BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig7016
         (658 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY585865_1616326 Digitalis grandiflora progesterone 5-beta-re...   301   6e-81   
gb:AY750898_1626670 Digitalis subalpina progesterone 5 beta redu...   300   1e-80   
gb:AY738711_1626106 Digitalis ferruginea progesterone 5-beta-red...   300   1e-80   
gb:DOB555127_1675991 Digitalis obscura p5Br gene for putative pr...   299   3e-80   
gb:AY574950_1615880 Digitalis lanata progesterone 5-beta-reducta...   298   5e-80   
gb:DPU310673_1676036 Digitalis purpurea mRNA for progesterone 5-...   298   7e-80   
gb:AY585868_1616329 Digitalis purpurea putative progesterone 5-b...   298   7e-80   
gb:AY585866_1616327 Digitalis parviflora progesterone 5-beta-red...   297   1e-79   
gb:AY738712_1626107 Digitalis thapsi progesterone 5-beta-reducta...   293   2e-78   
gb:AY738710_1626105 Digitalis mariana subsp. heywoodii progester...   293   2e-78   
pir|T09885|T09885 hypothetical protein T22A6.50 - Arabidopsis th...   289   3e-77   Arabidopsis thaliana [mouse-ear cress]
gb:ATORFW_1553803 A.thaliana gene induced upon wounding stress.       285   6e-76   
gb:AY229876_1591320 Populus tremuloides unknown mRNA.                 279   3e-74   
gb:AC147802_1744749 Oryza sativa chromosome 3 BAC OSJNBb0013C14 ...   226   2e-58   
gb:AP004230_1839003 Oryza sativa (japonica cultivar-group) genom...   197   1e-49   
gb:AE011844_277011 Xanthomonas axonopodis pv. citri str. 306, se...   128   1e-28   
gb:AE012319_281365 Xanthomonas campestris pv. campestris str. AT...   124   1e-27   
gb:AC135598_1742733 Oryza sativa chromosome 3 BAC OSJNBb0021K20 ...   118   1e-25   
gb:AC114983_1739206 Oryza sativa (japonica cultivar-group) chrom...   118   1e-25   
gb:AE008692_239839 Zymomonas mobilis subsp. mobilis ZM4, complet...   113   2e-24   
gb:AB020755_1514720 Arabidopsis thaliana genomic DNA, chromosome...   110   2e-23   
gb:AE016865_352109 Pseudomonas syringae pv. tomato str. DC3000 s...   104   2e-21   
gb:CP000009_862927 Gluconobacter oxydans 621H, complete genome.       103   3e-21   
gb:BX640413_805317 Bordetella pertussis strain Tohama I, complet...    75   1e-12   
gb:BX640441_814221 Bordetella bronchiseptica strain RB50, comple...    72   6e-12   
gb:BX640429_810425 Bordetella parapertussis strain 12822, comple...    72   6e-12   
gb:AE013598_296004 Xanthomonas oryzae pv. oryzae KACC10331, comp...    62   1e-08   
gb:AY553235_1613421 Leptosphaeria maculans HDX1 (HDX1), PKS1 (PK...    61   1e-08   
pir|T41593|T41593 hypothetical protein SPCC757.02c - fission yea...    46   5e-04   Schizosaccharomyces pombe
gb:AE013598_296003 Xanthomonas oryzae pv. oryzae KACC10331, comp...    45   8e-04   
gb:AF228583_490395 Burkholderia pseudomallei capsular polysaccha...    44   0.003   
gb:AY553235_1613424 Leptosphaeria maculans HDX1 (HDX1), PKS1 (PK...    43   0.005   
gb:AP006840_568561 Symbiobacterium thermophilum DNA, complete ge...    42   0.007   
gb:AY553235_1613431 Leptosphaeria maculans HDX1 (HDX1), PKS1 (PK...    41   0.021   
gb:AP006618_558477 Nocardia farcinica IFM 10152 DNA, complete ge...    39   0.078   
gb:AK118211_1816202 Arabidopsis thaliana At3g18520 mRNA for puta...    35   0.86    
gb:AF482758_2264415 Cowpox virus strain Brighton Red, complete g...    35   1.5     
gb:AY089519_1297175 Drosophila melanogaster GM12762 full insert ...    34   1.9     
gb:AF461121_513427 Escherichia coli serotype O55:H7 O-antigen ge...    34   1.9     
sp|Q9VMW9|GMDS_DROME|GMDS_DROME Probable GDP-mannose 4,6 dehydratase (EC 4....    34   1.9     Drosophila melanogaster
gb:BC047185_2549849 Danio rerio zgc:55754, mRNA (cDNA clone MGC:...    33   3.3     
gb:AY577000_2538244 Danio rerio clone RZ150A1H09 C19orf13-like p...    33   3.3     
gb:AY603973_2366559 Monkeypox virus strain MPXV-WRAIR7-61, compl...    33   3.3     
gb:AF380138_2244946 Monkeypox virus strain Zaire-96-I-16, comple...    33   3.3     
gb:AY523972S2_625194 Azospirillum brasilense plasmid 90 MDa, par...    33   3.3     
pir|D64525|D64525 GDP-D-mannose dehydratase - Helicobacter pylor...    33   3.3     Helicobacter pylori
gb:CV41KBPL_2398163 Cowpox virus strain GRI-90, complete genome.       33   4.3     
gb:AY484669_2350045 Rabbitpox virus, complete genome.                  33   4.3     
gb:AY009089_2286256 Camelpox virus CMS, complete genome.               33   4.3     
gb:AF438165_2255566 Camelpox virus M-96 from Kazakhstan, complet...    33   4.3     
gb:AF095689_2194358 Vaccinia virus (strain Tian Tan) complete ge...    33   4.3     
gb:AF012825_2177999 Ectromelia virus strain Moscow, complete gen...    33   4.3     
gb:AF006633_467727 Streptomyces peucetius daunosamine biosynthes...    33   4.3     
pir|T37430|T37430 hydroyxsteroid dehydrogenase - vaccinia virus ...    33   4.3     Vaccinia virus Ankara
sp|P26670|3BHS_VACCV|3BHS_VACCV 3 beta-hydroxysteroid dehydrogenase/delta 5...    33   4.3     Vaccinia virus
sp|P21097|3BHS_VACCC|3BHS_VACCC 3 beta-hydroxysteroid dehydrogenase/delta 5...    33   4.3     Vaccinia virus
gb:AY086135_1571191 Arabidopsis thaliana clone 21721 mRNA, compl...    33   5.6     
gb:AB026658_1517374 Arabidopsis thaliana genomic DNA, chromosome...    33   5.6     
gb:BA000040_730455 Bradyrhizobium japonicum USDA 110 DNA, comple...    33   5.6     
gb:AE017232_412178 Mycobacterium avium subsp. paratuberculosis s...    33   5.6     
gb:AE014295_311930 Bifidobacterium longum NCC2705, complete genome.    33   5.6     
gb:AE012516_283174 Xanthomonas campestris pv. campestris str. AT...    33   5.6     
gb:AL954681_2504934 Zebrafish DNA sequence from clone BUSM1-84G1...    32   7.3     
gb:AL954681_2504933 Zebrafish DNA sequence from clone BUSM1-84G1...    32   7.3     
gb:AE014292_309993 Brucella suis 1330 chromosome II, complete se...    32   7.3     
gb:AE009769_255443 Pyrobaculum aerophilum strain IM2 section 24 ...    32   7.3     
pir|AG3615|AG3615 GDPmannose 4,6-dehydratase (EC 4.2.1.47) [impo...    32   7.3     Brucella melitensis
gb:BC042270_2548090 Xenopus laevis GDP-mannose 4, 6-dehydratase,...    32   9.5     
gb:BT019885_2151584 Synthetic construct Homo sapiens GDP-mannose...    32   9.5     
gb:MMU21392_2118920 Mus musculus putative serine/threonine kinas...    32   9.5     
gb:BC063051_2105125 Mus musculus polo-like kinase 3 (Drosophila)...    32   9.5     
gb:BC031180_2097000 Mus musculus polo-like kinase 3 (Drosophila)...    32   9.5     
gb:AF062655_2052921 Mus musculus plenty-of-prolines-101 mRNA, co...    32   9.5     
gb:CR541947_1994174 Homo sapiens full open reading frame cDNA cl...    32   9.5     
gb:AC149291_1744955 Solanum demissum chromosome 5 clone PGEC568H...    32   9.5     
pir|D69255|D69255 GDP-D-mannose dehydratase (gmd-1), authentic f...    32   9.5     Archaeoglobus fulgidus
pir|D71981|D71981 gdp-d-mannose dehydratase - Helicobacter pylor...    32   9.5     Helicobacter pylori J99
sp|Q60806|PLK3_MOUSE|PLK3_MOUSE Serine/threonine-protein kinase PLK3 (EC 2....    32   9.5     Mus musculus [mouse]
sp|O60547|GMDS_HUMAN|GMDS_HUMAN GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (...    32   9.5     Homo sapiens [man]


