BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6988
         (1705 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9ZUB3|SPD1_ARATH|SPD1_ARATH Spermidine synthase 1 (EC 2.5.1.16) (Putres...   292   e-149   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZS45|SPDE_LYCES|SPDE_LYCES Spermidine synthase (EC 2.5.1.16) (Putresci...   294   e-148   Solanum lycopersicum
sp|Q96557|SPD2_DATST|SPD2_DATST Spermidine synthase 2 (EC 2.5.1.16) (Putres...   291   e-147   Datura stramonium [common thornapple]
sp|O82147|SPDE_COFAR|SPDE_COFAR Spermidine synthase (EC 2.5.1.16) (Putresci...   302   e-147   Coffea arabica [arabica coffee]
gb:STU345003_1723068 Solanum tuberosum mRNA for spermidine synth...   289   e-146   
gb:AB072915_1523119 Malus x domestica MdSPDS1 mRNA forspermidine...   291   e-146   
sp|Q96556|SPD1_DATST|SPD1_DATST Spermidine synthase 1 (EC 2.5.1.16) (Putres...   298   e-146   Datura stramonium [common thornapple]
sp|Q9ZTR1|SPD1_PEA|SPD1_PEA Spermidine synthase 1 (EC 2.5.1.16) (Putresci...   291   e-146   Pisum sativum [garden pea]
sp|O48658|SPD1_HYONI|SPD1_HYONI Spermidine synthase 1 (EC 2.5.1.16) (Putres...   294   e-145   Hyoscyamus niger [black henbane]
gb:AB072916_1523120 Malus x domestica MdSPDS2a mRNA forspermidin...   285   e-145   
sp|O48659|SPD2_HYONI|SPD2_HYONI Spermidine synthase 2 (EC 2.5.1.16) (Putres...   295   e-145   Hyoscyamus niger [black henbane]
sp|O48660|SPDE_NICSY|SPDE_NICSY Spermidine synthase (EC 2.5.1.16) (Putresci...   291   e-144   Nicotiana sylvestris
sp|Q9SMB1|SPD1_ORYSA|SPD1_ORYSA Spermidine synthase 1 (EC 2.5.1.16) (Putres...   293   e-143   Oryza sativa [red rice]
sp|O48661|SPD2_ARATH|SPD2_ARATH Spermidine synthase 2 (EC 2.5.1.16) (Putres...   273   e-142   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZTR0|SPD2_PEA|SPD2_PEA Spermidine synthase 2 (EC 2.5.1.16) (Putresci...   285   e-141   Pisum sativum [garden pea]
gb:AB100310_1526262 Petunia x hybrida spds mRNA for spermidine s...   266   e-139   
gb:AB006693_1509809 Arabidopsis thaliana mRNA for spermidine syn...   273   e-135   
gb:AB072917_1523121 Malus x domestica MdSPDS2b mRNA forspermidin...   285   e-131   
gb:AF321139_1785927 Nicotiana tabacum spermidine synthase mRNA, ...   244   e-120   
gb:AP004875_1846401 Oryza sativa (japonica cultivar-group) genom...   231   e-115   
gb:AB098063_1526058 Oryza sativa (japonica cultivar-group) OsSPD...   233   e-114   
gb:AB018570_1513971 Atropa belladonna mRNA for putrescine N-meth...   256   e-113   
gb:AF126810_1770493 Nicotiana tabacum cultivar Xanthi putrescine...   259   e-113   
gb:AY690623_1622464 Anisodus tanguticus putrescine N-methyltrans...   255   e-113   
sp|Q9SEH5|PMT3_TOBAC|PMT3_TOBAC Putrescine N-methyltransferase 3 (EC 2.1.1....   260   e-113   Nicotiana tabacum [American tobacco]
gb:AF280402_1782878 Nicotiana attenuata putrescine N-methyltrans...   258   e-112   
gb:AB018572_1513973 Hyoscyamus niger mRNA for putrescine N-methy...   254   e-112   
sp|Q42963|PMT1_TOBAC|PMT1_TOBAC Putrescine N-methyltransferase 1 (EC 2.1.1....   258   e-112   Nicotiana tabacum [American tobacco]
gb:AB018571_1513972 Atropa belladonna mRNA for putrescine N-meth...   257   e-112   
gb:AY335900_1600222 Lycopersicon esculentum putative spermine sy...   221   e-112   
gb:AY040013_1560514 Arabidopsis thaliana putative spermidine syn...   223   e-112   
gb:AJ583514_1811347 Datura stramonium mRNA for putrescine N-meth...   256   e-112   
gb:AB004324_1509073 Nicotiana sylvestris NsPMT3 gene for putresc...   260   e-112   
gb:AF424571_1798910 Arabidopsis thaliana AT5g53120/MFH8_5 mRNA, ...   221   e-111   
gb:AY087226_1572260 Arabidopsis thaliana clone 33021 mRNA, compl...   221   e-111   
gb:AF280403_1782879 Nicotiana attenuata putrescine N-methyltrans...   255   e-111   
gb:AB004322_1509071 Nicotiana sylvestris NsPMT1 gene for putresc...   256   e-111   
sp|Q9SEH7|PMT2_TOBAC|PMT2_TOBAC Putrescine N-methyltransferase 2 (EC 2.1.1....   256   e-111   Nicotiana tabacum [American tobacco]
sp|Q9SEH4|PMT4_TOBAC|PMT4_TOBAC Putrescine N-methyltransferase 4 (EC 2.1.1....   260   e-111   Nicotiana tabacum [American tobacco]
gb:AB025622_1516442 Arabidopsis thaliana genomic DNA, chromosome...   223   e-110   
gb:AJ605553_1811910 Solanum tuberosum mRNA for putrescine N-meth...   254   e-110   
gb:AB004323_1509072 Nicotiana sylvestris NsPMT2 gene for putresc...   173   7e-87   
sp|Q09741|SPEE_SCHPO|SPEE_SCHPO Spermidine synthase (EC 2.5.1.16) (Putresci...   160   2e-77   Schizosaccharomyces pombe
sp|Q9Y8H7|SPEE_NEUCR|SPEE_NEUCR Spermidine synthase (EC 2.5.1.16) (Putresci...   157   8e-77   
sp|Q9XY92|SPEE_DICDI|SPEE_DICDI Spermidine synthase (EC 2.5.1.16) (Putresci...   161   2e-76   Dictyostelium discoideum
gb:HUMSPERSYO_2036688 Human spermidine synthase mRNA, complete cds.   159   4e-76   
sp|P19623|SPEE_HUMAN|SPEE_HUMAN Spermidine synthase (EC 2.5.1.16) (Putresci...   159   8e-76   Homo sapiens [man]
gb:BC070692_2555663 Xenopus laevis hypothetical protein MGC83147...   155   1e-75   
gb:AF337636_2063649 Rattus norvegicus spermidine synthase mRNA, ...   160   9e-75   
sp|Q64674|SPEE_MOUSE|SPEE_MOUSE Spermidine synthase (EC 2.5.1.16) (Putresci...   158   6e-74   Mus musculus [mouse]
gb:AK028359_1160946 Mus musculus 18 days pregnant adult female p...   158   2e-73   
gb:CR382131_1664837 Yarrowia lipolytica chromosome E of strain C...   151   1e-72   
gb:AY050641_1562269 Aspergillus nidulans spermidine synthase gen...   154   2e-72   
gb:CR380950_1649713 Candida glabrata strain CBS138 chromosome D ...   152   3e-72   
gb:BC055159_2551243 Danio rerio zgc:63600, mRNA (cDNA clone MGC:...   150   5e-72   
gb:AE017347_1757745 Cryptococcus neoformans var. neoformans JEC2...   157   9e-72   
sp|Q12074|SPEE_YEAST|SPEE_YEAST Spermidine synthase (EC 2.5.1.16) (Putresci...   157   1e-71   Saccharomyces cerevisiae [brewer's yeast]
gb:BX649606_1643475 Aspergillus fumigatus BAC pilot project supe...   155   1e-71   
gb:CR382122_1655207 Kluyveromyces lactis strain NRRL Y-1140 chro...   152   8e-71   
gb:AY486138_1608546 Cryptococcus neoformans var. grubii chimeric...   154   2e-70   
gb:AF368901_1791927 Filobasidiella neoformans chimeric spermidin...   154   6e-70   
gb:AE014186_938264 Plasmodium falciparum 3D7 chromosome 11 compl...   160   1e-69   
gb:PFA271622_1392154 Plasmodium falciparum mRNA for spermidine s...   158   7e-69   
gb:CR382136_1669065 Debaryomyces hansenii chromosome D of strain...   151   1e-68   
gb:AE016817_1747043 Ashbya gossypii (= Eremothecium gossypii) AT...   145   5e-68   
gb:CEL306734_1365802 Caenorhabditis elegans mRNA for spermidine ...   154   2e-67   
gb:CR382124_1657079 Kluyveromyces lactis strain NRRL Y-1140 chro...   145   8e-61   
gb:CR382131_1663655 Yarrowia lipolytica chromosome E of strain C...   140   3e-60   
gb:LMFLCHR4B_1388533 Leishmania major Friedlin chromosome 4, rig...   138   5e-58   
gb:BT003549_1356951 Drosophila melanogaster RE01362 full insert ...   138   8e-58   
gb:AE014297_1138706 Drosophila melanogaster chromosome 3R, compl...   138   1e-57   
gb:OSA251302_1692416 Oryza sativa partial mRNA for putative amin...   225   2e-57   
gb:AF298195_1260012 Leishmania donovani spermidine synthase gene...   135   3e-57   
gb:CR380959_1653850 Candida glabrata strain CBS138 chromosome M ...   132   3e-56   
sp|Q8EXA3|SPE2_LEPIN|SPE2_LEPIN Spermidine synthase 2 (EC 2.5.1.16) (Putres...   122   2e-55   Leptospira interrogans
sp|Q12455|SPSY_YEAST|SPSY_YEAST Spermine synthase (EC 2.5.1.22) (Spermidine...   127   1e-53   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382137_1670260 Debaryomyces hansenii chromosome E of strain...   120   1e-48   
gb:AP006840_567206 Symbiobacterium thermophilum DNA, complete ge...   105   9e-44   
sp|Q9K6B8|SPEE_BACHD|SPEE_BACHD Spermidine synthase (EC 2.5.1.16) (Putresci...   102   3e-43   Bacillus halodurans
sp|Q8XMY8|SPEE_CLOPE|SPEE_CLOPE Spermidine synthase (EC 2.5.1.16) (Putresci...   111   1e-41   Clostridium perfringens
sp|Q8RA94|SPE1_THETN|SPE1_THETN Spermidine synthase 1 (EC 2.5.1.16) (Putres...   101   2e-41   Caldanaerobacter subterraneus subsp. tengcongensis
gb:AP006840_568802 Symbiobacterium thermophilum DNA, complete ge...    96   1e-40   
gb:AP006627_566213 Bacillus clausii KSM-K16 DNA, complete genome.      98   3e-40   
sp|Q57761|SPEE_METJA|SPEE_METJA Probable spermidine synthase (EC 2.5.1.16) ...   101   1e-39   Methanocaldococcus jannaschii
gb:AE017333_449750 Bacillus licheniformis DSM 13, complete genom...    94   5e-39   
gb:AE005674_69700 Shigella flexneri 2a str. 301, complete genome...   103   6e-39   
pir|A29778|SYECSD spermidine synthase (EC 2.5.1.16) - Escherichi...   103   6e-39   
sp|Q83MF0|SPEE_SHIFL|SPEE_SHIFL Spermidine synthase (EC 2.5.1.16) (Putresci...   103   6e-39   Shigella flexneri
sp|P09158|SPEE_ECOLI|SPEE_ECOLI Spermidine synthase (EC 2.5.1.16) (Putresci...   103   6e-39   Escherichia coli [E. coli]
pir|E85495|E85495 hypothetical protein speE [imported] - Escheri...   103   8e-39   Escherichia coli O157:H7
sp|Q8X951|SPEE_ECOL6|SPEE_ECOL6 Spermidine synthase (EC 2.5.1.16) (Putresci...   103   8e-39   
gb:CP000009_863104 Gluconobacter oxydans 621H, complete genome.       117   1e-38   
sp|Q8Z9E2|SPEE_SALTI|SPEE_SALTI Spermidine synthase (EC 2.5.1.16) (Putresci...   103   1e-38   Salmonella enterica subsp. enterica serovar Typhi
sp|P70998|SPEE_BACSU|SPEE_BACSU Spermidine synthase (EC 2.5.1.16) (Putresci...    93   1e-38   Bacillus subtilis
sp|Q81JT0|SPE1_BACAN|SPE1_BACAN Spermidine synthase 1 (EC 2.5.1.16) (Putres...    93   2e-38   Bacillus anthracis [anthrax]
gb:CP000026_75086 Salmonella enterica subsp. enterica serovar Pa...   103   2e-38   
sp|O66473|SPE1_AQUAE|SPE1_AQUAE Spermidine synthase 1 (EC 2.5.1.16) (Putres...   111   3e-38   Aquifex aeolicus
gb:BA000043_739982 Geobacillus kaustophilus HTA426 DNA, complete...    94   3e-38   
gb:BA000043_738317 Geobacillus kaustophilus HTA426 DNA, complete...    92   4e-38   
sp|Q8ZRS3|SPEE_SALTY|SPEE_SALTY Spermidine synthase (EC 2.5.1.16) (Putresci...   103   4e-38   Salmonella enterica subsp. enterica serovar Typhimurium
gb:BX957223_844837 Methanococcus maripaludis S2 complete genome;...   102   4e-38   
sp|Q814Q1|SPE1_BACCR|SPE1_BACCR Spermidine synthase 1 (EC 2.5.1.16) (Putres...    92   4e-38   Bacillus cereus
sp|Q97RA7|SPEE_STRPN|SPEE_STRPN Spermidine synthase (EC 2.5.1.16) (Putresci...   110   5e-38   
gb:CP000001_855657 Bacillus cereus ZK, complete genome.                93   5e-38   
gb:BX950851_842068 Erwinia carotovora subsp. atroseptica SCRI104...   111   1e-37   
gb:AJ749949_530888 Francisella tularensis subsp. tularensis comp...   100   1e-37   
gb:BX842656_826362 Bdellovibrio bacteriovorus complete genome, s...   105   3e-37   
gb:AF143948_482979 Pseudomonas aeruginosa putative spermidine sy...   101   7e-37   
gb:AE013680_299104 Yersinia pestis KIM section 80 of 415 of the ...   108   7e-37   
sp|Q8ZBJ8|SPEE_YERPE|SPEE_YERPE Spermidine synthase (EC 2.5.1.16) (Putresci...   108   7e-37   Yersinia pestis
gb:BX936398_835365 Yersinia pseudotuberculosis IP32953 genome, c...   107   2e-36   
gb:AY658708_2147718 Synthetic construct Peudomonas aeruginosa cl...   100   2e-36   
sp|Q9X6R0|SPE1_PSEAE|SPE1_PSEAE Spermidine synthase 1 (EC 2.5.1.16) (Putres...   100   2e-36   Pseudomonas aeruginosa
gb:AP008231_580591 Synechococcus elongatus PCC 6301 DNA, complet...    99   1e-35   
gb:AE014297_1138707 Drosophila melanogaster chromosome 3R, compl...   110   1e-35   
sp|Q891W4|SPEE_CLOTE|SPEE_CLOTE Spermidine synthase (EC 2.5.1.16) (Putresci...   101   2e-35   Clostridium tetani
sp|Q884N3|SPEE_PSESM|SPEE_PSESM Spermidine synthase (EC 2.5.1.16) (Putresci...    99   4e-35   Pseudomonas syringae pv. tomato
sp|Q9WZC2|SPEE_THEMA|SPEE_THEMA Spermidine synthase (EC 2.5.1.16) (Putresci...   103   6e-35   Thermotoga maritima
sp|Q97FX3|SPEE_CLOAB|SPEE_CLOAB Spermidine synthase (EC 2.5.1.16) (Putresci...    88   2e-34   Clostridium acetobutylicum
sp|Q7N892|SPEE_PHOLL|SPEE_PHOLL Spermidine synthase (EC 2.5.1.16) (Putresci...   102   7e-34   Photorhabdus laumondii subsp. laumondii
gb:AE017282_428774 Methylococcus capsulatus str. Bath, complete ...    86   1e-33   
sp|Q8K9T5|SPEE_BUCAP|SPEE_BUCAP Spermidine synthase (EC 2.5.1.16) (Putresci...   101   6e-32   
sp|P57305|SPEE_BUCAI|SPEE_BUCAI Spermidine synthase (EC 2.5.1.16) (Putresci...   100   5e-31   
gb:BX572101_799554 Prochlorococcus marinus MIT9313 complete geno...    88   1e-30   
sp|Q7V3X3|SPEE_PROMM|SPEE_PROMM Spermidine synthase (EC 2.5.1.16) (Putresci...    88   1e-30   Prochlorococcus marinus
sp|Q97BN7|SPEE_THEVO|SPEE_THEVO Probable spermidine synthase (EC 2.5.1.16) ...    79   1e-30   Thermoplasma volcanium
sp|Q975S5|SPEE_SULTO|SPEE_SULTO Probable spermidine synthase (EC 2.5.1.16) ...    87   2e-30   Sulfurisphaera tokodaii
sp|Q8PFQ4|SPEE_XANAC|SPEE_XANAC Spermidine synthase (EC 2.5.1.16) (Putresci...    83   2e-30   Xanthomonas citri
sp|Q87F26|SPEE_XYLFT|SPEE_XYLFT Spermidine synthase (EC 2.5.1.16) (Putresci...    86   5e-30   Xylella fastidiosa
sp|Q9PH03|SPEE_XYLFA|SPEE_XYLFA Spermidine synthase (EC 2.5.1.16) (Putresci...    86   7e-30   Xylella fastidiosa
gb:AE013598_293920 Xanthomonas oryzae pv. oryzae KACC10331, comp...    83   1e-29   
sp|Q9V277|SPEE_PYRAB|SPEE_PYRAB Probable spermidine synthase (EC 2.5.1.16) ...    82   1e-29   Pyrococcus abyssi
gb:AB198392_18215 Selenomonas ruminantium gene for putative sper...    97   2e-29   
gb:AP006878_575299 Thermococcus kodakaraensis strain KOD1 DNA, c...    84   2e-29   
sp|Q8P447|SPEE_XANCP|SPEE_XANCP Spermidine synthase (EC 2.5.1.16) (Putresci...    81   2e-29   Xanthomonas campestris pv. campestris
sp|Q9HL75|SPEE_THEAC|SPEE_THEAC Probable spermidine synthase (EC 2.5.1.16) ...    78   3e-29   Thermoplasma acidophilum
gb:AE017261_419630 Picrophilus torridus DSM 9790, complete genome.     82   5e-29   
sp|O27950|SPEE_ARCFU|SPEE_ARCFU Probable spermidine synthase (EC 2.5.1.16) ...    85   1e-28   Archaeoglobus fulgidus
sp|Q7U3L0|SPEE_SYNPX|SPEE_SYNPX Spermidine synthase (EC 2.5.1.16) (Putresci...    85   4e-28   Synechococcus sp.
gb:AE017302_436112 Thermus thermophilus HB27 section 2 of 7 of t...    92   1e-27   
sp|O57950|SPEE_PYRHO|SPEE_PYRHO Probable spermidine synthase (EC 2.5.1.16) ...    81   1e-27   Pyrococcus horikoshii
sp|Q82XD4|SPEE_NITEU|SPEE_NITEU Spermidine synthase (EC 2.5.1.16) (Putresci...    76   4e-27   Nitrosomonas europaea
sp|Q7UZI0|SPEE_PROMP|SPEE_PROMP Spermidine synthase (EC 2.5.1.16) (Putresci...    76   2e-25   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
sp|Q7V9I5|SPEE_PROMA|SPEE_PROMA Spermidine synthase (EC 2.5.1.16) (Putresci...    74   2e-25   Prochlorococcus marinus
sp|Q8U4G1|SPEE_PYRFU|SPEE_PYRFU Probable spermidine synthase (EC 2.5.1.16) ...    72   4e-25   Pyrococcus furiosus
gb:AB076744_1523518 Arabis gemmifera ACL5 gene for spermine synt...    87   2e-24   
sp|Q9YE02|SPEE_AERPE|SPEE_AERPE Probable spermidine synthase (EC 2.5.1.16) ...    83   3e-24   Aeropyrum pernix
gb:AB076737_1523511 Arabidopsis thaliana ACL5 gene for spermine ...    87   4e-24   
gb:AB076739_1523513 Arabidopsis thaliana ACL5 gene for spermine ...    87   8e-24   
gb:AB076723_1523497 Arabidopsis thaliana ACL5 gene for spermine ...    87   8e-24   
sp|Q9UXE4|SPEE_SULSO|SPEE_SULSO Probable spermidine synthase (EC 2.5.1.16) ...    77   1e-23   Saccharolobus solfataricus
gb:CP000010_866630 Burkholderia mallei ATCC 23344 chromosome 1, ...    77   2e-23   
gb:BX571965_792752 Burkholderia pseudomallei strain K96243, chro...    77   2e-23   
gb:AB076738_1523512 Arabidopsis thaliana ACL5 gene for spermine ...    87   2e-23   
gb:CR555306_106599 Azoarcus sp. EbN1 complete genome.                  67   3e-23   
gb:AB076735_1523509 Arabidopsis thaliana ACL5 gene for spermine ...    85   3e-23   
gb:AJ606077_1811954 Lycopersicon esculentum mRNA for putative sp...    86   4e-22   
gb:AY743326_1626432 Sclerotinia sclerotiorum spermidine synthase...   102   2e-20   
sp|Q9HV34|SPE2_PSEAE|SPE2_PSEAE Spermidine synthase 2 (EC 2.5.1.16) (Putres...    74   8e-20   Pseudomonas aeruginosa
gb:AP003991_1836038 Oryza sativa (japonica cultivar-group) genom...    81   1e-19   
sp|Q8ZXM4|SPEE_PYRAE|SPEE_PYRAE Probable spermidine synthase (EC 2.5.1.16) ...    76   1e-19   Pyrobaculum aerophilum
gb:AB004325_1509074 Nicotiana sylvestris NsPMT2 mRNA for putresc...    92   4e-17   
sp|Q8R977|SPE2_THETN|SPE2_THETN Spermidine synthase 2 (EC 2.5.1.16) (Putres...    67   4e-13   Caldanaerobacter subterraneus subsp. tengcongensis
gb:AB096270_1525480 Cryptomeria japonica Acl5 gene for putative ...    77   1e-12   
gb:AB096606_1525816 Taxodium distichum Acl5 gene for putative sp...    77   1e-12   
gb:AY550925_1431356 Sus scrofa spermidine synthase mRNA, partial...    75   4e-12   
sp|Q7TY95|SPEE_MYCBO|SPEE_MYCBO Probable spermidine synthase (EC 2.5.1.16) ...    47   2e-11   Mycobacterium tuberculosis variant bovis
gb:AF055854_474048 Synechococcus PCC7002 clone SK1.4E15 spermidi...    73   2e-11   
gb:BA000036_720429 Corynebacterium glutamicum ATCC 13032 DNA, co...    45   4e-10   
gb:AE017230_411736 Mycobacterium avium subsp. paratuberculosis s...    48   6e-10   
sp|Q815E8|SPE2_BACCR|SPE2_BACCR Spermidine synthase 2 (EC 2.5.1.16) (Putres...    56   9e-10   Bacillus cereus
sp|Q9L091|SPE1_STRCO|SPE1_STRCO Probable spermidine synthase 1 (EC 2.5.1.16...    49   2e-08   Streptomyces coelicolor
gb:AP006618_559891 Nocardia farcinica IFM 10152 DNA, complete ge...    43   2e-08   
gb:CP000001_855495 Bacillus cereus ZK, complete genome.                59   4e-07   
gb:AE017288_432668 Leptospira interrogans serovar Copenhageni st...    58   5e-07   
sp|Q8EZP1|SPE1_LEPIN|SPE1_LEPIN Probable spermidine synthase 1 (EC 2.5.1.16...    57   9e-07   Leptospira interrogans
gb:AE017355_466175 Bacillus thuringiensis serovar konkukian str....    55   3e-06   
sp|Q81X05|SPE2_BACAN|SPE2_BACAN Spermidine synthase 2 (EC 2.5.1.16) (Putres...    55   3e-06   Bacillus anthracis [anthrax]
sp|O67365|SPE2_AQUAE|SPE2_AQUAE Probable spermidine synthase 2 (EC 2.5.1.16...    41   4e-06   Aquifex aeolicus
sp|Q9X8S2|SPE2_STRCO|SPE2_STRCO Probable spermidine synthase 2 (EC 2.5.1.16...    40   7e-06   Streptomyces coelicolor
sp|Q8CV14|SPEE_OCEIH|SPEE_OCEIH Probable spermidine synthase (EC 2.5.1.16) ...    54   1e-05   Oceanobacillus iheyensis
gb:AE017282_427807 Methylococcus capsulatus str. Bath, complete ...    40   4e-04   
gb:TFL009863_2580551 Tetraodon fluviatilis mRNA for spermine syn...    48   5e-04   
gb:FRU009865_2572056 Fugu rubripes spermine synthase gene.             48   5e-04   
sp|Q7M7Q6|SPEE_WOLSU|SPEE_WOLSU Spermidine synthase (EC 2.5.1.16) (Putresci...    48   7e-04   Wolinella succinogenes
sp|Q7UWD1|SPEE_RHOBA|SPEE_RHOBA Probable spermidine synthase (EC 2.5.1.16) ...    48   7e-04   Rhodopirellula baltica
sp|Q8FMF7|SPEE_COREF|SPEE_COREF Probable spermidine synthase (EC 2.5.1.16) ...    47   0.002   Corynebacterium efficiens
gb:CR555306_109097 Azoarcus sp. EbN1 complete genome.                  34   0.002   
sp|Q82EU4|SPEE_STRAW|SPEE_STRAW Probable spermidine synthase (EC 2.5.1.16) ...    46   0.002   Streptomyces avermitilis
gb:CR522870_101952 Desulfotalea psychrophila LSv54 chromosome.         37   0.005   
gb:MMAJ87_2114100 Mus musculus gene encoding spermine synthase, ...    44   0.013   
gb:AF136179_2055933 Mus musculus spermine synthase gene, partial...    44   0.013   
gb:U53331_2042627 Homo sapiens cosmid clone U129A10 from Xp22.1-...    44   0.013   
pir|S54160|S54160 spermine synthase (EC 2.5.1.22) - human>gb:HSS...    44   0.013   Homo sapiens [man]
sp|P97355|SPSY_MOUSE|SPSY_MOUSE Spermine synthase (EC 2.5.1.22) (Spermidine...    44   0.013   Mus musculus [mouse]
sp|P52788|SPSY_HUMAN|SPSY_HUMAN Spermine synthase (EC 2.5.1.22) (Spermidine...    44   0.013   Homo sapiens [man]
gb:AK049787_1168968 Mus musculus 12 days embryo spinal cord cDNA...    42   0.039   
gb:AE017180_400795 Geobacter sulfurreducens PCA, complete genome.      42   0.039   
gb:NSY271871_1691219 Nicotiana sylvestris Ext1.2A gene for putat...    21   0.096   
gb:AE013598_295289 Xanthomonas oryzae pv. oryzae KACC10331, comp...    40   0.11    
gb:AE017149_391452 Helicobacter hepaticus ATCC 51449 section 6 o...    40   0.19    
gb:AE008919_246251 Uncultured proteobacterium BAC EBAC000-65D09 ...    39   0.25    
gb:AB020666_1865264 Homo sapiens mRNA for KIAA0859 protein, part...    34   0.35    
gb:BC029083_1979401 Homo sapiens KIAA0859, transcript variant 1,...    34   0.35    
gb:AF132936_1885523 Homo sapiens CGI-01 protein mRNA, complete cds.    34   0.35    
gb:HS612B18_1999150 Human DNA sequence from clone RP4-612B18 on ...    34   0.35    
gb:AX881035_1478518 Sequence 15940 from Patent EP1074617.              34   0.35    
gb:HS612B18_1999149 Human DNA sequence from clone RP4-612B18 on ...    34   0.36    
gb:BC006814_1970412 Homo sapiens KIAA0859, mRNA (cDNA clone IMAG...    34   0.37    
sp|Q8XQC8|SPE2_RALSO|SPE2_RALSO Probable spermidine synthase 2 (EC 2.5.1.16...    38   0.56    Ralstonia solanacearum
sp|Q8XQC5|SPE1_RALSO|SPE1_RALSO Probable spermidine synthase 1 (EC 2.5.1.16...    38   0.56    Ralstonia solanacearum
gb:AF145038_483114 Streptomyces spectabilis glycosyltransferase ...    37   0.96    
gb:AE012474_282765 Xanthomonas campestris pv. campestris str. AT...    37   0.96    
gb:AX879853_1478013 Sequence 14758 from Patent EP1074617.              35   0.97    
gb:AX876151_1476393 Sequence 11056 from Patent EP1074617.              35   1.0     
gb:AX877044_1476810 Sequence 11949 from Patent EP1074617.>gb:AK0...    34   1.6     
sp|Q7MF74|SPEE_VIBVY|SPEE_VIBVY Spermidine synthase (EC 2.5.1.16) (Putresci...    37   1.6     Vibrio vulnificus
sp|Q8D3Q3|SPEE_VIBVU|SPEE_VIBVU Spermidine synthase (EC 2.5.1.16) (Putresci...    37   1.6     Vibrio vulnificus
gb:HS612B18_1999151 Human DNA sequence from clone RP4-612B18 on ...    34   1.7     
gb:AP006618_560183 Nocardia farcinica IFM 10152 DNA, complete ge...    36   2.1     
sp|Q7NQK7|SPEE_CHRVO|SPEE_CHRVO Spermidine synthase (EC 2.5.1.16) (Putresci...    36   2.1     Chromobacterium violaceum
gb:CQ783942_1452704 Sequence 4082 from Patent EP1396543.>gb:AK07...    34   2.8     
gb:U70376_207822 Streptomyces flavopersicus spectinomycin biosyn...    36   2.8     
gb:AY458648_620088 Uncultured bacterium 581 clone EBAC000-69B03 ...    35   6.2     


