLGVLVND 635
               LY P +      V C    CA+ + G    C +   C+Y V Y DG S+ G  V+D
Sbjct: 131 LELTLYDPKDSSTGSKVSCDQGFCAATYGGLLPGCTTSLPCEYSVTYGDGSSTTGYFVSD 190

Query: 636 V 638
           +
Sbjct: 191 L 191



>pir|E96676|E96676 hypothetical protein T23K8.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_894175 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:T23K8_1723841 Arabidopsis thaliana
           chromosome 1 BAC T23K8 sequence, complete sequence.
          Length = 449

 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 11/121 (9%)
 Frame = +3

Query: 315 IVLPLYGN--VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLY 488
           I LPL G+  V   G YF ++ +G+PP+ Y V  DTGSD+ W+ C  PC  C    +  +
Sbjct: 58  IDLPLGGDSRVDSVGLYFTKIKLGSPPKEYHVQVDTGSDILWINC-KPCPKCPTKTNLNF 116

Query: 489 K---------PNNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF 641
           +           +  V C D  C+ +   D +C+    C Y + YAD  +S G  + D+ 
Sbjct: 117 RLSLFDMNASSTSKKVGCDDDFCSFISQSD-SCQPALGCSYHIVYADESTSDGKFIRDML 175

Query: 642 S 644
           +
Sbjct: 176 T 176



>pir|C84783|C84783 probable proteinase [imported] - Arabidopsis
           thaliana>gb:AC006282_1533953 Arabidopsis thaliana
           chromosome 2 clone F13K3 map g6825, complete sequence.
          Length = 469

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 36/113 (31%), Positives = 50/113 (44%), Gaps = 13/113 (11%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHP--------LYKPN 497
           Y  G YF +V +G+PP  + V  DTGSD+ W+ C +    C+  PH          +   
Sbjct: 95  YLVGLYFTKVKLGSPPTEFNVQIDTGSDILWVTCSS----CSNCPHSSGLGIDLHFFDAP 150

Query: 498 NDL----VICKDPLCASL-HVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF 641
             L    V C DP+C+S+       C    QC Y   Y DG  + G  + D F
Sbjct: 151 GSLTAGSVTCSDPICSSVFQTTAAQCSENNQCGYSFRYGDGSGTSGYYMTDTF 203



>pir|E86440|E86440 probable chloroplast nucleoid DNA binding protein
           T8E3.12 - Arabidopsis thaliana>gb:AE005172_892010
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AC027135_1539882 Arabidopsis thaliana
           chromosome 1 BAC T8E3 genomic sequence, complete
           sequence.
          Length = 445

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 37/109 (33%), Positives = 46/109 (42%), Gaps = 5/109 (4%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVI 512
           G +   G YF  + IG PP   F   DTGSDLTW+QC  PC  C K   PL+        
Sbjct: 77  GLISNGGEYFMSISIGTPPSKVFAIADTGSDLTWVQC-KPCQQCYKQNSPLFDKKKSSTY 135

Query: 513 ----CKDPLCASLHVGDYTC-ESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               C    C +L   +  C ES   C Y   Y D   + G +  +  S
Sbjct: 136 KTESCDSKTCQALSEHEEGCDESKDICKYRYSYGDNSFTKGDVATETIS 184



>gb:AY092970_1574924 Arabidopsis thaliana unknown protein
           (At1g08210) mRNA, complete cds.>gb:AY128724_1580804
           Arabidopsis thaliana unknown protein (At1g08210) mRNA,
           complete cds.>gb:AF329505_1786990 Arabidopsis thaliana
           unknown protein (At1g08210) mRNA, complete cds.
          Length = 492

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 9/107 (8%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH---------PLYKPNND 503
           G Y+ +V +G PPR + V  DTGSD+ W+ C + C  C K            P    +  
Sbjct: 82  GLYYTKVKLGTPPREFNVQIDTGSDVLWVSCTS-CNGCPKTSELQIQLSFFDPGVSSSAS 140

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           LV C D  C S    +  C     C Y  +Y DG  + G  ++D  S
Sbjct: 141 LVSCSDRRCYSNFQTESGCSPNNLCSYSFKYGDGSGTSGYYISDFMS 187



>gb:AB114915_1527503 Nepenthes gracilis nep2 mRNA for aspartic
           proteinase nepenthesin II, complete cds.
          Length = 438

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 36/112 (32%), Positives = 51/112 (45%), Gaps = 2/112 (1%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           I  P+Y     +G Y   V IG P   +    DTGSDL W QC+ PC  C   P P++ P
Sbjct: 85  IETPVYAG---DGEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCE-PCTQCFSQPTPIFNP 140

Query: 495 NNDLVICKDPLCASLHVGDYTCE--SPTQCDYDVEYADGGSSLGVLVNDVFS 644
            +       P C S +  D   E  +  +C Y   Y DG ++ G +  + F+
Sbjct: 141 QDSSSFSTLP-CESQYCQDLPSETCNNNECQYTYGYGDGSTTQGYMATETFT 191



>gb:AY088528_1573546 Arabidopsis thaliana clone 7567 mRNA, complete
           sequence.
          Length = 485

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 33/95 (34%), Positives = 45/95 (47%), Gaps = 4/95 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YF ++ +G P R  ++  DTGSD+ WLQC APC  C     P++ P        + C
Sbjct: 139 SGEYFTRLGVGTPARYVYMVLDTGSDIVWLQC-APCRRCYSQSDPIFDPRKSKTYATIPC 197

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLG 620
             P C  L          T C Y V Y DG  ++G
Sbjct: 198 SSPHCRRLDSAGCNTRRKT-CLYQVSYGDGSFTVG 231



>gb:AC006580_1534488 Arabidopsis thaliana chromosome 2 clone F23E6
           map m551, complete sequence.>gb:AC006931_1534811
           Arabidopsis thaliana chromosome 2 clone F7D19 map m551,
           complete sequence.
          Length = 527

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 38/111 (34%), Positives = 50/111 (45%), Gaps = 7/111 (6%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL-- 506
           G    +G YF  V +G PP+ + +  DTGSDL WLQC  PC  C       Y P      
Sbjct: 152 GMTLGSGEYFMDVLVGTPPKHFSLILDTGSDLNWLQC-LPCYDCFHQNGMFYDPKTSASF 210

Query: 507 --VICKDPLCASLHVGD--YTCESPTQ-CDYDVEYADGGSSLGVLVNDVFS 644
             + C DP C+ +   D    CES  Q C Y   Y D  ++ G    + F+
Sbjct: 211 KNITCNDPRCSLISSPDPPVQCESDNQSCPYFYWYGDRSNTTGDFAVETFT 261



>pir|T08860|T08860 hypothetical protein A_TM017A05.8 - Arabidopsis
           thaliana
          Length = 472

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 9/109 (8%)
 Frame = +3

Query: 339 VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAP-CVHCTKAPH------PLYKPN 497
           ++    ++A V +G P   + V  DTGSDL WL CD   CV   KAP        +Y PN
Sbjct: 49  LFMRDLHYANVTVGTPSDWFMVALDTGSDLFWLPCDCTNCVRELKAPGGSSLDLNIYSPN 108

Query: 498 NDLVICKDPLCASLHVGDYTCESP-TQCDYDVEY-ADGGSSLGVLVNDV 638
                 K P  ++L      C SP + C Y + Y ++G SS GVLV DV
Sbjct: 109 ASSTSTKVPCNSTLCTRGDRCASPESDCPYQIRYLSNGTSSTGVLVEDV 157



>pir|C86143|C86143 hypothetical protein F6F3.10 - Arabidopsis
           thaliana>gb:AE005172_889180 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC023628_1539184 Arabidopsis thaliana
           chromosome I BAC F6F3 genomic sequence, complete
           sequence.>gb:AY128344_1580643 Arabidopsis thaliana
           chloroplast nucleoid DNA binding protein, putative
           (At1g01300) mRNA, complete cds.>gb:BT006619_1639506
           Arabidopsis thaliana At1g01300 mRNA, complete cds.
          Length = 485

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 33/95 (34%), Positives = 45/95 (47%), Gaps = 4/95 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YF ++ +G P R  ++  DTGSD+ WLQC APC  C     P++ P        + C
Sbjct: 139 SGEYFTRLGVGTPARYVYMVLDTGSDIVWLQC-APCRRCYSQSDPIFDPRKSKTYATIPC 197

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLG 620
             P C  L          T C Y V Y DG  ++G
Sbjct: 198 SSPHCRRLDSAGCNTRRKT-CLYQVSYGDGSFTVG 231



>pir|E84860|E84860 hypothetical protein At2g42980 [imported] -
           Arabidopsis thaliana
          Length = 481

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 38/111 (34%), Positives = 50/111 (45%), Gaps = 7/111 (6%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL-- 506
           G    +G YF  V +G PP+ + +  DTGSDL WLQC  PC  C       Y P      
Sbjct: 106 GMTLGSGEYFMDVLVGTPPKHFSLILDTGSDLNWLQC-LPCYDCFHQNGMFYDPKTSASF 164

Query: 507 --VICKDPLCASLHVGD--YTCESPTQ-CDYDVEYADGGSSLGVLVNDVFS 644
             + C DP C+ +   D    CES  Q C Y   Y D  ++ G    + F+
Sbjct: 165 KNITCNDPRCSLISSPDPPVQCESDNQSCPYFYWYGDRSNTTGDFAVETFT 215



>pir|B84556|B84556 hypothetical protein At2g17760 [imported] -
           Arabidopsis thaliana
          Length = 473

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 41/109 (37%), Positives = 54/109 (49%), Gaps = 9/109 (8%)
 Frame = +3

Query: 339 VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAP-CVHCTKAPH------PLYKPN 497
           ++    ++A V +G P   + V  DTGSDL WL CD   CV   KAP        +Y PN
Sbjct: 49  LFMRDLHYANVTVGTPSDWFMVALDTGSDLFWLPCDCTNCVRELKAPGGSSLDLNIYSPN 108

Query: 498 NDLVICKDPLCASLHVGDYTCESP-TQCDYDVEY-ADGGSSLGVLVNDV 638
                 K P  ++L      C SP + C Y + Y ++G SS GVLV DV
Sbjct: 109 ASSTSTKVPCNSTLCTRGDRCASPESDCPYQIRYLSNGTSSTGVLVEDV 157



>gb:AY069886_1566629 Arabidopsis thaliana putative chloroplast
           nucleoid DNA-binding protein mRNA, complete
           cds.>gb:AY142012_1582849 Arabidopsis thaliana
           At2g17760/At2g17760 mRNA, complete cds.
          Length = 513

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 41/103 (39%), Positives = 52/103 (50%), Gaps = 9/103 (8%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAP-CVHCTKAPH------PLYKPNNDLVIC 515
           ++A V +G P   + V  DTGSDL WL CD   CV   KAP        +Y PN      
Sbjct: 104 HYANVTVGTPSDWFMVALDTGSDLFWLPCDCTNCVRELKAPGGSSLDLNIYSPNASSTST 163

Query: 516 KDPLCASLHVGDYTCESP-TQCDYDVEY-ADGGSSLGVLVNDV 638
           K P  ++L      C SP + C Y + Y ++G SS GVLV DV
Sbjct: 164 KVPCNSTLCTRGDRCASPESDCPYQIRYLSNGTSSTGVLVEDV 206



>gb:AE005172_889828 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC011438_1537215 Genomic sequence
           for Arabidopsis thaliana BAC T23G18 from chromosome I,
           complete sequence.
          Length = 566

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 9/104 (8%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH---------PLYKPNND 503
           G Y+ +V +G PPR + V  DTGSD+ W+ C + C  C K            P    +  
Sbjct: 130 GLYYTKVKLGTPPREFNVQIDTGSDVLWVSCTS-CNGCPKTSELQIQLSFFDPGVSSSAS 188

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
           LV C D  C S    +  C     C Y  +Y DG  + G  ++D
Sbjct: 189 LVSCSDRRCYSNFQTESGCSPNNLCSYSFKYGDGSGTSGYYISD 232



>pir|T47313|T47313 hypothetical protein T32A11.120 - Arabidopsis
           thaliana>gb:ATT32A11_1555872 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T32A11.
          Length = 356

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 35/103 (33%), Positives = 47/103 (45%), Gaps = 4/103 (3%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +  Y+  V IG PPR   V  DTGSDL W+ C++ CV C       + P        + C
Sbjct: 75  SALYYTTVQIGTPPRELDVVIDTGSDLVWVSCNS-CVGCPLHNVTFFDPGASSSAVKLAC 133

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
            D  C+S       C     C Y VEY DG  + G  ++D+ S
Sbjct: 134 SDKRCSSDLQKKSRCSLLESCTYKVEYGDGSVTSGYYISDLIS 176



>gb:AP004891_1846727 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0705A04.
          Length = 514

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 37/107 (34%), Positives = 51/107 (47%), Gaps = 8/107 (7%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL----VIC 515
           +G Y   + +G PPR + +  DTGSDL WLQC APC+ C +   P++ P   L    V C
Sbjct: 149 SGEYLVDLYVGTPPRRFQMIMDTGSDLNWLQC-APCLDCFEQRGPVFDPAASLSYRNVTC 207

Query: 516 KDPLCASL--HVGDYTCESP--TQCDYDVEYADGGSSLGVLVNDVFS 644
            DP C  +        C  P    C Y   Y D  ++ G L  + F+
Sbjct: 208 GDPRCGLVAPPTAPRACRRPHSDPCPYYYWYGDQSNTTGDLALEAFT 254



>pir|T02706|T02706 hypothetical protein At2g03200 [imported] -
           Arabidopsis thaliana>gb:BT006454_1639341 Arabidopsis
           thaliana At2g03200 gene, complete cds.
          Length = 461

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 38/114 (33%), Positives = 52/114 (45%), Gaps = 4/114 (3%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           I  P +G    +G +  ++ IGNP   Y    DTGSDL W QC  PC  C   P P++ P
Sbjct: 96  IKAPTHGG---SGEFLMELSIGNPAVKYSAIVDTGSDLIWTQC-KPCTECFDQPTPIFDP 151

Query: 495 NN----DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                   V C   LC +L   +   E    C+Y   Y D  S+ G+L  + F+
Sbjct: 152 EKSSSYSKVGCSSGLCNALPRSNCN-EDKDACEYLYTYGDYSSTRGLLATETFT 204



>gb:AP003292_1827426 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0690B02.
          Length = 446

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 40/113 (35%), Positives = 52/113 (46%), Gaps = 9/113 (7%)
 Frame = +3

Query: 324 PLYGNV-YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN 500
           P++  + + +G YFA V +G P     +  DTGSDL WLQC +PC  C      ++ P  
Sbjct: 74  PVFSGIPFESGEYFALVGVGTPSTKAMLVIDTGSDLVWLQC-SPCRRCYAQRGQVFDPRR 132

Query: 501 D----LVICKDPLCASLHVGDYTCESPTQ----CDYDVEYADGGSSLGVLVND 635
                 V C  P C +L      C+S       C Y V Y DG SS G L  D
Sbjct: 133 SSTYRRVPCSSPQCRALRFPG--CDSGGAAGGGCRYMVAYGDGSSSTGDLATD 183



>gb:AY075656_1567795 Arabidopsis thaliana AT5g10770/T30N20_40 mRNA,
           complete cds.>gb:BT001004_1635259 Arabidopsis thaliana
           At5g10770/T30N20_40 mRNA, complete cds.
          Length = 474

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 37/111 (33%), Positives = 51/111 (45%), Gaps = 7/111 (6%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVH-CTKAPHPLYKPNNDL- 506
           G+   +G Y   V +G P     +  DTGSDLTW QC  PCV  C     P++ P+    
Sbjct: 124 GSTLGSGNYIVTVGLGTPKNDLSLIFDTGSDLTWTQCQ-PCVRTCYDQKEPIFNPSKSTS 182

Query: 507 ---VICKDPLCASLH--VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              V C    C SL    G+    S + C Y ++Y D   S+G L  + F+
Sbjct: 183 YYNVSCSSAACGSLSSATGNAGSCSASNCIYGIQYGDQSFSVGFLAKEKFT 233



>pir|T50786|T50786 nucleoid DNA-binding protein cnd41-like protein -
           Arabidopsis thaliana>gb:ATT30N20_1555795 Arabidopsis
           thaliana DNA chromosome 5, BAC clone T30N20 (ESSA
           project).
          Length = 446

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 37/111 (33%), Positives = 51/111 (45%), Gaps = 7/111 (6%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVH-CTKAPHPLYKPNNDL- 506
           G+   +G Y   V +G P     +  DTGSDLTW QC  PCV  C     P++ P+    
Sbjct: 96  GSTLGSGNYIVTVGLGTPKNDLSLIFDTGSDLTWTQCQ-PCVRTCYDQKEPIFNPSKSTS 154

Query: 507 ---VICKDPLCASLH--VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              V C    C SL    G+    S + C Y ++Y D   S+G L  + F+
Sbjct: 155 YYNVSCSSAACGSLSSATGNAGSCSASNCIYGIQYGDQSFSVGFLAKEKFT 205



>gb:AY243479_1592423 Arabidopsis thaliana CDR1 mRNA, complete cds.
          Length = 437

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 34/103 (33%), Positives = 42/103 (40%), Gaps = 4/103 (3%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL----VIC 515
           +G Y   V IG PP P     DTGSDL W QC APC  C     PL+ P        V C
Sbjct: 87  SGEYLMNVSIGTPPFPIMAIADTGSDLLWTQC-APCDDCYTQVDPLFDPKTSSTYKDVSC 145

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               C +L        +   C Y + Y D   + G +  D  +
Sbjct: 146 SSSQCTALENQASCSTNDNTCSYSLSYGDNSYTKGNIAVDTLT 188



>gb:AP003616_1831469 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0490F09.
          Length = 519

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 37/108 (34%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL-- 506
           G     G Y   V +G P   Y V  DTGSD TW+QC    V C +    L+ P +    
Sbjct: 175 GRALGTGNYVVTVGLGTPASRYTVVFDTGSDTTWVQCQPCVVACYEQREKLFDPASSSTY 234

Query: 507 --VICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
             V C  P C+ L V      S   C Y V+Y DG  S+G    D  +
Sbjct: 235 ANVSCAAPACSDLDVSGC---SGGHCLYGVQYGDGSYSIGFFAMDTLT 279



>gb:AP004040_1836747 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1008_D06.>gb:AP005052_1847311 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0654B04.
          Length = 458

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 34/105 (32%), Positives = 45/105 (42%), Gaps = 7/105 (6%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICK 518
           G Y  ++ +G P   Y +  DTGS LTWLQC    V C +   P++ P +      V C 
Sbjct: 120 GNYVTRMGLGTPATQYVMVVDTGSSLTWLQCSPCLVSCHRQSGPVFNPKSSSTYASVGCS 179

Query: 519 DPLCASL---HVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              C+ L    +    C S   C Y   Y D   S+G L  D  S
Sbjct: 180 AQQCSDLPSATLNPSACSSSNVCIYQASYGDSSFSVGYLSKDTVS 224