>gb:AY585865_1616326 Digitalis grandiflora progesterone
           5-beta-reductase gene, complete cds.
          Length = 389

 Score =  301 bits (771), Expect = 6e-81
 Identities = 144/193 (74%), Positives = 164/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLEEDD---APTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>gb:AY750898_1626670 Digitalis subalpina progesterone 5 beta
           reductase gene, complete cds.
          Length = 389

 Score =  300 bits (769), Expect = 1e-80
 Identities = 143/193 (74%), Positives = 164/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLEEDD---APSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>gb:AY738711_1626106 Digitalis ferruginea progesterone
           5-beta-reductase gene, complete cds.
          Length = 389

 Score =  300 bits (768), Expect = 1e-80
 Identities = 144/193 (74%), Positives = 163/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAARK+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAARKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+  EV
Sbjct: 178 FYYDLEDIMLGEV 190



>gb:DOB555127_1675991 Digitalis obscura p5Br gene for putative
           progesterone 5-beta-reductase, exons 1-2.
          Length = 389

 Score =  299 bits (765), Expect = 3e-80
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+  EV
Sbjct: 178 FYYDLEDIMLKEV 190



>gb:AY574950_1615880 Digitalis lanata progesterone 5-beta-reductase
           mRNA, complete cds.>gb:AY585867_1616328 Digitalis lanata
           progesterone 5-beta-reductase gene, complete cds.
          Length = 389

 Score =  298 bits (763), Expect = 5e-80
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+KR EEDD   A  KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKRLEEDD---AQPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>gb:DPU310673_1676036 Digitalis purpurea mRNA for progesterone
           5-beta-reductase (p5Br gene).
          Length = 389

 Score =  298 bits (762), Expect = 7e-80
 Identities = 143/193 (74%), Positives = 164/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTWANRSTEPENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>gb:AY585868_1616329 Digitalis purpurea putative progesterone
           5-beta-reductase gene, complete cds.
          Length = 389

 Score =  298 bits (762), Expect = 7e-80
 Identities = 143/193 (74%), Positives = 164/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTWANRSTEPENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>gb:AY585866_1616327 Digitalis parviflora progesterone
           5-beta-reductase gene, complete cds.
          Length = 389

 Score =  297 bits (760), Expect = 1e-79
 Identities = 140/193 (72%), Positives = 164/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIG+A+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGSAKKKLEEDD---APSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RP+W+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPSWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN +M RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct: 118 ANSQMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYSEDLPRLKYMN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>gb:AY738712_1626107 Digitalis thapsi progesterone 5-beta-reductase
           gene, complete cds.
          Length = 389

 Score =  293 bits (750), Expect = 2e-78
 Identities = 141/193 (73%), Positives = 162/193 (83%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+  +P+ YIQCDISD +D+ +KLS L DVTHVFYVTWANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEGNPINYIQCDISDPDDSLAKLSPLADVTHVFYVTWANRSTEPENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>gb:AY738710_1626105 Digitalis mariana subsp. heywoodii progesterone
           5-beta-reductase gene, complete cds.
          Length = 389

 Score =  293 bits (749), Expect = 2e-78
 Identities = 142/193 (73%), Positives = 163/193 (84%), Gaps = 1/193 (0%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVT ANR TE ENCE
Sbjct: 58  VYGVARRTRPAWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANRSTEPENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN 618
           AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct: 118 ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN 177

Query: 619 FYYTLEDILFDEV 657
           FYY LEDI+ +EV
Sbjct: 178 FYYDLEDIMLEEV 190



>pir|T09885|T09885 hypothetical protein T22A6.50 - Arabidopsis
           thaliana>gb:ATCHRIV61_1546305 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 61.>gb:ATT22A6_1555171
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22A6
           (ESSA project).>gb:AY062451_1565107 Arabidopsis thaliana
           putative protein (At4g24220; T22A6.50) mRNA, complete
           cds.>gb:AY087323_1572355 Arabidopsis thaliana clone
           34176 mRNA, complete sequence.>gb:BT008479_1639696
           Arabidopsis thaliana At4g24220 gene, complete cds.
          Length = 388

 Score =  289 bits (739), Expect = 3e-77
 Identities = 134/192 (69%), Positives = 156/192 (81%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAA+K+ +ED+   +    +SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct: 1   MSWWWAGAIGAAKKKLDEDEPSQS---FESVALIIGVTGIVGNSLAEILPLSDTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARRPRP WN+DHP++YIQCD+SD ED  SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct: 58  VYGVARRPRPTWNADHPIDYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF 621
           ANG MLRNVL A+IP +P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct: 118 ANGSMLRNVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQIQNF 177

Query: 622 YYTLEDILFDEV 657
           YYT EDILF+E+
Sbjct: 178 YYTQEDILFEEI 189



>gb:ATORFW_1553803 A.thaliana gene induced upon wounding stress.
          Length = 386

 Score =  285 bits (728), Expect = 6e-76
 Identities = 132/192 (68%), Positives = 154/192 (80%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           M WW AGAIGAA+K+ +ED+   +    +SVALI+GVT IVGNSLAEILPL+DTPGGPWK
Sbjct: 1   MRWWWAGAIGAAKKKLDEDEPSQS---FESVALIIGVTAIVGNSLAEILPLSDTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARRPRP WN+DHP++YIQCD+SD ED  SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct: 58  VYGVARRPRPTWNADHPIDYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF 621
           ANG MLRNVL A+IP +P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct: 118 ANGSMLRNVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQIQNF 177

Query: 622 YYTLEDILFDEV 657
           YYT EDILF+E+
Sbjct: 178 YYTQEDILFEEI 189



>gb:AY229876_1591320 Populus tremuloides unknown mRNA.
          Length = 391

 Score =  279 bits (714), Expect = 3e-74
 Identities = 135/194 (69%), Positives = 159/194 (81%), Gaps = 2/194 (1%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW +GAIGAA+K+ E+D+   A   + SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct: 1   MSWWWSGAIGAAKKKTEDDE---ASRGYPSVALILGVTGIVGNSLAEILPLSDTPGGPWK 57

Query: 262 VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE 441
           VYGVARRPRP WN DHP+EYIQCDIS+  +  SKLS LTDVTHVFYVTWA++ TE ENCE
Sbjct: 58  VYGVARRPRPNWNEDHPVEYIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCE 117

Query: 442 ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRL-ESP 615
            NG M RNVL AVIPN+ +L+H+CLQTG K Y G F + GK+ AHD P  EDLPRL + P
Sbjct: 118 INGLMFRNVLQAVIPNAANLRHVCLQTGGKQYVGPFALLGKIEAHDPPFTEDLPRLNDFP 177

Query: 616 NFYYTLEDILFDEV 657
           NFYYTLED++++EV
Sbjct: 178 NFYYTLEDVMYEEV 191



>gb:AC147802_1744749 Oryza sativa chromosome 3 BAC OSJNBb0013C14
           genomic sequence, complete sequence.>gb:AC147803_1744752
           Oryza sativa chromosome 3 BAC OSJNBb0034P05 genomic
           sequence, complete sequence.
          Length = 396

 Score =  226 bits (577), Expect = 2e-58
 Identities = 111/195 (56%), Positives = 138/195 (70%), Gaps = 3/195 (1%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGA +KR EE+     P   QSVAL+VG TGIVG SL +ILPL DTPGGPWK
Sbjct: 1   MSWWWAGAIGAVKKRQEENAAATEP-SFQSVALVVGSTGIVGTSLLDILPLQDTPGGPWK 59

Query: 262 VYGVARRPRPAWN--SDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELEN 435
           VY V+RRP P W+  +   + ++  D++D       L+ LTD+THVFYV W+  PTE +N
Sbjct: 60  VYAVSRRPLPPWSPPASPAVTHLHLDLADSAAVAEVLTPLTDITHVFYVAWSAHPTEAQN 119

Query: 436 CEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLES 612
            E N  MLRN+L+ V+PN P L H+CLQTG+KHY G F+V GK+ A D P  ED+ RL+ 
Sbjct: 120 REVNSAMLRNILSVVVPNCPALVHVCLQTGRKHYIGPFEVIGKIAAPDPPFTEDMLRLDC 179

Query: 613 PNFYYTLEDILFDEV 657
           PNFYY LED+LF+EV
Sbjct: 180 PNFYYDLEDVLFNEV 194



>gb:AP004230_1839003 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ2013_G04.
          Length = 410