>sp|Q9ZUB3|SPD1_ARATH Spermidine synthase 1 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 1) (SPDSY 1).>pir|F86372|F86372
            Spermidine synthase (EC 2.5.1.16) [imported] -
            Arabidopsis thaliana>gb:AE005172_891334 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:ATH251296_1552169 Arabidopsis thaliana mRNA
            for spermidine synthase 1 (spdSyn1
            gene).>gb:ATH252215_1552198 Arabidopsis thaliana spdsyn1
            gene for spermidine synthase, exons
            1-9.>gb:AY062593_1565249 Arabidopsis thaliana Strong
            similarity to spermidine synthase (At1g23820; F5O8.38)
            mRNA, complete cds.>gb:AY093360_1575314 Arabidopsis
            thaliana strong similarity to spermidine synthase
            (At1g23820) mRNA, complete cds.>gb:F5O8_1678448
            Arabidopsis thaliana chromosome 1 BAC F5O8 sequence,
            complete sequence.
          Length = 334

 Score =  292 bits (748), Expect(2) = e-149
 Identities = 141/166 (84%), Positives = 155/166 (93%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV L IGDGVAFLKN AEG+YDAVIVDSSDPIGPA+ELFEKPFFQ+VARALRPG
Sbjct: 169  IGYEDPRVNLVIGDGVAFLKNAAEGSYDAVIVDSSDPIGPAKELFEKPFFQSVARALRPG 228

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAES+WLHM IIE+IV+NCR+IFKGSVNYAWT+VPTYPSGVIGFMLCSTEGP VD
Sbjct: 229  GVVCTQAESLWLHMDIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFMLCSTEGPDVD 288

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKA 1386
            FKHP+NPIDE++ +KS  PLKFYN+EIHSAAFCLPSFAKKVIESKA
Sbjct: 289  FKHPLNPIDESS-SKSNGPLKFYNAEIHSAAFCLPSFAKKVIESKA 333



 Score =  262 bits (669), Expect(2) = e-149
 Identities = 129/177 (72%), Positives = 150/177 (84%), Gaps = 2/177 (1%)
 Frame = +3

Query: 390 VKRQREDGQNGESVSVEMEDXXXXXXXXXXGDKGEQ--CFSSVIPGWFSEISPMWPGEAH 563
           +KR RE+  NG + ++E E+          GD+ ++  CFS+VIPGWFSE+SPMWPGEAH
Sbjct: 11  LKRPREEDDNGGAATMETEN----------GDQKKEPACFSTVIPGWFSEMSPMWPGEAH 60

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           SLKVEK+LF+GKSDYQDV+VFQS+TYGKVLVLDGVIQ+TERDECAYQEMITHLPLCSIPN
Sbjct: 61  SLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIPN 120

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPPCN 914
           PKKVLVI      VLREVARHAS++QID+CEIDKMVVDV+KQFFPDVA+GYEDP  N
Sbjct: 121 PKKVLVIGGGDGGVLREVARHASIEQIDMCEIDKMVVDVSKQFFPDVAIGYEDPRVN 177



>sp|Q9ZS45|SPDE_LYCES Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>gb:LES6414_1684624
            Lycopersicon esculentum mRNA for spermidine synthase.
          Length = 342

 Score =  294 bits (753), Expect(2) = e-148
 Identities = 140/167 (83%), Positives = 153/167 (91%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGDGVAFLKNV  GTYDAVIVDSSDPIGPAQELFEKPFF+++A+ALRPG
Sbjct: 176  VGYEDPRVNLHIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFESIAKALRPG 235

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVV TQAESIWLHMHIIE IVANCRQIFKGSVNYAWTTVPTYPSG+IGFMLCSTEGPAVD
Sbjct: 236  GVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPAVD 295

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FK+PINPID+ + AKS  PLKFYNSEIH A+FCLPSFAK+VIE+K +
Sbjct: 296  FKNPINPIDDESPAKSIEPLKFYNSEIHQASFCLPSFAKRVIETKGK 342



 Score =  256 bits (654), Expect(2) = e-148
 Identities = 131/180 (72%), Positives = 144/180 (80%)
 Frame = +3

Query: 375 GGELPVKRQREDGQNGESVSVEMEDXXXXXXXXXXGDKGEQCFSSVIPGWFSEISPMWPG 554
           G ELPVKR RE     E    EME            ++     SSV+PGWFSEISP+WPG
Sbjct: 11  GTELPVKRPRE-----EEAETEME-AANNSNNGCEKEESSPYISSVLPGWFSEISPLWPG 64

Query: 555 EAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCS 734
           EAHSLKVEK+LF+GKSDYQ+V+VFQSSTYGKVLVLDGVIQ+TERDECAYQEMITHLPLCS
Sbjct: 65  EAHSLKVEKILFQGKSDYQNVLVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCS 124

Query: 735 IPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPPCN 914
           IPNPKKVLVI      VLREV+RH+SV+QIDICEIDKMVV+VAKQFFPDVAVGYEDP  N
Sbjct: 125 IPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVAKQFFPDVAVGYEDPRVN 184



>sp|Q96557|SPD2_DATST Spermidine synthase 2 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 2) (SPDSY 2).>gb:DSSS2_1676161
            D.stramonium mRNA for spermidine synthase 2.
          Length = 317

 Score =  291 bits (746), Expect(2) = e-147
 Identities = 138/167 (82%), Positives = 152/167 (91%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGDGVAFLKNV  GTYDAVIVDSSDPIGPAQELFEKPFF+T+ARALRPG
Sbjct: 151  VGYEDPRVNLHIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFETIARALRPG 210

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVV TQAESIWLHMHIIE IVANCR+IFKGSVNYAWTTVPTYPSG+IGFMLCSTEGPAVD
Sbjct: 211  GVVSTQAESIWLHMHIIEEIVANCREIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPAVD 270

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FK+PINPID+ +  ++  PLKFYNSEIH A+FCLPSFAK+VIE+K +
Sbjct: 271  FKNPINPIDDESHGQTIGPLKFYNSEIHQASFCLPSFAKRVIETKGK 317



 Score =  255 bits (651), Expect(2) = e-147
 Identities = 122/144 (84%), Positives = 132/144 (91%)
 Frame = +3

Query: 483 DKGEQCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLD 662
           DK   C SSV+PGWFSEISP+WPGEAHSLKVEK+LF+GKSDYQDVMVFQS+TYGKVLVLD
Sbjct: 16  DKESPCISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQDVMVFQSTTYGKVLVLD 75

Query: 663 GVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEID 842
           GVIQ+TERDECAYQEMITHLPLCSIPNPKKVLVI      VLREV+RH+SV+QIDICEID
Sbjct: 76  GVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEID 135

Query: 843 KMVVDVAKQFFPDVAVGYEDPPCN 914
           KMVV+VAKQFFPDVAVGYEDP  N
Sbjct: 136 KMVVEVAKQFFPDVAVGYEDPRVN 159



>sp|O82147|SPDE_COFAR Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>gb:AB015599_1512705
            Coffea arabica mRNA for spermidine synthase, complete
            cds.
          Length = 316

 Score =  302 bits (773), Expect(2) = e-147
 Identities = 148/168 (88%), Positives = 157/168 (93%), Gaps = 2/168 (1%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGDGVAFLK V EGTYDA+IVDSSDPIGPAQELFEKPFF++VA+ALRPG
Sbjct: 149  VGFEDPRVVLHIGDGVAFLKAVPEGTYDAIIVDSSDPIGPAQELFEKPFFESVAKALRPG 208

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHMHIIE+IVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGP VD
Sbjct: 209  GVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPPVD 268

Query: 1249 FKHPINPIDEANDAKSKS--PLKFYNSEIHSAAFCLPSFAKKVIESKA 1386
            FKHPINPID AND +SK+  PLKFYNSEIHSAAFCLPSFAKKVI+SKA
Sbjct: 269  FKHPINPID-ANDGRSKTMKPLKFYNSEIHSAAFCLPSFAKKVIDSKA 315



 Score =  244 bits (622), Expect(2) = e-147
 Identities = 118/134 (88%), Positives = 126/134 (94%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           SSVIPGWFSEISPMWPGEAHSLKVEK+LF+GKSDYQ+VMVFQSSTYGKVLVLDGVIQ+TE
Sbjct: 21  SSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTE 80

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDECAYQEMI HLPLCSIP+PKKVLVI      VLREVARH SV+QIDICEIDKMVVDV+
Sbjct: 81  RDECAYQEMIAHLPLCSIPSPKKVLVIGGGDGGVLREVARHLSVEQIDICEIDKMVVDVS 140

Query: 864 KQFFPDVAVGYEDP 905
           KQFFPDVAVG+EDP
Sbjct: 141 KQFFPDVAVGFEDP 154



>gb:STU345003_1723068 Solanum tuberosum mRNA for spermidine synthase
            (SpdSy gene).
          Length = 347