>gb:AC136216_1742995 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0022J22, complete sequence.
          Length = 481

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 36/104 (34%), Positives = 48/104 (46%), Gaps = 5/104 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YFAQV +G P     +  DTGSD+ WLQC APC HC      ++ P        V C
Sbjct: 125 SGEYFAQVGVGTPATTALMVLDTGSDVVWLQC-APCRHCYAQSGRVFDPRRSRSYAAVDC 183

Query: 516 KDPLCASLHVGDYTCE-SPTQCDYDVEYADGGSSLGVLVNDVFS 644
             P+C  L      C+     C Y V Y DG  + G   ++  +
Sbjct: 184 VAPICRRLDSAG--CDRRRNSCLYQVAYGDGSVTAGDFASETLT 225



>gb:AC105260_1737887 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1115_D04, complete sequence.
          Length = 475

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 36/104 (34%), Positives = 48/104 (46%), Gaps = 5/104 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YFAQV +G P     +  DTGSD+ WLQC APC HC      ++ P        V C
Sbjct: 119 SGEYFAQVGVGTPATTALMVLDTGSDVVWLQC-APCRHCYAQSGRVFDPRRSRSYAAVDC 177

Query: 516 KDPLCASLHVGDYTCE-SPTQCDYDVEYADGGSSLGVLVNDVFS 644
             P+C  L      C+     C Y V Y DG  + G   ++  +
Sbjct: 178 VAPICRRLDSAG--CDRRRNSCLYQVAYGDGSVTAGDFASETLT 219



>gb:OSJN00083_1694585 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064G10, complete sequence.
          Length = 451

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 5/98 (5%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVIC 515
           +G YF +V +G+PP   ++  D+GSD+ W+QC  PC  C     PL+ P    +   V C
Sbjct: 127 SGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQC-RPCEQCYAQTDPLFDPAASSSFSGVSC 185

Query: 516 KDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVL 626
              +C +L   G        +CDY V Y DG  + G L
Sbjct: 186 GSAICRTLSGTGCGGGGDAGKCDYSVTYGDGSYTKGEL 223



>gb:BT003814_1636945 Arabidopsis thaliana clone C105394 unknown
           protein (At3g20015) mRNA, complete cds.
          Length = 470

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 4/97 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVIC 515
           +G YF ++ +G+PPR  ++  D+GSD+ W+QC  PC  C K   P++ P    +   V C
Sbjct: 128 SGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQ-PCKLCYKQSDPVFDPAKSGSYTGVSC 186

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVL 626
              +C    + +  C S   C Y+V Y DG  + G L
Sbjct: 187 GSSVCD--RIENSGCHS-GGCRYEVMYGDGSYTKGTL 220



>gb:ATF24M12_1549974 Arabidopsis thaliana DNA chromosome 3, BAC
           clone F24M12.
          Length = 475

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 14/108 (12%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCD--APCVHCTK-------APHPLYKPN---- 497
           Y+A V +G PP  + V  DTGSDL WL C+    C+   +        P  LY PN    
Sbjct: 102 YYANVSVGTPPSSFLVALDTGSDLFWLPCNCGTTCIRDLEDIGVPQSVPLNLYTPNASTT 161

Query: 498 NDLVICKDPLCASLHVGDYTCESPTQ-CDYDVEYADGGSSLGVLVNDV 638
           +  + C D  C     G   C SP+  C Y + Y++   + G L+ DV
Sbjct: 162 SSSIRCSDKRC----FGSKKCSSPSSICPYQISYSNSTGTKGTLLQDV 205



>pir|E96671|E96671 hypothetical protein F13O11.13 [imported] -
           Arabidopsis thaliana>gb:AE005173_894135 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC006193_1533530 Arabidopsis thaliana
           chromosome I BAC F13O11 genomic sequence, complete
           sequence.
          Length = 431

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 34/100 (34%), Positives = 44/100 (44%), Gaps = 5/100 (5%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICK 518
           G Y   + IG PP P     DTGSDL W QC+ PC  C +   PL+ P        V C 
Sbjct: 84  GEYLMNISIGTPPVPILAIADTGSDLIWTQCN-PCEDCYQQTSPLFDPKESSTYRKVSCS 142

Query: 519 DPLCASLHVGDYTCES-PTQCDYDVEYADGGSSLGVLVND 635
              C +L   D +C +    C Y + Y D   + G +  D
Sbjct: 143 SSQCRALE--DASCSTDENTCSYTITYGDNSYTKGDVAVD 180



>pir|T45766|T45766 hypothetical protein F24M12.390 - Arabidopsis
           thaliana
          Length = 475

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 14/108 (12%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCD--APCVHCTK-------APHPLYKPN---- 497
           Y+A V +G PP  + V  DTGSDL WL C+    C+   +        P  LY PN    
Sbjct: 102 YYANVSVGTPPSSFLVALDTGSDLFWLPCNCGTTCIRDLEDIGVPQSVPLNLYTPNASTT 161

Query: 498 NDLVICKDPLCASLHVGDYTCESPTQ-CDYDVEYADGGSSLGVLVNDV 638
           +  + C D  C     G   C SP+  C Y + Y++   + G L+ DV
Sbjct: 162 SSSIRCSDKRC----FGSKKCSSPSSICPYQISYSNSTGTKGTLLQDV 205



>gb:OSJN00021_1693426 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0008A08, complete
           sequence.>gb:OSJN00287_1697978 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0011K22, complete
           sequence.>gb:OSJN00300_1698235 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: B1159F04, complete sequence.
          Length = 431

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 39/120 (32%), Positives = 54/120 (45%), Gaps = 14/120 (11%)
 Frame = +3

Query: 321 LPLYG-NV-YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH----- 479
           LPL G N+ Y  G Y+  + IG P   Y+V  DTGS   W+      + C + PH     
Sbjct: 45  LPLGGFNIPYGTGLYYTDIGIGTPAVKYYVQLDTGSKAFWVN----GISCKQCPHESDIL 100

Query: 480 ---PLYKPNNDL----VICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDV 638
                Y P + +    V C D +C S       C    +C Y   YADGG ++G+L  D+
Sbjct: 101 RKLTFYDPRSSVSSKEVKCDDTICTSRP----PCNMTLRCPYITGYADGGLTMGILFTDL 156



>gb:AC005313_1532547 Arabidopsis thaliana chromosome 2 clone T18E12
           map CIC11A04, complete sequence.
          Length = 353

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 34/97 (35%), Positives = 45/97 (46%), Gaps = 4/97 (4%)
 Frame = +3

Query: 366 QVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN----DLVICKDPLCA 533
           ++ IGNP   Y    DTGSDL W QC  PC  C   P P++ P        V C   LC 
Sbjct: 2   ELSIGNPAVKYSAIVDTGSDLIWTQC-KPCTECFDQPTPIFDPEKSSSYSKVGCSSGLCN 60

Query: 534 SLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           +L   +   E    C+Y   Y D  S+ G+L  + F+
Sbjct: 61  ALPRSNCN-EDKDACEYLYTYGDYSSTRGLLATETFT 96



>gb:AP003846_1834158 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1710_H11.
          Length = 631

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 35/107 (32%), Positives = 60/107 (56%), Gaps = 1/107 (0%)
 Frame = +3

Query: 327 LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL 506
           L+ ++  NG+Y  ++ IG P + + +  D+GS +T++ C A C  C     P ++P  DL
Sbjct: 81  LHDDLLTNGYYTTRLYIGTPSQEFALIVDSGSTVTYVPC-ATCEQCGNHQDPRFQP--DL 137

Query: 507 VICKDPLCASLHVGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS 644
                P+  ++   D TC++  +QC Y+ +YA+  SS GVL  D+ S
Sbjct: 138 SSTYSPVKCNV---DCTCDNERSQCTYERQYAEMSSSSGVLGEDIMS 181



>gb:AP003504_1830005 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0025A05.
          Length = 500

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 34/95 (35%), Positives = 44/95 (46%), Gaps = 4/95 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVIC 515
           +G YF ++ +G P  P  +  DTGSD+ WLQC APC  C      ++ P    +   V C
Sbjct: 144 SGEYFTKIGVGTPVTPALMVLDTGSDVVWLQC-APCRRCYDQSGQMFDPRASHSYGAVDC 202

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLG 620
             PLC  L  G         C Y V Y DG  + G
Sbjct: 203 AAPLCRRLDSGGCDLRRKA-CLYQVAYGDGSVTAG 236



>pir|F84679|F84679 hypothetical protein At2g28010 [imported] -
           Arabidopsis thaliana>gb:AC006929_1534795 Arabidopsis
           thaliana chromosome 2 clone T1E2 map mi54, complete
           sequence.
          Length = 396

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 31/107 (28%), Positives = 48/107 (44%)
 Frame = +3

Query: 324 PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND 503
           P    V+ N  Y  ++ +G PP       DTGS++TW QC  PCVHC +   P++ P+  
Sbjct: 54  PYANTVFDNSVYLMKLQVGTPPFEIQAIIDTGSEITWTQC-LPCVHCYEQNAPIFDPSKS 112

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               K+  C               C Y+V+Y D   ++G L  +  +
Sbjct: 113 STF-KEKRC-----------DGHSCPYEVDYFDHTYTMGTLATETIT 147



>gb:AB114914_1527502 Nepenthes gracilis nep1 mRNA for aspartic
           proteinase nepenthesin I, complete cds.
          Length = 437

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 33/95 (34%), Positives = 42/95 (44%), Gaps = 4/95 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN----DLVIC 515
           +G Y   + IG P +P+    DTGSDL W QC  PC  C     P++ P        + C
Sbjct: 92  DGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQ-PCTQCFNQSTPIFNPQGSSSFSTLPC 150

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLG 620
              LC +L     TC S   C Y   Y DG  + G
Sbjct: 151 SSQLCQAL--SSPTC-SNNFCQYTYGYGDGSETQG 182



>gb:AP004758_1844545 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0664C05.
          Length = 454

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 37/103 (35%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---AP--HPLYKPNNDLVICKD 521
           Y   V +G PPRP  +  DTGSDL W QC APC+ C +   AP   P     +  + C  
Sbjct: 90  YLMHVSVGTPPRPVALTLDTGSDLVWTQC-APCLDCFEQGAAPVLDPAASSTHAALPCDA 148

Query: 522 PLCASLHVGDYTCES--PTQCDYDVEYADGGSSLGVLVNDVFS 644
           PLC +L        S     C Y   Y D   ++G L  D F+
Sbjct: 149 PLCRALPFTSCGGRSWGDRSCVYVYHYGDRSLTVGQLATDSFT 191



>pir|T45858|T45858 hypothetical protein F3A4.130 - Arabidopsis
           thaliana>gb:ATF3A4_1550559 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F3A4.>gb:BT015816_1642434
           Arabidopsis thaliana At3g50050 gene, complete
           cds.>gb:BT020205_1642600 Arabidopsis thaliana At3g50050
           mRNA, complete cds.
          Length = 632

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = +3

Query: 327 LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL 506
           LY ++  NG+Y  ++ IG PP+ + +  D+GS +T++ C + C  C K   P ++P  ++
Sbjct: 83  LYDDLLINGYYTTRLWIGTPPQMFALIVDSGSTVTYVPC-SDCEQCGKHQDPKFQP--EM 139

Query: 507 VICKDPLCASLHVGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS 644
                P+  ++   D  C+    QC Y+ EYA+  SS GVL  D+ S
Sbjct: 140 SSTYQPVKCNM---DCNCDDDREQCVYEREYAEHSSSKGVLGEDLIS 183



>gb:AP006164_1861170 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1386G10.
          Length = 469

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 7/105 (6%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICK 518
           G Y  ++ +G P   Y +  DTGS LTWLQC    V C +   P++ P        V C 
Sbjct: 129 GNYVTRLGLGTPATSYVMVVDTGSSLTWLQCSPCSVSCHRQAGPVFDPRASGTYAAVQCS 188

Query: 519 DPLCASLH---VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              C  L    +    C     C Y   Y D   S+G L  D  S
Sbjct: 189 SSECGELQAATLNPSACSVSNVCIYQASYGDSSYSVGYLSKDTVS 233



>gb:AP002524_1822386 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP002903_1823790 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0509B06.
          Length = 454

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDA--PCVHCTKAPHPLYKPNND----LVICK 518
           Y   V++G+PPR      DTGSDL W++C           AP   + P+       V C+
Sbjct: 101 YLMTVNLGSPPRSMLAIADTGSDLVWVKCKKGNNDTSSAAAPTTQFDPSRSSTYGRVSCQ 160

Query: 519 DPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              C +L  G  TC+  + C Y   Y DG ++ GVL  + F+
Sbjct: 161 TDACEAL--GRATCDDGSNCAYLYAYGDGSNTTGVLSTETFT 200



>pir|T47790|T47790 hypothetical protein F17J16.130 - Arabidopsis
           thaliana>gb:ATF17J16_1548969 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F17J16.>gb:AY099818_1576843
           Arabidopsis thaliana putative protein (At3g59080) mRNA,
           complete cds.>gb:BT000326_1634604 Arabidopsis thaliana
           putative protein (At3g59080) mRNA, complete
           cds.>gb:AF424562_1798901 Arabidopsis thaliana
           AT3g59080/F17J16_130 mRNA, complete cds.
          Length = 535

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 7/111 (6%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL-- 506
           G    +G YF  V +G+PP+ + +  DTGSDL W+QC  PC  C +     Y P      
Sbjct: 162 GMTLGSGEYFMDVLVGSPPKHFSLILDTGSDLNWIQC-LPCYDCFQQNGAFYDPKASASY 220

Query: 507 --VICKDPLCASLHVGD--YTCESPTQ-CDYDVEYADGGSSLGVLVNDVFS 644
             + C D  C  +   D    C+S  Q C Y   Y D  ++ G    + F+
Sbjct: 221 KNITCNDQRCNLVSSPDPPMPCKSDNQSCPYYYWYGDSSNTTGDFAVETFT 271



>gb:BT015344_1642172 Arabidopsis thaliana At5g22850 gene, complete
           cds.>gb:BT020219_1642614 Arabidopsis thaliana At5g22850
           mRNA, complete cds.
          Length = 426

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 11/107 (10%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH-----PLYKPNNDL--- 506
           G Y+ ++ +G PPR ++V  DTGSD+ W+ C A C  C +          + P + +   
Sbjct: 79  GLYYTKLRLGTPPRDFYVQVDTGSDVLWVSC-ASCNGCPQTSGLQIQLNFFDPGSSVTAS 137

Query: 507 -VICKDPLCA-SLHVGDYTCESPTQ-CDYDVEYADGGSSLGVLVNDV 638
            + C D  C+  +   D  C      C Y  +Y DG  + G  V+DV
Sbjct: 138 PISCSDQRCSWGIQSSDSGCSVQNNLCAYTFQYGDGSGTSGFYVSDV 184



>gb:AC005170_1532294 Arabidopsis thaliana chromosome 2 clone T29E15
           map CIC06C07, complete sequence.
          Length = 458

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 33/99 (33%), Positives = 42/99 (42%), Gaps = 6/99 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK--APHPLYKPNNDLVI----CK 518
           +     +G PP P     DTGS L W+QC  PC HC+     HP++ P          C 
Sbjct: 96  FLVNFSVGQPPVPQLTIMDTGSSLLWIQCQ-PCKHCSSDHMIHPVFNPALSSTFVECSCD 154

Query: 519 DPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
           D  C     G   C S  +C Y+  Y  G  S GVL  +
Sbjct: 155 DRFCRYAPNGH--CGSSNKCVYEQVYISGTGSKGVLAKE 191



>gb:AB005243_1509532 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRN17.
          Length = 539

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 11/107 (10%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH-----PLYKPNNDL--- 506
           G Y+ ++ +G PPR ++V  DTGSD+ W+ C A C  C +          + P + +   
Sbjct: 79  GLYYTKLRLGTPPRDFYVQVDTGSDVLWVSC-ASCNGCPQTSGLQIQLNFFDPGSSVTAS 137

Query: 507 -VICKDPLCA-SLHVGDYTCESPTQ-CDYDVEYADGGSSLGVLVNDV 638
            + C D  C+  +   D  C      C Y  +Y DG  + G  V+DV
Sbjct: 138 PISCSDQRCSWGIQSSDSGCSVQNNLCAYTFQYGDGSGTSGFYVSDV 184



>gb:AP004774_1844838 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0431B06.
          Length = 520

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 16/118 (13%)
 Frame = +3

Query: 333 GNVYPNG-----FYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH------ 479
           G+++P+G      Y+  VD+G P   + V  DTGSDL W+ CD  C+ C           
Sbjct: 89  GSIFPSGNDLGWLYYTWVDVGTPNTSFLVALDTGSDLFWVPCD--CIQCAPLSSYHGSLD 146

Query: 480 ---PLYKPNNDLVICKDPLCASLHVGDYTCESPTQ-CDYDVEY-ADGGSSLGVLVNDV 638
               +YKP+        P    L      C +P Q C Y+++Y ++  +S G+L+ D+
Sbjct: 147 RDLGIYKPSESTTSRHLPCSHELCSPASGCTNPKQPCPYNIDYFSENTTSSGLLIEDM 204



>pir|T01996|T01996 nucleoid DNA-binding protein cnd41, chloroplast -
           common tobacco>gb:D26015_1674491 Nicotiana tabacum mRNA
           for CND41, chloroplast nucleoid DNA binding protein with
           aspartic protease activity, complete cds.
          Length = 502

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 33/102 (32%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCV-HCTKAPHPLYKPNNDL----VIC 515
           G Y   V +G P +   +  DTGSDLTW QC  PCV  C     P++ P+       + C
Sbjct: 152 GNYIVNVGLGTPKKDLSLIFDTGSDLTWTQCQ-PCVKSCYAQQQPIFDPSTSKTYSNISC 210

Query: 516 KDPLCASLH--VGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
               C+SL    G+    S + C Y ++Y D   ++G    D
Sbjct: 211 TSAACSSLKSATGNSPGCSSSNCVYGIQYGDSSFTIGFFAKD 252



>gb:AP004040_1836748 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1008_D06.>gb:AP005052_1847312 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0654B04.
          Length = 333

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 32/97 (32%), Positives = 41/97 (42%), Gaps = 7/97 (7%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICKDPLCASL- 539
           +G P   Y +  DTGS LTWLQC    V C +   P++ P +      V C    C+ L 
Sbjct: 3   LGTPATQYVMVVDTGSSLTWLQCSPCLVSCHRQSGPVFNPKSSSTYASVGCSAQQCSDLP 62

Query: 540 --HVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              +    C S   C Y   Y D   S+G L  D  S
Sbjct: 63  SATLNPSACSSSNVCIYQASYGDSSFSVGYLSKDTVS 99



>gb:AP001313_1821180 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:T5M7.
          Length = 452