 Score =  197 bits (501), Expect = 1e-49
 Identities = 104/195 (53%), Positives = 127/195 (65%), Gaps = 3/195 (1%)
 Frame = +1

Query: 82  MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK 261
           MSWW AGAIGAARKR +       P   +SVAL+VG TGIVG SL +ILPL DTPGGPWK
Sbjct: 6   MSWWWAGAIGAARKRHDGGGGEQQP-PFRSVALVVGSTGIVGTSLVDILPLPDTPGGPWK 64

Query: 262 VYGVARRPRPAWNSDHP--MEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWAN-RPTELE 432
           VY ++RRP P W+   P  + ++  D++D       L+ LTD+THVFYV  A     E  
Sbjct: 65  VYALSRRPPPPWSPPPPAAVTHLCVDLADAAAVAEALAPLTDITHVFYVALAAPHLAEAR 124

Query: 433 NCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLES 612
           + EAN  MLRNVL AV+P  P L H+ LQTG KHY G  +  GK+  +TP  ED+PR + 
Sbjct: 125 SREANAGMLRNVLAAVVPTCPALAHVALQTGSKHYIGPPESIGKLPVETPFSEDMPRHDY 184

Query: 613 PNFYYTLEDILFDEV 657
           PNFYY  ED+LFD V
Sbjct: 185 PNFYYDQEDVLFDAV 199



>gb:AE011844_277011 Xanthomonas axonopodis pv. citri str. 306,
           section 222 of 469 of the complete
           genome.>gb:AE008923_918786 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 393

 Score =  128 bits (321), Expect = 1e-28
 Identities = 74/161 (45%), Positives = 99/161 (61%)
 Frame = +1

Query: 166 QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDE 345
           + +ALIVGVTGI G +LA +L LAD     W VYG+ARRP P       +  +  D+ D 
Sbjct: 42  KGIALIVGVTGISGYNLANVL-LADG----WTVYGLARRPLP----HDGVIPVAADLLDA 92

Query: 346 EDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
           E  ++ L  L  +THVF+ TW  R TE EN +ANG M+R++ +A+  +   L+H+ L TG
Sbjct: 93  ESTNNALRGLP-ITHVFFCTWTRRDTERENVQANGAMMRHLCDAL--SDAPLQHMALVTG 149

Query: 526 KKHYFGAFQVFGKVAHDTPHHEDLPRLESPNFYYTLEDILF 648
            KHY GAF+ +G    +TP  E  PR    NFYYTLED+LF
Sbjct: 150 TKHYLGAFENYGSGKAETPFRESEPRQPGENFYYTLEDLLF 190



>gb:AE012319_281365 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 227 of 460 of the complete
           genome.>gb:AE008922_914647 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 354

 Score =  124 bits (312), Expect = 1e-27
 Identities = 74/161 (45%), Positives = 96/161 (59%)
 Frame = +1

Query: 166 QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDE 345
           +  ALIVGVTGI G +LA +L LAD     W VYG+ARRP     S   +  +  D+ D 
Sbjct: 3   KGAALIVGVTGISGYNLANVL-LADG----WTVYGLARRPL----SHEGVIPVAADLLDA 53

Query: 346 EDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
           E   + L  L  +THVF+ TW  R TE EN EANG M+R++ + +  +   L+H+ L TG
Sbjct: 54  EATKTALQGLP-ITHVFFCTWTRRDTERENVEANGAMMRHLCDGL--SEAPLQHMALVTG 110

Query: 526 KKHYFGAFQVFGKVAHDTPHHEDLPRLESPNFYYTLEDILF 648
            KHY GAF+ +G    +TP  E  PR    NFYYTLED+LF
Sbjct: 111 TKHYLGAFENYGSGKAETPFRESEPRQPGENFYYTLEDLLF 151



>gb:AC135598_1742733 Oryza sativa chromosome 3 BAC OSJNBb0021K20
           genomic sequence, complete sequence.
          Length = 313

 Score =  118 bits (295), Expect = 1e-25
 Identities = 61/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (1%)
 Frame = +1

Query: 310 PMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELE-NCEANGKMLRNVLNAVIP 486
           P+ +I  D++D     + L+ LTD+THVFYV WA    E + N EAN +MLRNVL+AV+P
Sbjct: 11  PVTHICVDLADPAAVSAALAPLTDITHVFYVAWAPHFFEEDQNREANSRMLRNVLSAVVP 70

Query: 487 NSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLES-PNFYYTLEDILFDEV 657
           N P L H+ LQTG KHY G  +  GK   +TP  ED+PRL++ PN YY  ED LFD V
Sbjct: 71  NCPALVHVSLQTGSKHYIGPPESIGKFTIETPFSEDMPRLDNCPNLYYDQEDALFDAV 128



>gb:AC114983_1739206 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0032H19 map E30331S, complete
           sequence.
          Length = 308

 Score =  118 bits (295), Expect = 1e-25
 Identities = 61/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (1%)
 Frame = +1

Query: 310 PMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELE-NCEANGKMLRNVLNAVIP 486
           P+ +I  D++D     + L+ LTD+THVFYV WA    E + N EAN +MLRNVL+AV+P
Sbjct: 11  PVTHICVDLADPAAVSAALAPLTDITHVFYVAWAPHFFEEDQNREANSRMLRNVLSAVVP 70

Query: 487 NSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLES-PNFYYTLEDILFDEV 657
           N P L H+ LQTG KHY G  +  GK   +TP  ED+PRL++ PN YY  ED LFD V
Sbjct: 71  NCPALVHVSLQTGSKHYIGPPESIGKFTIETPFSEDMPRLDNCPNLYYDQEDALFDAV 128



>gb:AE008692_239839 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 354

 Score =  113 bits (283), Expect = 2e-24
 Identities = 66/159 (41%), Positives = 91/159 (57%), Gaps = 1/159 (0%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           AL+VG TGIVG +L+  L         W VYG+AR P    +   P   +  DI D E  
Sbjct: 5   ALVVGSTGIVGQNLSNRLVAEG-----WTVYGLARHPFDIVSGVLP---VAADIFDREAL 56

Query: 355 HSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKH 534
              L+ ++ V+HVF+  W+ RPTE ENC  N +M+ ++  A +P+   +KH  L TG KH
Sbjct: 57  QQALADIS-VSHVFFCAWSRRPTEKENCIVNSEMITHIFQA-LPHPEKIKHSALITGMKH 114

Query: 535 YFGAFQVFGK-VAHDTPHHEDLPRLESPNFYYTLEDILF 648
           Y G+F+ + K  A +TP  E +PRL+  NFYY  ED LF
Sbjct: 115 YLGSFENYAKGGAIETPFRESMPRLDLENFYYNQEDALF 153



>gb:AB020755_1514720 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MZN1.
          Length = 386

 Score =  110 bits (275), Expect = 2e-23
 Identities = 71/172 (41%), Positives = 101/172 (58%), Gaps = 8/172 (4%)
 Frame = +1

Query: 166 QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPM-EYIQCDISD 342
           ++VALI GVTG+VG  + + L L   PG  W++YGVAR P    NS   M  +I CD+ +
Sbjct: 16  ENVALIFGVTGLVGREIVKTL-LMSKPG--WRIYGVARNPEI--NSMTKMYNFISCDLLN 70

Query: 343 EEDAHSKLSVLTD-VTHVFYVTWANR-PTELENCEANGK-MLRNVLNAVIPNSPDLKHIC 513
             +   +LS L D V+HVF+VTW+   P + + C    K ML N L+A++PN+  LKH  
Sbjct: 71  ASETKQRLSPLQDIVSHVFWVTWSGEFPLDTDECCVQNKTMLMNALDAILPNAKRLKHFS 130

Query: 514 LQTGKKHYFGAFQ---VFGKVAHDTPHHEDLPRLES-PNFYYTLEDILFDEV 657
           LQTG KHY    +     G+ +    + E+ PR  S  NFYY LED+L +++
Sbjct: 131 LQTGMKHYVSLVEETMARGEGSSLYYYSEECPRKSSGKNFYYVLEDLLKEKI 182



>gb:AE016865_352109 Pseudomonas syringae pv. tomato str. DC3000
           section 10 of 21 of the complete
           genome.>gb:AE016853_1037284 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 353

 Score =  104 bits (259), Expect = 2e-21
 Identities = 63/160 (39%), Positives = 90/160 (56%), Gaps = 2/160 (1%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHP-MEYIQCDISDEED 351
           AL+VG +GIVG+++ ++L   D     W+V  ++R P     S  P +  +  D+ D   
Sbjct: 5   ALVVGASGIVGSAITQLLLEND-----WQVAALSRSP-----STRPGVIPVAADLQDPAS 54