 Score =  289 bits (739), Expect(2) = e-146
 Identities = 137/167 (82%), Positives = 151/167 (90%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV L IGDGVAFLKNV  GTYDAVIVDSSDPIGPAQELFEKPFF+++A+ALRPG
Sbjct: 181  VGYEDPRVNLRIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFESIAKALRPG 240

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVV TQAESIWLHMHIIE IVANCRQIFKGSVNYAWTTVPTYPSG+IGFMLCSTEGPAVD
Sbjct: 241  GVVATQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPAVD 300

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FK+PINPID+ +  K+  PLKFYNSEIH A+FCLPSFAK+VIE+K +
Sbjct: 301  FKNPINPIDDESPVKTIEPLKFYNSEIHQASFCLPSFAKRVIETKGK 347



 Score =  255 bits (652), Expect(2) = e-146
 Identities = 131/182 (71%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +3

Query: 375 GGELPVKRQREDGQNGESVSVEMEDXXXXXXXXXXGDKGEQC--FSSVIPGWFSEISPMW 548
           G ELPVKR RE+    E   +E  +           +K E     SSV+PGWFSEISP+W
Sbjct: 11  GTELPVKRPREEEAETE---MEAANNSNNNNGCSTNEKEEPSPYISSVLPGWFSEISPLW 67

Query: 549 PGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPL 728
           PGEAHSLKVEK+LF+GKSDYQ+V+VFQSSTYGKVLVLDGVIQ+TERDECAYQEMITHLPL
Sbjct: 68  PGEAHSLKVEKILFQGKSDYQNVLVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPL 127

Query: 729 CSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
           CSIPNPKKVLVI      VLREV+RH+SV+QIDICEIDKMVV+VAKQFFPDVAVGYEDP 
Sbjct: 128 CSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVAKQFFPDVAVGYEDPR 187

Query: 909 CN 914
            N
Sbjct: 188 VN 189



>gb:AB072915_1523119 Malus x domestica MdSPDS1 mRNA forspermidine
            synthase, complete cds.
          Length = 335

 Score =  291 bits (744), Expect(2) = e-146
 Identities = 141/167 (84%), Positives = 152/167 (91%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRVTLH+GDGVAFLK V  GTYDAVIVDSSDPIGPA+ELFEKPFFQTVA ALRPG
Sbjct: 174  IGYEDPRVTLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAKELFEKPFFQTVANALRPG 233

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHMHIIE+IVANCR+IFKGSVNYAWTTVPTYPSGVIGFMLCSTEG AVD
Sbjct: 234  GVVCTQAESIWLHMHIIEDIVANCREIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGTAVD 293

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FKHP+N IDE     SK PL+FYNSEIH+AAFCLPSFAKKVI++KA+
Sbjct: 294  FKHPVNSIDE-----SKRPLRFYNSEIHTAAFCLPSFAKKVIDAKAK 335



 Score =  251 bits (641), Expect(2) = e-146
 Identities = 126/178 (70%), Positives = 145/178 (81%), Gaps = 3/178 (1%)
 Frame = +3

Query: 381 ELPVKRQREDGQNGESVS---VEMEDXXXXXXXXXXGDKGEQCFSSVIPGWFSEISPMWP 551
           + PVKR RE+ +NG + +   V ME           G K     S+VIPGWFSEIS MWP
Sbjct: 11  DFPVKRPREEEENGSAAAASAVSMEPD---------GGKEPDSVSAVIPGWFSEISSMWP 61

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           GEAHSLK+EK+LF+GKSDYQ+VMVFQS+TYGKVLVLDGVIQ+TERDECAYQEMITHLPLC
Sbjct: 62  GEAHSLKIEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLC 121

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           SIPNPKKVLVI      VLREVAR+ASV++IDICEIDKMV+DV+KQFFP+VA+GYEDP
Sbjct: 122 SIPNPKKVLVIGGGDGGVLREVARYASVEKIDICEIDKMVIDVSKQFFPEVAIGYEDP 179



>sp|Q96556|SPD1_DATST Spermidine synthase 1 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 1) (SPDSY 1).>gb:DSSS1_1676160
            D.stramonium mRNA for spermidine synthase 1.
          Length = 308

 Score =  298 bits (763), Expect(2) = e-146
 Identities = 143/168 (85%), Positives = 157/168 (93%), Gaps = 1/168 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LH+GDGVAFLK VAEGTYDAVIVDSSDPIGPAQELFEKPFF++VARALRPG
Sbjct: 141  IGYEDPRVKLHVGDGVAFLKFVAEGTYDAVIVDSSDPIGPAQELFEKPFFESVARALRPG 200

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHMHIIE+IVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD
Sbjct: 201  GVVCTQAESIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 260

Query: 1249 FKHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FK+PINP+D + +  K++ PLKFYNSEIHSA+FCLPSFAK+VIESK +
Sbjct: 261  FKNPINPVDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIESKGK 308



 Score =  244 bits (622), Expect(2) = e-146
 Identities = 114/141 (80%), Positives = 130/141 (92%)
 Frame = +3

Query: 483 DKGEQCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLD 662
           +K     SS++PGWFSEISP+WPGEAHSLKVEK+LF+GKSDYQ+VMVFQSSTYGKVL+LD
Sbjct: 6   NKESPYISSILPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLILD 65

Query: 663 GVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEID 842
           GVIQ+TERDECAYQEMITHLPLCSIPNPKKVLVI      VLREV+RH+SV+QIDICEID
Sbjct: 66  GVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEID 125

Query: 843 KMVVDVAKQFFPDVAVGYEDP 905
           KMV+DV+KQFFP+VA+GYEDP
Sbjct: 126 KMVIDVSKQFFPNVAIGYEDP 146



>sp|Q9ZTR1|SPD1_PEA Spermidine synthase 1 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 1) (SPDSY 1).>gb:AF043108_1763673
            Pisum sativum spermidine synthase 1 (SPDSYN1) mRNA,
            complete cds.
          Length = 334

 Score =  291 bits (744), Expect(2) = e-146
 Identities = 137/165 (83%), Positives = 150/165 (90%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRVTL+IGDGVAFLK   EGTYDAVIVDSSDPIGPAQELFEKPFF++VARALRPG
Sbjct: 168  VGFADPRVTLNIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEKPFFESVARALRPG 227

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHMHIIE+IV NCRQ+FKGSVNYAWTTVPTYPSG+IGFMLCSTEGP+VD
Sbjct: 228  GVVCTQAESIWLHMHIIEDIVVNCRQVFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPSVD 287

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
            FKHP+NPIDE +  ++  PLKFYN EIHSAAFCLPSFAK+ I SK
Sbjct: 288  FKHPVNPIDENDSQQAARPLKFYNREIHSAAFCLPSFAKRAIASK 332



 Score =  251 bits (640), Expect(2) = e-146
 Identities = 125/173 (72%), Positives = 141/173 (81%)
 Frame = +3

Query: 387 PVKRQREDGQNGESVSVEMEDXXXXXXXXXXGDKGEQCFSSVIPGWFSEISPMWPGEAHS 566
           P+KRQRED  NG S ++  E                   SSVIPGWFSEISPMWPGEAHS
Sbjct: 14  PLKRQREDEVNGVSDTLSKEPQPNG-------------LSSVIPGWFSEISPMWPGEAHS 60

Query: 567 LKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNP 746
           LKVEK+LF+GKSDYQDVMVFQS+TYGKVL+LDGVIQ+TERDECAYQEMITHLPLCSIPNP
Sbjct: 61  LKVEKILFQGKSDYQDVMVFQSATYGKVLILDGVIQLTERDECAYQEMITHLPLCSIPNP 120

Query: 747 KKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           KKVLVI      VLREVARH+SV++IDICEIDKMVVDV+K++FPD+AVG+ DP
Sbjct: 121 KKVLVIGGGDGGVLREVARHSSVEKIDICEIDKMVVDVSKEYFPDIAVGFADP 173



>sp|O48658|SPD1_HYONI Spermidine synthase 1 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 1) (SPDSY 1).>gb:AB006690_1509806
            Hyoscyamus niger mRNA for spermidine synthase 1, complete
            cds.
          Length = 315

 Score =  294 bits (752), Expect(2) = e-145
 Identities = 140/167 (83%), Positives = 153/167 (91%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGDGVAFLKNV  GTYDAVIVDSSDPIGPAQELFEKPFF+++ARALRPG
Sbjct: 149  VGYEDPRVNLHIGDGVAFLKNVPAGTYDAVIVDSSDPIGPAQELFEKPFFESIARALRPG 208

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVV TQAESIWLHMHIIE IVANCRQIFKGSVNYAWTTVPTYPSG+IGFMLCSTEGPAVD
Sbjct: 209  GVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPAVD 268

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FK+PINPID+ +  K+ +PLKFYNSEIH A+FCLPSFAK+VIESK +
Sbjct: 269  FKNPINPIDDESGPKTIAPLKFYNSEIHQASFCLPSFAKRVIESKGK 315



 Score =  247 bits (631), Expect(2) = e-145
 Identities = 119/144 (82%), Positives = 131/144 (90%)
 Frame = +3

Query: 483 DKGEQCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLD 662
           +K     SSV+PGWFSEISP+WPGEAHSLKVEK+LF+GKSDYQ+VMVFQSSTYGKVLVLD
Sbjct: 14  EKESPYISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLD 73

Query: 663 GVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEID 842
           GVIQ+TERDECAYQEMITHLPLCSIPNPKKVLVI      VLREV+RH+SV+QIDICEID
Sbjct: 74  GVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEID 133

Query: 843 KMVVDVAKQFFPDVAVGYEDPPCN 914
           KMVV+VAK+FFPDVAVGYEDP  N
Sbjct: 134 KMVVEVAKEFFPDVAVGYEDPRVN 157



>gb:AB072916_1523120 Malus x domestica MdSPDS2a mRNA forspermidine
            synthase, complete cds.
          Length = 335

 Score =  285 bits (728), Expect(2) = e-145
 Identities = 138/167 (82%), Positives = 150/167 (89%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV+LH+GDGVAFLK V  GTYDAVIVDSSDPIGPA+ELFEKPFFQTVA ALRPG
Sbjct: 174  IGYDDPRVSLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAKELFEKPFFQTVANALRPG 233

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHM IIE+IV NCR++FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD
Sbjct: 234  GVVCTQAESIWLHMDIIEDIVENCREVFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 293

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FKHP+N ID      SK PLKFYNSEIH+AAFCLPSFAKKVI++KA+
Sbjct: 294  FKHPVNSID-----ASKRPLKFYNSEIHTAAFCLPSFAKKVIDAKAK 335



 Score =  256 bits (653), Expect(2) = e-145
 Identities = 126/175 (72%), Positives = 143/175 (81%)
 Frame = +3

Query: 381 ELPVKRQREDGQNGESVSVEMEDXXXXXXXXXXGDKGEQCFSSVIPGWFSEISPMWPGEA 560
           +LP+KR RE+ +NG       E           G K     S+VIPGWFSEISPMWPGEA
Sbjct: 11  DLPLKRPREEEENGA------EAAASAVSMETDGGKEPDSVSAVIPGWFSEISPMWPGEA 64

Query: 561 HSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIP 740
           HSLK+EK+LF+GKSDYQ+VMVFQS+TYGKVLVLDGVIQ+TERDECAYQEMITHLPLCSIP
Sbjct: 65  HSLKIEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIP 124

Query: 741 NPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           NPKKVLVI      VLREVAR+ASV++IDICEIDKMVVDV+KQFFPDVA+GY+DP
Sbjct: 125 NPKKVLVIGGGDGGVLREVARYASVEKIDICEIDKMVVDVSKQFFPDVAIGYDDP 179



>sp|O48659|SPD2_HYONI Spermidine synthase 2 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 2) (SPDSY 2).>gb:AB006691_1509807
            Hyoscyamus niger mRNA for spermidine synthase 2, complete
            cds.
          Length = 308

 Score =  295 bits (756), Expect(2) = e-145
 Identities = 142/168 (84%), Positives = 156/168 (92%), Gaps = 1/168 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LH+GDGVAFLKNV EGTYDAVIVDSSDPIGPAQELFEKPFF++VARAL PG
Sbjct: 141  IGYEDPRVKLHVGDGVAFLKNVPEGTYDAVIVDSSDPIGPAQELFEKPFFESVARALCPG 200

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHMHIIE+IV+NCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD
Sbjct: 201  GVVCTQAESIWLHMHIIEDIVSNCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 260

Query: 1249 FKHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FK+PINPID + +  K++ PLKFYNSEIHSA+FCLPSFAK+VIES A+
Sbjct: 261  FKNPINPIDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIESNAK 308



 Score =  243 bits (620), Expect(2) = e-145
 Identities = 114/142 (80%), Positives = 130/142 (91%)
 Frame = +3

Query: 480 GDKGEQCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVL 659
           G+      SS++PGWFSEISP+WPGEAHSLKVEK+LF+GKSDYQ+V+VFQSSTYGKVLVL
Sbjct: 5   GNNESAYISSILPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVVVFQSSTYGKVLVL 64

Query: 660 DGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEI 839
           DGVIQ+TERDECAYQEMITHLPLCSIPNPKKVLVI      VLREV+RH+SV+QIDICEI
Sbjct: 65  DGVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEI 124

Query: 840 DKMVVDVAKQFFPDVAVGYEDP 905
           DKMV+DV+KQFFP+VA+GYEDP
Sbjct: 125 DKMVIDVSKQFFPNVAIGYEDP 146



>sp|O48660|SPDE_NICSY Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase)
            (Aminopropyltransferase).>pir|T15045|T15045 spermidine
            synthase (EC 2.5.1.16) - wood tobacco>gb:AB006692_1509808
            Nicotiana sylvestris mRNA for spermidine synthase,
            complete cds.
          Length = 314

 Score =  291 bits (745), Expect(2) = e-144
 Identities = 140/168 (83%), Positives = 154/168 (91%), Gaps = 1/168 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGDGVAFLKNVA GTYDAVIVDSSDPIGPAQELFEKPFF+++ARALRPG
Sbjct: 147  VGYEDPRVNLHIGDGVAFLKNVAAGTYDAVIVDSSDPIGPAQELFEKPFFESIARALRPG 206

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVV TQAESIWLHMHIIE IVANCRQIFKGSVNYAWTTVPTYPSG+IGFMLCSTEGPAVD
Sbjct: 207  GVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPAVD 266

Query: 1249 FKHPINPI-DEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FK+PINPI D+A+  K+  P+KFYNSE+H A+FCLPSFAK+VIESK +
Sbjct: 267  FKNPINPIDDDASHNKTLGPMKFYNSELHKASFCLPSFAKRVIESKGK 314



 Score =  244 bits (624), Expect(2) = e-144
 Identities = 117/137 (85%), Positives = 128/137 (93%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           SSV+PGWFSEISP+WPGEAHSLKVEK+LF+GKSDYQ+VMVFQSSTYGKVLVLDGVIQ+TE
Sbjct: 19  SSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTE 78

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDECAYQEMI HLPLCSIPNPKKVLVI      VLREV+RH+SV+QIDICEIDKMVV+V+
Sbjct: 79  RDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVS 138

Query: 864 KQFFPDVAVGYEDPPCN 914
           KQFFPDVAVGYEDP  N
Sbjct: 139 KQFFPDVAVGYEDPRVN 155



>sp|Q9SMB1|SPD1_ORYSA Spermidine synthase 1 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 1) (SPDSY 1).>gb:OSA251298_1692415
            Oryza sativa mRNA for spermidine synthase 1 (spdSyn1
            gene).>gb:AP004305_1839908 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0492E07.
          Length = 323

 Score =  293 bits (749), Expect(2) = e-143
 Identities = 143/167 (85%), Positives = 151/167 (90%), Gaps = 1/167 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV+LHIGDGVAFLKN  EGTYDAVIVDSSDPIGPAQELFEKPFFQ+VARALRPG
Sbjct: 156  VGFEDPRVSLHIGDGVAFLKNAPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVARALRPG 215

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHMHIIE+IVANCRQ+FKGSVNYAWTTVPTYPSGVIGFMLCSTEGP VD
Sbjct: 216  GVVCTQAESIWLHMHIIEDIVANCRQVFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPTVD 275

Query: 1249 FKHPI-NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKA 1386
            F+HPI N  D     KSK PLKFYNSEIHSA+FCLPSFAK+VI SKA
Sbjct: 276  FQHPIFNIEDNEFSTKSKGPLKFYNSEIHSASFCLPSFAKRVIGSKA 322



 Score =  239 bits (609), Expect(2) = e-143
 Identities = 117/140 (83%), Positives = 129/140 (92%), Gaps = 1/140 (0%)
 Frame = +3

Query: 489 GEQC-FSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDG 665
           GEQ   S+VIPGWFSEISPMWPGEAHSLKVEK+LF+GKSDYQ+VMVFQSSTYGKVLVLDG
Sbjct: 22  GEQAGISAVIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQNVMVFQSSTYGKVLVLDG 81

Query: 666 VIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDK 845
           VIQ+TERDECAYQEMITHLPLCSI +PKKVLVI      VLREV+RH+SV+QIDICEIDK
Sbjct: 82  VIQVTERDECAYQEMITHLPLCSIKDPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDK 141

Query: 846 MVVDVAKQFFPDVAVGYEDP 905
           MVVDV+KQFFP +AVG+EDP
Sbjct: 142 MVVDVSKQFFPHLAVGFEDP 161



>sp|O48661|SPD2_ARATH Spermidine synthase 2 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 2) (SPDSY 2).>pir|T01492|T01492
            spermidine synthase homolog F17O7.16 - Arabidopsis
            thaliana>gb:AE005173_894614 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:ATH251297_1552170 Arabidopsis thaliana mRNA
            for spermidine synthase 2 (spdSyn2
            gene).>gb:BT020360_1642755 Arabidopsis thaliana At1g70310
            gene, complete cds.>gb:F17O7_1677668 Arabidopsis thaliana
            chromosome 1 BAC F17O7 complete
            sequence.>gb:AF375409_1792914 Arabidopsis thaliana
            At1g70310/F17O7_16 mRNA, complete cds.
          Length = 340

 Score =  273 bits (699), Expect(2) = e-142
 Identities = 133/167 (79%), Positives = 149/167 (89%), Gaps = 1/167 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV L IGDGVAFLKN AEGTYDAVIVDSSDPIGPA+ELFEKPFF++V RALRPG
Sbjct: 173  VGYEDPRVNLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRALRPG 232

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAES+WLHM IIE+IV+NCR IFKGSVNYAWT+VPTYPSGVIGFMLCS+EGP VD
Sbjct: 233  GVVCTQAESLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPSGVIGFMLCSSEGPQVD 292

Query: 1249 FKHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKA 1386
            FK P++ ID + +  KS  PLK+YN+EIHSAAFCLPSFAKKVI+SKA
Sbjct: 293  FKKPVSLIDTDESSIKSHCPLKYYNAEIHSAAFCLPSFAKKVIDSKA 339



 Score =  257 bits (657), Expect(2) = e-142
 Identities = 129/178 (72%), Positives = 145/178 (81%)
 Frame = +3

Query: 381 ELPVKRQREDGQNGESVSVEMEDXXXXXXXXXXGDKGEQCFSSVIPGWFSEISPMWPGEA 560
           +LPVKR RE  ++    ++E E+            K   C SS+IPGWFSEISPMWPGEA
Sbjct: 11  DLPVKRPREAEEDNNGGAMETENGGGEI-------KEPSCMSSIIPGWFSEISPMWPGEA 63

Query: 561 HSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIP 740
           HSLKVEK+LF+GKSDYQDV+VFQS+TYGKVLVLDGVIQ+TERDECAYQEMITHLPLCSI 
Sbjct: 64  HSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLCSIS 123