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 10/109 (9%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT-KAPHPLYKPNNDLVI---- 512
           +G YF  + IG PP+   +  DTGSDL W++C A C +C+  +P  ++ P +        
Sbjct: 81  SGQYFVDLRIGQPPQSLLLIADTGSDLVWVKCSA-CRNCSHHSPATVFFPRHSSTFSPAH 139

Query: 513 CKDPLCASLHVGDYT--CESP---TQCDYDVEYADGGSSLGVLVNDVFS 644
           C DP+C  +   D    C      + C Y+  YADG  + G+   +  S
Sbjct: 140 CYDPVCRLVPKPDRAPICNHTRIHSTCHYEYGYADGSLTSGLFARETTS 188



>gb:AP004040_1836743 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1008_D06.>gb:AP005052_1847307 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0654B04.
          Length = 475

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 5/101 (4%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQC-DAPCVHCTKAPHPLYKPNN----DLVICKD 521
           Y   V +G P     ++ DTGSD++W+QC   P   C     PL+ P        V C  
Sbjct: 142 YVVTVSLGTPAVAQTLEVDTGSDVSWVQCKPCPSPPCYSQRDPLFDPTRSSSYSAVPCAA 201

Query: 522 PLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
             C+ L +    C S  QC Y V Y DG ++ GV  +D  +
Sbjct: 202 ASCSQLALYSNGC-SGGQCGYVVSYGDGSTTTGVYSSDTLT 241



>gb:AP006753_1862862 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0039D04.
          Length = 436

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 4/89 (4%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVI----CK 518
           G Y   + +G P   + V  DTGSDL W QC APC  C + P P ++P +        C 
Sbjct: 84  GGYNMNISVGTPLLTFSVVADTGSDLIWTQC-APCTKCFQQPAPPFQPASSSTFSKLPCT 142

Query: 519 DPLCASLHVGDYTCESPTQCDYDVEYADG 605
              C  L     TC + T C Y+ +Y  G
Sbjct: 143 SSFCQFLPNSIRTCNA-TGCVYNYKYGSG 170



>gb:AP003811_1833698 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1131_E05.>gb:AP006753_1862869 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039D04.
          Length = 453

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/99 (37%), Positives = 46/99 (46%), Gaps = 9/99 (9%)
 Frame = +3

Query: 345 PNGF-YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPC-VHCTKAPHPLYKPNND----L 506
           PNG  Y   + IG PP+ Y    DTGSDL W QC APC   C K P PLY P++     +
Sbjct: 87  PNGGEYIMTLAIGTPPQSYPAIADTGSDLVWTQC-APCGERCFKQPSPLYNPSSSPTFRV 145

Query: 507 VICKDPL---CASLHVGDYTCESPTQCDYDVEYADGGSS 614
           + C   L    A   +   T      C Y+  Y  G +S
Sbjct: 146 LPCSSALNLCAAEARLAGATPPPGCACRYNQTYGTGWTS 184



>gb:AB008267_1510437 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMG4.
          Length = 586

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 35/109 (32%), Positives = 57/109 (52%), Gaps = 1/109 (0%)
 Frame = +3

Query: 321 LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN 500
           + LY ++  NG+Y  ++ IG PP+ + +  DTGS +T++ C + C  C K   P ++P  
Sbjct: 64  MKLYDDLLSNGYYTTRLWIGTPPQEFALIVDTGSTVTYVPC-STCKQCGKHQDPKFQP-- 120

Query: 501 DLVICKDPLCASLHVGDYTCESPTQ-CDYDVEYADGGSSLGVLVNDVFS 644
           +L      L  +    D  C+   + C Y+  YA+  SS GVL  D+ S
Sbjct: 121 ELSTSYQALKCN---PDCNCDDEGKLCVYERRYAEMSSSSGVLSEDLIS 166



>gb:AP006149_1860977 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1274F11.
          Length = 476

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 40/118 (33%), Positives = 54/118 (45%), Gaps = 13/118 (11%)
 Frame = +3

Query: 324 PLYGNVYPNGF---YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHP---- 482
           P +G    N F   ++A V +G P   + V  DTGSDL W+ CD  C+ C     P    
Sbjct: 48  PPHGTADLNDFGFLHYAVVALGTPNVTFLVALDTGSDLFWVPCD--CLKCAPFQSPNYGS 105

Query: 483 ----LYKPNNDLVICKDPLCASLHVGDYTCESPT-QCDYDVEY-ADGGSSLGVLVNDV 638
               +Y P       K P  ++L      C S +  C Y ++Y +D  SS GVLV DV
Sbjct: 106 LKFDVYSPAQSTTSRKVPCSSNLCDLQNACRSKSNSCPYSIQYLSDNTSSSGVLVEDV 163



>gb:AF083666_1766898 Arabidopsis thaliana clone sps3 unknown mRNA.
          Length = 464

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 5/104 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCV-HCTKAPHPLYKPNNDL----VI 512
           +G Y   + IG P     +  DTGSDLTW QC+ PC+  C     P + P++      V 
Sbjct: 129 SGNYIVTIGIGTPKHDLSLVFDTGSDLTWTQCE-PCLGSCYSQKEPKFNPSSSSTYQNVS 187

Query: 513 CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           C  P+C      D    S + C Y + Y D   + G L  + F+
Sbjct: 188 CSSPMCE-----DAESCSASNCVYSIGYGDKSFTQGFLAKEKFT 226



>pir|T50785|T50785 nucleoid DNA-binding protein cnd41-like protein -
           Arabidopsis thaliana>gb:ATT30N20_1555794 Arabidopsis
           thaliana DNA chromosome 5, BAC clone T30N20 (ESSA
           project).>gb:AY072168_1567060 Arabidopsis thaliana
           putative nucleoid DNA-binding protein cnd41 (At5g10760)
           mRNA, complete cds.>gb:AY133788_1581608 Arabidopsis
           thaliana clone U18251 putative nucleoid DNA-binding
           protein cnd41 (At5g10760) mRNA, complete cds.
          Length = 464

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 5/104 (4%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCV-HCTKAPHPLYKPNNDL----VI 512
           +G Y   + IG P     +  DTGSDLTW QC+ PC+  C     P + P++      V 
Sbjct: 129 SGNYIVTIGIGTPKHDLSLVFDTGSDLTWTQCE-PCLGSCYSQKEPKFNPSSSSTYQNVS 187

Query: 513 CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           C  P+C      D    S + C Y + Y D   + G L  + F+
Sbjct: 188 CSSPMCE-----DAESCSASNCVYSIVYGDKSFTQGFLAKEKFT 226



>gb:AP006753_1862863 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0039D04.
          Length = 451

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 33/89 (37%), Positives = 39/89 (43%), Gaps = 4/89 (4%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVI----CK 518
           G Y   + IG PP  + V  DTGS L W QC APC  C   P P ++P +        C 
Sbjct: 88  GAYNMNLSIGTPPVTFSVLADTGSSLIWTQC-APCTECAARPAPPFQPASSSTFSKLPCA 146

Query: 519 DPLCASLHVGDYTCESPTQCDYDVEYADG 605
             LC  L     TC + T C Y   Y  G
Sbjct: 147 SSLCQFLTSPYLTCNA-TGCVYYYPYGMG 174



>gb:AP005420_1851518 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0418B08.>gb:AP005579_1854432 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1740_D06.
          Length = 473

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 37/107 (34%), Positives = 49/107 (45%), Gaps = 11/107 (10%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICKDP 524
           Y A V +G       VD  T S+LTW+QC APC  C     PL+ P +     ++ C   
Sbjct: 127 YVATVGLGGGEATVIVD--TASELTWVQC-APCASCHDQQGPLFDPASSPSYAVLPCNSS 183

Query: 525 LCASLHVGDYTC-------ESPTQCDYDVEYADGGSSLGVLVNDVFS 644
            C +L V   +        E P+ C Y + Y DG  S GVL +D  S
Sbjct: 184 SCDALQVATGSAAGACGGGEQPS-CSYTLSYRDGSYSQGVLAHDKLS 229



>gb:AB026442S2_1516991 Nicotiana sylvestris gene for 41 kD
           chloroplast nucleoid DNA binding protein (CND41), exon 2
           and complete cds.
          Length = 502

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 7/105 (6%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCV-HCTKAPHPLYKPNNDL----VIC 515
           G Y   V +G P +   +  DTGSDLTW QC  PCV  C     P++ P+       + C
Sbjct: 152 GNYIVNVGLGTPKKDLSLIFDTGSDLTWTQCQ-PCVKSCYAQQQPIFDPSASKTYSNISC 210

Query: 516 KDPLCASLH--VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               C+ L    G+    S + C Y ++Y D   ++G    D  +
Sbjct: 211 TSTACSGLKSATGNSPGCSSSNCVYGIQYGDSSFTVGFFAKDTLT 255



>gb:AP003564_1830874 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0062J13.
          Length = 494

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 5/83 (6%)
 Frame = +3

Query: 411 DTGSDLTWLQCD-APCVHCTKAPHPLYKP----NNDLVICKDPLCASLHVGDYTCESPTQ 575
           DT SD+TW+QC   P   C      LY P    ++ +  C  P C  L      C +  Q
Sbjct: 174 DTASDVTWVQCSPCPTPPCYPQKDVLYDPTKSSSSGVFSCNSPTCTQLGPYANGCTNNNQ 233

Query: 576 CDYDVEYADGGSSLGVLVNDVFS 644
           C Y V Y DG S+ G  ++D+ +
Sbjct: 234 CQYRVRYPDGTSTAGTYISDLLT 256



>pir|T50012|T50012 hypothetical protein T31P16.70 - Arabidopsis
           thaliana>gb:ATT31P16_1555844 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T31P16 (ESSA project).
          Length = 528

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 17/111 (15%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP---------------HPLYK 491
           ++  +DIG P   + V  DTGS+L W+ C+  CV C                   +P   
Sbjct: 100 HYTWIDIGTPSVSFLVALDTGSNLLWIPCN--CVQCAPLTSTYYSSLATKDLNEYNPSSS 157

Query: 492 PNNDLVICKDPLCASLHVGDYTCESP-TQCDYDVEYADGG-SSLGVLVNDV 638
             + + +C   LC S       CESP  QC Y V Y  G  SS G+LV D+
Sbjct: 158 STSKVFLCSHKLCDSAS----DCESPKEQCPYTVNYLSGNTSSSGLLVEDI 204



>gb:AB109206_1526817 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone: P0478E02.
          Length = 732

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 36/104 (34%), Positives = 49/104 (47%), Gaps = 10/104 (9%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHP--------LYKPNNDLVI 512
           ++A V +G P   + V  DTGSDL W+ CD  C+ C     P        +Y P      
Sbjct: 99  HYAVVALGTPNVTFLVALDTGSDLFWVPCD--CLKCAPFQSPNYGSLKFDVYSPAQSTTS 156

Query: 513 CKDPLCASLHVGDYTCESPT-QCDYDVEY-ADGGSSLGVLVNDV 638
            K P  ++L      C S +  C Y ++Y +D  SS GVLV DV
Sbjct: 157 RKVPCSSNLCDLQNACRSKSNSCPYSIQYLSDNTSSSGVLVEDV 200



>pir|H84679|H84679 hypothetical protein At2g28030 [imported] -
           Arabidopsis thaliana>gb:CQ789597_1452880 Sequence 47
           from Patent WO2004022780.>gb:AC005851_1533121
           Arabidopsis thaliana chromosome 2 clone F24D13 map B68,
           complete sequence.>gb:AC006929_1534793 Arabidopsis
           thaliana chromosome 2 clone T1E2 map mi54, complete
           sequence.
          Length = 392

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 30/104 (28%), Positives = 44/104 (42%)
 Frame = +3

Query: 324 PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND 503
           P    ++    Y  ++ +G PP     + DTGSDL W QC  PC +C     P++ P+N 
Sbjct: 50  PYADTLFDYNIYLMKLQVGTPPFEIEAEIDTGSDLIWTQC-MPCTNCYSQYAPIFDPSNS 108

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
               K+  C           +   C Y + YAD   S G L  +
Sbjct: 109 STF-KEKRC-----------NGNSCHYKIIYADTTYSKGTLATE 140



>pir|T08979|T08979 hypothetical protein F6G3.60 - Arabidopsis
           thaliana>gb:ATCHRIV72_1546924 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 72.>gb:ATF6G3_1550830
           Arabidopsis thaliana DNA chromosome 4, BAC clone F6G3
           (ESSA project).
          Length = 424

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 2/95 (2%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           + A + IGNPP P  +  DTGSDLTW+ C  PC  C     P + P+           ++
Sbjct: 78  FLANISIGNPPVPQLLLIDTGSDLTWIHC-LPC-KCYPQTIPFFHPSRSSTYRNASCVSA 135

Query: 537 LHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND 635
            H     +  E    C Y + Y D  ++ G+L  +
Sbjct: 136 PHAMPQIFRDEKTGNCQYHLRYRDFSNTRGILAEE 170



>pir|C84682|C84682 hypothetical protein At2g28220 [imported] -
           Arabidopsis thaliana>gb:AC006202_1533612 Arabidopsis
           thaliana chromosome 2 clone T3B23 map mi54, complete
           sequence.
          Length = 756

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 28/104 (26%), Positives = 45/104 (43%)
 Frame = +3

Query: 324 PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND 503
           P    +Y    Y  ++ +G PP     + DTGSD+ W QC  PC +C     P++ P+  
Sbjct: 410 PYADTLYDYSIYLMKLQVGTPPFEIVAEIDTGSDIIWTQC-MPCPNCYSQFAPIFDPSKS 468

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
               ++  C           +   C Y++ YAD   S G+L  +
Sbjct: 469 STF-REQRC-----------NGNSCHYEIIYADKTYSKGILATE 500



 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 28/104 (26%), Positives = 43/104 (41%)
 Frame = +3

Query: 324 PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND 503
           P    ++    Y  ++ +G PP     + DTGSDL W QC  PC  C     P++ P+  
Sbjct: 71  PYADTLFDYNIYLMKLQVGTPPFEIAAEIDTGSDLIWTQC-MPCPDCYSQFDPIFDPSK- 128

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                     S    +  C   + C Y++ Y D   S G+L  +
Sbjct: 129 ----------SSTFNEQRCHGKS-CHYEIIYEDNTYSKGILATE 161



>pir|T45765|T45765 hypothetical protein F24M12.380 - Arabidopsis
           thaliana>gb:ATF24M12_1549973 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.
          Length = 518

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 35/108 (32%), Positives = 47/108 (43%), Gaps = 14/108 (12%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCD--APCVHCTK-------APHPLYKPN---- 497
           ++A V +G P   + V  DTGSDL WL C+    C+H  K        P  LY PN    
Sbjct: 91  HYANVSLGTPATWFLVALDTGSDLFWLPCNCGTTCIHDLKDARFSESVPLNLYTPNASTT 150

Query: 498 NDLVICKDPLCASLHVGDYTCESPTQ-CDYDVEYADGGSSLGVLVNDV 638
           +  + C D  C     G   C SP   C Y +  +    + G L+ DV
Sbjct: 151 SSSIRCSDKRC----FGSGKCSSPESICPYQIALSSNTVTTGTLLQDV 194



>gb:AY039899_1560413 Arabidopsis thaliana AT3g61820/F15G16_210 mRNA,
           complete cds.
          Length = 362

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 8/99 (8%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YF ++ +G P    ++  DTGSD+ WLQC +PC  C      ++ P        V C
Sbjct: 132 SGEYFMRLGVGTPATNVYMVLDTGSDVVWLQC-SPCKACYNQTDAIFDPKKSKTFATVPC 190

Query: 516 KDPLCASLHVGDYTCESPTQ----CDYDVEYADGGSSLG 620
              LC  L   D + E  T+    C Y V Y DG  + G
Sbjct: 191 GSRLCRRL---DDSSECVTRRSKTCLYQVSYGDGSFTEG 226



>pir|T47974|T47974 hypothetical protein F15G16.210 - Arabidopsis
           thaliana>gb:ATF15G16_1548708 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F15G16.
          Length = 483

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 33/99 (33%), Positives = 46/99 (46%), Gaps = 8/99 (8%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVIC 515
           +G YF ++ +G P    ++  DTGSD+ WLQC +PC  C      ++ P        V C
Sbjct: 132 SGEYFMRLGVGTPATNVYMVLDTGSDVVWLQC-SPCKACYNQTDAIFDPKKSKTFATVPC 190

Query: 516 KDPLCASLHVGDYTCESPTQ----CDYDVEYADGGSSLG 620
              LC  L   D + E  T+    C Y V Y DG  + G
Sbjct: 191 GSRLCRRL---DDSSECVTRRSKTCLYQVSYGDGSFTEG 226



>gb:AY090445_1574134 Arabidopsis thaliana At1g79720/F19K16_30 mRNA,
           complete cds.>gb:AK117694_1815715 Arabidopsis thaliana
           At1g79720 mRNA for unknown protein, complete cds, clone:
           RAFL17-36-A04.
          Length = 484

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 35/105 (33%), Positives = 43/105 (40%), Gaps = 12/105 (11%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVICKDP 524
           Y   V++G       VD  TGSDLTW+QC  PC  C     PLY P    +   V C   
Sbjct: 135 YIVTVELGGKNMSLIVD--TGSDLTWVQCQ-PCRSCYNQQGPLYDPSVSSSYKTVFCNSS 191

Query: 525 LCASL--------HVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
            C  L          G       T C+Y V Y DG  + G L ++
Sbjct: 192 TCQDLVAATSNSGPCGGNNGVVKTPCEYVVSYGDGSYTRGDLASE 236



>gb:AY088536_1573554 Arabidopsis thaliana clone 7650 mRNA, complete
           sequence.
          Length = 484

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 35/105 (33%), Positives = 43/105 (40%), Gaps = 12/105 (11%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVICKDP 524
           Y   V++G       VD  TGSDLTW+QC  PC  C     PLY P    +   V C   
Sbjct: 135 YIVTVELGGKNMSLIVD--TGSDLTWVQCQ-PCRSCYNQQGPLYDPSVSSSYKTVFCNSS 191

Query: 525 LCASL--------HVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
            C  L          G       T C+Y V Y DG  + G L ++
Sbjct: 192 TCQDLVAATSNSGPCGGNNGVVKTPCEYVVSYGDGSYTRGDLASE 236



>pir|B96828|B96828 probable aspartyl proteinase, 105611-106921
           [imported] - Arabidopsis thaliana>gb:AE005173_895492
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010793_1537070 Genomic sequence for
           Arabidopsis thaliana BAC F20B17 from chromosome I,
           complete sequence.>gb:AC011717_1537379 Arabidopsis
           thaliana chromosome 1 BAC F19K16 genomic sequence,
           complete sequence.
          Length = 436

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 35/105 (33%), Positives = 43/105 (40%), Gaps = 12/105 (11%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVICKDP 524
           Y   V++G       VD  TGSDLTW+QC  PC  C     PLY P    +   V C   
Sbjct: 87  YIVTVELGGKNMSLIVD--TGSDLTWVQCQ-PCRSCYNQQGPLYDPSVSSSYKTVFCNSS 143