Query: 352 AHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKK 531
             + L+ L   TH+F  TW+ + TE EN   N  M+RNVL+AV P +  +KH+ L TG K
Sbjct: 55  VTAALADLRP-THIFITTWSRQATEAENIRVNAAMVRNVLDAVRP-AGSVKHVALVTGLK 112

Query: 532 HYFGAFQVFGK-VAHDTPHHEDLPRLESPNFYYTLEDILF 648
           HY G F+ +GK     TP  E  PRL+  NFYY  ED +F
Sbjct: 113 HYLGPFEAYGKGTLPQTPFRESQPRLDIENFYYAQEDEVF 152



>gb:CP000009_862927 Gluconobacter oxydans 621H, complete genome.
          Length = 376

 Score =  103 bits (257), Expect = 3e-21
 Identities = 65/162 (40%), Positives = 86/162 (53%), Gaps = 3/162 (1%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           AL+VG TGIVG +LA  L         W V+G+ARRPR      H +  +    +D  D 
Sbjct: 27  ALVVGATGIVGQNLAARLVAEG-----WTVHGLARRPR------HDVAGVLPVAADLLDP 75

Query: 355 HSKLSVLTDV--THVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGK 528
            S    L D+  +HVF+ +W  + TE ENC  N  M+RN L A +P    L H  L TG 
Sbjct: 76  PSLAGALKDLRPSHVFFCSWMRQATEEENCRVNAAMVRN-LFAALPEPELLVHAALTTGM 134

Query: 529 KHYFGAFQVFGKVAHD-TPHHEDLPRLESPNFYYTLEDILFD 651
           KHY G F+ +       TP  E++PRL+  NFYY  ED L++
Sbjct: 135 KHYLGPFEAYASGEPPVTPFREEVPRLDLRNFYYDQEDALYE 176



>gb:BX640413_805317 Bordetella pertussis strain Tohama I, complete
           genome; segment 3/12.
          Length = 351

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 54/155 (34%), Positives = 73/155 (47%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           ALI G  GIVGN+L + L         W V  ++RR   A      + +I  D+ D   A
Sbjct: 5   ALIAGPYGIVGNALVQHL----ARDAAWDVVTISRRQEAALPG---VRHIAADLLDAAQA 57

Query: 355 HSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKH 534
            + L+    +THVFY  +A RPT  E    N  ML N+++AV  ++  L+ + L  G K 
Sbjct: 58  EAALAAFPGITHVFYCAYAPRPTLGEEAAPNLAMLANLVSAVDRHARGLERVVLVHGTKW 117

Query: 535 YFGAFQVFGKVAHDTPHHEDLPRLESPNFYYTLED 639
           Y      F      TP  ED  R   PNFYY  +D
Sbjct: 118 YGNHLGPF-----RTPAREDDARHCPPNFYYDQQD 147



>gb:BX640441_814221 Bordetella bronchiseptica strain RB50, complete
           genome; segment 5/16.
          Length = 351

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 53/155 (34%), Positives = 71/155 (45%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           ALI G  GIVGN+L + L         W V  ++RR          + +I  D+ D   A
Sbjct: 5   ALIAGPYGIVGNALVQHL----ARDAAWDVVTISRRQEATLPG---VRHIAADLLDAAQA 57

Query: 355 HSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKH 534
            + L+    +THVFY  +A RPT  E    N  ML N+++AV  ++  L  + L  G K 
Sbjct: 58  EAALAAFPGITHVFYCAYAPRPTLGEEAAPNLAMLANLVSAVDRHARGLARVVLVHGTKW 117

Query: 535 YFGAFQVFGKVAHDTPHHEDLPRLESPNFYYTLED 639
           Y      F      TP  ED  R   PNFYY  +D
Sbjct: 118 YGNHLGPF-----RTPAREDDARHCPPNFYYDQQD 147



>gb:BX640429_810425 Bordetella parapertussis strain 12822, complete
           genome; segment 7/14.
          Length = 351

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 53/155 (34%), Positives = 71/155 (45%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           ALI G  GIVGN+L + L         W V  ++RR          + +I  D+ D   A
Sbjct: 5   ALIAGPYGIVGNALVQHL----ARDAAWDVVTISRRQEATLPG---VRHIAADLLDAAQA 57

Query: 355 HSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKH 534
            + L+    +THVFY  +A RPT  E    N  ML N+++AV  ++  L  + L  G K 
Sbjct: 58  EAALAAFPGITHVFYCAYAPRPTLGEEAAPNLAMLANLVSAVDRHARGLARVVLVHGTKW 117

Query: 535 YFGAFQVFGKVAHDTPHHEDLPRLESPNFYYTLED 639
           Y      F      TP  ED  R   PNFYY  +D
Sbjct: 118 YGNHLGPF-----RTPAREDDARHCPPNFYYDQQD 147



>gb:AE013598_296004 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 266

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 30/65 (46%), Positives = 41/65 (63%)
 Frame = +1

Query: 454 MLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNFYYTL 633
           M+R++ +A+      L+H+ L TG KHY GAF+ +G    +TP  E  PR    NFYYTL
Sbjct: 1   MMRHLCDAL--RDAPLQHMVLVTGTKHYLGAFENYGSGKAETPFRESEPRQPGENFYYTL 58

Query: 634 EDILF 648
           ED+LF
Sbjct: 59  EDLLF 63



>gb:AY553235_1613421 Leptosphaeria maculans HDX1 (HDX1), PKS1
           (PKS1), and UVI-1h (UVI-1h) genes, complete cds;
           sirodesmin biosynthetic gene cluster, complete sequence;
           MP1 (MP1), and ZnF3 (ZnF3) genes, complete cds.
          Length = 393

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 49/162 (30%), Positives = 76/162 (46%), Gaps = 13/162 (8%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEY--------- 321
           +VA++ G +GI G  + + L  A T     K+  +  R      S  P +          
Sbjct: 2   AVAVVFGASGISGWGITKALLDAKTQNAFSKIIALTNRSLSLAESGLPDDDRLQLHSGID 61

Query: 322 IQCDISDE-EDAHSKLSVLTDVTHVFYVTWANRPTE--LENCEANGKMLRNVLNAVIPNS 492
           +Q ++ D       ++  + +VTHVFY  ++   T+  L    +N KMLR ++ A+   +
Sbjct: 62  LQANVDDVIAKLRERIPSIGNVTHVFYTAFSTSHTDNQLMMKASNTKMLRTMVEAMETVA 121

Query: 493 PDLKHICLQTGKKHYFGAF-QVFGKVAHDTPHHEDLPRLESP 615
           P L  I +QTG  HY   F +V G+     P  EDLPRL SP
Sbjct: 122 PSLSFIAVQTGSNHYGILFAEVLGERFGPVPLKEDLPRLPSP 163



>pir|T41593|T41593 hypothetical protein SPCC757.02c - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPCC757_1721597 S.pombe
           chromosome III cosmid c757.
          Length = 405

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 5/163 (3%)
 Frame = +1

Query: 172 VALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE- 348
           VA++ G TG+ G ++ + L   D       ++ ++R  +  +     +++   D+ +EE 
Sbjct: 7   VAIVTGATGLNGAAIIKRLSEDDNCK---TIHCISRSLKDEY--PRKIKHHSIDLLNEEP 61

Query: 349 -DAHSKLSV--LTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAV-IPNSPDLKHICL 516
            D   K S+  +  + + ++  +     E + CE NG MLRN + A+ + +   L+ + L
Sbjct: 62  KDIAKKFSLEGVKGINYAYFAAYKEENNEEKLCEVNGNMLRNFVQALELTSIQTLRRVIL 121

Query: 517 QTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNFYYTLEDIL 645
            TG K Y            +T          +PNFYY  EDIL
Sbjct: 122 TTGLKFYGLHLGEVRLPMIETDIRVPETFSGTPNFYYVQEDIL 164



>gb:AE013598_296003 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 101

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 26/48 (54%), Positives = 32/48 (66%)
 Frame = +1

Query: 148 DAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRP 291
           + P   + +ALIVGVTGI G +LA +L LAD     W VYG+ARRP P
Sbjct: 45  EPPPMRKGIALIVGVTGISGYNLANVL-LAD----GWTVYGLARRPLP 87



>gb:AF228583_490395 Burkholderia pseudomallei capsular
           polysaccharide gene cluster, complete
           sequence.>gb:AF285636_495705 Burkholderia mallei capsule
           gene cluster, complete sequence.>gb:BX571965_792594
           Burkholderia pseudomallei strain K96243, chromosome 1,
           complete sequence.>gb:CP000010_866473 Burkholderia
           mallei ATCC 23344 chromosome 1, complete sequence.
          Length = 337

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 41/148 (27%), Positives = 67/148 (45%), Gaps = 15/148 (10%)
 Frame = +1