Query: 741 NPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPPCN 914
           NPKKVLVI      VLREVARH+SV+QIDICEIDKMVVDVAKQ+FP+VAVGYEDP  N
Sbjct: 124 NPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVAKQYFPNVAVGYEDPRVN 181



>sp|Q9ZTR0|SPD2_PEA Spermidine synthase 2 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 2) (SPDSY 2).>gb:AF043109_1763674
            Pisum sativum spermidine synthase 2 (SPDSYN2) mRNA,
            complete cds.
          Length = 342

 Score =  285 bits (730), Expect(2) = e-141
 Identities = 137/165 (83%), Positives = 148/165 (89%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRVTL IGDGVAFLK   EGTYDAVIVDSSDPIGPAQELFEKPFFQ+VARALRPG
Sbjct: 176  VGFNDPRVTLRIGDGVAFLKAAPEGTYDAVIVDSSDPIGPAQELFEKPFFQSVARALRPG 235

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+CTQAESIWLHM IIE+IV+NCR IFKGSVNYAWTTVPTYPSG+IGFMLCSTEGP VD
Sbjct: 236  GVMCTQAESIWLHMDIIEDIVSNCRHIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGPLVD 295

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
            FKHP+NPID+ +  KS  PLKFYNSEIH+AAFCLPSFAK+ I SK
Sbjct: 296  FKHPVNPIDQKDCQKSVRPLKFYNSEIHTAAFCLPSFAKRKIGSK 340



 Score =  240 bits (612), Expect(2) = e-141
 Identities = 123/177 (69%), Positives = 139/177 (78%), Gaps = 2/177 (1%)
 Frame = +3

Query: 381 ELPVKRQREDGQ--NGESVSVEMEDXXXXXXXXXXGDKGEQCFSSVIPGWFSEISPMWPG 554
           E  +K  R+D +  NG SVS    D           D      SSVIPGWFSEISPMWPG
Sbjct: 10  ESSMKEHRDDDEKSNGFSVSAVSMDVEGGDK-----DPSGNGVSSVIPGWFSEISPMWPG 64

Query: 555 EAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCS 734
           EAHSLK+EK+LF+GKS+YQ VMVFQSSTYGKVLVLDGVIQ+TERDECAYQEMITHLPLCS
Sbjct: 65  EAHSLKIEKILFQGKSEYQKVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLCS 124

Query: 735 IPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           IPNPKKVLVI      VLREVARH+S+++IDICEID MVV+V+KQFFP+VAVG+ DP
Sbjct: 125 IPNPKKVLVIGGGDGGVLREVARHSSIEKIDICEIDNMVVEVSKQFFPEVAVGFNDP 181



>gb:AB100310_1526262 Petunia x hybrida spds mRNA for spermidine
            synthase, complete cds.
          Length = 316

 Score =  266 bits (681), Expect(2) = e-139
 Identities = 133/166 (80%), Positives = 144/166 (86%), Gaps = 1/166 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGDGVAFLK V  GTYDAVIVDSSDPIGPAQELFEKPFF+TVARALRPG
Sbjct: 149  VGYEDPRVNLHIGDGVAFLKAVPAGTYDAVIVDSSDPIGPAQELFEKPFFETVARALRPG 208

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVV TQAESIWLHM IIENIV NCRQIFKGSVNYAWTTVPTYPSG+IGFMLCSTEG  VD
Sbjct: 209  GVVSTQAESIWLHMDIIENIVTNCRQIFKGSVNYAWTTVPTYPSGMIGFMLCSTEGLEVD 268

Query: 1249 FKHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
            FK+P+N I+ +   +K+  PLKFYN EIH A+F LPSFAK+VIESK
Sbjct: 269  FKNPVNLIENDEIHSKTLPPLKFYNFEIHKASFALPSFAKRVIESK 314



 Score =  253 bits (645), Expect(2) = e-139
 Identities = 120/144 (83%), Positives = 132/144 (91%)
 Frame = +3

Query: 483 DKGEQCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLD 662
           DK   C SSV+PGWFSEISP+WPGEAHSLKVEK+LF+GKSDYQ+VMVFQSSTYGKVLVLD
Sbjct: 14  DKESACISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLD 73

Query: 663 GVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEID 842
           GVIQ+TERDECAYQEMITHLPLCSIPNPKKVLVI      VLREV+RH+S++QIDICEID
Sbjct: 74  GVIQLTERDECAYQEMITHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSIEQIDICEID 133

Query: 843 KMVVDVAKQFFPDVAVGYEDPPCN 914
           KMVV+V+KQFFPDVAVGYEDP  N
Sbjct: 134 KMVVEVSKQFFPDVAVGYEDPRVN 157



>gb:AB006693_1509809 Arabidopsis thaliana mRNA for spermidine
            synthase, partial cds.
          Length = 293

 Score =  273 bits (699), Expect(2) = e-135
 Identities = 133/167 (79%), Positives = 149/167 (89%), Gaps = 1/167 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV L IGDGVAFLKN AEGTYDAVIVDSSDPIGPA+ELFEKPFF++V RALRPG
Sbjct: 126  VGYEDPRVNLIIGDGVAFLKNAAEGTYDAVIVDSSDPIGPAKELFEKPFFESVNRALRPG 185

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAES+WLHM IIE+IV+NCR IFKGSVNYAWT+VPTYPSGVIGFMLCS+EGP VD
Sbjct: 186  GVVCTQAESLWLHMDIIEDIVSNCRDIFKGSVNYAWTSVPTYPSGVIGFMLCSSEGPQVD 245

Query: 1249 FKHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKA 1386
            FK P++ ID + +  KS  PLK+YN+EIHSAAFCLPSFAKKVI+SKA
Sbjct: 246  FKKPVSLIDTDESSIKSHCPLKYYNAEIHSAAFCLPSFAKKVIDSKA 292



 Score =  234 bits (597), Expect(2) = e-135
 Identities = 113/131 (86%), Positives = 122/131 (93%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WFSEISPMWPGEAHSLKVEK+LF+GKSDYQDV+VFQS+TYGKVLVLDGVIQ+TERDECAY
Sbjct: 4   WFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAY 63

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
           QEMITHLPLCSI NPKKVLVI      VLREVARH+SV+QIDICEIDKMVVDVAKQ+FP+
Sbjct: 64  QEMITHLPLCSISNPKKVLVIGGGDGGVLREVARHSSVEQIDICEIDKMVVDVAKQYFPN 123

Query: 882 VAVGYEDPPCN 914
           VAVGYEDP  N
Sbjct: 124 VAVGYEDPRVN 134



>gb:AB072917_1523121 Malus x domestica MdSPDS2b mRNA forspermidine
            synthase, complete cds.
          Length = 292

 Score =  285 bits (728), Expect(2) = e-131
 Identities = 138/167 (82%), Positives = 150/167 (89%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV+LH+GDGVAFLK V  GTYDAVIVDSSDPIGPA+ELFEKPFFQTVA ALRPG
Sbjct: 131  IGYDDPRVSLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAKELFEKPFFQTVANALRPG 190

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GVVCTQAESIWLHM IIE+IV NCR++FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD
Sbjct: 191  GVVCTQAESIWLHMDIIEDIVENCREVFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 250

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            FKHP+N ID      SK PLKFYNSEIH+AAFCLPSFAKKVI++KA+
Sbjct: 251  FKHPVNSID-----ASKRPLKFYNSEIHTAAFCLPSFAKKVIDAKAK 292



 Score =  208 bits (530), Expect(2) = e-131
 Identities = 100/118 (84%), Positives = 112/118 (94%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           GEAHSLK+EK+LF+GKSDYQ+VMVFQS+TYGKVLVLDGVIQ+TERDECAYQEMITHLPLC
Sbjct: 19  GEAHSLKIEKILFQGKSDYQNVMVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLC 78

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           SIPNPKKVLVI      VLREVAR+ASV++IDICEIDKMVVDV+KQFFPDVA+GY+DP
Sbjct: 79  SIPNPKKVLVIGGGDGGVLREVARYASVEKIDICEIDKMVVDVSKQFFPDVAIGYDDP 136



>gb:AF321139_1785927 Nicotiana tabacum spermidine synthase mRNA,
           complete cds.
          Length = 261

 Score =  244 bits (624), Expect(2) = e-120
 Identities = 117/137 (85%), Positives = 128/137 (93%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           SSV+PGWFSEISP+WPGEAHSLKVEK+LF+GKSDYQ+VMVFQSSTYGKVLVLDGVIQ+TE
Sbjct: 20  SSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDGVIQLTE 79

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDECAYQEMI HLPLCSIPNPKKVLVI      VLREV+RH+SV+QIDICEIDKMVV+V+
Sbjct: 80  RDECAYQEMIAHLPLCSIPNPKKVLVIGGGDGGVLREVSRHSSVEQIDICEIDKMVVEVS 139

Query: 864 KQFFPDVAVGYEDPPCN 914
           KQFFPDVAVGYEDP  N
Sbjct: 140 KQFFPDVAVGYEDPRVN 156



 Score =  211 bits (537), Expect(2) = e-120
 Identities = 101/114 (88%), Positives = 105/114 (92%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGDGVAFLKNVA GTYDAVIVDSSDPIGPAQELFEKPFF ++ARAL PG
Sbjct: 148  VGYEDPRVNLHIGDGVAFLKNVAAGTYDAVIVDSSDPIGPAQELFEKPFFDSIARALHPG 207

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST 1230
            GVV TQAESIWLHMHIIE IVANCRQIFKGSVNYAWTTVPTYPSG+IGFMLCST
Sbjct: 208  GVVSTQAESIWLHMHIIEEIVANCRQIFKGSVNYAWTTVPTYPSGMIGFMLCST 261



>gb:AP004875_1846401 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0463G12.>gb:AP006844_1863012 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0052K15.
          Length = 397

 Score =  231 bits (590), Expect(2) = e-115
 Identities = 105/165 (63%), Positives = 137/165 (83%), Gaps = 1/165 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G + PRV LH+GD V FL+N  EGTYDA+IVDSSDPIGPAQEL EKPFF T+ARALRPG
Sbjct: 201  VGFKDPRVRLHVGDAVEFLRNAPEGTYDAIIVDSSDPIGPAQELVEKPFFDTIARALRPG 260

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C QAES+WLH H+I+++++ CR+ FKGSV+YAWT+VPTYPSGVIGF+LC+ EGP V+
Sbjct: 261  GVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVPTYPSGVIGFLLCAKEGPPVN 320

Query: 1249 FKHPINPIDEANDA-KSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            F  P NPI++   A ++   ++FYNSE+H AAF LP+FA++ +E+
Sbjct: 321  FLTPANPIEKLEGAMEAGRDIRFYNSEMHRAAFVLPTFARRELEA 365



 Score =  207 bits (527), Expect(2) = e-115
 Identities = 95/151 (62%), Positives = 122/151 (80%), Gaps = 14/151 (9%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEI--------------SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQS 632
           +C ++V+ GWF+E               +PMWPGEAHSLKVEK+L++GKS YQ+V+VF+S
Sbjct: 56  KCHATVVSGWFTEPRSRGGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVLVFES 115

Query: 633 STYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHAS 812
           STYGKVLVLDG++Q+T++DECAYQEMITHLPLCSIP+PKKVLVI      VLRE+ RH S
Sbjct: 116 STYGKVLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREICRHGS 175

Query: 813 VDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           V+ IDICEID++V+DV K FFPD++VG++DP
Sbjct: 176 VESIDICEIDQLVIDVCKDFFPDLSVGFKDP 206



>gb:AB098063_1526058 Oryza sativa (japonica cultivar-group) OsSPDS2
            mRNA for aminopropyl transferase, complete
            cds.>gb:AP004745_1844265 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0001B01.
          Length = 387

 Score =  233 bits (593), Expect(2) = e-114
 Identities = 104/165 (63%), Positives = 138/165 (83%), Gaps = 1/165 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G + PRV LH+GD V FL+N  EG YDA+IVDSSDPIGPAQEL EKPFFQT+ARAL+PG
Sbjct: 190  VGFKDPRVQLHVGDAVDFLRNAPEGKYDAIIVDSSDPIGPAQELVEKPFFQTIARALKPG 249

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C QAES+WLH H+I+++++ CR+ FKG+V+YAWT+VPTYPSGVIGF+LC+ EGPAV+
Sbjct: 250  GVLCNQAESMWLHTHLIQDMLSICRETFKGAVHYAWTSVPTYPSGVIGFLLCAKEGPAVN 309

Query: 1249 FKHPINPIDEANDA-KSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            F  P+NPI++   A ++   ++FYNSE+H AAF LP+F ++ +ES
Sbjct: 310  FLSPVNPIEKLEGAMEAGREIRFYNSEVHRAAFVLPTFVRRELES 354



 Score =  202 bits (514), Expect(2) = e-114
 Identities = 91/151 (60%), Positives = 120/151 (79%), Gaps = 14/151 (9%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEI--------------SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQS 632
           +C ++V+ GWF+E               +PMWPGEAHSLKVE +L++GKS YQ+++VF+S
Sbjct: 45  KCHATVVSGWFTEPRSHSGKTSKVQYFNNPMWPGEAHSLKVENILYQGKSPYQEILVFES 104

Query: 633 STYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHAS 812
           STYG VLVLDG++Q+TE+DECAYQEM+THLPLCSIP+PK VLV+      VLRE+ARHAS
Sbjct: 105 STYGNVLVLDGIVQLTEKDECAYQEMVTHLPLCSIPSPKSVLVVGGGDGGVLREIARHAS 164

Query: 813 VDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           V+ IDICEID++V+DV K FFP ++VG++DP
Sbjct: 165 VENIDICEIDQLVIDVCKDFFPQLSVGFKDP 195



>gb:AB018570_1513971 Atropa belladonna mRNA for putrescine
            N-methyltransferase 1, complete cds.>gb:AB018573_1513974
            Atropa belladonna gene for putrescine N-methyltransferase
            1, complete cds.
          Length = 336

 Score =  256 bits (654), Expect(2) = e-113
 Identities = 119/163 (73%), Positives = 141/163 (86%), Gaps = 1/163 (0%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   PRVTL IGDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGG
Sbjct: 173  GFDDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGG 232

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            VVCTQAESIWLHMH+I+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP V+F
Sbjct: 233  VVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNF 292

Query: 1252 KHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            K+P+N ID + +  KSK PLKFYNS+IH AAF LPSFA+ ++E
Sbjct: 293  KNPVNSIDKDTSHVKSKGPLKFYNSDIHKAAFILPSFARDLVE 335



 Score =  177 bits (450), Expect(2) = e-113
 Identities = 84/137 (61%), Positives = 107/137 (78%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQ 674
           +C +S+ PGWFSE S +WPGEA SLK+EKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ
Sbjct: 41  ECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQ 100

Query: 675 ITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVV 854
            TE     Y EMI HLPL SIP+PKKVL+I       L EV+R+ ++D IDI EID +VV
Sbjct: 101 HTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIDTIDIVEIDDVVV 160

Query: 855 DVAKQFFPDVAVGYEDP 905
           DV++++FP +A G++DP
Sbjct: 161 DVSRKYFPYLAAGFDDP 177



>gb:AF126810_1770493 Nicotiana tabacum cultivar Xanthi putrescine
            N-methyltransferase (PMT1) gene, complete cds.
          Length = 375

 Score =  259 bits (663), Expect(2) = e-113
 Identities = 123/161 (76%), Positives = 141/161 (87%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 215  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 274

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+P+
Sbjct: 275  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPV 334

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK  PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 335  NPIDKETTQVKSKLGPLKFYNSDIHKAAFILPSFARSMIES 375



 Score =  172 bits (437), Expect(2) = e-113
 Identities = 84/133 (63%), Positives = 102/133 (76%)
 Frame = +3

Query: 507 SVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITER 686
           S+ PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE 
Sbjct: 83  SIKPGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTEN 142

Query: 687 DECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
               Y EMI HLPL SIPNPKKVL+I       L E+ R+ S+++IDI EID +VVDV++
Sbjct: 143 GGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSR 202

Query: 867 QFFPDVAVGYEDP 905
           +FFP +A  + DP
Sbjct: 203 KFFPYLAANFNDP 215



>gb:AY690623_1622464 Anisodus tanguticus putrescine
            N-methyltransferase (PMT) mRNA, complete cds.
          Length = 338

 Score =  255 bits (651), Expect(2) = e-113
 Identities = 118/163 (72%), Positives = 141/163 (86%), Gaps = 1/163 (0%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   PRVTL IGDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ +A+ALRPGG
Sbjct: 175  GFDDPRVTLIIGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEALAKALRPGG 234

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            VVCTQAESIWLHMH+I+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP V+F
Sbjct: 235  VVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNF 294

Query: 1252 KHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            K+P+N ID + +  KSK PLKFYNS+IH AAF LPSFA+ ++E
Sbjct: 295  KNPVNSIDKDTSHVKSKGPLKFYNSDIHKAAFILPSFARDLVE 337



 Score =  177 bits (449), Expect(2) = e-113
 Identities = 84/137 (61%), Positives = 107/137 (78%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQ 674
           +C +S+ PGWFSE S +WPGEA SLK+EKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ
Sbjct: 43  ECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQ 102

Query: 675 ITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVV 854
            TE     Y EMI HLPL SIP+PKKVL+I       L EV+R+ +++ IDI EID +VV
Sbjct: 103 HTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYPTIETIDIVEIDDVVV 162

Query: 855 DVAKQFFPDVAVGYEDP 905
           DV+++FFP +A G++DP
Sbjct: 163 DVSRKFFPYLAAGFDDP 179



>sp|Q9SEH5|PMT3_TOBAC Putrescine N-methyltransferase 3 (EC 2.1.1.53)
            (PMT 3).>gb:AF126811_1770494 Nicotiana tabacum cultivar
            Xanthi putrescine N-methyltransferase (PMT3) gene,
            complete cds.
          Length = 381

 Score =  260 bits (664), Expect(2) = e-113
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 221  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 280

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+P+
Sbjct: 281  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPV 340

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK +PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 341  NPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIES 381



 Score =  172 bits (435), Expect(2) = e-113
 Identities = 83/134 (61%), Positives = 103/134 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+ PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE
Sbjct: 88  NSIKPGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE 147

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
                Y EMI HLPL SIPNPKKVL+I       L E+ R+ ++++IDI EID +VVDV+
Sbjct: 148 NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVS 207

Query: 864 KQFFPDVAVGYEDP 905
           ++FFP +A  + DP
Sbjct: 208 RKFFPYLAANFSDP 221



>gb:AF280402_1782878 Nicotiana attenuata putrescine
            N-methyltransferase 1 (PMT1) mRNA, complete cds.
          Length = 388

 Score =  258 bits (659), Expect(2) = e-112
 Identities = 123/161 (76%), Positives = 141/161 (87%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 228  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 287

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+PI
Sbjct: 288  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPI 347

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK +PLKFYN +IH AAF LPSFA+ +IES
Sbjct: 348  NPIDKETTQVKSKLAPLKFYNFDIHKAAFILPSFARSMIES 388



 Score =  173 bits (438), Expect(2) = e-112
 Identities = 84/134 (62%), Positives = 103/134 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+ PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE
Sbjct: 95  NSIKPGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE 154

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
                Y EMI HLPL SIPNPKKVL+I       L E+ R+ S+++IDI EID +VVDV+
Sbjct: 155 NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVS 214

Query: 864 KQFFPDVAVGYEDP 905
           ++FFP +A  + DP
Sbjct: 215 RKFFPYLAANFNDP 228



>gb:AB018572_1513973 Hyoscyamus niger mRNA for putrescine
            N-methyltransferase, complete cds.
          Length = 338