Query: 525 LCASL--------HVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
            C  L          G       T C+Y V Y DG  + G L ++
Sbjct: 144 TCQDLVAATSNSGPCGGNNGVVKTPCEYVVSYGDGSYTRGDLASE 188



>gb:AP003216_1825398 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0090K04.
          Length = 452

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 10/106 (9%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCD-----APC-VHCTKAPHPLYKPNNDLVICK 518
           Y   V +G+P     V  DTGSD++W+QC+     +PC  H      P          C 
Sbjct: 108 YVISVGLGSPAVTQRVVIDTGSDVSWVQCEPCPAPSPCHAHAGALFDPAASSTYAAFNCS 167

Query: 519 DPLCASLHVGD----YTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              CA L  GD      C++ ++C Y V+Y DG ++ G   +DV +
Sbjct: 168 AAACAQL--GDSGEANGCDAKSRCQYIVKYGDGSNTTGTYSSDVLT 211



>gb:OSJN00013_1693276 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064H22, complete sequence.
          Length = 464

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 29/99 (29%), Positives = 39/99 (39%), Gaps = 4/99 (4%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICK 518
           G Y  ++ IG PP  +    DT SDL W QC  PC  C     P++ P        + C 
Sbjct: 87  GEYLVKLGIGTPPYKFTAAIDTASDLIWTQCQ-PCTGCYHQVDPMFNPRVSSTYAALPCS 145

Query: 519 DPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
              C  L V     +    C Y   Y+   ++ G L  D
Sbjct: 146 SDTCDELDVHRCGHDDDESCQYTYTYSGNATTEGTLAVD 184



>pir|T08980|T08980 hypothetical protein F6G3.70 - Arabidopsis
           thaliana>gb:ATCHRIV72_1546925 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 72.>gb:ATF6G3_1550831
           Arabidopsis thaliana DNA chromosome 4, BAC clone F6G3
           (ESSA project).
          Length = 427

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 3/97 (3%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           +   + IG+PP    +  DT SDL W+QC  PC++C     P++ P+      ++  C +
Sbjct: 85  FLVNISIGSPPITQLLHMDTASDLLWIQC-LPCINCYAQSLPIFDPSRSYT-HRNETCRT 142

Query: 537 LHVGDYTCE---SPTQCDYDVEYADGGSSLGVLVNDV 638
                 + +   +   C+Y + Y D   S G+L  ++
Sbjct: 143 SQYSMPSLKFNANTRSCEYSMRYVDDTGSKGILAREM 179



>gb:AP006753_1862867 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0039D04.
          Length = 455

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 30/93 (32%), Positives = 38/93 (40%), Gaps = 8/93 (8%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC--TKAPHPLYKPNNDLVI---- 512
           G Y   + +G PP  + V  DTGS+L W QC APC  C     P P+ +P          
Sbjct: 89  GAYNMNISLGTPPLDFPVIVDTGSNLIWAQC-APCTRCFPRPTPAPVLQPARSSTFSRLP 147

Query: 513 CKDPLCASLHVGD--YTCESPTQCDYDVEYADG 605
           C    C  L       TC +   C Y+  Y  G
Sbjct: 148 CNGSFCQYLPTSSRPRTCNATAACAYNYTYGSG 180



>gb:BT002746_1636349 Arabidopsis thaliana clone C105368 unknown
           protein (At3g51330) mRNA, complete cds.
          Length = 529

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 15/109 (13%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCD--APCVHCTK-------APHPLYKPN---- 497
           ++A V +G P   + V  DTGSDL WL C+  + C+   K        P  LY PN    
Sbjct: 102 HYANVSVGTPATWFLVALDTGSDLFWLPCNCGSTCIRDLKEVGLSQSRPLNLYSPNTSST 161

Query: 498 NDLVICKDPLCASLHVGDYTCESP-TQCDYDVEYADGGS-SLGVLVNDV 638
           +  + C D  C     G   C SP + C Y ++Y    + + G L  DV
Sbjct: 162 SSSIRCSDDRC----FGSSRCSSPASSCPYQIQYLSKDTFTTGTLFEDV 206



>pir|T45764|T45764 hypothetical protein F24M12.370 - Arabidopsis
           thaliana>gb:ATF24M12_1549972 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.
          Length = 519

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 15/109 (13%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCD--APCVHCTK-------APHPLYKPN---- 497
           ++A V +G P   + V  DTGSDL WL C+  + C+   K        P  LY PN    
Sbjct: 102 HYANVSVGTPATWFLVALDTGSDLFWLPCNCGSTCIRDLKEVGLSQSRPLNLYSPNTSST 161

Query: 498 NDLVICKDPLCASLHVGDYTCESP-TQCDYDVEYADGGS-SLGVLVNDV 638
           +  + C D  C     G   C SP + C Y ++Y    + + G L  DV
Sbjct: 162 SSSIRCSDDRC----FGSSRCSSPASSCPYQIQYLSKDTFTTGTLFEDV 206



>gb:AE016959_1023639 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541236
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753458 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 397

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 31/104 (29%), Positives = 45/104 (43%), Gaps = 4/104 (3%)
 Frame = +3

Query: 345 PNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVI---- 512
           P  +  A   IG PP+      D   +L W QC + C+HC K   P++ PN         
Sbjct: 50  PELYNVANFTIGTPPQAASAFIDLTGELVWTQC-SQCIHCFKQDLPVFVPNASSTFKPEP 108

Query: 513 CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           C   +C S+      C S   C YD     GG ++G++  D F+
Sbjct: 109 CGTDVCKSIPTP--KCASDV-CAYDGVTGLGGHTVGIVATDTFA 149



>gb:AP004040_1836744 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1008_D06.>gb:AP005052_1847308 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0654B04.
          Length = 463

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 32/103 (31%), Positives = 45/103 (43%), Gaps = 7/103 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVH--CTKAPHPLYKPNND----LVICK 518
           Y   V +G P     V  DTGSD++W+QC+ PC +  C      L+ P        V C 
Sbjct: 127 YVISVGLGTPAVTQTVTIDTGSDVSWVQCN-PCPNPPCYAQTGALFDPAKSSTYRAVSCA 185

Query: 519 DPLCASLHVGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS 644
              CA L      C +   +C Y V+Y DG ++ G    D  +
Sbjct: 186 AAECAQLEQQGNGCGATNYECQYGVQYGDGSTTNGTYSRDTLT 228



>gb:AY536047_1612315 Fagopyrum esculentum aspartic protease-like
           protein (API1) mRNA, partial cds.
          Length = 297

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 33/103 (32%), Positives = 46/103 (44%), Gaps = 15/103 (14%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAP-----CVHCT-----KAPHPLYKPNNDLVI---- 512
           +G PP+   +  DTGS L W  C  P     C +CT         P+Y  N    +    
Sbjct: 1   LGTPPQKVSLVLDTGSSLVWTPCTIPTATYTCQNCTFSGVDPTKIPIYARNKSSTVQSLP 60

Query: 513 CKDPLCASLHVGDYTCESPTQCD-YDVEYADGGSSLGVLVNDV 638
           C+ P C  +   D  C +  +C  Y +EY   GS+ G LV+DV
Sbjct: 61  CRSPKCNWVFGSDLNCSTTKRCPYYGLEYG-LGSTTGQLVSDV 102



>gb:AC074196_1541248 Oryza sativa chromosome 10 BAC OSJNBa0040D23
           genomic sequence, complete sequence.
          Length = 377

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 33/114 (28%), Positives = 45/114 (39%), Gaps = 4/114 (3%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           + +P+Y  +   G Y A   IG PP+P     D   +L W QC  PC  C +   PL+ P
Sbjct: 45  VAVPIY--LSSQGLYVANFTIGTPPQPVSAVVDLTGELVWTQC-TPCQPCFEQDLPLFDP 101

Query: 495 NNDLVI----CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                     C   LC S+      C S   C Y+      G + G    D F+
Sbjct: 102 TKSSTFRGLPCGSHLCESIPESSRNCTSDV-CIYEAP-TKAGDTGGKAGTDTFA 153



>gb:AE016959_1023651 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC096782_1736348
           Oryza sativa chromosome 10 BAC OSJNBa0025B05 genomic
           sequence, complete sequence.>gb:AE017116_1753470 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           70 of 77 of the complete sequence.
          Length = 405

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 33/114 (28%), Positives = 45/114 (39%), Gaps = 4/114 (3%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           + +P+Y  +   G Y A   IG PP+P     D   +L W QC  PC  C +   PL+ P
Sbjct: 45  VAVPIY--LSSQGLYVANFTIGTPPQPVSAVVDLTGELVWTQC-TPCQPCFEQDLPLFDP 101

Query: 495 NNDLVI----CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                     C   LC S+      C S   C Y+      G + G    D F+
Sbjct: 102 TKSSTFRGLPCGSHLCESIPESSRNCTSDV-CIYEAP-TKAGDTGGKAGTDTFA 153



>gb:AE016959_1023650 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541247
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017116_1753469 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           70 of 77 of the complete sequence.
          Length = 373

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 34/113 (30%), Positives = 48/113 (42%), Gaps = 4/113 (3%)
 Frame = +3

Query: 318 VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN 497
           V+P+Y   +    Y A + IG PP+P         +  W QC +PC  C K   PL+  +
Sbjct: 18  VVPIY---WSQPLYMANLTIGTPPQPASAIIHLAGEFVWTQC-SPCRRCFKQDLPLFNRS 73

Query: 498 NDLVI----CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                    C   LC S+     TC     C Y+VE   G +S G+   D F+
Sbjct: 74  ASSTYRPEPCGTALCESVPAS--TCSGDGVCSYEVETMFGDTS-GIGGTDTFA 123



>gb:AP003458_1829828 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0701E03.
          Length = 472

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 36/110 (32%), Positives = 47/110 (42%), Gaps = 14/110 (12%)
 Frame = +3

Query: 348 NGFYFAQ-VDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC---TKAPHPLYKPNNDL--- 506
           N F F   V +G PP    V  DTGS L+W+QC    VHC   +    P++ P       
Sbjct: 110 NDFLFLMAVSLGKPPVVNLVAIDTGSTLSWVQCQPCAVHCHTQSAKAGPIFDPGRSYTSR 169

Query: 507 -VICKDPLCA----SLHVGDYTC-ESPTQCDYDVEYADGGS-SLGVLVND 635
            V C    C      L +    C E    C Y V Y +G + S+G +V D
Sbjct: 170 RVRCSSVKCGELRYDLRLQQANCMEKEDSCTYSVTYGNGWAYSVGKMVTD 219



>pir|T10194|T10194 hypothetical protein F25G13.10 - Arabidopsis
           thaliana>gb:ATCHRIV35_1545056 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           35.>gb:ATF25G13_1549997 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F25G13, partial sequence (ESSA
           project).
          Length = 389

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 34/116 (29%), Positives = 53/116 (45%), Gaps = 6/116 (5%)
 Frame = +3

Query: 315 IVLPLYGNVYPNGFYF-AQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC-TKAPHPLY 488
           + LPL       G  F A++  G+P +  F+  DTGS LTW QC  PC  C  +  +P Y
Sbjct: 43  VSLPLSSPHSQRGLAFMAEIHFGSPQKKQFLHMDTGSSLTWTQC-FPCSDCYAQKIYPKY 101

Query: 489 KPNNDLVICKDPLCASLHVGD---YTCESPTQ-CDYDVEYADGGSSLGVLVNDVFS 644
           +P   +   +D +C   H      +  +  T+ C Y   Y D  +  G L  ++ +
Sbjct: 102 RPAASITY-RDAMCEDSHPKSNPHFAFDPLTRICTYQQHYLDETNIKGTLAQEMIT 156



>gb:AE016959_1023647 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541244
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753466 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 396

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 25/92 (27%), Positives = 36/92 (39%), Gaps = 4/92 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           +   FY   + IG PP+P     D G +L W QC   C  C K   PL+  N       +
Sbjct: 46  FSQAFYVVNLTIGTPPQPVSAIIDIGGELVWTQCAQHCRRCFKQDLPLFDTNASSTFRPE 105

Query: 522 P----LCASLHVGDYTCESPTQCDYDVEYADG 605
           P    +C S+       +    C Y+   + G
Sbjct: 106 PCGAAVCESIPTRSCAGDGGGACGYEASTSFG 137



>gb:AY088920_1573928 Arabidopsis thaliana clone 99625 mRNA, complete
           sequence.
          Length = 430

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 33/98 (33%), Positives = 44/98 (44%), Gaps = 11/98 (11%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-------HPLYKPNNDLVICKDPLCA 533
           IG PP+   +  DTGS L+W+QC     H  K P        P    +   + C  PLC 
Sbjct: 78  IGTPPQAQQMVLDTGSQLSWIQC-----HRKKLPPKPKTSFDPSLSSSFSTLPCSHPLCK 132

Query: 534 SLHVGDYT----CESPTQCDYDVEYADGGSSLGVLVND 635
              + D+T    C+S   C Y   YADG  + G LV +
Sbjct: 133 P-RIPDFTLPTSCDSNRLCHYSYFYADGTFAEGNLVKE 169



>gb:AB025630_1516552 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPA22.>gb:AY054192_1563014 Arabidopsis thaliana
           AT5g37540/mpa22_p_70 mRNA, complete
           cds.>gb:AY092990_1574944 Arabidopsis thaliana unknown
           protein (At5g37540) mRNA, complete
           cds.>gb:BT000082_1634360 Arabidopsis thaliana unknown
           protein (At5g37540) mRNA, complete cds.
          Length = 442

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 34/104 (32%), Positives = 45/104 (43%), Gaps = 14/104 (13%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL----------VICKDP 524
           IG P +   +  DTGS L+W+QC     H  K   PL  P              + C  P
Sbjct: 86  IGTPSQSQELVLDTGSQLSWIQC-----HPKKIKKPLPPPTTSFDPSLSSSFSDLPCSHP 140

Query: 525 LCASLHVGDYT----CESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           LC    + D+T    C+S   C Y   YADG  + G LV + F+
Sbjct: 141 LCKP-RIPDFTLPTSCDSNRLCHYSYFYADGTFAEGNLVKEKFT 183



>gb:AE016959_1023645 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541242
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753464 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 418

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 31/100 (31%), Positives = 43/100 (43%), Gaps = 6/100 (6%)
 Frame = +3

Query: 363 AQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVI----CKDPLC 530
           A   IG PP+P     D   +L W QC + C  C K   PL+ PN         C    C
Sbjct: 69  ANFTIGTPPQPASAIIDVAGELVWTQC-SMCSRCFKQDLPLFVPNASSTFRPEPCGTDAC 127

Query: 531 ASLHVGDYTCESPTQCDYD--VEYADGGSSLGVLVNDVFS 644
            S+   +  C S   C Y+  +    GG +LG++  D F+
Sbjct: 128 KSIPTSN--CSS-NMCTYEGTINSKLGGHTLGIVATDTFA 164



>pir|F96686|F96686 unknown protein F15E12.7 [imported] - Arabidopsis
           thaliana>gb:AE005173_894266 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC026480_1539651 Arabidopsis thaliana
           chromosome 1 BAC F15E12 genomic sequence, complete
           sequence.>gb:AY035077_1559849 Arabidopsis thaliana
           unknown protein (At1g66180) mRNA, complete
           cds.>gb:AY051031_1562507 Arabidopsis thaliana unknown
           protein (At1g66180) mRNA, complete cds.
          Length = 430

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 33/98 (33%), Positives = 44/98 (44%), Gaps = 11/98 (11%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-------HPLYKPNNDLVICKDPLCA 533
           IG PP+   +  DTGS L+W+QC     H  K P        P    +   + C  PLC 
Sbjct: 78  IGTPPQAQQMVLDTGSQLSWIQC-----HRKKLPPKPKTSFDPSLSSSFSTLPCSHPLCK 132

Query: 534 SLHVGDYT----CESPTQCDYDVEYADGGSSLGVLVND 635
              + D+T    C+S   C Y   YADG  + G LV +
Sbjct: 133 P-RIPDFTLPTSCDSNRLCHYSYFYADGTFAEGNLVKE 169



>gb:AP006164_1861185 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1386G10.
          Length = 521

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/102 (31%), Positives = 45/102 (44%), Gaps = 13/102 (12%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPC--VHCTKAPHPLYKPNND----LVICK 518
           Y   + IG P     V  DTGSDL+W+QC  PC    C     PL+ P++      V C 
Sbjct: 171 YVVTLGIGTPAVQQTVLIDTGSDLSWVQC-KPCGAGECYAQKDPLFDPSSSSSYASVPCD 229

Query: 519 DPLCASLHVGDY-------TCESPTQCDYDVEYADGGSSLGV 623
              C  L  G Y       +  +   C+Y +EY +  ++ GV
Sbjct: 230 SDACRKLAAGAYGHGCTGVSGGAAALCEYGIEYGNRATTTGV 271



>gb:AY070426_1566822 Arabidopsis thaliana unknown protein
           (At3g12700) mRNA, complete cds.
          Length = 439

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/109 (29%), Positives = 45/109 (41%), Gaps = 8/109 (7%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQC-------DAPCVHCTKAPHPLYKPNN 500
           Y    YF ++ +G P + + V  DTGS+LTW+ C       D   V              
Sbjct: 79  YGTAQYFTEIRVGTPAKKFRVVVDTGSELTWVNCRYRARGKDNRRVFRADESKSFKTVGC 138

Query: 501 DLVICKDPLCASLHVGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS 644
               CK  L     +   TC +P T C YD  YADG ++ GV   +  +
Sbjct: 139 LTQTCKVDLMNLFSL--TTCPTPSTPCSYDYRYADGSAAQGVFAKETIT 185



>gb:AB024033_1515784 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MBK21.
          Length = 461

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/109 (29%), Positives = 45/109 (41%), Gaps = 8/109 (7%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQC-------DAPCVHCTKAPHPLYKPNN 500
           Y    YF ++ +G P + + V  DTGS+LTW+ C       D   V              
Sbjct: 101 YGTAQYFTEIRVGTPAKKFRVVVDTGSELTWVNCRYRARGKDNRRVFRADESKSFKTVGC 160

Query: 501 DLVICKDPLCASLHVGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS 644
               CK  L     +   TC +P T C YD  YADG ++ GV   +  +
Sbjct: 161 LTQTCKVDLMNLFSL--TTCPTPSTPCSYDYRYADGSAAQGVFAKETIT 207



>gb:AP003457_1829791 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0660D08.>gb:AP003564_1830884 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0062J13.
          Length = 495

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 5/75 (6%)
 Frame = +3

Query: 411 DTGSDLTWLQCD-APCVHCTKAPHPLYKPNNDL----VICKDPLCASLHVGDYTCESPTQ 575
           D+GSD++W+QC   P   C +   PL+ P        V C    CA L      C +  Q
Sbjct: 173 DSGSDVSWVQCKPCPLPMCHRQRDPLFDPAMSTTYAAVPCTSAACAQLGPYRRGCSANAQ 232