Query: 178 LIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDH---------PMEYIQC 330
           LI G+TG+VG+ LA+ L L +T    W++YG+ R   P  N  H          +  +  
Sbjct: 6   LITGITGMVGSHLADFL-LENTD---WEIYGLCRWRSPLDNVSHLLPRINEKNRIRLVYG 61

Query: 331 DISDEEDAHSKLSVLTDVTHVFYVTWANRP-----TELENCEANGKMLRNVLNAVIPNSP 495
           D+ D    H  +   T    VF++   + P     + L+  E N +   NVL A+  N+ 
Sbjct: 62  DLRDYLSIHEAVKQSTP-DFVFHLAAQSYPKTSFDSPLDTLETNVQGTANVLEALRKNNI 120

Query: 496 D-LKHICLQTGKKHYFGAFQVFGKVAHD 576
           D + H+C  +         +VFG+V  +
Sbjct: 121 DAVTHVCASS---------EVFGRVPRE 139



>gb:AY553235_1613424 Leptosphaeria maculans HDX1 (HDX1), PKS1
           (PKS1), and UVI-1h (UVI-1h) genes, complete cds;
           sirodesmin biosynthetic gene cluster, complete sequence;
           MP1 (MP1), and ZnF3 (ZnF3) genes, complete cds.
          Length = 404

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 45/159 (28%), Positives = 65/159 (40%), Gaps = 12/159 (7%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRP----RPAWNSDHPMEY---IQCD 333
           AL++G TG+ G SL   L    TP     V  +  RP       W +D  +     I  +
Sbjct: 8   ALVIGATGVSGWSLCLQLLQTQTPSAFESVDLLTNRPVSLSDAQWPTDSRLRVHSGIDLN 67

Query: 334 ISDEEDAHSKLSV--LTDVTHVFYVTWANRPTE--LENCEANGKMLRNVLNAVIPNSPDL 501
            + EE   S   +  + ++THVFYV     PT    E  + N +M +  L+A+   +   
Sbjct: 68  RTSEEVIGSFRGIPDIGEITHVFYVACGMSPTYDFAETAKINVQMTKAALDAIEAVAVCT 127

Query: 502 KHICLQTGKKHYFGAF-QVFGKVAHDTPHHEDLPRLESP 615
           KHI  Q G   Y   F    G      P +E   R+  P
Sbjct: 128 KHISFQAGSIVYGIPFADWLGDNFRPGPFNESFARVPPP 166



>gb:AP006840_568561 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 332

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 23/57 (40%), Positives = 30/57 (52%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDE 345
           ALI GVTG++G  LA  L         + VYG ARRP   W        I+CD++D+
Sbjct: 5   ALITGVTGVLGRELAGCLRRRG-----YAVYGAARRPLEGWQDGLDWLPIECDVTDD 56



>gb:AY553235_1613431 Leptosphaeria maculans HDX1 (HDX1), PKS1
           (PKS1), and UVI-1h (UVI-1h) genes, complete cds;
           sirodesmin biosynthetic gene cluster, complete sequence;
           MP1 (MP1), and ZnF3 (ZnF3) genes, complete cds.
          Length = 409

 Score = 40.8 bits (94), Expect = 0.021
 Identities = 45/162 (27%), Positives = 74/162 (45%), Gaps = 15/162 (9%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEIL--PLADTPGGPW--KVYGVARRPRP---AWNSDHPMEYIQ-C 330
           AL+ G TG+ G  L + L    AD+   P   +V GV ++P      +  D   E +   
Sbjct: 13  ALVYGATGVTGWGLCKNLLEQQADSASTPTFSRVIGVCKQPAQDLGLFLEDKRFELVDGV 72

Query: 331 DISDEEDAH----SKLSVLTDVTHVFYVTWANRPTE--LENCEANGKMLRNVLNAVIPNS 492
           D+   ED+      ++  + +VTHVFYV   N P++   E    N KM+++ + A    S
Sbjct: 73  DLLQGEDSVVEVLKEVKGIENVTHVFYVANRNSPSDGPDERISFNVKMIQSAVKAAEQLS 132

Query: 493 PDLKHICLQTGKKHY-FGAFQVFGKVAHDTPHHEDLPRLESP 615
            +++ + +QT    Y   A  + G +   +P  E   R  SP
Sbjct: 133 SNMQVLIMQTSINVYGIFASLMGGTLTCPSPLVESADRTPSP 174



>gb:AP006618_558477 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 358

 Score = 38.9 bits (89), Expect = 0.078
 Identities = 21/81 (25%), Positives = 41/81 (50%)
 Frame = +1

Query: 178 LIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAH 357
           ++VG +G +G++L  +L  A       +V G+ RRP P   +   + +++CD++D     
Sbjct: 4   VVVGASGNIGSALVRVLLAAGE-----EVVGLCRRP-PGPGTFDAVRWVRCDLADPAAVD 57

Query: 358 SKLSVLTDVTHVFYVTWANRP 420
           +  +   D   V ++ WA  P
Sbjct: 58  TLRATFADADAVVHLAWAIHP 78



>gb:AK118211_1816202 Arabidopsis thaliana At3g18520 mRNA for
           putative histone deacetylase, complete cds, clone:
           RAFL19-53-B07.
          Length = 552

 Score = 35.4 bits (80), Expect = 0.86
 Identities = 22/57 (38%), Positives = 31/57 (54%)
 Frame = -2

Query: 396 KNMRDISQHRQLGMGIFLVGNIALDILHWMIRVPGGSGAAGDAVNLPWAAGCVGERE 226
           K++  IS HR  G GIF  G  A D +       G +G  G  VN+PW+ G VG+++
Sbjct: 328 KSVLYISLHRHEG-GIFYPGTGAADEV-------GSNGGEGYCVNVPWSCGGVGDKD 376



>gb:AF482758_2264415 Cowpox virus strain Brighton Red, complete
           genome.
          Length = 345

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 21/74 (28%), Positives = 35/74 (47%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  VA  P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRHIVKLLISADDVQ-EIRVIDVAEDPQPLTSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH 390
                L  +  + H
Sbjct: 61  KVREALDGVNLIIH 74



>gb:AY089519_1297175 Drosophila melanogaster GM12762 full insert
           cDNA.
          Length = 395

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 2/93 (2%)
 Frame = +1

Query: 172 VALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEED 351
           VALI G+TG  G+ LAE L   D     ++V+G+ RR    +N+   +E++  D    + 
Sbjct: 48  VALITGITGQDGSYLAEFLLKKD-----YEVHGIIRR-ASTFNTTR-IEHLYADPKAHKG 100

Query: 352 AHSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
              KL    +TD + +  +    +PTE+ N  A
Sbjct: 101 GRMKLHYGDMTDSSSLVKIINMVKPTEIYNLAA 133



>gb:AF461121_513427 Escherichia coli serotype O55:H7 O-antigen gene
           cluster, complete sequence.
          Length = 372

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 28/91 (30%), Positives = 45/91 (49%)
 Frame = +1

Query: 172 VALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEED 351
           VALI GVTG  G+ LAE L         ++V+G+ RR   ++N++      Q   S + +
Sbjct: 4   VALITGVTGQDGSYLAEFLLEKG-----YEVHGIKRR-ASSFNTERVDHIYQDPHSAKPN 57

Query: 352 AHSKLSVLTDVTHVFYVTWANRPTELENCEA 444
            H     LTD +++  +    +P E+ N  A
Sbjct: 58  FHLHYGDLTDTSNITRILQEVKPDEVYNLGA 88



>sp|Q9VMW9|GMDS_DROME Probable GDP-mannose 4,6 dehydratase (EC
           4.2.1.47) (GDP-D-mannose dehydratase)
           (Dm-gmd).>gb:AE014134_1127570 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003608_1217677
           Drosophila melanogaster chromosome 2L, section 17 of 83
           of the complete sequence.
          Length = 395

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 2/93 (2%)
 Frame = +1

Query: 172 VALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEED 351
           VALI G+TG  G+ LAE L   D     ++V+G+ RR    +N+   +E++  D    + 
Sbjct: 48  VALITGITGQDGSYLAEFLLKKD-----YEVHGIIRR-ASTFNTTR-IEHLYADPKAHKG 100

Query: 352 AHSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
              KL    +TD + +  +    +PTE+ N  A
Sbjct: 101 GRMKLHYGDMTDSSSLVKIINMVKPTEIYNLAA 133



>gb:BC047185_2549849 Danio rerio zgc:55754, mRNA (cDNA clone
           MGC:55754 IMAGE:3816509), complete cds.
          Length = 448