 Score =  254 bits (648), Expect(2) = e-112
 Identities = 117/163 (71%), Positives = 139/163 (85%), Gaps = 1/163 (0%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ V +ALRPGG
Sbjct: 175  GFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVTKALRPGG 234

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            VVCTQAESIWLHMH+I+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP V+F
Sbjct: 235  VVCTQAESIWLHMHLIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVNF 294

Query: 1252 KHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            K+P+N ID +    KSK PLKFYNS+IH AAF LPSFA+ ++E
Sbjct: 295  KNPVNSIDKDTTHVKSKGPLKFYNSDIHKAAFILPSFARDLVE 337



 Score =  177 bits (449), Expect(2) = e-112
 Identities = 82/137 (59%), Positives = 109/137 (79%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQ 674
           +C +S+ PGWFSE S +WPGEA SLK+EKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ
Sbjct: 43  ECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQ 102

Query: 675 ITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVV 854
            TE     Y EMI HLPL SIP+PKKVL+I       L EV+R++++++IDI EID +V+
Sbjct: 103 HTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVI 162

Query: 855 DVAKQFFPDVAVGYEDP 905
           DV++++FP +A G++DP
Sbjct: 163 DVSRKYFPYLAAGFDDP 179



>sp|Q42963|PMT1_TOBAC Putrescine N-methyltransferase 1 (EC 2.1.1.53)
            (PMT 1) (A411).>pir|T03681|T03681 putrescine
            N-methyltransferase (EC 2.1.1.53) A411 [validated] -
            common tobacco>gb:TOBPNMB_1725501 Nicotiana tabacum mRNA
            for putrescine N-Methyltransferase, complete cds.
          Length = 375

 Score =  258 bits (659), Expect(2) = e-112
 Identities = 122/161 (75%), Positives = 140/161 (86%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 215  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 274

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTT PTYP+GVIG+MLCSTEGP VDFK+P+
Sbjct: 275  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTAPTYPTGVIGYMLCSTEGPEVDFKNPV 334

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK  PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 335  NPIDKETTQVKSKLGPLKFYNSDIHKAAFILPSFARSMIES 375



 Score =  172 bits (437), Expect(2) = e-112
 Identities = 84/133 (63%), Positives = 102/133 (76%)
 Frame = +3

Query: 507 SVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITER 686
           S+ PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE 
Sbjct: 83  SIKPGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTEN 142

Query: 687 DECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
               Y EMI HLPL SIPNPKKVL+I       L E+ R+ S+++IDI EID +VVDV++
Sbjct: 143 GGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSR 202

Query: 867 QFFPDVAVGYEDP 905
           +FFP +A  + DP
Sbjct: 203 KFFPYLAANFNDP 215



>gb:AB018571_1513972 Atropa belladonna mRNA for putrescine
            N-methyltransferase 2, complete cds.
          Length = 340

 Score =  257 bits (657), Expect(2) = e-112
 Identities = 119/167 (71%), Positives = 144/167 (86%), Gaps = 1/167 (0%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGG
Sbjct: 174  GFDDPRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGG 233

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            VVCTQAESIWLHMHII+ I+ NCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCST+GP VDF
Sbjct: 234  VVCTQAESIWLHMHIIKQIIDNCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTKGPQVDF 293

Query: 1252 KHPINPID-EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            ++P+NPID + +  KSK PLKFYNS+IH AAF LPSFA+ ++ES+ +
Sbjct: 294  RNPVNPIDKKTSHIKSKGPLKFYNSDIHKAAFILPSFARNLMESELD 340



 Score =  173 bits (439), Expect(2) = e-112
 Identities = 83/135 (61%), Positives = 103/135 (76%)
 Frame = +3

Query: 501 FSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQIT 680
           F  + PGWFSE S +WPGEA SLK+EKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ T
Sbjct: 44  FGCIKPGWFSEFSQLWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHT 103

Query: 681 ERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDV 860
           E     Y EMI HLPL SIP+PKKVL+I       L EV R+ +++ IDI EID +VVDV
Sbjct: 104 ENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVFRYPTIENIDIVEIDNVVVDV 163

Query: 861 AKQFFPDVAVGYEDP 905
           +++FFP +A G++DP
Sbjct: 164 SRKFFPYLAAGFDDP 178



>gb:AY335900_1600222 Lycopersicon esculentum putative spermine
            synthase (SPM1) mRNA, complete cds.
          Length = 356

 Score =  221 bits (563), Expect(2) = e-112
 Identities = 102/163 (62%), Positives = 128/163 (78%), Gaps = 1/163 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LH+GD V FLKN  EG YDA+IVDSSDP+GPA EL E PFF  +ARALRPG
Sbjct: 179  IGFEDPRVNLHVGDAVEFLKNTPEGKYDAIIVDSSDPVGPAIELVEGPFFAKIARALRPG 238

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C  AES+WLH H+I+++++ CR+ F  SV+YAW +VPTYPSGVIGF+LCSTEGP VD
Sbjct: 239  GVLCNMAESMWLHTHLIQDMISICRETF-SSVHYAWASVPTYPSGVIGFLLCSTEGPFVD 297

Query: 1249 FKHPINPIDEANDA-KSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            FKHP+NPI++   A + +  LKFYNSE+H AAF LP F ++ +
Sbjct: 298  FKHPVNPIEKLEGALQHQRELKFYNSEMHEAAFALPCFLRREV 340



 Score =  209 bits (531), Expect(2) = e-112
 Identities = 96/153 (62%), Positives = 125/153 (81%), Gaps = 14/153 (9%)
 Frame = +3

Query: 498 CFSSVIPGWFSEI--------------SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSS 635
           C S+V+ GWFS+               +PMWPGEAHSLKVEK+LFKGKS++Q+V+VF+S+
Sbjct: 35  CHSTVVSGWFSQPPTSFDGKEKVLYFNNPMWPGEAHSLKVEKVLFKGKSEFQEVLVFESA 94

Query: 636 TYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASV 815
           +YGKVLVLDG++Q+TE+DECAYQEMI HLPLCSI +PKKVLV+      VLRE++RH+SV
Sbjct: 95  SYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSIKSPKKVLVVGGGDGGVLREISRHSSV 154

Query: 816 DQIDICEIDKMVVDVAKQFFPDVAVGYEDPPCN 914
           + IDICEIDKMV+DV+K++FPD+A+G+EDP  N
Sbjct: 155 ELIDICEIDKMVIDVSKKYFPDLAIGFEDPRVN 187



>gb:AY040013_1560514 Arabidopsis thaliana putative spermidine synthase
            (At5g53120) mRNA, complete cds.>gb:AY079367_1568257
            Arabidopsis thaliana putative spermidine synthase
            (At5g53120) mRNA, complete cds.>gb:BT000742_1635014
            Arabidopsis thaliana putative spermidine synthase
            (At5g53120) mRNA, complete cds.
          Length = 359

 Score =  223 bits (568), Expect(2) = e-112
 Identities = 105/165 (63%), Positives = 134/165 (81%), Gaps = 1/165 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGD   FL+   EG YDA+IVDSSDP+GPA  L EKPFF+T+ARAL+PG
Sbjct: 192  VGFDDPRVQLHIGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLARALKPG 251

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C  AES+WLH H+IE++++ CRQ FK SV+YAW++VPTYPSGVIGF+LCSTEGPAVD
Sbjct: 252  GVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEGPAVD 310

Query: 1249 FKHPINPIDEANDAKS-KSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            FK+PINPI++ + A + K  LKFYNS++H AAF LP+F ++ + S
Sbjct: 311  FKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRREVAS 355



 Score =  206 bits (524), Expect(2) = e-112
 Identities = 96/152 (63%), Positives = 123/152 (80%), Gaps = 15/152 (9%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEI---------------SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQ 629
           +C S+V+ GWFSE                +PMWPGEAHSLKVEK+LFK KSD+Q+V+VF+
Sbjct: 46  KCHSTVVSGWFSEPHPRSGKKGGKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFE 105

Query: 630 SSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHA 809
           S+TYGKVLVLDG++Q+TE+DECAYQEMI HLPLCSI +PK VLV+      VLRE++RH+
Sbjct: 106 SATYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHS 165

Query: 810 SVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           SV+ IDICEIDKMV+DV+K+FFP++AVG++DP
Sbjct: 166 SVEVIDICEIDKMVIDVSKKFFPELAVGFDDP 197



>gb:AJ583514_1811347 Datura stramonium mRNA for putrescine
            N-methyltransferase (pmt gene).
          Length = 344

 Score =  256 bits (654), Expect(2) = e-112
 Identities = 121/161 (75%), Positives = 141/161 (87%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 184  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 243

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+P+
Sbjct: 244  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPV 303

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID +   A SK  PLKFYN++IH AAF LPSFA+ +IES
Sbjct: 304  NPIDKDETHANSKLGPLKFYNTDIHKAAFILPSFARSMIES 344



 Score =  173 bits (438), Expect(2) = e-112
 Identities = 84/134 (62%), Positives = 103/134 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+ PGWFSE S +WPGEA SLK+EKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE
Sbjct: 51  NSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE 110

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
                Y EMI HLPL SIPNPKKVL+I       L EV R+ +V++IDI EID +VVDV+
Sbjct: 111 NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEVLRYPTVEKIDIVEIDDVVVDVS 170

Query: 864 KQFFPDVAVGYEDP 905
           ++FFP +A  + DP
Sbjct: 171 RKFFPYLAANFNDP 184



>gb:AB004324_1509073 Nicotiana sylvestris NsPMT3 gene for putrescine
            N-methyltransferase, complete cds.
          Length = 430

 Score =  260 bits (665), Expect(2) = e-112
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 270  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 329

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+PI
Sbjct: 330  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPI 389

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK +PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 390  NPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIES 430



 Score =  168 bits (425), Expect(2) = e-112
 Identities = 82/134 (61%), Positives = 102/134 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+  GWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE
Sbjct: 137 NSIKLGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE 196

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
                Y EMI HLPL SIPNPKKVL+I       L E+ R+ ++++IDI EID +VVDV+
Sbjct: 197 NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVS 256

Query: 864 KQFFPDVAVGYEDP 905
           ++FFP +A  + DP
Sbjct: 257 RKFFPYLAANFNDP 270



>gb:AF424571_1798910 Arabidopsis thaliana AT5g53120/MFH8_5 mRNA,
            complete cds.
          Length = 359

 Score =  221 bits (563), Expect(2) = e-111
 Identities = 104/165 (63%), Positives = 134/165 (81%), Gaps = 1/165 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGD   FL+   EG YDA+IV+SSDP+GPA  L EKPFF+T+ARAL+PG
Sbjct: 192  VGFDDPRVQLHIGDAAEFLRKSPEGKYDAIIVNSSDPVGPALALVEKPFFETLARALKPG 251

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C  AES+WLH H+IE++++ CRQ FK SV+YAW++VPTYPSGVIGF+LCSTEGPAVD
Sbjct: 252  GVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEGPAVD 310

Query: 1249 FKHPINPIDEANDAKS-KSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            FK+PINPI++ + A + K  LKFYNS++H AAF LP+F ++ + S
Sbjct: 311  FKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRREVAS 355



 Score =  206 bits (524), Expect(2) = e-111
 Identities = 96/152 (63%), Positives = 123/152 (80%), Gaps = 15/152 (9%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEI---------------SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQ 629
           +C S+V+ GWFSE                +PMWPGEAHSLKVEK+LFK KSD+Q+V+VF+
Sbjct: 46  KCHSTVVSGWFSEPHPRSGKKGGKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFE 105

Query: 630 SSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHA 809
           S+TYGKVLVLDG++Q+TE+DECAYQEMI HLPLCSI +PK VLV+      VLRE++RH+
Sbjct: 106 SATYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHS 165

Query: 810 SVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           SV+ IDICEIDKMV+DV+K+FFP++AVG++DP
Sbjct: 166 SVEVIDICEIDKMVIDVSKKFFPELAVGFDDP 197



>gb:AY087226_1572260 Arabidopsis thaliana clone 33021 mRNA, complete
            sequence.
          Length = 345

 Score =  221 bits (562), Expect(2) = e-111
 Identities = 104/165 (63%), Positives = 133/165 (80%), Gaps = 1/165 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHI D   FL+   EG YDA+IVDSSDP+GPA  L EKPFF+T+ARAL+PG
Sbjct: 178  VGFDDPRVQLHISDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLARALKPG 237

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C  AES+WLH H+IE++++ CRQ FK SV+YAW++VPTYPSGVIGF+LCSTEGPAVD
Sbjct: 238  GVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEGPAVD 296

Query: 1249 FKHPINPIDEANDAKS-KSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            FK+PINPI++ + A + K  LKFYNS++H AAF LP+F ++ + S
Sbjct: 297  FKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRREVAS 341



 Score =  206 bits (524), Expect(2) = e-111
 Identities = 96/152 (63%), Positives = 123/152 (80%), Gaps = 15/152 (9%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEI---------------SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQ 629
           +C S+V+ GWFSE                +PMWPGEAHSLKVEK+LFK KSD+Q+V+VF+
Sbjct: 32  KCHSTVVSGWFSEPHPRSGKKGGKAVYFNNPMWPGEAHSLKVEKVLFKDKSDFQEVLVFE 91

Query: 630 SSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHA 809
           S+TYGKVLVLDG++Q+TE+DECAYQEMI HLPLCSI +PK VLV+      VLRE++RH+
Sbjct: 92  SATYGKVLVLDGIVQLTEKDECAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHS 151

Query: 810 SVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           SV+ IDICEIDKMV+DV+K+FFP++AVG++DP
Sbjct: 152 SVEVIDICEIDKMVIDVSKKFFPELAVGFDDP 183



>gb:AF280403_1782879 Nicotiana attenuata putrescine
            N-methyltransferase 2 (PMT2) mRNA, complete cds.
          Length = 371

 Score =  255 bits (651), Expect(2) = e-111
 Identities = 121/161 (75%), Positives = 140/161 (86%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K      YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 211  PRVTLVLGDGAAFVKAAQAEYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 270

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+P+
Sbjct: 271  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPV 330

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    K K +PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 331  NPIDKETTQVKPKLAPLKFYNSDIHKAAFILPSFARSMIES 371



 Score =  171 bits (433), Expect(2) = e-111
 Identities = 83/130 (63%), Positives = 100/130 (76%)
 Frame = +3

Query: 516 PGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE    
Sbjct: 82  PGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF 141

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
            Y EMI HLPL SIPNPKKVL+I       L E+ R+ S+++IDI EID +VVDV+++FF
Sbjct: 142 PYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPSIEKIDIVEIDDVVVDVSRKFF 201

Query: 876 PDVAVGYEDP 905
           P +A  + DP
Sbjct: 202 PYLAANFNDP 211



>gb:AB004322_1509071 Nicotiana sylvestris NsPMT1 gene for putrescine
            N-methyltransferase, complete cds.
          Length = 353

 Score =  256 bits (653), Expect(2) = e-111
 Identities = 121/161 (75%), Positives = 141/161 (87%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K      YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 193  PRVTLVLGDGAAFVKAAQAEYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 252

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP +DFK+P+
Sbjct: 253  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEIDFKNPV 312

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK +PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 313  NPIDKETAQVKSKLAPLKFYNSDIHKAAFILPSFARSMIES 353



 Score =  170 bits (430), Expect(2) = e-111
 Identities = 82/130 (63%), Positives = 100/130 (76%)
 Frame = +3

Query: 516 PGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE    
Sbjct: 64  PGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF 123

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
            Y EMI HLPL SIPNPKKVL+I       L E+ R+ ++++IDI EID +VVDV+++FF
Sbjct: 124 PYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKFF 183

Query: 876 PDVAVGYEDP 905
           P +A  + DP
Sbjct: 184 PYLAANFNDP 193



>sp|Q9SEH7|PMT2_TOBAC Putrescine N-methyltransferase 2 (EC 2.1.1.53)
            (PMT 2).>gb:AF126809_1770492 Nicotiana tabacum cultivar
            Xanthi putrescine N-methyltransferase (PMT2) gene,
            complete cds.
          Length = 353

 Score =  256 bits (653), Expect(2) = e-111
 Identities = 121/161 (75%), Positives = 141/161 (87%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K      YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 193  PRVTLVLGDGAAFVKAAQAEYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 252

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP +DFK+P+
Sbjct: 253  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEIDFKNPV 312

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK +PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 313  NPIDKETAQVKSKLAPLKFYNSDIHKAAFILPSFARSMIES 353



 Score =  170 bits (430), Expect(2) = e-111
 Identities = 82/130 (63%), Positives = 100/130 (76%)
 Frame = +3

Query: 516 PGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE    
Sbjct: 64  PGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGF 123

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
            Y EMI HLPL SIPNPKKVL+I       L E+ R+ ++++IDI EID +VVDV+++FF
Sbjct: 124 PYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVSRKFF 183

Query: 876 PDVAVGYEDP 905
           P +A  + DP
Sbjct: 184 PYLAANFNDP 193



>sp|Q9SEH4|PMT4_TOBAC Putrescine N-methyltransferase 4 (EC 2.1.1.53)
            (PMT 4).>gb:AF126812_1770495 Nicotiana tabacum cultivar
            Xanthi putrescine N-methyltransferase (PMT4) gene,
            complete cds.
          Length = 419

 Score =  260 bits (665), Expect(2) = e-111
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 259  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 318

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+PI
Sbjct: 319  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPI 378

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID E    KSK +PLKFYNS+IH AAF LPSFA+ +IES
Sbjct: 379  NPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMIES 419



 Score =  165 bits (417), Expect(2) = e-111
 Identities = 81/134 (60%), Positives = 101/134 (75%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+  GWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE
Sbjct: 126 NSIKLGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE 185

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
                Y EMI HLPL SIPNPKKVL+I       L E+ R+ ++++IDI EID +VVDV+
Sbjct: 186 NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVS 245

Query: 864 KQFFPDVAVGYEDP 905
           ++ FP +A  + DP
Sbjct: 246 RKSFPYLAANFNDP 259



>gb:AB025622_1516442 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MFH8.
          Length = 343

 Score =  223 bits (568), Expect(2) = e-110
 Identities = 105/165 (63%), Positives = 134/165 (81%), Gaps = 1/165 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   PRV LHIGD   FL+   EG YDA+IVDSSDP+GPA  L EKPFF+T+ARAL+PG
Sbjct: 176  VGFDDPRVQLHIGDAAEFLRKSPEGKYDAIIVDSSDPVGPALALVEKPFFETLARALKPG 235

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C  AES+WLH H+IE++++ CRQ FK SV+YAW++VPTYPSGVIGF+LCSTEGPAVD
Sbjct: 236  GVLCNMAESMWLHTHLIEDMISICRQTFK-SVHYAWSSVPTYPSGVIGFVLCSTEGPAVD 294

Query: 1249 FKHPINPIDEANDAKS-KSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            FK+PINPI++ + A + K  LKFYNS++H AAF LP+F ++ + S
Sbjct: 295  FKNPINPIEKLDGAMTHKRELKFYNSDMHRAAFALPTFLRREVAS 339



 Score =  201 bits (511), Expect(2) = e-110
 Identities = 93/137 (67%), Positives = 119/137 (86%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQ 674
           +C S+V+ GWFSE  P   GEAHSLKVEK+LFK KSD+Q+V+VF+S+TYGKVLVLDG++Q
Sbjct: 46  KCHSTVVSGWFSEPHPR-SGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQ 104

Query: 675 ITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVV 854
           +TE+DECAYQEMI HLPLCSI +PK VLV+      VLRE++RH+SV+ IDICEIDKMV+
Sbjct: 105 LTEKDECAYQEMIAHLPLCSISSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMVI 164