Query: 576 CDYDVEYADGGSSLG 620
           C + + Y DG ++ G
Sbjct: 233 CQFGINYGDGSTATG 247



>gb:AE016959_1023644 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541241
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753463 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 413

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 34/105 (32%), Positives = 44/105 (41%), Gaps = 8/105 (7%)
 Frame = +3

Query: 354 FYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCA 533
           +Y A   IG PP+P     D   +L W QC A C  C K   P++ PN       +P   
Sbjct: 61  YYVANFTIGTPPQPASAIVDVAGELVWTQCSA-CRRCFKQDLPVFVPNASSTFKPEP--- 116

Query: 534 SLHVGDYTCES-PTQ-CDYDVEYADG------GSSLGVLVNDVFS 644
               G   CES PT+ C  DV    G      G++ G    D F+
Sbjct: 117 ---CGTAVCESIPTRSCSGDVCSYKGPPTQLRGNTSGFAATDTFA 158



>gb:OSJN00123_1695270 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0071D01, complete sequence.
          Length = 530

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 11/105 (10%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH----------PLYKPNNDL 506
           ++A V +G P + + V  DTGSDL WL C   C  CT              P     +  
Sbjct: 116 HYALVTVGTPGQTFMVALDTGSDLFWLPCQ--CDGCTPPASAASGSASFYIPSMSSTSQA 173

Query: 507 VICKDPLCASLHVGDYTCESPTQCDYDVEYADGG-SSLGVLVNDV 638
           V C    C         C + +QC Y + Y     SS G LV DV
Sbjct: 174 VPCNSQFCELRK----ECSTTSQCPYKMVYVSADTSSSGFLVEDV 214



>gb:BT003834_1636963 Arabidopsis thaliana clone RAFL15-11-N13
           (R20556) putative chloroplast nucleoid DNA binding
           protein (At2g28040) mRNA, complete
           cds.>gb:BT020369_1642764 Arabidopsis thaliana At2g28040
           gene, complete cds.
          Length = 395

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 29/104 (27%), Positives = 42/104 (40%)
 Frame = +3

Query: 324 PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND 503
           P    V+    Y  ++ IG PP       DTGS+  W QC  PCVHC     P++ P+  
Sbjct: 54  PYADTVFDTYEYLMKLQIGTPPFEIEAVLDTGSEHIWTQC-LPCVHCYNQTAPIFDPSKS 112

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
               K+  C +             C Y++ Y     + G LV +
Sbjct: 113 STF-KEIRCDT---------HDHSCPYELVYGGKSYTKGTLVTE 146



>gb:AB019224_1514045 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K17O22.
          Length = 491

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 34/125 (27%), Positives = 47/125 (37%), Gaps = 31/125 (24%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQC---DAPCVHC-------TKAP---HPLYKPN 497
           Y   ++IG PP+   V  DTGSDLTW+ C      C+ C        K+P    PL+   
Sbjct: 83  YLITLNIGTPPQAVQVYLDTGSDLTWVPCGNLSFDCIECYDLKNNDLKSPSVFSPLHSST 142

Query: 498 NDLVICKDPLCASLHVGD------------------YTCESPTQCDYDVEYADGGSSLGV 623
           +    C    C  +H  D                   TC  P    +   Y +GG   G+
Sbjct: 143 SFRDSCASSFCVEIHSSDNPFDPCAVAGCSVSMLLKSTCVRPCP-SFAYTYGEGGLISGI 201

Query: 624 LVNDV 638
           L  D+
Sbjct: 202 LTRDI 206



>pir|A84680|A84680 hypothetical protein At2g28040 [imported] -
           Arabidopsis thaliana>gb:AC005851_1533120 Arabidopsis
           thaliana chromosome 2 clone F24D13 map B68, complete
           sequence.>gb:AC006929_1534792 Arabidopsis thaliana
           chromosome 2 clone T1E2 map mi54, complete sequence.
          Length = 389

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 29/104 (27%), Positives = 42/104 (40%)
 Frame = +3

Query: 324 PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND 503
           P    V+    Y  ++ IG PP       DTGS+  W QC  PCVHC     P++ P+  
Sbjct: 48  PYADTVFDTYEYLMKLQIGTPPFEIEAVLDTGSEHIWTQC-LPCVHCYNQTAPIFDPSKS 106

Query: 504 LVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
               K+  C +             C Y++ Y     + G LV +
Sbjct: 107 STF-KEIRCDT---------HDHSCPYELVYGGKSYTKGTLVTE 140



>gb:AP004585_1841902 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0470B03.
          Length = 373

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 7/93 (7%)
 Frame = +3

Query: 387 PRPYFVDPDTGSDLTWLQCDAPCVHCTKAPH---PLYKPNND----LVICKDPLCASLHV 545
           PR   VD  TGSDL W QC         A H   P+Y P        + C D LC     
Sbjct: 25  PRKLIVD--TGSDLIWTQCKLSSSTAAAARHGSPPVYDPGESSTFAFLPCSDRLCQEGQF 82

Query: 546 GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               C S  +C Y+  Y    +++GVL ++ F+
Sbjct: 83  SFKNCTSKNRCVYEDVYG-SAAAVGVLASETFT 114



>pir|T48240|T48240 hypothetical protein T7H20.240 - Arabidopsis
           thaliana>gb:ATT7H20_1556434 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T7H20 (ESSA
           project).>gb:BT015130_1642100 Arabidopsis thaliana
           At5g02190 gene, complete cds.>gb:BT015855_1642473
           Arabidopsis thaliana At5g02190 gene, complete cds.
          Length = 453

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 10/99 (10%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPL--YKPNNDL----VICKDPLCAS 536
           +G PP+   +  DTGS+L+WL+C+      +  P+P+  + P        + C  P C +
Sbjct: 79  VGTPPQNISMVIDTGSELSWLRCNR-----SSNPNPVNNFDPTRSSSYSPIPCSSPTCRT 133

Query: 537 LHVGDY----TCESPTQCDYDVEYADGGSSLGVLVNDVF 641
               D+    +C+S   C   + YAD  SS G L  ++F
Sbjct: 134 -RTRDFLIPASCDSDKLCHATLSYADASSSEGNLAAEIF 171



>pir|T04698|T04698 hypothetical protein F4B14.150 - Arabidopsis
           thaliana>gb:ATCHRIV84_1547548 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 84.>gb:ATF4B14_1550622
           Arabidopsis thaliana DNA chromosome 4, BAC clone F4B14
           (ESSA project).
          Length = 455

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 14/108 (12%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCD----APCVHCTKAP-------HPLYKPNND 503
           ++  V +G P   + V  DTGSDL W+ CD    AP    T A        +P     N 
Sbjct: 107 HYTTVKLGTPGMRFMVALDTGSDLFWVPCDCGKCAPTEGATYASEFELSIYNPKVSTTNK 166

Query: 504 LVICKDPLCASLH--VGDYTCESPTQCDYDVEYADGGSSL-GVLVNDV 638
            V C + LCA  +  +G +     + C Y V Y    +S  G+L+ DV
Sbjct: 167 KVTCNNSLCAQRNQCLGTF-----STCPYMVSYVSAQTSTSGILMEDV 209



>gb:AP006064_1860791 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0023I13.
          Length = 524

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 33/92 (35%), Positives = 38/92 (41%), Gaps = 17/92 (18%)
 Frame = +3

Query: 411 DTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICKDPLC-ASLHV---------- 545
           DTGSDLTW+QC  PC  C     PL+ P+       V C    C ASL            
Sbjct: 181 DTGSDLTWVQC-KPCSVCYAQRDPLFDPSGSASYAAVPCNASACEASLKAATGVPGSCAT 239

Query: 546 --GDYTCESPTQCDYDVEYADGGSSLGVLVND 635
             G        +C Y + Y DG  S GVL  D
Sbjct: 240 VGGGGGGGKSERCYYSLAYGDGSFSRGVLATD 271



>gb:AE016959_1023642 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541239
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753461 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 394

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 33/113 (29%), Positives = 45/113 (39%), Gaps = 4/113 (3%)
 Frame = +3

Query: 318 VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN 497
           V+P++     N  Y A   IG PP+P     D   +L W QC   C  C +   PL+ P 
Sbjct: 40  VVPIHWTQAMN--YVANFTIGTPPQPASAVIDLAGELVWTQC-KQCSRCFEQDTPLFDPT 96

Query: 498 NDLVI----CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                    C  PLC S+      C S   C Y     + G + G +  D F+
Sbjct: 97  ASNTYRAEPCGTPLCESIPSDSRNC-SGNVCAYQAS-TNAGDTGGKVGTDTFA 147



>gb:AP003335_1828166 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1144G04.
          Length = 216

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +3

Query: 321 LPLYGNVYPN-GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP 476
           +PL    Y   G YF +  +G P +P+ +  DTGSDLTW++C       + +P
Sbjct: 74  MPLSSGAYTGTGQYFVRFRVGTPAQPFLLVADTGSDLTWVKCHRAAAAASASP 126



>gb:AC091774_1735050 Oryza sativa chromosome 6 BAC OJ1540_H01
           genomic sequence, complete sequence.>gb:AP003769_1833297
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, PAC clone:P0541C02.
          Length = 551

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 35/112 (31%), Positives = 45/112 (40%), Gaps = 18/112 (16%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT----------------KAPHPLY 488
           ++A+V +G P   + V  DTGSDL W+ CD  C  C                 +   P  
Sbjct: 105 HYAEVAVGTPNTTFLVALDTGSDLFWVPCD--CKQCAPLGNLTAVDGGGGPELRQYSPSK 162

Query: 489 KPNNDLVICKDPLCASLHVGDYTCESPT-QCDYDVEYADGG-SSLGVLVNDV 638
              +  V C   LC   +     C + T  C Y V YA    SS G LV DV
Sbjct: 163 SSTSKTVTCASNLCDQPN----ACATATSSCPYAVRYAMANTSSSGELVEDV 210



>gb:OSJN00092_1694767 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088H09, complete sequence.
          Length = 490

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 30/130 (23%)
 Frame = +3

Query: 336 NVYPNGF--YFAQVDIGNPPRPYFVDPDTGSDLTWL----QCDAPCVHCTKAP-----HP 482
           ++YP+ +  Y   V +G PP+P  V  +TGS L+W+       A C   + A      HP
Sbjct: 80  SLYPHSYGGYAFTVSLGTPPQPLPVLLETGSHLSWVPSTSSYSANCSSLSAASPLHVFHP 139

Query: 483 LYKPNNDLVICKDPLCASLHVGDY--TCESPTQC-----------------DYDVEYADG 605
               ++ L+ C++P C  +H  D+   C + + C                  Y V Y   
Sbjct: 140 KNSSSSRLIGCRNPSCLWIHSPDHLSDCRAASSCPGANCTPRNANANNVCPPYLVVYG-S 198

Query: 606 GSSLGVLVND 635
           GS+ G+L++D
Sbjct: 199 GSTAGLLISD 208



>gb:BX538352_1359028 Cryptosporidium parvum chromosome 6, complete
           sequence; segment 3/4.
          Length = 467

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP 494
           Y N  YF ++++G PPR + V  DTGS   W+     C H    PH  Y P
Sbjct: 91  YQNSQYFGKIEVGTPPREFVVIFDTGSSSVWIP-SIECKHKGCEPHNKYDP 140



>gb:AE016959_1023638 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541235
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753457 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 394

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 33/113 (29%), Positives = 46/113 (40%), Gaps = 4/113 (3%)
 Frame = +3

Query: 318 VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN 497
           V+P++     N  Y A   IG PP+P     D   +L W QC   C  C +   PL+ P 
Sbjct: 40  VVPIHWTQAMN--YVANFTIGTPPQPASAVIDLAGELVWTQC-KQCGRCFEQGTPLFDPT 96

Query: 498 NDLVI----CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
                    C  PLC S+      C S   C Y+    + G + G +  D F+
Sbjct: 97  ASNTYRAEPCGTPLCESIPSDVRNC-SGNVCAYEAS-TNAGDTGGKVGTDTFA 147



>gb:AK118359_1816342 Arabidopsis thaliana At2g39710 mRNA for unknown
           protein, complete cds, clone: RAFL19-62-P06.
          Length = 442

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 11/100 (11%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP------HPLYKPNNDLVICKDPLCAS 536
           +G+PP+   +  DTGS+L+WL       HC K+P      +P+       V C  P+C +
Sbjct: 71  VGDPPQNISMVLDTGSELSWL-------HCKKSPNLGSVFNPVSSSTYSPVPCSSPICRT 123

Query: 537 LHVGDY----TCESPTQ-CDYDVEYADGGSSLGVLVNDVF 641
               D     +C+  T  C   + YAD  S  G L ++ F
Sbjct: 124 -RTRDLPIPASCDPKTHLCHVAISYADATSIEGNLAHETF 162



>gb:AC003000_1530914 Arabidopsis thaliana chromosome 2 clone T5I7
           map CIC10A06, complete sequence.>gb:AC003674_1531179
           Arabidopsis thaliana chromosome 2 clone F17A14 map
           CIC10A06, complete sequence.>gb:AY051049_1562525
           Arabidopsis thaliana unknown protein (At2g39710) mRNA,
           complete cds.>gb:AF370142_1792030 Arabidopsis thaliana
           unknown protein (At2g39710) mRNA, complete cds.
          Length = 442

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 11/100 (11%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP------HPLYKPNNDLVICKDPLCAS 536
           +G+PP+   +  DTGS+L+WL       HC K+P      +P+       V C  P+C +
Sbjct: 71  VGDPPQNISMVLDTGSELSWL-------HCKKSPNLGSVFNPVSSSTYSPVPCSSPICRT 123

Query: 537 LHVGDY----TCESPTQ-CDYDVEYADGGSSLGVLVNDVF 641
               D     +C+  T  C   + YAD  S  G L ++ F
Sbjct: 124 -RTRDLPIPASCDPKTHLCHVAISYADATSIEGNLAHETF 162



>pir|T01000|T01000 hypothetical protein At2g39710 [imported] -
           Arabidopsis thaliana
          Length = 441

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 11/100 (11%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP------HPLYKPNNDLVICKDPLCAS 536
           +G+PP+   +  DTGS+L+WL       HC K+P      +P+       V C  P+C +
Sbjct: 70  VGDPPQNISMVLDTGSELSWL-------HCKKSPNLGSVFNPVSSSTYSPVPCSSPICRT 122

Query: 537 LHVGDY----TCESPTQ-CDYDVEYADGGSSLGVLVNDVF 641
               D     +C+  T  C   + YAD  S  G L ++ F
Sbjct: 123 -RTRDLPIPASCDPKTHLCHVAISYADATSIEGNLAHETF 161



>gb:AP003240_1826050 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406G08.>gb:AP003251_1826304 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0446B05.
          Length = 442

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 31/98 (31%), Positives = 41/98 (41%), Gaps = 8/98 (8%)
 Frame = +3

Query: 375 IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPL-YKPNNDLVICKDPLCASLHVGD 551
           +G PP+   +  DTGS+L+WL C             L ++P   L     P C S     
Sbjct: 72  VGTPPQNVTMVLDTGSELSWLLCAPGGGGGGGGRSALSFRPRASLTFASVP-CDSAQCRS 130

Query: 552 YTCESPTQCD-------YDVEYADGGSSLGVLVNDVFS 644
               SP  CD         + YADG SS G L  +VF+
Sbjct: 131 RDLPSPPACDGASKQCRVSLSYADGSSSDGALATEVFT 168



>gb:AY088661_1573677 Arabidopsis thaliana clone 8987 mRNA, complete
           sequence.
          Length = 425

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP--HPLYKPNNDLVICKDPLC 530
           Y  + +IG P +P  V  DT +D  W+ C   CV C+ +    P    ++  + C+ P C
Sbjct: 88  YIVRANIGTPAQPMLVALDTSNDAAWIPCSG-CVGCSSSVLFDPSKSSSSRTLQCEAPQC 146

Query: 531 ASLHVGDYTCESPTQCDYDVEYADGGSSL 617
                 + +C     C +++ Y  GGS++
Sbjct: 147 K--QAPNPSCTVSKSCGFNMTY--GGSTI 171



>pir|T47599|T47599 nucleoid DNA-binding-like protein - Arabidopsis
           thaliana>gb:ATT12E18_1554328 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T12E18.>gb:AY070479_1566862
           Arabidopsis thaliana AT3g54400/T12E18_90 mRNA, complete
           cds.>gb:AY124840_1580205 Arabidopsis thaliana
           AT3g54400/T12E18_90 mRNA, complete cds.
          Length = 425

 Score = 41.6 bits (96), Expect = 0.012
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP--HPLYKPNNDLVICKDPLC 530
           Y  + +IG P +P  V  DT +D  W+ C   CV C+ +    P    ++  + C+ P C
Sbjct: 88  YIVRANIGTPAQPMLVALDTSNDAAWIPCSG-CVGCSSSVLFDPSKSSSSRTLQCEAPQC 146

Query: 531 ASLHVGDYTCESPTQCDYDVEYADGGSSL 617
                 + +C     C +++ Y  GGS++
Sbjct: 147 K--QAPNPSCTVSKSCGFNMTY--GGSTI 171



>gb:AP003457_1829804 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0660D08.
          Length = 424

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 28/84 (33%), Positives = 36/84 (42%), Gaps = 6/84 (7%)
 Frame = +3

Query: 411 DTGSDLTWLQCDAPCV--HCTKAPHPLYKPNND----LVICKDPLCASLHVGDYTCESPT 572
           DT  DL W+QC APC    C    + L+ P        V C    C  L      C S  
Sbjct: 151 DTSIDLPWIQC-APCPMPECYPQQNALFDPRRSRTSAAVPCGSAACGELGRYGAGC-SNN 208

Query: 573 QCDYDVEYADGGSSLGVLVNDVFS 644
           QC Y V+Y DG ++ G  + D  +
Sbjct: 209 QCQYFVDYGDGRATSGTYMVDALT 232



>gb:AP003456_1829754 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0542E10.>gb:AP003457_1829808 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0660D08.
          Length = 424

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 28/84 (33%), Positives = 36/84 (42%), Gaps = 6/84 (7%)
 Frame = +3

Query: 411 DTGSDLTWLQCDAPCV--HCTKAPHPLYKPNND----LVICKDPLCASLHVGDYTCESPT 572
           DT  DL W+QC APC    C    + L+ P        V C    C  L      C S  
Sbjct: 151 DTSIDLPWIQC-APCPMPECYPQQNALFDPRRSRTSAAVPCGSAACGELGRYGAGC-SNN 208

Query: 573 QCDYDVEYADGGSSLGVLVNDVFS 644
           QC Y V+Y DG ++ G  + D  +
Sbjct: 209 QCQYFVDYGDGRATSGTYMVDALT 232



>gb:AF370291_1792176 Arabidopsis thaliana unknown protein
           (At1g09750) mRNA, partial cds.
          Length = 375