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%)
 Frame = +2

Query: 200 LSATASPRS----SLSPTHPAAHGRFTASPAAPDPPGTLIIQWSISSAIFPTRKMP 355
           L++TA P +    S SP   A + +FT++P  P   G  +     S ++ PTRK P
Sbjct: 98  LASTAGPTAPSFQSYSPFSRAPYSQFTSTPLVPQAFGAAVTAGRSSPSLEPTRKTP 153



>gb:AY577000_2538244 Danio rerio clone RZ150A1H09 C19orf13-like
           protein mRNA, complete cds.>gb:BC065685_2554130 Danio
           rerio zgc:77202, mRNA (cDNA clone MGC:77202
           IMAGE:6962125), complete cds.
          Length = 448

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%)
 Frame = +2

Query: 200 LSATASPRS----SLSPTHPAAHGRFTASPAAPDPPGTLIIQWSISSAIFPTRKMP 355
           L++TA P +    S SP   A + +FT++P  P   G  +     S ++ PTRK P
Sbjct: 98  LASTAGPTAPSFQSYSPFSRAPYSQFTSTPLVPQAFGAAVTAGRSSPSLEPTRKTP 153



>gb:AY603973_2366559 Monkeypox virus strain MPXV-WRAIR7-61, complete
           genome.
          Length = 346

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGNPFIGHEHTLYDISPGHVY 147



>gb:AF380138_2244946 Monkeypox virus strain Zaire-96-I-16, complete
           genome.
          Length = 346

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGNPFIGHEHTLYDISPGHVY 147



>gb:AY523972S2_625194 Azospirillum brasilense plasmid 90 MDa,
           partial sequence.
          Length = 353

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 31/93 (33%), Positives = 49/93 (52%), Gaps = 2/93 (2%)
 Frame = +1

Query: 172 VALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEED 351
           VALI GVTG  G  LAE+L         + V+GV RR   ++N++  +E++  D+  E D
Sbjct: 4   VALITGVTGQDGAYLAELL-----LSKGYTVHGVKRR-SSSFNTER-VEHLYHDV-HEGD 55

Query: 352 AHSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
              ++    LTD T++  +    +P E+ N  A
Sbjct: 56  VRFRMHYGDLTDATNLIRIVQEVQPDEIYNLAA 88



>pir|D64525|D64525 GDP-D-mannose dehydratase - Helicobacter pylori
           (strain 26695)>gb:AE000526_24224 Helicobacter pylori
           26695 section 4 of 134 of the complete
           genome.>gb:AE000511_879663 Helicobacter pylori 26695
           complete genome.
          Length = 381

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 3/96 (3%)
 Frame = +1

Query: 166 QSVALIVGVTGIVGNSLAE-ILPLADTPGGPWKVYGVARRPRPAWNS--DHPMEYIQCDI 336
           + +ALI GVTG  G+ LAE +L L       ++V+G+ RR      S  DH  E +  D 
Sbjct: 3   EKIALITGVTGQDGSYLAEYLLNLG------YEVHGLKRRSSSINTSRIDHLYEDLHSDH 56

Query: 337 SDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA 444
                 H     +TD +++ ++    +PTE+ N  A
Sbjct: 57  KRRFFLH--YGDMTDSSNLIHLIATTKPTEIYNLAA 90



>gb:CV41KBPL_2398163 Cowpox virus strain GRI-90, complete genome.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVY 147



>gb:AY484669_2350045 Rabbitpox virus, complete genome.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVY 147



>gb:AY009089_2286256 Camelpox virus CMS, complete genome.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 40/163 (24%), Positives = 63/163 (38%), Gaps = 5/163 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  V   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDVVEDPQPLTSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVKEALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYYTLEDI 642
            K+  Y  + +  G   H  P   HE           YTL DI
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHE-----------YTLYDI 141



>gb:AF438165_2255566 Camelpox virus M-96 from Kazakhstan, complete
           genome.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 40/163 (24%), Positives = 63/163 (38%), Gaps = 5/163 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  V   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDVVEDPQPLTSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVKEALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYYTLEDI 642
            K+  Y  + +  G   H  P   HE           YTL DI
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHE-----------YTLYDI 141



>gb:AF095689_2194358 Vaccinia virus (strain Tian Tan) complete
           genome.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVY 147



>gb:AF012825_2177999 Ectromelia virus strain Moscow, complete
           genome.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 38/158 (24%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  V   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDVEEDPQPLTSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVY 147



>gb:AF006633_467727 Streptomyces peucetius daunosamine biosynthesis
           genes, putative flavoprotein (dnmZ), putative epimerase
           (dnmU) and thymidine
           diphospho-4-keto-2,3,6-trideoxyhexulose reductase (dnmV)
           genes, complete cds.
          Length = 307

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 38/144 (26%), Positives = 62/144 (43%), Gaps = 4/144 (2%)
 Frame = +1

Query: 178 LIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAH 357
           +++G TG VG  +      A      W V+GVARRP P  +      + + D++      
Sbjct: 4   VVLGATGSVGRQVC-----AAYQAHGWDVHGVARRPAPHLSG---CGFTELDLAAAAPGR 55

Query: 358 SKLSVLTDVTHVFYVTWAN--RPTELENCEANGKMLRNVLN--AVIPNSPDLKHICLQTG 525
              +VL D+     V  A     TE E   ++ +++R ++   A++P  P L H+     
Sbjct: 56  I-ATVLGDLPADVVVNAAGGWGDTEEEMTYSHLRLVRRLVEALALLPFRPRLVHL----- 109

Query: 526 KKHYFGAFQVFGKVAHDTPHHEDL 597
                G+   +G V   T  HEDL
Sbjct: 110 -----GSVHEYGPVPAGTLLHEDL 128



>pir|T37430|T37430 hydroyxsteroid dehydrogenase - vaccinia virus
           (strain Ankara)>gb:AY603355_2366277 Vaccinia virus
           strain Acambis 3000 Modified Virus Ankara (MVA),
           complete genome.>gb:U94848_2456983 Vaccinia virus strain
           Ankara, complete genomic sequence.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVY 147



>sp|P26670|3BHS_VACCV 3 beta-hydroxysteroid dehydrogenase/delta
           5-->4-isomerase (3Beta-HSD) [Includes:
           3-beta-hydroxy-delta(5)-steroid dehydrogenase (EC
           1.1.1.145) (3-beta-hydroxy-5-ene steroid dehydrogenase)
           (Progesterone reductase); Steroid delta-isomerase (EC
           5.3.3.1) (Delta- 5-3-ketosteroid
           isomerase)].>pir|E40897|WMVZ2W
           3beta-hydroxy-Delta5-steroid dehydrogenase
           multifunctional protein - vaccinia virus (strain
           WR)>gb:AY243312_2316742 Vaccinia virus strain WR,
           complete genome.>gb:VACPROF_2457622 Vaccinia virus gene
           ORF2, ORF3, ORF4, ORF5, ORF6, and ORF7 complete cds;
           ORF1, 5' end; ORF8, 3' end.>gb:VACRHF_2457644 Vaccinia
           virus genomic DNA, 42kbp from near the right ITR.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVY 147



>sp|P21097|3BHS_VACCC 3 beta-hydroxysteroid dehydrogenase/delta
           5-->4-isomerase (3Beta-HSD) [Includes:
           3-beta-hydroxy-delta(5)-steroid dehydrogenase (EC
           1.1.1.145) (3-beta-hydroxy-5-ene steroid dehydrogenase)
           (Progesterone reductase); Steroid delta-isomerase (EC
           5.3.3.1) (Delta- 5-3-ketosteroid
           isomerase)].>pir|A42522|WMVZ1W
           3beta-hydroxy-Delta5-steroid dehydrogenase
           multifunctional protein - vaccinia virus (strain
           Copenhagen)>gb:VACCG_2457395 Vaccinia virus, complete
           genome.
          Length = 346

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 37/158 (23%), Positives = 61/158 (38%), Gaps = 5/158 (3%)
 Frame = +1

Query: 169 SVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEE 348
           +V  + G  G +G  + ++L  AD      +V  +   P+P  +    + YIQCDI+D +
Sbjct: 2   AVYAVTGGAGFLGRYIVKLLISADDVQ-EIRVIDIVEDPQPITSKVKVINYIQCDINDFD 60

Query: 349 DAHSKLSVLTDVTH-VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG 525
                L  +  + H    V    + T+ E  + N    + +L A           C+  G
Sbjct: 61  KVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAA-----------CVDLG 109

Query: 526 KKH--YFGAFQVFGKVAHDTPH--HEDLPRLESPNFYY 627
            K+  Y  + +  G   H  P   HE      SP   Y
Sbjct: 110 IKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVY 147



>gb:AY086135_1571191 Arabidopsis thaliana clone 21721 mRNA, complete
           sequence.
          Length = 552