Query: 855 DVAKQFFPDVAVGYEDP 905
           DV+K+FFP++AVG++DP
Sbjct: 165 DVSKKFFPELAVGFDDP 181



>gb:AJ605553_1811910 Solanum tuberosum mRNA for putrescine
            N-methyltransferase (pmt gene).
          Length = 340

 Score =  254 bits (648), Expect(2) = e-110
 Identities = 119/161 (73%), Positives = 140/161 (86%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGV+CT
Sbjct: 180  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVICT 239

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAESIWLHMHII+ I+ANCR +FKGSVNYAWTTVPTYP+GVIG+MLCSTEGP VDFK+P+
Sbjct: 240  QAESIWLHMHIIKQIIANCRLVFKGSVNYAWTTVPTYPTGVIGYMLCSTEGPEVDFKNPV 299

Query: 1264 NPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            NPID +    KSK  PLKFYN++IH AAF LPSFA+ +IES
Sbjct: 300  NPIDKDTTHVKSKLEPLKFYNTDIHKAAFILPSFARSLIES 340



 Score =  170 bits (430), Expect(2) = e-110
 Identities = 81/134 (60%), Positives = 103/134 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+ PGWFSE S +WPGEA S+K+EKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE
Sbjct: 47  NSIKPGWFSEFSALWPGEAFSVKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE 106

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
                Y EMI HLPL SIP PKKVL+I       L EV R++++++IDI EID +VVDV+
Sbjct: 107 NGGFPYTEMIVHLPLGSIPTPKKVLIIGGGIGFTLFEVLRYSTIEKIDIVEIDDVVVDVS 166

Query: 864 KQFFPDVAVGYEDP 905
           ++FFP +A  + DP
Sbjct: 167 RKFFPYLAANFNDP 180



>gb:AB004323_1509072 Nicotiana sylvestris NsPMT2 gene for putrescine
            N-methyltransferase, partial cds.
          Length = 319

 Score =  173 bits (439), Expect(2) = 7e-87
 Identities = 78/99 (78%), Positives = 90/99 (90%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRVTL +GDG AF+K    G YDA+IVDSSDPIGPA++LFE+PFF+ VA+ALRPGGVVCT
Sbjct: 221  PRVTLVLGDGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKALRPGGVVCT 280

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPS 1200
            QAESIWLHMHII+ I+ANCRQ+FKGSVNYAWTTVPTYP+
Sbjct: 281  QAESIWLHMHIIKQIIANCRQVFKGSVNYAWTTVPTYPT 319



 Score =  172 bits (435), Expect(2) = 7e-87
 Identities = 83/134 (61%), Positives = 103/134 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+ PGWFSE S +WPGEA SLKVEKLLF+GKSDYQDVM+F+S+TYGKVL LDG IQ TE
Sbjct: 88  NSIKPGWFSEFSALWPGEAFSLKVEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTE 147

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
                Y EMI HLPL SIPNPKKVL+I       L E+ R+ ++++IDI EID +VVDV+
Sbjct: 148 NGGFPYTEMIVHLPLGSIPNPKKVLIIGGGIGFTLFEMLRYPTIEKIDIVEIDDVVVDVS 207

Query: 864 KQFFPDVAVGYEDP 905
           ++FFP +A  + DP
Sbjct: 208 RKFFPYLAANFSDP 221



>sp|Q09741|SPEE_SCHPO Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|T39374|T39374
           spermidine synthase - fission yeast (Schizosaccharomyces
           pombe)>gb:SPBC12C2_1718888 S.pombe chromosome II cosmid
           c12C2.
          Length = 298

 Score =  160 bits (406), Expect(2) = 2e-77
 Identities = 76/129 (58%), Positives = 98/129 (75%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GWF EI+ MWPG+A +LKV+K+L+ GKS YQDV+VF+S TYG VLVLDG IQ TERDE +
Sbjct: 14  GWFREINNMWPGQAMTLKVKKVLYAGKSKYQDVLVFESETYGHVLVLDGAIQATERDEFS 73

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           YQEMI HL L S PNPKKVLVI      VLREV +H  V++  +C+ID+ V+ V+KQ+ P
Sbjct: 74  YQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEDVIKVSKQYLP 133

Query: 879 DVAVGYEDP 905
           +++ G+  P
Sbjct: 134 EMSAGFNHP 142



 Score =  153 bits (386), Expect(2) = 2e-77
 Identities = 74/162 (45%), Positives = 112/162 (69%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   P+V +HIGDG  FL++  + T+D +I DSSDP GPA+ LF+KP+FQ ++ ALR GG
Sbjct: 138  GFNHPKVKVHIGDGFKFLQDY-QNTFDVIITDSSDPDGPAEALFQKPYFQLLSDALRGGG 196

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            V+ TQAE +W+H+ +I N++   + +F  +V YA+TT+PTYPSG IGF++ S +  ++D 
Sbjct: 197  VITTQAECMWIHLGVISNVLTAVKTVFP-NVRYAYTTIPTYPSGSIGFVVASKDA-SIDL 254

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
              P+       + K     K+YNSEIH+A+F LP+FA+ V++
Sbjct: 255  SKPLRKWSPEEENKL---CKYYNSEIHAASFVLPTFARDVVD 293



>sp|Q9Y8H7|SPEE_NEUCR Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>gb:AB001598_1508492
            Neurospora crassa gene for spermidine synthase, complete
            cds.>gb:NCB11H7_1689059 Neurospora crassa DNA linkage
            group V BAC clone B11H7.
          Length = 291

 Score =  157 bits (397), Expect(2) = 8e-77
 Identities = 77/162 (47%), Positives = 111/162 (68%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   P+V +H+GDG  FL++  + T+D +I DSSDP GPA+ LF+KP+FQ +  ALR GG
Sbjct: 136  GFEHPKVKVHVGDGFKFLEDF-KNTFDVIITDSSDPEGPAESLFQKPYFQLLHDALREGG 194

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            V+ TQAE+ WLH+ +I  +  +C+++F     YA+TT+PTYPSG IGFM+CS + P  + 
Sbjct: 195  VITTQAENQWLHLPLITKLKKDCKEVFP-VAEYAYTTIPTYPSGQIGFMVCSKD-PNANV 252

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            K P+    +  + K     ++YNSEIH A+F LP+FAKK +E
Sbjct: 253  KVPLRSWSQEEEEKL---CRYYNSEIHKASFILPTFAKKALE 291



 Score =  154 bits (390), Expect(2) = 8e-77
 Identities = 75/129 (58%), Positives = 97/129 (75%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GWF EIS MWPG+A +LKVEK+L   KS YQDV++F+S+ +G VLVLD VIQ TERDE +
Sbjct: 12  GWFREISNMWPGQAMTLKVEKVLHHEKSLYQDVLIFKSTDHGNVLVLDNVIQCTERDEFS 71

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           YQEMITHL + S PNPKKVLVI      VLREV +H  V++  +C+ID+ V+ ++KQF P
Sbjct: 72  YQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIRLSKQFLP 131

Query: 879 DVAVGYEDP 905
            ++ G+E P
Sbjct: 132 HMSAGFEHP 140



>sp|Q9XY92|SPEE_DICDI Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AF069757_1238532
           Dictyostelium discoideum spermidine synthase gene,
           complete cds.
          Length = 284

 Score =  161 bits (408), Expect(2) = 2e-76
 Identities = 74/129 (57%), Positives = 99/129 (76%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GWFSEIS  WPG + SL+VEK+L   KS+YQD++VF+S ++G VLVLDGVIQ TERDE A
Sbjct: 7   GWFSEISEFWPGNSFSLEVEKVLHHEKSEYQDILVFKSKSFGNVLVLDGVIQATERDEFA 66

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           YQEMITH+PL S P+PK+VLV+      VLREV +H  V+ + +CEIDK V++ ++ F P
Sbjct: 67  YQEMITHIPLFSHPSPKRVLVVGGGDGGVLREVVKHPLVESVTLCEIDKGVIEASRNFLP 126

Query: 879 DVAVGYEDP 905
           ++ VG++ P
Sbjct: 127 NMRVGFDHP 135



 Score =  149 bits (375), Expect(2) = 2e-76
 Identities = 72/160 (45%), Positives = 108/160 (67%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   P+VTL IGDG+ F++   +G +D +I DSSDPIGPAQ LFE+ +++ +  AL PG
Sbjct: 130  VGFDHPKVTLFIGDGMEFMRQ-RKGEFDVIITDSSDPIGPAQGLFERAYYELLKAALAPG 188

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            G+VC+Q ES+WLH+  I+ +   C++++  +V YA+T++P+YP G IGF+LCS  G    
Sbjct: 189  GIVCSQCESMWLHLDTIKGLTTFCKELYP-NVEYAYTSIPSYPGGSIGFILCSLGGST-- 245

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKK 1368
             K PI  I      + +S +++YN E+H A+F LP FA K
Sbjct: 246  -KAPIREI----TPEVQSQMQYYNGEVHKASFVLPQFAAK 280



>gb:HUMSPERSYO_2036688 Human spermidine synthase mRNA, complete cds.
          Length = 302

 Score =  159 bits (401), Expect(2) = 4e-76
 Identities = 75/131 (57%), Positives = 99/131 (75%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++  GWF E   +WPG+A SL+VE+LL   +S YQD++VF+S TYG VLVLDGVIQ TE
Sbjct: 14  AAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTE 73

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMI +LPLCS PNP+KVL+I      VLREV +H SV+ +  CEID+ V+ V+
Sbjct: 74  RDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVS 133

Query: 864 KQFFPDVAVGY 896
           K+F P +A+GY
Sbjct: 134 KKFLPGMAIGY 144



 Score =  150 bits (380), Expect(2) = 4e-76
 Identities = 72/162 (44%), Positives = 110/162 (67%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G    +VTLH+GDG  F+K   +  +D +I DSSDP+GPA+ LF++ ++Q +  AL+  
Sbjct: 142  IGYSSSKVTLHVGDGFEFMKQ-NQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKED 200

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C Q E  WLH+ +I+ +   C+ +F   V YA+ T+PTYPSG IGFMLCS + P+ +
Sbjct: 201  GVLCCQGECEWLHLDLIKEMRQFCQSLFP-VVAYAYCTIPTYPSGQIGFMLCS-KNPSTN 258

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            F+ P+ P+ +   A+ +  LK+YNS++H AAF LP FA+K +
Sbjct: 259  FQEPVQPLTQQQVAQMQ--LKYYNSDVHRAAFVLPEFARKAL 298



>sp|P19623|SPEE_HUMAN Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|A32610|A32610
           spermidine synthase (EC 2.5.1.16) -
           human>gb:BC000309_1966601 Homo sapiens spermidine
           synthase, mRNA (cDNA clone MGC:8422 IMAGE:2820975),
           complete cds.>gb:BC033106_1980804 Homo sapiens
           spermidine synthase, mRNA (cDNA clone MGC:45687
           IMAGE:5420683), complete cds.>gb:HSJ635E18_2016350 Human
           DNA sequence from clone RP4-635E18 on chromosome
           1p36.11-36.31 Contains the TARDBP gene for TAR DNA
           binding protein, the MASP2 gene for mannan-binding
           lectin serine protease 2, the SRM gene for spermidine
           synthase, the PMSCL2 gene for 100kDa
           polymyositis/scleroderma autoantigen 2 (FLJ41371,
           FLJ36636, two novel genes (FLJ30609), the 3' end of the
           FRAP1 gene for FK506 binding protein 12-rapamycin
           associated protein 1 and a CpG island, complete
           sequence.>gb:HUMSPERSYN_2036687 Human spermidine
           synthase gene, complete cds.
          Length = 302

 Score =  159 bits (401), Expect(2) = 8e-76
 Identities = 75/131 (57%), Positives = 99/131 (75%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++  GWF E   +WPG+A SL+VE+LL   +S YQD++VF+S TYG VLVLDGVIQ TE
Sbjct: 14  AAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTE 73

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMI +LPLCS PNP+KVL+I      VLREV +H SV+ +  CEID+ V+ V+
Sbjct: 74  RDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVS 133

Query: 864 KQFFPDVAVGY 896
           K+F P +A+GY
Sbjct: 134 KKFLPGMAIGY 144



 Score =  149 bits (377), Expect(2) = 8e-76
 Identities = 71/162 (43%), Positives = 110/162 (67%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G    ++TLH+GDG  F+K   +  +D +I DSSDP+GPA+ LF++ ++Q +  AL+  
Sbjct: 142  IGYSSSKLTLHVGDGFEFMKQ-NQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKED 200

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+C Q E  WLH+ +I+ +   C+ +F   V YA+ T+PTYPSG IGFMLCS + P+ +
Sbjct: 201  GVLCCQGECQWLHLDLIKEMRQFCQSLFP-VVAYAYCTIPTYPSGQIGFMLCS-KNPSTN 258

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            F+ P+ P+ +   A+ +  LK+YNS++H AAF LP FA+K +
Sbjct: 259  FQEPVQPLTQQQVAQMQ--LKYYNSDVHRAAFVLPEFARKAL 298



>gb:BC070692_2555663 Xenopus laevis hypothetical protein MGC83147,
           mRNA (cDNA clone MGC:83147 IMAGE:6318961), complete cds.
          Length = 290

 Score =  155 bits (391), Expect(2) = 1e-75
 Identities = 70/129 (54%), Positives = 98/129 (75%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GWF E   +WPG+A SL+VE++L+  +S +Q+++V +S TYG VLVLDG+IQ TERDE +
Sbjct: 8   GWFRETCSLWPGQALSLEVEEVLYHQRSPFQEILVLRSKTYGNVLVLDGLIQCTERDEFS 67

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           YQEMI +LPLCS PNP+KVL+I      VLREV +H SV+ +  CEID+ V++V+K++ P
Sbjct: 68  YQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEEVINVSKKYLP 127

Query: 879 DVAVGYEDP 905
            +A+GY  P
Sbjct: 128 GMAIGYSSP 136



 Score =  153 bits (386), Expect(2) = 1e-75
 Identities = 72/162 (44%), Positives = 108/162 (66%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   P++TLH+GDG  F+K   +  +D +I DSSDP+GPA+ LF++ ++Q +  ALR G
Sbjct: 131  IGYSSPKLTLHVGDGFQFMKQ-NQDAFDIIITDSSDPVGPAESLFKESYYQLMKTALREG 189

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            G++C Q E  WLH+ +I+ +   C+ +F   V YA+ T+PTYPSG IGFMLCS + P+ +
Sbjct: 190  GILCCQGECQWLHLDLIKEMNQFCKTLFP-VVEYAYCTIPTYPSGQIGFMLCS-KNPSTN 247

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            FK P+  + +  +   K  L++YNS IH AAF LP F +K +
Sbjct: 248  FKEPVQQLSQ--EQVDKMNLRYYNSSIHRAAFVLPEFTRKAL 287



>gb:AF337636_2063649 Rattus norvegicus spermidine synthase mRNA,
           complete cds.
          Length = 302

 Score =  160 bits (404), Expect(2) = 9e-75
 Identities = 76/131 (58%), Positives = 100/131 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++  GWF E   +WPG+A SL+VE+LL   +S YQD++VF+S TYG VLVLDGVIQ TE
Sbjct: 14  AAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTE 73

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMI +LPLCS PNP+KVL+I      VLREV +H SV+ +  CEID+ V++V+
Sbjct: 74  RDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVS 133

Query: 864 KQFFPDVAVGY 896
           K+F P +AVGY
Sbjct: 134 KKFLPGMAVGY 144



 Score =  145 bits (365), Expect(2) = 9e-75
 Identities = 68/162 (41%), Positives = 108/162 (66%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G    ++TLH+GDG  F+K   +  +D +I DSSDP+GPA+ LF++ ++Q +  AL+  
Sbjct: 142  VGYSSSKLTLHVGDGFEFMKQ-NQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKED 200

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            G++C Q E  WLH+ +I+ +   C+ +F   V+YA+ T+PTYPSG IGFMLCS + P+ +
Sbjct: 201  GILCCQGECQWLHLDLIKEMRHFCKSLFP-VVSYAYCTIPTYPSGQIGFMLCS-KNPSTN 258

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            F+ P+  + +A     +  LK+YNS++H AAF LP F +K +
Sbjct: 259  FREPVQQLTQAQ--VEQMQLKYYNSDMHRAAFVLPEFTRKAL 298



>sp|Q64674|SPEE_MOUSE Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AK051101_1169574 Mus
           musculus 9 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:D030071N02
           product:spermidine synthase, full insert
           sequence.>gb:BC005566_2089979 Mus musculus spermidine
           synthase, mRNA (cDNA clone MGC:11495 IMAGE:3966710),
           complete cds.>gb:MMSPERSYN_2117424 M.musculus spermidine
           synthase gene.>gb:MUSSPSYN_2130059 Mouse spermidine
           synthase mRNA, complete cds.
          Length = 302

 Score =  158 bits (400), Expect(2) = 6e-74
 Identities = 75/131 (57%), Positives = 100/131 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++  GWF E   +WPG+A SL+VE+LL   +S YQD++VF+S TYG VLVLDGVIQ TE
Sbjct: 14  AAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTE 73

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMI +LPLCS PNP+KVL+I      VLREV +H SV+ +  CEID+ V++V+
Sbjct: 74  RDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVS 133

Query: 864 KQFFPDVAVGY 896
           K+F P +AVG+
Sbjct: 134 KKFLPGMAVGF 144



 Score =  144 bits (362), Expect(2) = 6e-74
 Identities = 67/162 (41%), Positives = 108/162 (66%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G    ++TLH+GDG  F+K   +  +D +I DSSDP+GPA+ LF++ ++Q +  AL+  
Sbjct: 142  VGFSSSKLTLHVGDGFEFMKQ-NQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKED 200

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            G++C Q E  WLH+ +I+ +   C+ +F   V+YA+ ++PTYPSG IGFMLCS + P+ +
Sbjct: 201  GILCCQGECQWLHLDLIKEMRHFCKSLFP-VVDYAYCSIPTYPSGQIGFMLCS-KNPSTN 258

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            F+ P+  + +A     +  LK+YNS++H AAF LP F +K +
Sbjct: 259  FREPVQQLTQAQ--VEQMQLKYYNSDMHRAAFVLPEFTRKAL 298



>gb:AK028359_1160946 Mus musculus 18 days pregnant adult female
           placenta and extra embryonic tissue cDNA, RIKEN
           full-length enriched library, clone:3830422I15
           product:spermidine synthase, full insert sequence.
          Length = 302

 Score =  158 bits (400), Expect(2) = 2e-73
 Identities = 75/131 (57%), Positives = 100/131 (76%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++  GWF E   +WPG+A SL+VE+LL   +S YQD++VF+S TYG VLVLDGVIQ TE
Sbjct: 14  AAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTE 73

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMI +LPLCS PNP+KVL+I      VLREV +H SV+ +  CEID+ V++V+
Sbjct: 74  RDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVS 133

Query: 864 KQFFPDVAVGY 896
           K+F P +AVG+
Sbjct: 134 KKFLPGMAVGF 144



 Score =  142 bits (357), Expect(2) = 2e-73
 Identities = 67/162 (41%), Positives = 107/162 (66%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G    ++TLH+GDG  F+K   +  +D +I DSSDP+GPA+ LF++ ++Q +  AL+  
Sbjct: 142  VGFSSSKLTLHVGDGFEFMKQ-NQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKED 200