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 7/111 (6%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN---D 503
           GN    G Y  +  +G PP+  F+  DT +D  WL C   C  C+ A       ++    
Sbjct: 22  GNQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSG-CSGCSNASTSFNTNSSSTYS 80

Query: 504 LVICKDPLCASLHVGDYTCES----PTQCDYDVEYADGGSSLGVLVNDVFS 644
            V C    C        TC S    P+ C ++  Y    S    LV D  +
Sbjct: 81  TVSCSTAQCTQAR--GLTCPSSSPQPSVCSFNQSYGGDSSFSASLVQDTLT 129



>pir|D86231|D86231 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889979 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY088375_1573395 Arabidopsis thaliana clone
           6295 mRNA, complete sequence.>gb:BT002332_1635935
           Arabidopsis thaliana clone C104927 unknown protein
           (At1g09750) mRNA, complete cds.>gb:F21M12_1677852
           Sequence of BAC F21M12 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 449

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 7/111 (6%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN---D 503
           GN    G Y  +  +G PP+  F+  DT +D  WL C   C  C+ A       ++    
Sbjct: 96  GNQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSG-CSGCSNASTSFNTNSSSTYS 154

Query: 504 LVICKDPLCASLHVGDYTCES----PTQCDYDVEYADGGSSLGVLVNDVFS 644
            V C    C        TC S    P+ C ++  Y    S    LV D  +
Sbjct: 155 TVSCSTAQCTQAR--GLTCPSSSPQPSVCSFNQSYGGDSSFSASLVQDTLT 203



>gb:AC135207_1742049 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1261C08, complete sequence.
          Length = 447

 Score = 40.8 bits (94), Expect = 0.020
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 7/98 (7%)
 Frame = +3

Query: 369 VDIGNPPRPYFVDPDTGSDLTWLQCDAP-CVHCTKAPHPLYKPNNDLVICKDPLC----A 533
           V +G PP+   +  DTGS+L+WL C+       T A +     +   V C    C     
Sbjct: 59  VAVGTPPQNVTMVLDTGSELSWLLCNGSYAPPLTPAFNASGSSSYGAVPCPSTACEWRGR 118

Query: 534 SLHVGDYTCESP--TQCDYDVEYADGGSSLGVLVNDVF 641
            L V  + C++P    C   + YAD  S+ GVL  D F
Sbjct: 119 DLPVPPF-CDTPPSNACRVSLSYADASSADGVLATDTF 155



>gb:AP003919_1835235 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1734_E04.
          Length = 449

 Score = 40.4 bits (93), Expect = 0.026
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +3

Query: 339 VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLY 488
           +Y +  Y A+++IG   +  ++  DTGS L W QCD  C HC     P Y
Sbjct: 76  IYEDVVYLAEMEIGERQQKQYLLIDTGSSLVWTQCD-ECPHCHIGDVPPY 124



>gb:AY584109_1339155 Plasmodium vivax isolate KOR 21 aspartic
           protease PM5 mRNA, complete cds.>gb:AY584110_1339156
           Plasmodium vivax isolate KOR 22 aspartic protease PM5
           mRNA, complete cds.
          Length = 536

 Score = 40.4 bits (93), Expect = 0.026
 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 4/110 (3%)
 Frame = +3

Query: 327 LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN-- 500
           LYG++    +YF  +DIG P +   +  DTGS      C A C +C       +  NN  
Sbjct: 52  LYGDIDEYAYYFLDIDIGTPEQRISLILDTGSSSLSFPC-AGCKNCGVHMENPFNLNNSK 110

Query: 501 --DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              ++ C++  C         C    +C+Y   Y +G    G   +DV S
Sbjct: 111 TSSILYCENEECPF----KLNCVK-GKCEYMQSYCEGSQISGFYFSDVVS 155



>gb:AY584090_1339136 Plasmodium vivax isolate KOR 1 aspartic
           protease PM5 mRNA, complete cds.>gb:AY584091_1339137
           Plasmodium vivax isolate KOR 2 aspartic protease PM5
           mRNA, complete cds.>gb:AY584092_1339138 Plasmodium vivax
           isolate KOR 3 aspartic protease PM5 mRNA, complete
           cds.>gb:AY584093_1339139 Plasmodium vivax isolate KOR 4
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584094_1339140 Plasmodium vivax isolate KOR 5
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584095_1339141 Plasmodium vivax isolate KOR 6
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584096_1339142 Plasmodium vivax isolate KOR 7
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584097_1339143 Plasmodium vivax isolate KOR 8
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584098_1339144 Plasmodium vivax isolate KOR 9
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584099_1339145 Plasmodium vivax isolate KOR 10
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584100_1339146 Plasmodium vivax isolate KOR 11
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584101_1339147 Plasmodium vivax isolate KOR 12
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584102_1339148 Plasmodium vivax isolate KOR 14
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584103_1339149 Plasmodium vivax isolate KOR 15
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584104_1339150 Plasmodium vivax isolate KOR 16
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584105_1339151 Plasmodium vivax isolate KOR 17
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584106_1339152 Plasmodium vivax isolate KOR 18
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584107_1339153 Plasmodium vivax isolate KOR 19
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584108_1339154 Plasmodium vivax isolate KOR 20
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584111_1339157 Plasmodium vivax isolate KOR 13
           aspartic protease PM5 mRNA, complete cds.
          Length = 536

 Score = 40.4 bits (93), Expect = 0.026
 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 4/110 (3%)
 Frame = +3

Query: 327 LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN-- 500
           LYG++    +YF  +DIG P +   +  DTGS      C A C +C       +  NN  
Sbjct: 52  LYGDIDEYAYYFLDIDIGTPEQRISLILDTGSSSLSFPC-AGCKNCGVHMENPFNLNNSK 110

Query: 501 --DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
              ++ C++  C         C    +C+Y   Y +G    G   +DV S
Sbjct: 111 TSSILYCENEECPF----KLNCVK-GKCEYMQSYCEGSQISGFYFSDVVS 155



>gb:BC089070_2566036 Xenopus tropicalis cDNA clone MGC:107756
           IMAGE:7004284, complete cds.
          Length = 385

 Score = 40.0 bits (92), Expect = 0.034
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = +3

Query: 330 YGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN 497
           Y  +Y + +YF ++ IG PP+ + V  DTGS   W+     C       HPL+ P+
Sbjct: 65  YEPMYLDIYYFGEISIGTPPQNFLVAFDTGSSNLWV-ASTYCQSQACTNHPLFNPS 119



>gb:PFMAL13_1191311 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 590

 Score = 40.0 bits (92), Expect = 0.034
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 3/107 (2%)
 Frame = +3

Query: 327 LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDA--PC-VHCTKAPHPLYKPN 497
           LYG++    +YF  +DIG P +   +  DTGS      C+    C +H  K  +  Y   
Sbjct: 90  LYGDIDEYAYYFLDIDIGKPSQRISLILDTGSSSLSFPCNGCKDCGIHMEKPYNLNYSKT 149

Query: 498 NDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDV 638
           + ++ C    C         C    +C+Y   Y +G    G   +D+
Sbjct: 150 SSILYCNKSNCPY----GLKCVG-NKCEYLQSYCEGSQIYGFYFSDI 191



>gb:OSJN00082_1694563 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0061C06, complete sequence.
          Length = 183

 Score = 39.7 bits (91), Expect = 0.045
 Identities = 26/67 (38%), Positives = 31/67 (46%), Gaps = 7/67 (10%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCD---APCVHCTKAPHPLYKPNNDL----V 509
           G YF +  IG+PP+      DTGS+L W QC    A    C K   PLY  +       V
Sbjct: 79  GEYFTEYLIGDPPQHAEAIVDTGSNLVWTQCTDCLAVADRCFKQHLPLYNYSASRSAKPV 138

Query: 510 ICKDPLC 530
            C D LC
Sbjct: 139 PCTDALC 145



>gb:AY507155_1610023 Botryotinia fuckeliana aspartic proteinase
           precursor (ap3) gene, complete cds.
          Length = 519

 Score = 39.7 bits (91), Expect = 0.045
 Identities = 28/110 (25%), Positives = 41/110 (37%), Gaps = 6/110 (5%)
 Frame = +3

Query: 333 GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVI 512
           GN   +G Y+A V +G P +   +  DTGS   W+                  P++   I
Sbjct: 64  GNAVTSGLYYANVTVGTPAQALSLQIDTGSSDVWV------------------PSSSASI 105

Query: 513 CKDPLCASLHVGDY------TCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           C+D        G +      T     Q  +++ Y DG  S G    D FS
Sbjct: 106 CEDTRDGGCPGGSFDFSASKTFLDVDQDAFNISYVDGTGSTGDYFQDTFS 155



>gb:AB045892_1520469 Nepenthes alata NaAP2 mRNA for aspartic
           proteinase 2, complete cds.
          Length = 514

 Score = 39.3 bits (90), Expect = 0.058
 Identities = 21/69 (30%), Positives = 31/69 (44%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y +  YF ++ IG+PP+ + V  DTGS   W+             HP YK        K+
Sbjct: 85  YMDAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPKYKSFKSSTYAKN 144

Query: 522 PLCASLHVG 548
              A++H G
Sbjct: 145 GKSAAIHYG 153



>gb:ETE293829_1384941 Eimeria tenella mRNA for aspartyl proteinase
           (eimepsin).>gb:ETE293830_1384942 Eimeria tenella
           eimepsin gene for aspartyl proteinase (eimepsin), exons
           1-18.
          Length = 468

 Score = 39.3 bits (90), Expect = 0.058
 Identities = 26/82 (31%), Positives = 33/82 (40%), Gaps = 9/82 (10%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLV- 509
           Y N  YF ++ IG P R + V  DTGS   W+    P   C K   APH  + P      
Sbjct: 97  YHNSQYFGEIKIGTPGRRFVVVFDTGSSNLWV----PAAECEKGGCAPHEKFDPKYSSTF 152

Query: 510 -----ICKDPLCASLHVGDYTC 560
                +  DP  A +  G   C
Sbjct: 153 SPIRSLTGDPAVAFIQYGTGAC 174



>gb:AE016959_1023648 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541245
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017116_1753467 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           70 of 77 of the complete sequence.
          Length = 419

 Score = 39.3 bits (90), Expect = 0.058
 Identities = 30/114 (26%), Positives = 46/114 (40%), Gaps = 5/114 (4%)
 Frame = +3

Query: 318 VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDA-PCVHCTKAPHPLYKP 494
           V+PL+   +    Y A   IG PP+      D   +L W QC A     C K   P++ P
Sbjct: 52  VVPLH---WSGAHYVANFTIGTPPQAVSGIVDLSGELVWTQCAACRSSGCFKQELPVFDP 108

Query: 495 NNDLVI----CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
           +         C  PLC S+   +  C    +C Y+   +  G + G+   D  +
Sbjct: 109 SASNTYRAEQCGSPLCKSIPTRN--CSGDGECGYEAP-SMFGDTFGIASTDAIA 159



>pir|S35971|S35971 aspartic proteinase - Eimeria
           acervulina>gb:EAASPPRTA_1384106 E.acervulina aspartyl
           protease complete CDS.
          Length = 468

 Score = 39.3 bits (90), Expect = 0.058
 Identities = 26/82 (31%), Positives = 33/82 (40%), Gaps = 9/82 (10%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLV- 509
           Y N  YF ++ IG P R + V  DTGS   W+    P   C K   APH  + P      
Sbjct: 97  YHNSQYFGEIKIGTPGRRFVVVFDTGSSNLWV----PAAECEKGGCAPHEKFDPKYSSTF 152

Query: 510 -----ICKDPLCASLHVGDYTC 560
                +  DP  A +  G   C
Sbjct: 153 SPIRSLTGDPAVAFIQYGTGAC 174



>sp|P16476|PEPE_CHICK Embryonic pepsinogen precursor (EC
           3.4.23.-).>pir|A41443|A41443 pepsin (EC 3.4.23.-)
           precursor, embryonic - chicken>gb:CHKPSN_2569500 Gallus
           gallus mRNA for pepsinogen, complete cds.
          Length = 383

 Score = 39.3 bits (90), Expect = 0.058
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 3/78 (3%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVICKDPL 527
           Y+  + IG PP+ + V  DTGS   W+    P V CT      H ++ P+          
Sbjct: 76  YYGTISIGTPPQDFTVVFDTGSSNLWV----PSVSCTSPACQSHQMFNPSQSSTYKSTGQ 131

Query: 528 CASLHVGDYTCESPTQCD 581
             S+H G    E    CD
Sbjct: 132 NLSIHYGTGDMEGTVGCD 149



>gb:BC075134_2558247 Xenopus laevis hypothetical protein LOC443721,
           mRNA (cDNA clone IMAGE:7009273), partial cds.
          Length = 398

 Score = 38.9 bits (89), Expect = 0.076
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y +  Y+ ++ IG PP+P+ V  DTGS   W+    P VHC+
Sbjct: 73  YLDAQYYGEISIGTPPQPFTVVFDTGSSNLWV----PSVHCS 110



>gb:RCHRCAPAA_1703371 Rhizopus chinensis (clone 36c6) rhizopuspepsin
           I (RCAPI) mRNA, partial cds.
          Length = 340

 Score = 38.5 bits (88), Expect = 0.099
 Identities = 26/93 (27%), Positives = 38/93 (40%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           Y+ QV IG P + + +D DTGS   W+     C +C  +    Y PN             
Sbjct: 84  YYGQVTIGTPGKKFNLDFDTGSSDLWI-ASTLCTNC-GSRQTKYDPNQS----------- 130

Query: 537 LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                Y  +  T   + + Y DG S+ G+L  D
Sbjct: 131 ---STYQADGRT---WSISYGDGSSASGILAKD 157



>gb:ATU51036_1557064 Arabidopsis thaliana aspartic proteinase mRNA,
           partial cds.
          Length = 486

 Score = 38.5 bits (88), Expect = 0.099
 Identities = 20/69 (28%), Positives = 31/69 (44%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y +  Y+ ++ IG PP+ + V  DTGS   W+             HP YK +      K+
Sbjct: 57  YLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSSTYEKN 116

Query: 522 PLCASLHVG 548
              A++H G
Sbjct: 117 GKAAAIHYG 125



>gb:AB010697_1511205 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MOJ9.>gb:AY085521_1570590 Arabidopsis thaliana
           clone 15560 mRNA, complete sequence.
          Length = 439

 Score = 38.5 bits (88), Expect = 0.099
 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 2/89 (2%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC--TKAPHPLYKPNNDLVICKDPLC 530
           Y  +  IG P +P  +  DT SD+ W+ C   CV C    A  P    +   V C  P C
Sbjct: 99  YIVKALIGTPAQPLLLAMDTSSDVAWIPCSG-CVGCPSNTAFSPAKSTSFKNVSCSAPQC 157

Query: 531 ASLHVGDYTCESPTQCDYDVEYADGGSSL 617
               V + TC     C +++ Y  G SS+
Sbjct: 158 K--QVPNPTC-GARACSFNLTY--GSSSI 181



>gb:AE016959_1023646 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541243
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753465 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 397

 Score = 38.5 bits (88), Expect = 0.099
 Identities = 27/78 (34%), Positives = 33/78 (42%), Gaps = 2/78 (2%)
 Frame = +3

Query: 363 AQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCASLH 542
           A   IG PP+P     D   +L W QC + C  C K   PL+ PN       +P      
Sbjct: 45  ANFTIGTPPQPASAIIDVAGELVWTQC-SRCSRCFKQDLPLFIPNASSTFRPEP------ 97

Query: 543 VGDYTCES-PT-QCDYDV 590
            G   C+S PT  C  DV
Sbjct: 98  CGTDACKSTPTSNCSGDV 115



>pir|F86253|F86253 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890204 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY056387_1563695 Arabidopsis thaliana
           At1g11910/F12F1_24 mRNA, complete
           cds.>gb:AY056403_1563711 Arabidopsis thaliana
           At1g11910/F12F1_24 mRNA, complete
           cds.>gb:AY063974_1565919 Arabidopsis thaliana putative
           aspartic proteinase (At1g11910) mRNA, complete
           cds.>gb:AY088657_1573673 Arabidopsis thaliana clone 8972
           mRNA, complete sequence.>gb:BT001980_1635583 Arabidopsis
           thaliana clone U11602 putative aspartic proteinase
           (At1g11910) mRNA, complete cds.>gb:F12F1_1677355
           Arabidopsis thaliana chromosome 1 BAC F12F1 sequence,
           complete sequence.
          Length = 506

 Score = 38.5 bits (88), Expect = 0.099
 Identities = 20/69 (28%), Positives = 31/69 (44%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y +  Y+ ++ IG PP+ + V  DTGS   W+             HP YK +      K+
Sbjct: 77  YLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSSTYEKN 136

Query: 522 PLCASLHVG 548
              A++H G
Sbjct: 137 GKAAAIHYG 145



>pir|A41415|A41415 rhizopuspepsin (EC 3.4.23.21) I - Rhizopus
           chinensis
          Length = 325

 Score = 38.5 bits (88), Expect = 0.099
 Identities = 26/93 (27%), Positives = 38/93 (40%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           Y+ QV IG P + + +D DTGS   W+     C +C  +    Y PN             
Sbjct: 17  YYGQVTIGTPGKKFNLDFDTGSSDLWI-ASTLCTNC-GSRQTKYDPNQS----------- 63

Query: 537 LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                Y  +  T   + + Y DG S+ G+L  D
Sbjct: 64  ---STYQADGRT---WSISYGDGSSASGILAKD 90



>sp|Q800A0|CATE_RANCA Cathepsin E precursor (EC
           3.4.23.34).>gb:AB093036_2464523 Rana catesbeiana CE mRNA
           for cathepsin E, complete cds.
          Length = 397

 Score = 38.5 bits (88), Expect = 0.099
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF Q+ IG PP+ + V  DTGS   W+    P ++CT      H  Y+P+
Sbjct: 74  YFGQISIGTPPQQFTVIFDTGSSNLWV----PSIYCTSQACTKHNRYRPS 119



>gb:BC061433_2553207 Xenopus tropicalis hypothetical protein
           MGC76043, mRNA (cDNA clone MGC:76043 IMAGE:5385037),
           complete cds.
          Length = 398

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y +  Y+ ++ IG PP+P+ V  DTGS   W+    P +HC+
Sbjct: 73  YLDAQYYGEIGIGTPPQPFTVVFDTGSSNLWV----PSIHCS 110



>gb:AP004368_1840906 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1139B11.
          Length = 445

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 23/85 (27%), Positives = 34/85 (40%), Gaps = 4/85 (4%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND----LVICKDP 524
           Y A+  +G P +   V  D  +D  W+ C A C  C  A  P + P        V C  P
Sbjct: 102 YIARAGLGTPAQTLLVAIDPSNDAAWVPCSA-CAGCA-ASSPSFSPTQSSTYRTVPCGSP 159