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 21/57 (36%), Positives = 30/57 (52%)
 Frame = -2

Query: 396 KNMRDISQHRQLGMGIFLVGNIALDILHWMIRVPGGSGAAGDAVNLPWAAGCVGERE 226
           K++  IS HR  G G F  G  A D +       G +G  G  VN+PW+ G VG+++
Sbjct: 328 KSVLYISLHRHEG-GNFYPGTGAADEV-------GSNGGEGYCVNVPWSCGGVGDKD 376



>gb:AB026658_1517374 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MYF24.
          Length = 577

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 21/57 (36%), Positives = 30/57 (52%)
 Frame = -2

Query: 396 KNMRDISQHRQLGMGIFLVGNIALDILHWMIRVPGGSGAAGDAVNLPWAAGCVGERE 226
           K++  IS HR  G G F  G  A D +       G +G  G  VN+PW+ G VG+++
Sbjct: 347 KSVLYISLHRHEG-GNFYPGTGAADEV-------GSNGGEGYCVNVPWSCGGVGDKD 395



>gb:BA000040_730455 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 397

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +2

Query: 203 SATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLIIQWSISSAIFPT 343
           +A ASP  + +   PAA   F A PAAP P    ++  ++S+  F T
Sbjct: 156 AAVASPPLAPASPPPAARAPFVARPAAPAPAANALLPGALSTRPFST 202



>gb:AE017232_412178 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 6 of 16 of the complete
           genome.>gb:AE016958_1055582 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 201

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 21/56 (37%), Positives = 27/56 (48%)
 Frame = +2

Query: 188 ASPGLSATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLIIQWSISSAIFPTRKMP 355
           + P  S T S  SS S T PAA    + +PA P+    L+IQ S  +A  P    P
Sbjct: 20  SQPSTSKTGSATSSTSATSPAAAPPSSPAPATPNEYAKLLIQASDINAPVPFTGAP 75



>gb:AE014295_311930 Bifidobacterium longum NCC2705, complete genome.
          Length = 173

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 3/42 (7%)
 Frame = +2

Query: 194 PGLSATASPRSSL---SPTHPAAHGRFTASPAAPDPPGTLII 310
           PG SA  + RS     S  HP A  RF A P  PD PG  II
Sbjct: 56  PGSSAQLASRSQPIQPSQNHPVATCRFYADPDHPDQPGRYII 97



>gb:AE012516_283174 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 424 of 460 of the complete
           genome.>gb:AE008922_916456 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 839

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 27/71 (38%), Positives = 32/71 (45%), Gaps = 3/71 (4%)
 Frame = +2

Query: 161 STRAWL*SWASPGLSATASPR--SSLSPTHPAAHGRFTASPAAPDP-PGTLIIQWSISSA 331
           + RA L +W   GL+A A     + L P H AA  R    P A  P PGT+   W    A
Sbjct: 583 AVRACLQAW---GLAADALVHVDAQLLPLHQAAAERVLPEPPAQPPVPGTVAQAWLDGCA 639

Query: 332 IFPTRKMPIPS 364
             PTR   I S
Sbjct: 640 WLPTRDYSIAS 650



>gb:AL954681_2504934 Zebrafish DNA sequence from clone BUSM1-84G17
           in linkage group 20, complete sequence.
          Length = 263

 Score = 32.3 bits (72), Expect = 7.3
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 9/104 (8%)
 Frame = +1

Query: 160 KHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNS-------DHPME 318
           + + VA+I G+TG  G+ LAE+L LA      ++V+G+ RR   ++N+        +P  
Sbjct: 19  RKRKVAIITGITGQDGSYLAELL-LAK----GYEVHGILRR-SSSFNTGRIEHLYHNPQT 72

Query: 319 YIQCDISDEEDAHSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
           + +  I   +D H KL    LTD T +  +    +PTE+ N  A
Sbjct: 73  HTEGSIGATKD-HMKLHYGDLTDSTCLVKIINEVKPTEIYNLGA 115



>gb:AL954681_2504933 Zebrafish DNA sequence from clone BUSM1-84G17
           in linkage group 20, complete sequence.
          Length = 256

 Score = 32.3 bits (72), Expect = 7.3
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 2/97 (2%)
 Frame = +1

Query: 160 KHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDIS 339
           + + VA+I G+TG  G+ LAE+L LA      ++V+G+ RR   ++N+   +E++  +  
Sbjct: 19  RKRKVAIITGITGQDGSYLAELL-LAK----GYEVHGILRR-SSSFNTGR-IEHLYHNPQ 71

Query: 340 DEEDAHSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
              + + KL    LTD T +  +    +PTE+ N  A
Sbjct: 72  THTEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGA 108



>gb:AE014292_309993 Brucella suis 1330 chromosome II, complete
           sequence.
          Length = 356

 Score = 32.3 bits (72), Expect = 7.3
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           ALIVGVTG  G  L+E+L      G  ++V+G+ RR   ++N+   ++++  D   EED 
Sbjct: 6   ALIVGVTGQDGAYLSELL-----LGKGYRVHGLKRR-SSSFNTAR-IDHLYQD-PHEEDI 57

Query: 355 HSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
             +L    LTD T++  V    +P E+ N  A
Sbjct: 58  RFRLHFGDLTDATNLCRVIQEVQPDEIYNLGA 89



>gb:AE009769_255443 Pyrobaculum aerophilum strain IM2 section 24 of
           201 of the complete genome.>gb:AE009441_898069
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 791

 Score = 32.3 bits (72), Expect = 7.3
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -1

Query: 517 AGRYASNLENLGLP-HSTHSSTFSRWLHSFPVPWVGLPTSRKKHA*HQSAQTAWNG 353
           AG+Y S L+  G+  H   SSTF RW++  PV  V  P S   +      Q+AW G
Sbjct: 348 AGKYESYLDFCGVVFHKLRSSTFERWVYFTPVMNVTTPWSSGVNF-LDVGQSAWVG 402



>pir|AG3615|AG3615 GDPmannose 4,6-dehydratase (EC 4.2.1.47)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009718_254827 Brucella melitensis 16M
           chromosome II, section 80 of 107 of the complete
           sequence.>gb:AF076290_476830 Brucella melitensis Bme18
           (bme18) gene, partial cds; Bme19 (bme19), Bme16 (bme16),
           Bme17 (bme17), Bme20 (bme20), Bme21 (bme21), Bme22
           (bme22), Bme23 (bme23), Bme24 (bme24), Bme25 (bme25),
           Bme26 (bme26), Bme27 (bme27), Bme28 (bme28), Bme29
           (bme29), Bme30 (bme30), Bme31 (bme31), Bme1 (bme1), Bme2
           (bme2), Bme3 (bme3), Bme4 (bme4), outer membrane protein
           (omp31), Bme6 (bme6), Bme7 (bme7), Bme8 (bme8), Bme9
           (bme9), Bme10 (bme10), Bme11 (bme11), Bme12 (bme12),
           Bme13 (bme13), and Bme14 (bme14) genes, complete cds;
           and Bme15 (bme15) gene, partial cds.>gb:AE008918_980739
           Brucella melitensis 16M chromosome II, complete
           sequence.
          Length = 356

 Score = 32.3 bits (72), Expect = 7.3
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           ALIVGVTG  G  L+E+L      G  ++V+G+ RR   ++N+   ++++  D   EED 
Sbjct: 6   ALIVGVTGQDGAYLSELL-----LGKGYRVHGLKRR-SSSFNTAR-IDHLYQD-PHEEDI 57

Query: 355 HSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
             +L    LTD T++  V    +P E+ N  A
Sbjct: 58  RFRLHFGDLTDATNLCRVIQEVQPDEIYNLGA 89



>gb:BC042270_2548090 Xenopus laevis GDP-mannose 4, 6-dehydratase,
           mRNA (cDNA clone MGC:53456 IMAGE:5572021), complete cds.
          Length = 369

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 2/97 (2%)
 Frame = +1

Query: 160 KHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDIS 339
           K + VALI G+TG  G+ LAE L         ++V+G+ RR   ++N+   +E++  +  
Sbjct: 18  KPRKVALITGITGQDGSYLAEFLLEKG-----YEVHGIVRR-SSSFNTGR-IEHLYKNPH 70

Query: 340 DEEDAHSKLSV--LTDVTHVFYVTWANRPTELENCEA 444
              + + KL    LTD T +  +    +PTE+ N  A
Sbjct: 71  AHTEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGA 107



>gb:BT019885_2151584 Synthetic construct Homo sapiens GDP-mannose
           4,6-dehydratase mRNA, partial cds.>gb:BT019886_2151585
           Synthetic construct Homo sapiens GDP-mannose
           4,6-dehydratase mRNA, partial cds.
          Length = 373