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            G++C Q E  WLH+  I+ +   C+ +F   V+YA+ ++PTYPSG IGFMLCS + P+ +
Sbjct: 201  GILCCQGECQWLHLDHIKEMRHFCKSLFP-VVDYAYCSIPTYPSGQIGFMLCS-KNPSTN 258

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            F+ P+  + +A     +  LK+YNS++H AAF LP F +K +
Sbjct: 259  FREPVQQLTQAQ--VEQMQLKYYNSDMHRAAFVLPEFTRKAL 298



>gb:CR382131_1664837 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 292

 Score =  151 bits (381), Expect(2) = 1e-72
 Identities = 75/134 (55%), Positives = 97/134 (72%), Gaps = 1/134 (0%)
 Frame = +3

Query: 507 SVIPGWFSEISP-MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           S++ GWF EIS  MWPG+A +L+V ++L   KS YQDV+VF+S+ YG VLVLDG IQ TE
Sbjct: 8   SIVDGWFREISDTMWPGQAMALRVNQILHVEKSKYQDVLVFESTDYGNVLVLDGAIQATE 67

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE AYQEMI HL L S PNPKKVLVI      VLRE+ +H  V++  +C+ID+ V  V+
Sbjct: 68  RDEYAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEAVLCDIDEAVPRVS 127

Query: 864 KQFFPDVAVGYEDP 905
           KQ+ P ++VG+  P
Sbjct: 128 KQYLPTMSVGFNHP 141



 Score =  147 bits (370), Expect(2) = 1e-72
 Identities = 72/159 (45%), Positives = 107/159 (67%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G   P+  +HIGDG  FL+   + T+D +I DSSDP GPA  LF+KP+F+ ++ AL   
Sbjct: 136  VGFNHPKTKVHIGDGFKFLQEY-QNTFDVIITDSSDPEGPAASLFQKPYFELLSGALTEK 194

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+ TQ ESIWLHM II+ +   C+Q+F  S +YA+ T+PTYPSG IGFM+CS +  A +
Sbjct: 195  GVITTQGESIWLHMKIIKELRQACKQVFP-SADYAYCTIPTYPSGQIGFMVCSKDKDA-N 252

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAK 1365
             + P+  +    ++K     ++YN +IHSA+F LP++A+
Sbjct: 253  LRKPLRSVSPEEESKL---YRYYNKDIHSASFVLPTWAR 288



>gb:AY050641_1562269 Aspergillus nidulans spermidine synthase gene,
           complete cds.
          Length = 292

 Score =  154 bits (389), Expect(2) = 2e-72
 Identities = 73/129 (56%), Positives = 98/129 (75%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GWFSE S MWPG+A +L+V ++L   KS YQDV+VF+SS YG VLVLD VIQ TERDE +
Sbjct: 12  GWFSEQSEMWPGQAMNLRVNQILHHEKSKYQDVLVFESSDYGTVLVLDNVIQCTERDEFS 71

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           YQEMITHL + S PNPKKVLVI      VLREV +H +V++  +C+ID+ V+ V+K++ P
Sbjct: 72  YQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIRVSKKYLP 131

Query: 879 DVAVGYEDP 905
            +++G++ P
Sbjct: 132 GMSIGFQHP 140



 Score =  143 bits (360), Expect(2) = 2e-72
 Identities = 69/162 (42%), Positives = 104/162 (64%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G + P V +H+GDG  FLK   +  +D +I DSSDP GPA+ LF+KP+F+ +  ALR G
Sbjct: 135  IGFQHPNVKVHVGDGFEFLKQ-RQNEFDVIITDSSDPEGPAESLFQKPYFELLRDALRDG 193

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV+ TQAE+ WLH+ +I ++   C ++F     YA+TT+PTYPSG IGFM+C  +    +
Sbjct: 194  GVITTQAENQWLHLPLIADLKKACNEVFP-VAEYAYTTIPTYPSGQIGFMVCCKDANR-N 251

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
             K P+       + +     ++YN +IH A+F LP+FA+K +
Sbjct: 252  VKEPVRTWSREEEERL---CRYYNQDIHRASFVLPNFARKAL 290



>gb:CR380950_1649713 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 293

 Score =  152 bits (385), Expect(2) = 3e-72
 Identities = 75/134 (55%), Positives = 99/134 (73%), Gaps = 1/134 (0%)
 Frame = +3

Query: 507 SVIPGWFSEISP-MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++ GWF EIS  MWPG+A +LKVEK+L   KS YQDV++F+S+ YG VLVLD VIQ TE
Sbjct: 8   TIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTNYGNVLVLDNVIQATE 67

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMITHL + S PNPKKVLVI      VLREV +H  V++  +C+ID+ V+ ++
Sbjct: 68  RDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAWLCDIDEAVIRLS 127

Query: 864 KQFFPDVAVGYEDP 905
           K++ PD+A  Y  P
Sbjct: 128 KEYLPDMAGVYSHP 141



 Score =  144 bits (362), Expect(2) = 3e-72
 Identities = 70/158 (44%), Positives = 104/158 (65%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            P+V  HIGDG  FL++  + T+D +I DSSDP GPA+ LF++ +F+ +  AL   GV+ T
Sbjct: 141  PKVKTHIGDGFQFLRDY-QNTFDVIITDSSDPEGPAETLFQQSYFELLRSALTDKGVITT 199

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAES+WLH+ II+++   C Q+F     YA+TT+PTYPSG IGFM+CS +  A    +  
Sbjct: 200  QAESMWLHLPIIKDLKKACSQVFP-VAEYAYTTIPTYPSGTIGFMVCSKDASA----NVK 254

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
             P+ E  + + K  L++YN  IH ++F LP++  K +E
Sbjct: 255  KPLREMTEEQEKKLLRYYNKRIHESSFVLPTWVAKELE 292



>gb:BC055159_2551243 Danio rerio zgc:63600, mRNA (cDNA clone
           MGC:63600 IMAGE:5413394), complete cds.
          Length = 289

 Score =  150 bits (379), Expect(2) = 5e-72
 Identities = 71/129 (55%), Positives = 95/129 (73%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GWF+E   +WPG+A SL+VE++L+  KS +QDVMVF+S TYG VL+LDGVIQ TERDE +
Sbjct: 7   GWFTETCTLWPGQAMSLQVEEVLYHKKSKFQDVMVFKSKTYGNVLILDGVIQCTERDEFS 66

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           YQEMI +LPLC  P PKKVL+I      VLREV +H  V+ +  CEID+  ++V+K++ P
Sbjct: 67  YQEMIANLPLCCHPCPKKVLIIGGGDGGVLREVVKHPLVESVVQCEIDEDAINVSKKYLP 126

Query: 879 DVAVGYEDP 905
            +A G+  P
Sbjct: 127 GMAKGFFSP 135



 Score =  145 bits (366), Expect(2) = 5e-72
 Identities = 71/161 (44%), Positives = 104/161 (64%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   P++TLH+GDG  F+K   +  +D +I DSSDP+GPA+ L ++ ++Q +  AL  GG
Sbjct: 131  GFFSPKLTLHVGDGFEFMKK-NQDAFDIIITDSSDPVGPAESLLKESYYQLMKTALCEGG 189

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            ++C Q E  WLH+ +I+ +   C+ +F   V+YA+ T+PTYPSG IGFMLCS +    +F
Sbjct: 190  ILCCQGECQWLHLELIKEMRTFCKTLFP-VVDYAYCTIPTYPSGQIGFMLCS-KNSKTNF 247

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            + P+  +    D      LK+YN EIH AAF LP FA+KV+
Sbjct: 248  REPLREL--TRDEIESMSLKYYNPEIHRAAFILPEFARKVL 286



>gb:AE017347_1757745 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 748

 Score =  157 bits (396), Expect(2) = 9e-72
 Identities = 74/137 (54%), Positives = 103/137 (75%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQ 674
           Q   +++ GWF EI+  WPG+A +LKV+++L + KS +QDV+VF+S TYG VLVLDGVIQ
Sbjct: 5   QSHPNIVDGWFREINTQWPGQAMTLKVKQVLHQEKSLFQDVLVFESETYGNVLVLDGVIQ 64

Query: 675 ITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVV 854
            TERDE +YQEMITHLP+ S PNP+ VLVI      V+REV +H SV ++ +C+ID+ V+
Sbjct: 65  ATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIREVLKHKSVKKVTLCDIDEAVI 124

Query: 855 DVAKQFFPDVAVGYEDP 905
            V+KQ+ P ++  Y+DP
Sbjct: 125 RVSKQWLPLMSDCYKDP 141



 Score =  138 bits (347), Expect(2) = 9e-72
 Identities = 67/158 (42%), Positives = 99/158 (62%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV +HIGDG  FL    +  YD +I DSSDP+GPA+ LF+ P+FQ +  AL+ GG V T
Sbjct: 141  PRVEVHIGDGFKFLPE-HKNEYDVIITDSSDPVGPAEALFQPPYFQLLKEALKEGGSVST 199

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAE +W+H+ +I+ +   C ++F   V Y +TT+PTYP+G IG M+C T+    D   P+
Sbjct: 200  QAECLWIHLPLIKTLKETCSKLFP-VVKYGFTTIPTYPAGQIGIMVC-TKDSTRDLTVPL 257

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
              + +          ++YNSE+H AAF +P F + ++E
Sbjct: 258  RAVPDT---------RYYNSEVHRAAFTIPEFGRAMLE 286



>sp|Q12074|SPEE_YEAST Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|S54090|S54090
           spermidine synthase (EC 2.5.1.16) SPE3 - yeast
           (Saccharomyces cerevisiae)>gb:SC9499X_1705966
           S.cerevisiae chromosome XVI cosmid
           9499.>gb:SCCHRXVI_1707136 S.cerevisiae chromosome XVI
           165536 bp sequence, cen rightwards.>gb:SCU27519_1710088
           Saccharomyces cerevisiae spermidine synthase (SPE3)
           gene, complete cds.>gb:YSCP9513_1730131 Saccharomyces
           cerevisiae chromosome XVI cosmid 9513.
          Length = 293

 Score =  157 bits (396), Expect(2) = 1e-71
 Identities = 77/134 (57%), Positives = 100/134 (74%), Gaps = 1/134 (0%)
 Frame = +3

Query: 507 SVIPGWFSEISP-MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++ GWF EIS  MWPG+A +LKVEK+L   KS YQDV++F+S+TYG VLVLD VIQ TE
Sbjct: 9   TIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVLDNVIQATE 68

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE AYQEMI HL L S PNPKKVLVI      VLREV +H SV++  +C+ID+ V+ ++
Sbjct: 69  RDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHDSVEEAWLCDIDEAVIRLS 128

Query: 864 KQFFPDVAVGYEDP 905
           K++ P++A  Y  P
Sbjct: 129 KEYLPEMAASYSHP 142



 Score =  137 bits (346), Expect(2) = 1e-71
 Identities = 67/155 (43%), Positives = 101/155 (65%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            P+V  HIGDG  FL++  + T+D +I DSSDP GPA+ LF+K +FQ +  AL   GV+ T
Sbjct: 142  PKVKTHIGDGFQFLRDY-QNTFDVIITDSSDPEGPAETLFQKEYFQLLNSALTEKGVITT 200

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAES+W+H+ II+++   C ++F     Y++ T+PTYP+G IGFM+CS +       +  
Sbjct: 201  QAESMWIHLPIIKDLKKACSEVFP-VAEYSFVTIPTYPTGTIGFMVCSKDKTC----NVK 255

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKK 1368
             P+ E +D K     ++YN +IH A+F LP++A K
Sbjct: 256  KPLREISDEKEAELYRYYNKKIHEASFVLPTWAAK 290



>gb:BX649606_1643475 Aspergillus fumigatus BAC pilot project
           supercontig; segment 2/3.
          Length = 293

 Score =  155 bits (392), Expect(2) = 1e-71
 Identities = 74/129 (57%), Positives = 98/129 (75%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GWFSE S MWPG+A +LKV ++L   KS YQDV+VF+S+ YG VLVLD VIQ TERDE +
Sbjct: 12  GWFSEQSDMWPGQAMNLKVNQILHHEKSKYQDVLVFESTDYGTVLVLDNVIQCTERDEFS 71

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           YQEMITHL + S PNPKKVLVI      VLREV +H SV++  +C+ID+ V+ V+K++ P
Sbjct: 72  YQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAILCDIDEAVIRVSKKYLP 131

Query: 879 DVAVGYEDP 905
            +++G++ P
Sbjct: 132 GMSIGFQHP 140



 Score =  139 bits (350), Expect(2) = 1e-71
 Identities = 68/164 (41%), Positives = 107/164 (65%), Gaps = 1/164 (0%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G + P V +HIGDG  FLK   +  +D +I DSSDP GPA+ LF+KP+F+ +  ALR G
Sbjct: 135  IGFQHPNVKVHIGDGFQFLKE-RKNEFDVIITDSSDPEGPAESLFQKPYFELLRDALRDG 193

Query: 1069 GVVCTQ-AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAV 1245
            GV+ TQ +E+ WLH+ +I ++   C+++F     YA+TT+PTYPSG IGFM+C  +    
Sbjct: 194  GVITTQGSENQWLHLSLITDLKKACKEVFP-VAEYAYTTIPTYPSGQIGFMVCCKDAT-- 250

Query: 1246 DFKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
              ++   P+   +  + +   ++YN +IH A+F LP+FA+K ++
Sbjct: 251  --RNVREPVRTWSREEEERLCRYYNQDIHRASFVLPNFARKALD 292



>gb:CR382122_1655207 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 293

 Score =  152 bits (384), Expect(2) = 8e-71
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 1/134 (0%)
 Frame = +3

Query: 507 SVIPGWFSEISP-MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +++ GWF EIS  MWPG+A +L+VEK+L   KS YQDV+VF+S+ YG VLVLD  IQ+TE
Sbjct: 8   TIVDGWFREISDTMWPGQAMTLRVEKILHHEKSKYQDVLVFKSTDYGNVLVLDNAIQVTE 67

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMI HL L S PNPKKVLVI      VLRE+ +H SV +  +C+ID+ V+ V+
Sbjct: 68  RDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDSVQEAWLCDIDEAVIRVS 127

Query: 864 KQFFPDVAVGYEDP 905
           K++ P++A  Y  P
Sbjct: 128 KEYLPEMAKSYSHP 141



 Score =  139 bits (351), Expect(2) = 8e-71
 Identities = 67/158 (42%), Positives = 106/158 (67%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            P+V  HIGDG  FL++  + T+D +I DSSDP GPA  LF++ +F+ +  AL   GV+ T
Sbjct: 141  PKVKTHIGDGFQFLRDY-QNTFDVIITDSSDPEGPAASLFQQSYFELLNGALTEKGVIST 199

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAES+W+H+ II+ +   C+++F  +V YA+TT+PTYP+G IGFM+CS +   VD   P+
Sbjct: 200  QAESMWIHLPIIKELKKACKEVFP-TVGYAYTTIPTYPTGQIGFMVCSKDA-NVDVTKPL 257

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
              I E  +   ++  ++YN ++H A+F LP++  K ++
Sbjct: 258  RSISEEEE---EAKYRYYNKKVHEASFVLPTWVAKELD 292



>gb:AY486138_1608546 Cryptococcus neoformans var. grubii chimeric
           spermidine synthase/saccharopine dehydrogenase gene,
           complete cds.
          Length = 750

 Score =  154 bits (390), Expect(2) = 2e-70
 Identities = 73/136 (53%), Positives = 102/136 (75%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQ 674
           Q   +++ GWF EI+  WPG+A +LKV+++L + KS +QDV+VF+S TYG VLVLDGVIQ
Sbjct: 5   QSHPNIVDGWFREINTQWPGQAMTLKVKQILHQEKSLFQDVLVFESETYGNVLVLDGVIQ 64

Query: 675 ITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVV 854
            TERDE +YQEMITHLP+ S PNP+ VLVI      V+REV +H SV ++ +C+ID+ V+
Sbjct: 65  ATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIREVLKHKSVKKVTLCDIDEAVI 124

Query: 855 DVAKQFFPDVAVGYED 902
            V+KQ+ P ++  Y+D
Sbjct: 125 RVSKQWLPLMSDCYKD 140



 Score =  135 bits (341), Expect(2) = 2e-70
 Identities = 66/157 (42%), Positives = 98/157 (62%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV +HIGDG  FL    +  YD +I DSSDP+GPA+ LF+ P+FQ +  AL+ GG V TQ
Sbjct: 142  RVEVHIGDGFKFLPE-HKNEYDVIITDSSDPVGPAEALFQPPYFQLLKEALKEGGSVSTQ 200

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            AE +W+H+ +I+ +   C ++F   V Y +TT+PTYP+G IG M+CS +    D   P+ 
Sbjct: 201  AECLWVHLPLIKTLKETCSKLFP-VVKYGFTTIPTYPAGQIGIMVCSKDSTR-DLTVPLR 258

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
             + +          ++YNSE+H AAF +P F + ++E
Sbjct: 259  AVPDT---------RYYNSEVHRAAFTIPEFGRAMLE 286



>gb:AF368901_1791927 Filobasidiella neoformans chimeric spermidine
           synthase/saccharopine dehydrogenase mRNA, partial cds.
          Length = 748

 Score =  154 bits (390), Expect(2) = 6e-70
 Identities = 73/136 (53%), Positives = 102/136 (75%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQ 674
           Q   +++ GWF EI+  WPG+A +LKV+++L + KS +QDV+VF+S TYG VLVLDGVIQ
Sbjct: 3   QSHPNIVDGWFREINTQWPGQAMTLKVKQILHQEKSLFQDVLVFESETYGNVLVLDGVIQ 62

Query: 675 ITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVV 854
            TERDE +YQEMITHLP+ S PNP+ VLVI      V+REV +H SV ++ +C+ID+ V+
Sbjct: 63  ATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIREVLKHKSVKKVTLCDIDEAVI 122

Query: 855 DVAKQFFPDVAVGYED 902
            V+KQ+ P ++  Y+D
Sbjct: 123 RVSKQWLPLMSDCYKD 138



 Score =  134 bits (337), Expect(2) = 6e-70
 Identities = 66/157 (42%), Positives = 97/157 (61%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV +HIGDG  FL    +  YD +I DSSDP+GPA+ LF+ P+FQ +  AL+ GG V TQ
Sbjct: 140  RVEVHIGDGFKFLPE-HKNEYDVIITDSSDPVGPAEALFQPPYFQLLKEALKEGGSVSTQ 198

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            AE +W+H+ +I+ +   C ++F   V Y +TT+PTYP+G IG M+CS +    D   P+ 
Sbjct: 199  AECLWVHLPLIKTLKETCSKLFP-VVKYGFTTIPTYPAGQIGIMVCSKDSTR-DLTVPLR 256

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
             +            ++YNSE+H AAF +P F + ++E
Sbjct: 257  AVPTP---------RYYNSEVHRAAFTIPEFGRAMLE 284



>gb:AE014186_938264 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014840_1228998 Plasmodium falciparum 3D7
           chromosome 11 section 5 of 8 of the complete sequence.
          Length = 321

 Score =  160 bits (406), Expect(2) = 1e-69
 Identities = 75/139 (53%), Positives = 105/139 (75%)
 Frame = +3

Query: 498 CFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQI 677
           CFS     WFSE S MWPG+A SLK++K+L++ KS YQ+V+VF+S+TYGKVLVLDGVIQ+
Sbjct: 38  CFSKK---WFSEFSIMWPGQAFSLKIKKILYETKSKYQNVLVFESTTYGKVLVLDGVIQL 94

Query: 678 TERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVD 857
           TE+DE AY EM+TH+P+     PK VLV+      ++RE+ ++ SV+ IDICEID+ V++
Sbjct: 95  TEKDEFAYHEMMTHVPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIE 154