Query: 525 LCASLHVGDYTCESPTQCDYDVEYA 599
            CA +          + C +++ YA
Sbjct: 160 QCAQVPSPSCPAGVGSSCGFNLTYA 184



>gb:AC120987_1740015 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0007A06, complete sequence.
          Length = 481

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 16/29 (55%), Positives = 18/29 (62%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQC 443
           Y A   IG+PP+P     DTGSDL W QC
Sbjct: 78  YIASYGIGDPPQPAEAVVDTGSDLVWTQC 106



>sp|P25796|CATE_CAVPO Cathepsin E precursor (EC
           3.4.23.34).>pir|A43356|A43356 cathepsin E (EC 3.4.23.34)
           precursor - guinea pig>gb:GPIPROCAT_2113008 Cavia
           porcellus procathepsin E mRNA, complete
           cds.>gb:S80547_2139676 procathepsin E [guinea pigs,
           gastric mucosa, mRNA, 1326 nt].
          Length = 391

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF  + IG+PP+ + V  DTGS   W+    P V+CT      HP++ P+
Sbjct: 74  YFGTISIGSPPQNFTVIFDTGSSNLWV----PSVYCTSPACQTHPVFHPS 119



>gb:AB179548_2466900 Takifugu rubripes CTSD1 mRNA for cathepsin D1,
           complete cds.
          Length = 396

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y +  Y+ ++ +G PP+P+ V  DTGS   W+    P VHC+
Sbjct: 71  YLDAQYYGEIGLGTPPQPFTVVFDTGSSNLWV----PSVHCS 108



>gb:MMU9840_2124221 Mus musculus cathepsin E gene, exon 1, partial.
          Length = 397

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF  + IG PP+ + V  DTGS   W+    P V+CT      HP++ P+
Sbjct: 79  YFGTISIGTPPQNFTVIFDTGSSNLWV----PSVYCTSPACKAHPVFHPS 124



>gb:MMCATHEPE_2114425 M.musculus gene encoding cathepsin E.
          Length = 397

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF  + IG PP+ + V  DTGS   W+    P V+CT      HP++ P+
Sbjct: 79  YFGTISIGTPPQNFTVIFDTGSSNLWV----PSVYCTSPACKAHPVFHPS 124



>gb:ATT19K4_1554809 Arabidopsis thaliana DNA chromosome 4, BAC clone
           T19K4 (ESSAII project).
          Length = 335

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 30/90 (33%), Positives = 40/90 (44%), Gaps = 14/90 (15%)
 Frame = +3

Query: 411 DTGSDLTWLQCD----APCVHCTKAP-------HPLYKPNNDLVICKDPLCASLH--VGD 551
           DTGSDL W+ CD    AP    T A        +P     N  V C + LCA  +  +G 
Sbjct: 5   DTGSDLFWVPCDCGKCAPTEGATYASEFELSIYNPKVSTTNKKVTCNNSLCAQRNQCLGT 64

Query: 552 YTCESPTQCDYDVEYADGGSSL-GVLVNDV 638
           +     + C Y V Y    +S  G+L+ DV
Sbjct: 65  F-----STCPYMVSYVSAQTSTSGILMEDV 89



>sp|P70269|CATE_MOUSE Cathepsin E precursor (EC
           3.4.23.34).>gb:BC005432_2089864 Mus musculus cathepsin
           E, mRNA (cDNA clone MGC:5924 IMAGE:3601519), complete
           cds.>gb:MMPROCNE_2117058 M.musculus mRNA for
           procathepsin E.
          Length = 397

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF  + IG PP+ + V  DTGS   W+    P V+CT      HP++ P+
Sbjct: 79  YFGTISIGTPPQNFTVIFDTGSSNLWV----PSVYCTSPACKAHPVFHPS 124



>sp|P55956|ASP3_CAEEL Aspartic protease 3 precursor (EC
           3.4.23.-).>pir|T33383|T33383 hypothetical protein
           H22K11.1 - Caenorhabditis elegans>gb:AF077544_1239281
           Caenorhabditis elegans fosmid H22K11, complete sequence.
          Length = 398

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 5/104 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y N  Y+  V IG PP+ + V  DTGS   W+    PC +C         P  D + C+ 
Sbjct: 64  YSNAQYYGPVTIGTPPQNFQVLFDTGSSNLWV----PCANC---------PFGD-IACR- 108

Query: 522 PLCASLHVGDYTCESPTQC-----DYDVEYADGGSSLGVLVNDV 638
                +H   + C+  + C      ++++Y   GS  G + NDV
Sbjct: 109 -----MH-NRFDCKKSSSCTATGASFEIQYGT-GSMKGTVDNDV 145



>gb:CHAJ7878_2568700 Chionodraco hamatus mRNA for cathepsin D.
          Length = 396

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y +  Y+ ++ +G PP+P+ V  DTGS   W+    P +HC+
Sbjct: 71  YLDAQYYGEIGLGTPPQPFTVVFDTGSSNLWV----PSIHCS 108



>gb:AB179549_2466901 Takifugu rubripes CTSD2 mRNA for cathepsin D2,
           complete cds.
          Length = 386

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 32/100 (32%), Positives = 43/100 (43%), Gaps = 4/100 (4%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           YF ++ IG PP+ + V  DTGS   W+    P V+C+    PLY            L   
Sbjct: 68  YFGKISIGTPPQEFTVLFDTGSSDLWV----PSVYCS----PLY------------LACG 107

Query: 537 L--HVGDYTCESPTQCD--YDVEYADGGSSLGVLVNDVFS 644
           L  H   Y   +  QCD  + +EY  G  S G +  D  S
Sbjct: 108 LHRHYRSYRSSTYVQCDRGFFIEYQSGRLS-GFVSKDTLS 146



>gb:AY054167_1562989 Arabidopsis thaliana AT4g16560/dl4305c mRNA,
           complete cds.>gb:AY074554_1567594 Arabidopsis thaliana
           AT4g16560/dl4305c mRNA, complete cds.
          Length = 499

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 6/68 (8%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQC-DAPCVHCTKAPHPLYKPNN-----DLVICK 518
           Y   + +G+      +  DTGSDL W  C    C+ C   P P   P++       V C 
Sbjct: 83  YLISLSVGSSSSAVSLYLDTGSDLVWFPCRPFTCILCESKPLPPSPPSSLSSSATTVSCS 142

Query: 519 DPLCASLH 542
            P C++ H
Sbjct: 143 SPSCSAAH 150



>gb:AB047247_1408438 Suncus murinus pgnC mRNA for pepsinogen C,
           complete cds.
          Length = 389

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C       H  + PN     
Sbjct: 68  YMDASYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQSQACTGHARFNPNQSSTY 123

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 124 STNGQTFSLQYG 135



>pir|F71432|F71432 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV44_1545458 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 44.>gb:ATFCA6_1551706
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 6.
          Length = 1046

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 6/68 (8%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQC-DAPCVHCTKAPHPLYKPNN-----DLVICK 518
           Y   + +G+      +  DTGSDL W  C    C+ C   P P   P++       V C 
Sbjct: 113 YLISLSVGSSSSAVSLYLDTGSDLVWFPCRPFTCILCESKPLPPSPPSSLSSSATTVSCS 172

Query: 519 DPLCASLH 542
            P C++ H
Sbjct: 173 SPSCSAAH 180



>gb:AB188676_2049773 Octodon degus PgC mRNA for pepsinogen C,
           partial cds.
          Length = 378

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ +G PP+ + V  DTGS   W+    P V+C       HP + P+     
Sbjct: 56  YMDASYFGEISLGTPPQSFQVLFDTGSSNLWV----PSVYCKSLACTTHPRFNPSKSSTY 111

Query: 513 CKDPLCASLHVG 548
                  SL  G
Sbjct: 112 TSADQTFSLQYG 123



>gb:AF082029_1766571 Hemerocallis hybrid cultivar
           senescence-associated protein 4 (SA4) mRNA, complete
           cds.
          Length = 517

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 20/69 (28%), Positives = 29/69 (42%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y N  YF ++ +G PP+ + V  DTGS   W+             H  YK        K+
Sbjct: 83  YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACLLHTKYKSGRSSTYHKN 142

Query: 522 PLCASLHVG 548
              A++H G
Sbjct: 143 GKPAAIHYG 151



>gb:BX842625_1643833 Neurospora crassa DNA linkage group I BAC clone
           B16D18.
          Length = 492

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 28/103 (27%), Positives = 40/103 (38%)
 Frame = +3

Query: 336 NVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVIC 515
           N    G YFA   +G P +   +  DTGS   W+                  P++   IC
Sbjct: 60  NEQARGGYFATCAMGTPGQKVTLQLDTGSSDVWV------------------PDSTASIC 101

Query: 516 KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS 644
               C    +G +      Q ++D+ Y DG SS G    DVF+
Sbjct: 102 NKGAC---DLGSW------QGEFDISYVDGSSSKGDYFTDVFN 135



>gb:BC088063_2565575 Xenopus tropicalis hypothetical LOC496913, mRNA
           (cDNA clone IMAGE:7024289), partial cds.
          Length = 380

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y +  Y+ ++ IG PP+ + V  DTGS   W+     C       HPL+ P+       +
Sbjct: 59  YMDMSYYGEISIGTPPQNFLVLFDTGSSNLWV-ASTNCQSQACTNHPLFNPSQSSTYSSN 117

Query: 522 PLCASLHVG 548
               SL  G
Sbjct: 118 QQQFSLQYG 126



>sp|P43232|CAR5_RHINI Rhizopuspepsin 5 precursor (EC 3.4.23.21)
           (Aspartate protease).>gb:RNASPV_1703876 R.niveus gene
           for aspartic proteinase V.
          Length = 392

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 26/93 (27%), Positives = 35/93 (37%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           YF QV +G P     +D DTGS   W    + C +C  +    Y PN      KD     
Sbjct: 85  YFGQVKVGTPGVTLKLDFDTGSSDLWF-ASSLCTNCGYS-QTKYNPNQSRTYAKDGRA-- 140

Query: 537 LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                          + + Y DG S+ G+L  D
Sbjct: 141 ---------------WSISYGDGSSASGILGTD 158



>gb:AJ586914_1811853 Physcomitrella patens mRNA for putative
           vacuolar aspartic proteinase (ORF1).
          Length = 504

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +3

Query: 336 NVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWL 437
           N Y +  YF ++ IG+PP+P+ V  DTGS   W+
Sbjct: 73  NNYLDAQYFGEIGIGSPPQPFAVIFDTGSSNLWV 106



>gb:RCHRHIZ_1703374 Rhizopus microsporus var. chinensis
           rhizopuspepsinogen precursor, mRNA, partial cds.
          Length = 393

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 25/93 (26%), Positives = 37/93 (39%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           Y+ QV IG P + + +D DTGS   W+     C +C  +    Y P              
Sbjct: 85  YYGQVTIGTPGKKFNLDFDTGSSDLWI-ASTLCTNC-GSRQTKYDPKQS----------- 131

Query: 537 LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                Y  +  T   + + Y DG S+ G+L  D
Sbjct: 132 ---STYQADGRT---WSISYGDGSSASGILAKD 158



>gb:RCHPEP_1703366 Rhizopus chinensis rhizopuspepsin isozyme pI 5
           mRNA, 3' end.
          Length = 352

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 25/93 (26%), Positives = 37/93 (39%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           Y+ QV IG P + + +D DTGS   W+     C +C  +    Y P              
Sbjct: 44  YYGQVTIGTPGKKFNLDFDTGSSDLWI-ASTLCTNC-GSRQTKYDPKQS----------- 90

Query: 537 LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                Y  +  T   + + Y DG S+ G+L  D
Sbjct: 91  ---STYQADGRT---WSISYGDGSSASGILAKD 117



>gb:AB188678_1411106 Monodelphis domestica PgC mRNA for pepsinogen
           C, complete cds.
          Length = 391

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC 464
           Y + FYF ++ IG PP+ + V  DTGS   W+    P  +C
Sbjct: 70  YLDSFYFGEISIGTPPQNFLVLFDTGSSNLWV----PSTYC 106



>pir|JC7573|JC7573 pepsinogen C - African clawed
           frog>gb:AB045379_2462126 Xenopus laevis mRNA for
           pepsinogen C, complete cds.
          Length = 383

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y +  Y+ ++ IG PP+ + V  DTGS   W+     C       HPL+ P+       +
Sbjct: 62  YMDMSYYGEISIGTPPQNFLVLFDTGSSNLWV-ASTYCQSQACTNHPLFNPSQSSTYSSN 120

Query: 522 PLCASLHVG 548
               SL  G
Sbjct: 121 QQQFSLQYG 129



>pir|S66466|S66466 cathepsin E (EC 3.4.23.34) precursor (clone pTN1)
           - rat>gb:RATCEA_2131767 Rattus norvegicus mRNA for
           cathepsin E, complete cds.
          Length = 365

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPN 497
           YF  V IG+P + + V  DTGS   W+    P V+CT +    HP++ P+
Sbjct: 80  YFGTVSIGSPSQNFTVIFDTGSSNLWV----PSVYCTSSACKAHPVFHPS 125



>pir|A26681|A26681 rhizopuspepsin (EC 3.4.23.21) II precursor -
           Rhizopus chinensis
          Length = 393

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 25/93 (26%), Positives = 37/93 (39%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           Y+ QV IG P + + +D DTGS   W+     C +C  +    Y P              
Sbjct: 85  YYGQVTIGTPGKKFNLDFDTGSSDLWI-ASTLCTNC-GSRQTKYDPKQS----------- 131

Query: 537 LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                Y  +  T   + + Y DG S+ G+L  D
Sbjct: 132 ---STYQADGRT---WSISYGDGSSASGILAKD 158



>sp|P06026|CARP_RHICH Rhizopuspepsin precursor (EC
           3.4.23.21).>gb:RCHRCAPAC_1703372 Rhizopus chinensis
           (clone H7IG7) rhizopuspepsin II (RCAPII) gene, complete
           cds.>gb:RCHRCAPAD_1703373 Rhizopus chinensis (clone
           M12F3) rhizopuspepsin II (RCAPII) gene, complete cds.
          Length = 393

 Score = 36.2 bits (82), Expect = 0.49
 Identities = 25/93 (26%), Positives = 37/93 (39%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCAS 536
           Y+ QV IG P + + +D DTGS   W+     C +C  +    Y P              
Sbjct: 85  YYGQVTIGTPGKKFNLDFDTGSSDLWI-ASTLCTNC-GSRQTKYDPKQS----------- 131

Query: 537 LHVGDYTCESPTQCDYDVEYADGGSSLGVLVND 635
                Y  +  T   + + Y DG S+ G+L  D
Sbjct: 132 ---STYQADGRT---WSISYGDGSSASGILAKD 158



>gb:AB103479_2465049 Xenopus laevis mRNA for cathepsin D, complete
           cds.
          Length = 409

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 16/42 (38%), Positives = 24/42 (57%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y +  Y+ ++ IG PP+P+ V  DTGS   W+      VHC+
Sbjct: 74  YLDAQYYGEISIGTPPQPFTVVFDTGSSNLWV----ASVHCS 111



>gb:HUMPEPC9_2035576 Human pepsinogen C gene, exon 9, clone
           cosHPGC44-1.
          Length = 385

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C       H  + P+     
Sbjct: 65  YMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQSQACTSHSRFNPSESSTY 120

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 121 STNGQTFSLQYG 132



>gb:AC108501_1738496 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1354_D07, complete sequence.
          Length = 477

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 26/94 (27%), Positives = 38/94 (40%), Gaps = 6/94 (6%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCV---HCTKAPHPLYKP-NNDLVICK 518
           G Y   V +G PP+  +   D  S   W+ C+  CV    C      +YK    +L  C 
Sbjct: 85  GTYLITVGVGTPPQYVYGAFDISSQFVWVPCE-ECVSPYSCPSDKTGVYKTLPRELYSCG 143

Query: 519 DPLCASLHVGDYTCESPTQ--CDYDVEYADGGSS 614
           +  C ++ VG   C +P    C Y   Y   G +
Sbjct: 144 EQRCRTI-VGQPDCGAPYNGPCKYTCRYGGAGGT 176



>gb:CR382130_1663016 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 391

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +3

Query: 324 PLYGNVYPNGFYF-AQVDIGNPPRPYFVDPDTGSDLTWL 437
           PL+G++   G Y+ A ++IG PP+   V  DTGS L W+
Sbjct: 44  PLHGSMSLEGVYYQADLEIGTPPQKVSVTFDTGSPLLWV 82



>gb:CR382130_1662358 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 457

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 354 FYFAQVDIGNPPRPYFVDPDTGSDLTWLQCD 446
           +Y A+V +G PP+ + +D DTGS   W++ D
Sbjct: 65  YYLAEVALGTPPQKFQIDIDTGSSDLWVKAD 95



>pir|S19683|PEMQCJ gastricsin (EC 3.4.23.3) precursor - Japanese
           macaque  (fragment)
          Length = 377

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C       H  + P+     
Sbjct: 57  YMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQSQACTSHSRFNPSESSTY 112

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 113 STNGQTFSLQYG 124



>sp|P03955|PEPC_MACFU Gastricsin precursor (EC 3.4.23.3) (Pepsinogen
           C) (Fragment).>gb:MFPEPC_2039060 M.fuscata mRNA for
           progastricsin (pepsinogen C).
          Length = 377

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C       H  + P+     
Sbjct: 57  YMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQSQACTSHSRFNPSESSTY 112

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 113 STNGQTFSLQYG 124



>sp|P20142|PEPC_HUMAN Gastricsin precursor (EC 3.4.23.3) (Pepsinogen
           C).>pir|A29937|A29937 gastricsin (EC 3.4.23.3) precursor
           - human>gb:AL365205_1926194 Human DNA sequence from
           clone RP11-298J23 on chromosome 6 Contains the 5' end of
           the TFEB gene for transcription factor EB, the PGC gene
           for progastricsin, the FRS3 gene for fibroblast growth
           factor receptor substrate 3, the C6orf49 gene for
           chromosome 6 open reading frame 49, the 3' end of the
           USP49 gene for ubiquitin specific protease 49, the 3'
           end of a novel gene and 5 CpG islands, complete
           sequence.>gb:AL365205_1926195 Human DNA sequence from
           clone RP11-298J23 on chromosome 6 Contains the 5' end of
           the TFEB gene for transcription factor EB, the PGC gene
           for progastricsin, the FRS3 gene for fibroblast growth
           factor receptor substrate 3, the C6orf49 gene for
           chromosome 6 open reading frame 49, the 3' end of the
           USP49 gene for ubiquitin specific protease 49, the 3'
           end of a novel gene and 5 CpG islands, complete
           sequence.>gb:BC073740_1989060 Homo sapiens progastricsin
           (pepsinogen C), mRNA (cDNA clone MGC:88742
           IMAGE:6296399), complete cds.>gb:HSU75272_2025963 Human
           gastricsin mRNA, complete cds.>gb:HUMPEPCA9_2035577
           Human pepsinogen gene, exon 9, clone
           PCG401.>gb:HUMPGCA_2035605 Homo sapiens pepsinogen C
           (PGC) mRNA, complete cds.
          Length = 388