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +1

Query: 160 KHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNS---DHPMEYIQC 330
           K ++VALI G+TG  G+ LAE L         ++V+G+ RR   ++N+   +H  +  Q 
Sbjct: 21  KPRNVALITGITGQDGSYLAEFLLEKG-----YEVHGIVRR-SSSFNTGRIEHLYKNPQA 74

Query: 331 DISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA 444
            I      H     LTD T +  +    +PTE+ N  A
Sbjct: 75  HIEGNMKLH--YGDLTDSTCLVKIINEVKPTEIYNLGA 110



>gb:MMU21392_2118920 Mus musculus putative serine/threonine kinase
           (Fnk) mRNA, partial cds.
          Length = 609

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 19/40 (47%), Positives = 19/40 (47%)
 Frame = +2

Query: 188 ASPGLSATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLI 307
           A PG  A ASPRS              A P APDPPG LI
Sbjct: 2   AGPGPPANASPRSE---------PEVLAGPRAPDPPGRLI 32



>gb:BC063051_2105125 Mus musculus polo-like kinase 3 (Drosophila),
           mRNA (cDNA clone MGC:66660 IMAGE:5718130), complete cds.
          Length = 648

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 19/40 (47%), Positives = 19/40 (47%)
 Frame = +2

Query: 188 ASPGLSATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLI 307
           A PG  A ASPRS              A P APDPPG LI
Sbjct: 24  AGPGPPANASPRSE---------PEVLAGPRAPDPPGRLI 54



>gb:BC031180_2097000 Mus musculus polo-like kinase 3 (Drosophila),
           mRNA (cDNA clone MGC:37578 IMAGE:4988360), complete cds.
          Length = 504

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 19/40 (47%), Positives = 19/40 (47%)
 Frame = +2

Query: 188 ASPGLSATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLI 307
           A PG  A ASPRS              A P APDPPG LI
Sbjct: 24  AGPGPPANASPRSE---------PEVLAGPRAPDPPGRLI 54



>gb:AF062655_2052921 Mus musculus plenty-of-prolines-101 mRNA,
           complete cds.
          Length = 897

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 22/59 (37%), Positives = 26/59 (44%)
 Frame = +2

Query: 185 WASPGLSATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLIIQWSISSAIFPTRKMPIP 361
           W SP    T S R   SP+ P A  R + SPA P PP     +   S    P R+ P P
Sbjct: 548 WQSP---VTKSSRRRRSPSPPPARRRRSPSPAPPPPPPPPPPRRRRSPTPPPRRRTPSP 603



>gb:CR541947_1994174 Homo sapiens full open reading frame cDNA clone
           RZPDo834A1234D for gene GMDS, GDP-mannose
           4,6-dehydratase; complete cds, without stopcodon.
          Length = 372

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +1

Query: 160 KHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNS---DHPMEYIQC 330
           K ++VALI G+TG  G+ LAE L         ++V+G+ RR   ++N+   +H  +  Q 
Sbjct: 21  KPRNVALITGITGQDGSYLAEFLLEKG-----YEVHGIVRR-SSSFNTGRIEHLYKNPQA 74

Query: 331 DISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA 444
            I      H     LTD T +  +    +PTE+ N  A
Sbjct: 75  HIEGNMKLH--YGDLTDSTCLVKIINEVKPTEIYNLGA 110



>gb:AC149291_1744955 Solanum demissum chromosome 5 clone PGEC568H16
           map MAP_LOC, complete sequence.
          Length = 1622

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = +2

Query: 203 SATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLII 310
           ++ +SP  S  PTH     RF+ASP  P PPG+  +
Sbjct: 60  TSVSSPSYSAVPTHSR---RFSASPEIPSPPGSFFL 92



>pir|D69255|D69255 GDP-D-mannose dehydratase (gmd-1), authentic
           frameshift homolog - Archaeoglobus fulgidus
          Length = 255

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 26/71 (36%), Positives = 34/71 (47%)
 Frame = +1

Query: 175 ALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDA 354
           ALI GVTG VG+ LA+ L          +VYG+ RR R  W+   P   I   I ++   
Sbjct: 14  ALITGVTGFVGSYLAKHLIELGA-----EVYGIVRR-RADWSP--PQNLINMGILNDPHL 65

Query: 355 HSKLSVLTDVT 387
           H     L D+T
Sbjct: 66  HLIEGDLLDIT 76



>pir|D71981|D71981 gdp-d-mannose dehydratase - Helicobacter pylori
           (strain J99)>gb:AE001443_35033 Helicobacter pylori,
           strain J99 section 4 of 132 of the complete
           genome.>gb:AE001439_883803 Helicobacter pylori, strain
           J99 complete genome.
          Length = 381

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 3/96 (3%)
 Frame = +1

Query: 166 QSVALIVGVTGIVGNSLAE-ILPLADTPGGPWKVYGVARRPRPAWNS--DHPMEYIQCDI 336
           + +ALI GVTG  G+ LAE +L L       ++V+G+ RR      S  DH  E +  + 
Sbjct: 3   EKIALITGVTGQDGSYLAEYLLNLG------YEVHGLKRRSSSINTSRIDHLYEDLHSEH 56

Query: 337 SDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA 444
                 H     +TD +++ ++    +PTE+ N  A
Sbjct: 57  KRRFFLH--YGDMTDSSNLIHLIATTKPTEIYNLAA 90



>sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 (EC
           2.7.1.37) (Polo-like kinase 3) (PLK-3)
           (Cytokine-inducible serine/threonine-protein kinase)
           (FGF- inducible kinase).>pir|A57286|A57286 probable
           serine/threonine protein kinase (EC 2.7.1.-) fnk - mouse
          Length = 631

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 19/40 (47%), Positives = 19/40 (47%)
 Frame = +2

Query: 188 ASPGLSATASPRSSLSPTHPAAHGRFTASPAAPDPPGTLI 307
           A PG  A ASPRS              A P APDPPG LI
Sbjct: 24  AGPGPPANASPRSE---------PEVLAGPRAPDPPGRLI 54



>sp|O60547|GMDS_HUMAN GDP-mannose 4,6 dehydratase (EC 4.2.1.47)
           (GDP-D-mannose dehydratase) (GMD).>gb:AF042377_1878491
           Homo sapiens GDP-mannose 4,6 dehydratase mRNA, complete
           cds.>gb:AL137179_1919518 Human DNA sequence from clone
           RP11-82M9 on chromosome 6 Contains part of the GMDS gene
           for GDP-mannose 4 6-dehydratase, complete
           sequence.>gb:AL158139_1921314 Human DNA sequence from
           clone RP1-80B9 on chromosome 6 Contains the 5' end of
           the GMDS gene for GDP-mannose 4,6-dehydratase, a novel
           gene and a CpG island, complete
           sequence.>gb:BC000117_1966439 Homo sapiens GDP-mannose
           4,6-dehydratase, mRNA (cDNA clone MGC:1739
           IMAGE:3351070), complete cds.>gb:CR541929_1994156 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834B0234D for gene GMDS, GDP-mannose
           4,6-dehydratase; complete cds, incl.
           stopcodon.>gb:HS118B18_1996984 Human DNA sequence from
           clone RP1-118B18 on chromosome 6p24.1-25.3 Contains the
           FOXC1 gene for forkhead box C1 gene, the 3' end of the
           GMDS gene for GDP-mannose 4 6-dehydratase and four CpG
           Islands, complete sequence.>gb:HS279I9_1997845 Human DNA
           sequence from clone RP1-279I9 on chromosome 6p24.1-25.3
           Contains part of the GMDS gene for GDP-mannose 4
           6-dehydratase, complete sequence.>gb:HS33B19_1998160
           Human DNA sequence from clone RP1-33B19 on chromosome
           6p24.1-25.3 Contains part of the GMDS gene for
           GDP-mannose 4 6-dehydratase, complete sequence.
          Length = 372

 Score = 32.0 bits (71), Expect = 9.5
 Identities = 31/98 (31%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = +1

Query: 160 KHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNS---DHPMEYIQC 330
           K ++VALI G+TG  G+ LAE L         ++V+G+ RR   ++N+   +H  +  Q 
Sbjct: 21  KPRNVALITGITGQDGSYLAEFLLEKG-----YEVHGIVRR-SSSFNTGRIEHLYKNPQA 74

Query: 331 DISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA 444
            I      H     LTD T +  +    +PTE+ N  A
Sbjct: 75  HIEGNMKLH--YGDLTDSTCLVKIINEVKPTEIYNLGA 110


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 760,308,722
Number of Sequences: 1806583
Number of extensions: 17168914
Number of successful extensions: 59444
Number of sequences better than 10.0: 79
Number of HSP's better than 10.0 without gapping: 55714
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59240
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 35782545470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)