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C       H  + P+     
Sbjct: 68  YMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQSQACTSHSRFNPSESSTY 123

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 124 STNGQTFSLQYG 135



>sp|Q64411|PEPC_CAVPO Gastricsin precursor (EC 3.4.23.3) (Pepsinogen
           C).>pir|B43356|B43356 gastricsin (EC 3.4.23.3) precursor
           - guinea pig>gb:GPIPROGAS_2113009 Cavia porcellus
           progastricsin mRNA, complete cds.
          Length = 394

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF Q+ +G PP+ + V  DTGS   W+    P V+C+      H  + P +    
Sbjct: 74  YMDAAYFGQISLGTPPQSFQVLFDTGSSNLWV----PSVYCSSLACTTHTRFNPRDSSTY 129

Query: 513 CKDPLCASLHVG 548
                  SL  G
Sbjct: 130 VATDQSFSLEYG 141



>sp|O04057|ASPR_CUCPE Aspartic proteinase precursor (EC
           3.4.23.-).>pir|T09739|T09739 aspartic endopeptidase (EC
           3.4.23.-) - pumpkin>gb:AB002695_1508931 Pumpkin mRNA for
           aspartic endopeptidase, complete cds.
          Length = 513

 Score = 35.8 bits (81), Expect = 0.64
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-HPLYKPNNDLVICK 518
           Y +  Y+ ++ IG PP+ + V  DTGS   W+ C+  C+       H  YK +      K
Sbjct: 85  YLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVLCE--CLFSVACHFHARYKSSRSSSYKK 142

Query: 519 DPLCASLHVG 548
           +   AS+  G
Sbjct: 143 NGTSASIRYG 152



>gb:BC072252_2556506 Xenopus laevis MGC82347 protein, mRNA (cDNA
           clone MGC:82347 IMAGE:4175443), complete cds.
          Length = 401

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 16/42 (38%), Positives = 24/42 (57%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y +  Y+ ++ IG PP+ + V  DTGS   W+    P VHC+
Sbjct: 76  YLDAQYYGEIGIGTPPQTFTVVFDTGSSNLWV----PSVHCS 113



>gb:AF115925_2474823 Hynobius leechii cathepsin D mRNA, complete
           cds.
          Length = 397

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-----HPLYKPNNDL 506
           Y +  Y+ ++ IG PP+ + V  DTGS   W+    P VHC+        HP Y  ++  
Sbjct: 71  YLDAQYYGEICIGTPPQCFTVVFDTGSSNLWV----PSVHCSLLDIACLVHPKYDSSSSS 126

Query: 507 VICKDPLCASLHVG 548
              K+    S+  G
Sbjct: 127 TYVKNGTEFSIQYG 140



>gb:BC062002_2104778 Rattus norvegicus cathepsin E, mRNA (cDNA clone
           MGC:72542 IMAGE:5599861), complete cds.
          Length = 398

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF  V IG+P + + V  DTGS   W+    P V+CT      HP++ P+
Sbjct: 80  YFGTVSIGSPSQNFTVIFDTGSSNLWV----PSVYCTSPACKAHPVFHPS 125



>gb:AB045891_1520468 Nepenthes alata NaAP1 mRNA for aspartic
           proteinase 1, complete cds.
          Length = 514

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-HPLYKPNNDLVICK 518
           Y N  YF ++ IG PP+ + +  DTGS   W+   A C        H  YK +      K
Sbjct: 85  YMNAQYFGEIGIGTPPQKFTLIFDTGSSNLWVP-SAKCYFSIACYFHSKYKSSLSSSYTK 143

Query: 519 DPLCASLHVG 548
           +   A +H G
Sbjct: 144 NGKSAEIHYG 153



>gb:AB047249_1408440 Rhinolophus ferrumequinum pgnC mRNA for
           pepsinogen C, complete cds.
          Length = 389

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC-TKA--PHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C T+A   H  + P+     
Sbjct: 68  YMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQTQACTGHTRFNPSQSSTY 123

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 124 STNGQTFSLQYG 135



>gb:CEU34889_1368509 Caenorhabditis elegans aspartic protease
           (Ceasp1) mRNA, complete cds.
          Length = 388

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWL---QCDAPC 455
           Y + FY   + +G PP+P  V  DTGS   W+    CD  C
Sbjct: 63  YFDDFYLGNITLGTPPQPATVVLDTGSSNLWVPGPSCDGSC 103



>pir|T29412|T29412 hypothetical protein F21F8.3 - Caenorhabditis
           elegans>gb:U97000_1406987 Caenorhabditis elegans cosmid
           F21F8, complete sequence.
          Length = 393

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWL---QCDAPC 455
           Y   + IG PP+P+ V  DTGS   W+    CD  C
Sbjct: 73  YLGNITIGTPPQPFLVVLDTGSSNLWVPGPSCDGSC 108



>sp|Q9N2D3|PEPC_CALJA Gastricsin precursor (EC 3.4.23.3) (Pepsinogen
           C).>pir|JC7246|JC7246 pepsinogen C - common
           marmoset>gb:AB038385_1866708 Callithrix jacchus mRNA for
           pepsinogen C, complete cds.
          Length = 388

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C       H  + P+     
Sbjct: 68  YMDAAYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQSQACTSHSRFNPSASSTY 123

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 124 SSNGQTFSLQYG 135



>sp|P16228|CATE_RAT Cathepsin E precursor (EC
           3.4.23.34).>pir|S66465|S66465 cathepsin E (EC 3.4.23.34)
           precursor (clone pTN05) - rat>gb:RATCEB_2131773 Rattus
           rattus mRNA for cathepsin E, complete cds.
          Length = 398

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF  V IG+P + + V  DTGS   W+    P V+CT      HP++ P+
Sbjct: 80  YFGTVSIGSPSQNFTVIFDTGSSNLWV----PSVYCTSPACKAHPVFHPS 125



>sp|Q05744|CATD_CHICK Cathepsin D precursor (EC
           3.4.23.5).>pir|I51185|I51185 cathepsin D (EC 3.4.23.5)
           precursor - chicken>gb:S49650_2579210 prepro-cathepsin D
           [chickens, follicles, mRNA, 1448 nt].
          Length = 398

 Score = 35.4 bits (80), Expect = 0.84
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC 464
           Y +  Y+ ++ IG PP+ + V  DTGS   W+    P VHC
Sbjct: 73  YMDAQYYGEIGIGTPPQKFTVVFDTGSSNLWV----PSVHC 109



>gb:AP003681_1831917 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1158C05.
          Length = 522

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +3

Query: 324 PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-HPLYKPNN 500
           PL    + N  YF ++ +G PP+ + V  DTGS   W+   A CV       H  Y+  +
Sbjct: 128 PLALKNFLNAQYFGEIGVGCPPQNFTVVFDTGSSNLWVP-SAKCVFSLACYFHRKYESRS 186

Query: 501 DLVICKDPLCASLHVG 548
                ++   AS+H G
Sbjct: 187 SSTYMENGTPASIHYG 202



>gb:AP003286_1827279 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0677H08.
          Length = 486

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 31/111 (27%), Positives = 46/111 (41%), Gaps = 13/111 (11%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC-------TKAPHPLYKPNNDLV 509
           G Y     +G PP+      D  SD  W+QC A C  C       T AP P Y   +  +
Sbjct: 95  GMYVLSFSVGTPPQVVTGVLDITSDFVWMQCSA-CATCGADAPAATSAP-PFYAFLSSTI 152

Query: 510 ICKDPLCAS---LHVGDYTCES-PTQCDYDVEYADG--GSSLGVLVNDVFS 644
             ++  CA+     +   TC +  + C Y   Y  G   ++ G+L  D F+
Sbjct: 153 --REVRCANRGCQRLVPQTCSADDSPCGYSYVYGGGAANTTAGLLAVDAFA 201



>gb:CR382132_1666068 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 396

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHC 464
           Y N  Y+ +++IG PP+ + V  DTGS   W+    P V C
Sbjct: 78  YLNAQYYTEIEIGTPPQKFNVILDTGSSNLWV----PSVQC 114



>gb:CAPRA_1645107 Candida albicans gene for aspartyl proteinase (EC
           3.4.23.6).
          Length = 380

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y N  YF +++IG P +P+ V  DTGS   W+    P   CT
Sbjct: 61  YLNAQYFTEIEIGTPGQPFKVILDTGSSNLWV----PSQDCT 98



>gb:AF192330_1415864 Bos taurus pregnancy-associated glycoprotein-13
           (PAG-13) mRNA, partial cds.
          Length = 370

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:AF020510_1411850 Bos taurus pregnancy-associated glycoprotein 8
           (PAG8) mRNA, complete cds.
          Length = 387

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTW---LQCDAPCVHCTKAPHPLYKP 494
           + N  YF  + IG PP+ + V+ DTGS   W   + C +P   C+K  H  + P
Sbjct: 66  FQNAVYFGTITIGTPPQEFQVNFDTGSSDLWVPSVDCQSP--SCSK--HKRFDP 115



>gb:AB099092_1410415 Bos taurus mRNA for similar to
           pregnancy-associated glycoprotein 13, partial cds,
           clone: ORCS13913.
          Length = 187

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:AB099072_1410395 Bos taurus mRNA for similar to aspartic
           proteinase, partial cds, clone: ORCS13561.
          Length = 146

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 45  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 96



>gb:AB099069_1410392 Bos taurus mRNA for similar to aspartic
           proteinase, partial cds, clone: ORCS13442.
          Length = 172

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:AB099002_1410325 Bos taurus mRNA for similar to aspartic
           proteinase, partial cds, clone: ORCS11828.
          Length = 168

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:AB098984_1410307 Bos taurus mRNA for similar to aspartic
           proteinase, partial cds, clone: ORCS11626.
          Length = 138

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:AB098961_1410284 Bos taurus mRNA for similar to
           pregnancy-associated glycoprotein 8, partial cds, clone:
           ORCS11102.
          Length = 167

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 3/54 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTW---LQCDAPCVHCTKAPHPLYKP 494
           + N  YF  + IG PP+ + V+ DTGS   W   + C +P   C+K  H  + P
Sbjct: 65  FQNAVYFGTITIGTPPQEFQVNFDTGSSDLWVPSVDCQSP--SCSK--HKRFDP 114



>gb:AB098894_1410217 Bos taurus mRNA for similar to aspartic
           proteinase, partial cds, clone: ORCS10075.
          Length = 135

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:AB098892_1410215 Bos taurus mRNA for similar to aspartic
           proteinase, partial cds, clone: ORCS10067.
          Length = 168

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:AB047248_1408439 Sorex unguiculatus pgnC mRNA for pepsinogen C,
           complete cds.
          Length = 389

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 3/72 (4%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPNNDLVI 512
           Y +  YF ++ IG PP+ + V  DTGS   W+    P V+C       H  + P+     
Sbjct: 68  YLDAAYFGEISIGTPPQNFLVLFDTGSSNLWV----PSVYCQSQACTGHARFNPSKSSTY 123

Query: 513 CKDPLCASLHVG 548
             +    SL  G
Sbjct: 124 STNGQTFSLQYG 135



>gb:AC116918_1206373 Dictyostelium discoideum chromosome 2 map
           6143698-6163521 strain AX4, complete sequence.
          Length = 492

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 8/102 (7%)
 Frame = +3

Query: 354 FYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP----NNDLVICKD 521
           FY   V++    + + +  DTGS LT +     C  C K   P+Y P    ++ L+ C  
Sbjct: 95  FYQINVNVLIGQQKFILQVDTGSTLTAIPLKG-CNSC-KDNRPVYDPALSSSSQLIPCSS 152

Query: 522 PLCASLHVGDYTCE----SPTQCDYDVEYADGGSSLGVLVND 635
             C        +C+    + + CD+ + Y DG    G + +D
Sbjct: 153 DKCLGSGSASPSCKLHQNAKSTCDFIILYGDGSKIKGKVFSD 194



>pir|T29692|T29692 hypothetical protein T18H9.2 - Caenorhabditis
           elegans
          Length = 709

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWL---QCDAPCVHCTKA-PHPLY 488
           Y +  Y  ++ +G+PP+ + V  DTGS   W+    CD     C K  P P Y
Sbjct: 35  YEHAGYVGKITVGSPPQEFRVIMDTGSSNFWIPDSTCDTKATSCHKVLPAPNY 87



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 24/91 (26%), Positives = 35/91 (38%)
 Frame = +3

Query: 330 YGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLV 509
           Y N Y +  Y   + IG P + + V  DTGS   W+    P + C        KP N   
Sbjct: 345 YVNDYEDEAYVGNITIGTPQQQFKVILDTGSSNLWI----PDITCGT------KPENCST 394

Query: 510 ICKDPLCASLHVGDYTCESPTQCDYDVEYAD 602
           +   P C  + +  + C+    C     Y D
Sbjct: 395 V---PACRGI-ICQFECDDQACCGAGANYTD 421



>pir|S03433|S03433 candidapepsin (EC 3.4.23.24) precursor - yeast
           (Candida albicans)
          Length = 380

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCT 467
           Y N  YF +++IG P +P+ V  DTGS   W+    P   CT
Sbjct: 61  YLNAQYFTEIEIGTPGQPFKVILDTGSSNLWV----PSQDCT 98



>sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 precursor
           (EC 3.4.23.-) (PAG 2).>pir|I45856|I45856 aspartic
           proteinase - bovine>gb:BOVASPPRTA_1435180 Bovine
           aspartic proteinase mRNA, complete cds.
          Length = 376

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y +  Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 63  YLDTAYVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 114



>gb:BT007637_2150569 Synthetic construct Homo sapiens cathepsin D
           (lysosomal aspartyl protease) mRNA, partial cds.
          Length = 413

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 5/74 (6%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-----HPLYKPNNDL 506
           Y +  Y+ ++ IG PP+ + V  DTGS   W+    P +HC         H  Y  +   
Sbjct: 74  YMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWV----PSIHCKLLDIACWIHHKYNSDKSS 129

Query: 507 VICKDPLCASLHVG 548
              K+     +H G
Sbjct: 130 TYVKNGTSFDIHYG 143



>gb:BX571818_1991856 Human DNA sequence from clone RP11-38J22 on
           chromosome 1 Contains a novel gene, a ribosomal protein
           L22 (RPL22) pseudogene, a novel gene, the AVPR1B gene
           for arginine vasopressin receptor 1B, two novel genes,
           the CTSE gene for cathepsin E and two CpG islands,
           complete sequence.>gb:HSA250716_2001585 Homo sapiens
           mRNA for cathepsin E (CatE gene), alternative splicing,
           isolated from adenocarcinoma cell lines.
          Length = 363

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTK---APHPLYKPN 497
           YF  + IG+PP+ + V  DTGS   W+    P V+CT      H  ++P+
Sbjct: 78  YFGTISIGSPPQNFTVIFDTGSSNLWV----PSVYCTSPACKTHSRFQPS 123



>gb:AP003286_1827280 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0677H08.
          Length = 488

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 28/100 (28%), Positives = 38/100 (38%), Gaps = 2/100 (2%)
 Frame = +3

Query: 351 GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLC 530
           G Y     IG PP+      D  SDL W  C A     T   +P+       V C D  C
Sbjct: 98  GMYVFSYGIGTPPQQVSGALDISSDLVWTACGA-----TAPFNPVRSTTVADVPCTDDAC 152

Query: 531 ASLHVGDYTC-ESPTQCDYDVEYADG-GSSLGVLVNDVFS 644
                   TC    ++C Y   Y  G  ++ G+L  + F+
Sbjct: 153 QQF--APQTCGAGASECAYTYMYGGGAANTTGLLGTEAFT 190



>gb:AF162132_1773469 Coccidioides immitis aspartyl proteinase (PEP)
           mRNA, complete cds.
          Length = 399

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTWL 437
           N  YF+++ IGNPP+ + V  DTGS   W+
Sbjct: 82  NAQYFSEISIGNPPQNFKVVLDTGSSNLWV 111



>gb:BOASPPR_1633735 B.oleracea mRNA for aspartic protease.
          Length = 255

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 19/69 (27%), Positives = 30/69 (43%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKD 521
           Y +  Y+ ++ IG PP+ + V  DTGS   W+             H  YK +      K+
Sbjct: 77  YLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSKYKSSRSSTYEKN 136

Query: 522 PLCASLHVG 548
              A++H G
Sbjct: 137 GKSAAIHYG 145



>gb:AB045893_1520470 Nepenthes alata NaAP3 mRNA for aspartic
           proteinase 3, complete cds.
          Length = 507

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 5/74 (6%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWL---QC--DAPCVHCTKAPHPLYKPNNDL 506
           Y +  YF ++ IG PP+ + V  DTGS   W+   +C    PC       H  YK +   
Sbjct: 77  YMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCYF-----HAKYKSSISS 131

Query: 507 VICKDPLCASLHVG 548
              K+   A +H G
Sbjct: 132 SYKKNGKSADIHYG 145



>gb:AY792822_1433902 Sus scrofa cathepsin D protein mRNA, partial
           cds.
          Length = 395

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 5/74 (6%)
 Frame = +3

Query: 342 YPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAP-----HPLYKPNNDL 506
           Y +  Y+ ++ IG PP+ + V  DTGS   W+    P +HC         H  Y      
Sbjct: 59  YMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWV----PSIHCKLLDIACWIHHKYNSGKSS 114

Query: 507 VICKDPLCASLHVG 548
              K+    ++H G
Sbjct: 115 TYVKNGTTFAIHYG 128



>gb:AY509872_1430694 Odocoileus virginianus pregnancy-associated
           glycoprotein 7 (PAG7) mRNA, complete cds.
          Length = 381

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%)
 Frame = +3

Query: 348 NGFYFAQVDIGNPPRPYFVDPDTGSDLTW---LQCDAPCVHCTKAPHPLYKP 494
           N  YF ++ IG PP+ + V+ DTGS   W   + C +P   C+K  H  + P
Sbjct: 62  NMVYFGKISIGTPPQEFQVNFDTGSSDLWVPSVNCQSP--SCSK--HKRFNP 109



>gb:AB099067_1410390 Bos taurus mRNA for similar to aspartic
           proteinase, partial cds, clone: ORCS13348.
          Length = 133

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = +3

Query: 357 YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKA---PHPLYKPNN 500
           Y   + IG PP+ + V  DTGS   W+    PC+ CT      H  + P N
Sbjct: 2   YVGNITIGTPPQEFRVVFDTGSANLWV----PCITCTSPACYTHKTFNPQN 48


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 664,632,644
Number of Sequences: 1806583
Number of extensions: 13321739
Number of successful extensions: 35360
Number of sequences better than 10.0: 396
Number of HSP's better than 10.0 without gapping: 32399
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34635
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 34858786810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)