Query: 858 VAKQFFPDVAVGYEDPPCN 914
           V+K +F +++ GYED   N
Sbjct: 155 VSKIYFKNISCGYEDKRVN 173



 Score =  127 bits (318), Expect(2) = 1e-69
 Identities = 68/163 (41%), Positives = 98/163 (60%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G    RV + I D   FL+NV   TYD +IVDSSDPIGPA+ LF + F++ +  AL+P G
Sbjct: 166  GYEDKRVNVFIEDASKFLENVTN-TYDVIIVDSSDPIGPAETLFNQNFYEKIYNALKPNG 224

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
                Q ES+W+H+  I+N++   +++FK  V YA  ++PTYP G IG + CS        
Sbjct: 225  YCVAQCESLWIHVGTIKNMIGYAKKLFK-KVEYANISIPTYPCGCIGILCCSKTDTG--- 280

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
               +   ++  ++K  + LK+YN E HSAAF LP+F  K IE+
Sbjct: 281  ---LTKPNKKLESKEFADLKYYNYENHSAAFKLPAFLLKEIEN 320



>gb:PFA271622_1392154 Plasmodium falciparum mRNA for spermidine
           synthase (spds gene).
          Length = 321

 Score =  158 bits (400), Expect(2) = 7e-69
 Identities = 73/139 (52%), Positives = 105/139 (75%)
 Frame = +3

Query: 498 CFSSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQI 677
           CFS     WFSE S MWPG+A S++++K+L++ KS YQ+V+VF+S+TYGKVLVLDGVIQ+
Sbjct: 38  CFSKK---WFSEFSIMWPGQAFSVEIKKILYETKSKYQNVLVFESTTYGKVLVLDGVIQL 94

Query: 678 TERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVD 857
           TE+DE AY EM+TH+P+     PK VLV+      ++RE+ ++ SV+ IDICEID+ V++
Sbjct: 95  TEKDEFAYHEMMTHIPMTVSKEPKNVLVVGGGDGGIIRELCKYKSVENIDICEIDETVIE 154

Query: 858 VAKQFFPDVAVGYEDPPCN 914
           V+K +F +++ GYED   N
Sbjct: 155 VSKIYFKNISCGYEDKRVN 173



 Score =  127 bits (318), Expect(2) = 7e-69
 Identities = 68/163 (41%), Positives = 98/163 (60%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G    RV + I D   FL+NV   TYD +IVDSSDPIGPA+ LF + F++ +  AL+P G
Sbjct: 166  GYEDKRVNVFIEDASKFLENVTN-TYDVIIVDSSDPIGPAETLFNQNFYEKIYNALKPNG 224

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
                Q ES+W+H+  I+N++   +++FK  V YA  ++PTYP G IG + CS        
Sbjct: 225  YCVAQCESLWIHVGTIKNMIGYAKKLFK-KVEYANISIPTYPCGCIGILCCSKTDTG--- 280

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
               +   ++  ++K  + LK+YN E HSAAF LP+F  K IE+
Sbjct: 281  ---LTKPNKKLESKEFADLKYYNYENHSAAFKLPAFLLKEIEN 320



>gb:CR382136_1669065 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 297

 Score =  151 bits (381), Expect(2) = 1e-68
 Identities = 74/134 (55%), Positives = 100/134 (74%), Gaps = 1/134 (0%)
 Frame = +3

Query: 507 SVIPGWFSEISP-MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           S+  GWF+EIS  MWPG+A SLKVEK+L   KS YQDV+VF+S+ YG VLVLD  IQ TE
Sbjct: 9   SIKDGWFAEISDTMWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTDYGNVLVLDDCIQCTE 68

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE +YQEMI HL L S PNPKK LVI      VLRE+ +H S+++  +C+ID+ V++V+
Sbjct: 69  RDEFSYQEMIAHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDIDETVIEVS 128

Query: 864 KQFFPDVAVGYEDP 905
           K++ P+++  Y++P
Sbjct: 129 KKYLPEMSQSYKNP 142



 Score =  133 bits (335), Expect(2) = 1e-68
 Identities = 69/160 (43%), Positives = 101/160 (63%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  +HIGDG  FL    +  +D +I DSSDP GPA+ LF+KP+F+ +  AL   GV+ T
Sbjct: 142  PRTKVHIGDGFKFLAEY-KNQFDVIITDSSDPEGPAESLFQKPYFRLLKDALTEKGVITT 200

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QAE+I+LHM II  +  +C++IF     Y +T +PTYPSG IGFM+CS + P  +   P+
Sbjct: 201  QAENIFLHMEIISRLKKDCKEIFP-VAEYGYTMIPTYPSGSIGFMVCSKD-PNANVTKPL 258

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                + +D   +  LK+YN +IH A F LP++A + +  +
Sbjct: 259  R--FDWDDEFVRKNLKYYNKKIHEACFVLPTWADEKLNKQ 296



>gb:AE016817_1747043 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 293

 Score =  145 bits (367), Expect(2) = 5e-68
 Identities = 73/130 (56%), Positives = 96/130 (73%), Gaps = 1/130 (0%)
 Frame = +3

Query: 519 GWFSEISP-MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           GWF EIS  MWPG+A +L+VEK+L   KS YQDV+VF+S+ +G VLVLD V+Q +ERDE 
Sbjct: 13  GWFREISDTMWPGQAMTLRVEKVLHHEKSKYQDVLVFKSTNHGNVLVLDNVVQCSERDEF 72

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           AYQEMITHL +    NPKKVLVI      VLREV +H SV++  +C+ID+ V+ V+KQ+ 
Sbjct: 73  AYQEMITHLAMNLHANPKKVLVIGGGDGGVLREVLKHESVEEAWLCDIDEAVIRVSKQYL 132

Query: 876 PDVAVGYEDP 905
           P+++  YE P
Sbjct: 133 PEMSRSYEHP 142



 Score =  137 bits (344), Expect(2) = 5e-68
 Identities = 68/155 (43%), Positives = 101/155 (65%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            P+V  HIGDG  FL++    T+D +I DSSDP GPA+ LFE+P+F  + +AL   GV+ T
Sbjct: 142  PKVKTHIGDGFQFLRDYPN-TFDVIITDSSDPEGPAEALFEQPYFSLLNQALTENGVITT 200

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
              ES+++HM II+ +   C Q+F  +V YA+ +VPTYPSG IGFM+CS +   ++   P+
Sbjct: 201  HPESLFIHMEIIKQLKGTCSQLFP-NVGYAYASVPTYPSGQIGFMVCS-KNADIELSKPL 258

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKK 1368
              I   +D + +   K+Y+ ++H A F LP+FA K
Sbjct: 259  RTI---SDEQERELYKYYSKKMHEACFVLPTFAAK 290



>gb:CEL306734_1365802 Caenorhabditis elegans mRNA for spermidine
           synthase (spds gene).>gb:CEY46G5A_1370136 Caenorhabditis
           elegans YAC Y46G5A, complete sequence.
          Length = 314

 Score =  154 bits (389), Expect(2) = 2e-67
 Identities = 69/125 (55%), Positives = 98/125 (78%)
 Frame = +3

Query: 531 EISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEM 710
           E+   WPG+A SL+V+K+LF  KS YQDV+VF+S+TYG VLVLDG++Q TERDE +YQEM
Sbjct: 38  EMGGAWPGQAFSLQVKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEM 97

Query: 711 ITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAV 890
           + HLP+ + P+PK+VL+I      +LREV +H SV+++ +CEID+MV+DVAK+F P ++ 
Sbjct: 98  LAHLPMFAHPDPKRVLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMSC 157

Query: 891 GYEDP 905
           G+  P
Sbjct: 158 GFSHP 162



 Score =  126 bits (316), Expect(2) = 2e-67
 Identities = 67/162 (41%), Positives = 102/162 (62%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   P++ L  GDG  FLKN  +  +D +I DSSDP+GPA+ LF + +++ +  AL+  G
Sbjct: 158  GFSHPKLDLFCGDGFEFLKN-HKNEFDVIITDSSDPVGPAESLFGQSYYELLRDALKEDG 216

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            ++ +Q ES+WLH+ +I ++VA  R+IF  +V YA + V TYPSG +G+++C+      D 
Sbjct: 217  ILSSQGESVWLHLPLIAHLVAFNRKIFP-AVTYAQSIVSTYPSGSMGYLICAKNANR-DV 274

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
              P   +  A   K+ + L+FYNSE+H AAF LP F K  +E
Sbjct: 275  TTPARTL-TAEQIKALN-LRFYNSEVHKAAFVLPQFVKNALE 314



>gb:CR382124_1657079 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 296

 Score =  145 bits (365), Expect(2) = 8e-61
 Identities = 66/133 (49%), Positives = 100/133 (75%), Gaps = 1/133 (0%)
 Frame = +3

Query: 519 GWFSEISPM-WPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           GWF+E+S   +PG+A SLKV K+LF  K+ +QD+++F+SS YG VLVLDG+IQ++E+DE 
Sbjct: 11  GWFNEVSDKSFPGQAFSLKVNKILFHEKTQFQDILIFESSNYGNVLVLDGIIQVSEKDEF 70

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           AYQE+I+H+PL S  NPKK+LVI      VLREV +H+ V++  + EID  V++++K++ 
Sbjct: 71  AYQELISHVPLYSHENPKKILVIGGGDGGVLREVVKHSCVEEATLVEIDAKVIELSKKYL 130

Query: 876 PDVAVGYEDPPCN 914
           P++A  ++ P  N
Sbjct: 131 PNMACSFKHPKVN 143



 Score =  113 bits (283), Expect(2) = 8e-61
 Identities = 62/160 (38%), Positives = 100/160 (62%), Gaps = 3/160 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAE-GT-YDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVV 1077
            P+V + + DG  FL++VAE GT YD +I DSSDP GPA+  F+K +F+ + +AL   GVV
Sbjct: 140  PKVNVKLCDGFQFLRDVAESGTKYDVIITDSSDPEGPAEAFFQKEYFELLYKALTENGVV 199

Query: 1078 CTQA-ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFK 1254
              QA E++WL++  ++ ++   R +F     Y +T +PTY SG +G + C  + P  +  
Sbjct: 200  IAQASENVWLNLEYLKTLLNTSRSVFP-VAEYCYTMLPTYTSGQLGLIAC-CKNPNTNLI 257

Query: 1255 HPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
             P      A     +S +++YN+++HSAAF LP++A+KV+
Sbjct: 258  DPC----RAPTEDEQSQMRYYNNKMHSAAFVLPTWARKVL 293



>gb:CR382131_1663655 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 300

 Score =  140 bits (354), Expect(2) = 3e-60
 Identities = 64/133 (48%), Positives = 100/133 (75%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           +S+   WF+E+S  +PG+   LKVE++L   +S++QDV+VF+S+ YG VLVLDGV+Q++E
Sbjct: 9   ASIKNSWFTEVSDSFPGQGLMLKVEEILHVSQSEFQDVLVFRSTEYGNVLVLDGVVQVSE 68

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           RDE AYQEMI H+ + S   PK+VLVI      VLRE+ +H SV+   +CEID+ V++++
Sbjct: 69  RDEFAYQEMICHVAMMSHECPKRVLVIGGGDGGVLREIVKHESVEAAHLCEIDESVIELS 128

Query: 864 KQFFPDVAVGYED 902
           K++ P++AVG+++
Sbjct: 129 KKYLPNMAVGFDN 141



 Score =  115 bits (289), Expect(2) = 3e-60
 Identities = 64/169 (37%), Positives = 98/169 (57%), Gaps = 6/169 (3%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGT--YDAVIVDSSDPIGPAQELFEKPFFQTVARALR 1062
            +G    +VT+HI DG  F++ VA     YD +I DSSDP GPA++ F++ +FQ +  AL 
Sbjct: 137  VGFDNTKVTVHIRDGFEFIREVARSDEKYDVIITDSSDPDGPAEKFFQREYFQLLHTALN 196

Query: 1063 PGGVVCTQ-AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGP 1239
              G+V TQ +E++WL+   ++ +   C+ +F  SV Y    +PTY SG +G M+CS    
Sbjct: 197  DDGIVITQSSENVWLNFKFVKQLRDICKGVF-ASVEYCAALLPTYTSGQLGLMVCS---- 251

Query: 1240 AVDFKHPIN---PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
                K P N   P  +    +  S +++YN EIH A+F LP++AK  +E
Sbjct: 252  ----KKPTNLKIPKRQWTQEEESSLVRYYNKEIHEASFVLPNWAKHFLE 296



>gb:LMFLCHR4B_1388533 Leishmania major Friedlin chromosome 4, right
            end.
          Length = 300

 Score =  138 bits (347), Expect(2) = 5e-58
 Identities = 71/163 (43%), Positives = 100/163 (61%), Gaps = 1/163 (0%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   P VT  +GDG AF++NV +  YD +I+D++DP GPA ELF   F+  V R LRPGG
Sbjct: 142  GFANPCVTATVGDGAAFVRNVPDSVYDVIIIDTTDPKGPASELFGADFYTNVLRILRPGG 201

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQ-IFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            VVC Q ES+WLH  +IE ++   ++ I   +V YA   +PTYP G IG ++C+ +    D
Sbjct: 202  VVCNQGESVWLHRPLIEKMMGFLKKDIGFATVKYAMIYIPTYPCGSIGTLVCA-KSADTD 260

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
               P+ P++    A     LK+Y+S++H AAF LP FA  + E
Sbjct: 261  VTVPMRPVESLGFA---DQLKYYSSDMHKAAFVLPRFAAHLNE 300



 Score =  111 bits (277), Expect(2) = 5e-58
 Identities = 58/137 (42%), Positives = 84/137 (61%), Gaps = 8/137 (5%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSST---YGKVLVLDGVIQITERD 689
           GWF E S MWPG+A  LKVEK+L+   +++Q + VF+S     +G V+ LDG IQ+T+ D
Sbjct: 10  GWFREESTMWPGQAQGLKVEKVLYDQPTEFQHLTVFESDPSGPWGTVMTLDGAIQLTDYD 69

Query: 690 ECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHAS-----VDQIDICEIDKMVV 854
           E  Y EM+ +L L     P++VLVI      V+REV RH S     V  +++ +ID  V+
Sbjct: 70  EFVYHEMLANLSLACHHKPERVLVIGGGDGGVVREVLRHKSEKDGVVQSVELVDIDGAVM 129

Query: 855 DVAKQFFPDVAVGYEDP 905
             +K+ FP VA G+ +P
Sbjct: 130 QQSKKHFPQVACGFANP 146



>gb:BT003549_1356951 Drosophila melanogaster RE01362 full insert
           cDNA.
          Length = 299

 Score =  138 bits (348), Expect(2) = 8e-58
 Identities = 64/137 (46%), Positives = 98/137 (71%), Gaps = 1/137 (0%)
 Frame = +3

Query: 489 GEQCFSSVIPGWFSEI-SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDG 665
           G +   S+  GWFSE+ + +WPG++ SLKV++++ K KS +QD+ + ++ TYG+ L+LDG
Sbjct: 9   GIKQMDSLNNGWFSELQADLWPGQSFSLKVKEVIHKEKSRFQDIQIVETETYGRCLILDG 68

Query: 666 VIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDK 845
           +IQ T RDE +YQEMI+ LPLC+ PNPKKVL++      V REV +H  V+++   EID 
Sbjct: 69  IIQCTARDEFSYQEMISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDD 128

Query: 846 MVVDVAKQFFPDVAVGY 896
            VV+++KQ+ P +A G+
Sbjct: 129 RVVELSKQYLPAMACGF 145



 Score =  110 bits (274), Expect(2) = 8e-58
 Identities = 61/159 (38%), Positives = 94/159 (59%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G    ++ L IGDG  ++K   +  +D +I DSSDPIGPA  LF++ +++ +  AL+  G
Sbjct: 144  GFANEKLKLTIGDGFDYMKK-HKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKDDG 202

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            +VC+Q  S WL +  I+  ++ C++ F   V YA T+VP+YP G IGF++ S      DF
Sbjct: 203  IVCSQGGSFWLDLDYIKKTMSGCKEHF-AKVAYAVTSVPSYPCGHIGFVMGSL-NKNQDF 260

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKK 1368
              P     E +       L++Y+SE+HSAAF LP + +K
Sbjct: 261  ATPKLGKSEIDSI----DLRYYSSEVHSAAFALPRWVQK 295



>gb:AE014297_1138706 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003683_1220699 Drosophila melanogaster
           chromosome 3R, section 21 of 118 of the complete
           sequence.
          Length = 287

 Score =  138 bits (347), Expect(2) = 1e-57
 Identities = 62/127 (48%), Positives = 94/127 (74%), Gaps = 1/127 (0%)
 Frame = +3

Query: 519 GWFSEI-SPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           GWFSE+ + +WPG++ SLKV++++ K KS +QD+ + ++ TYG+ L+LDG+IQ T RDE 
Sbjct: 7   GWFSELQADLWPGQSFSLKVKEVIHKEKSRFQDIQIVETETYGRCLILDGIIQCTARDEF 66

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           +YQEMI+ LPLC+ PNPKKVL++      V REV +H  V+++   EID  VV+++KQ+ 
Sbjct: 67  SYQEMISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVELSKQYL 126

Query: 876 PDVAVGY 896
           P +A G+
Sbjct: 127 PAMACGF 133



 Score =  110 bits (274), Expect(2) = 1e-57
 Identities = 61/159 (38%), Positives = 94/159 (59%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G    ++ L IGDG  ++K   +  +D +I DSSDPIGPA  LF++ +++ +  AL+  G
Sbjct: 132  GFANEKLKLTIGDGFDYMKK-HKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKDDG 190

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            +VC+Q  S WL +  I+  ++ C++ F   V YA T+VP+YP G IGF++ S      DF
Sbjct: 191  IVCSQGGSFWLDLDYIKKTMSGCKEHF-AKVAYAVTSVPSYPCGHIGFVMGSL-NKNQDF 248

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKK 1368
              P     E +       L++Y+SE+HSAAF LP + +K
Sbjct: 249  ATPKLGKSEIDSI----DLRYYSSEVHSAAFALPRWVQK 283



>gb:OSA251302_1692416 Oryza sativa partial mRNA for putative
            aminopropyltransferase (spdSyn gene).
          Length = 197

 Score =  225 bits (574), Expect = 2e-57
 Identities = 101/159 (63%), Positives = 133/159 (83%), Gaps = 1/159 (0%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV LH+GD V FL+N  EG YDA+IVDSSDPIGPAQEL EKPFFQT+ARAL+P GV+C Q
Sbjct: 6    RVQLHVGDAVDFLRNAPEGKYDAIIVDSSDPIGPAQELVEKPFFQTIARALKPAGVLCNQ 65

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            AES+WLH H+I+++++ CR+ FKG+V+YAWT+VPTYPSGVIGF+LC+ EGPAV+F  P+N
Sbjct: 66   AESMWLHTHLIQDMLSICRETFKGAVHYAWTSVPTYPSGVIGFLLCAKEGPAVNFLSPVN 125

Query: 1267 PIDEANDA-KSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            PI++   A ++   ++FYNSE+H AAF LP+F ++ +ES
Sbjct: 126  PIEKLEGAMEAGREIRFYNSEVHRAAFVLPTFVRRELES 164



>gb:AF298195_1260012 Leishmania donovani spermidine synthase gene,
            complete cds.
          Length = 300

 Score =  135 bits (341), Expect(2) = 3e-57
 Identities = 70/163 (42%), Positives = 99/163 (60%), Gaps = 1/163 (0%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G   P VT  +GDG AF+K   +  YD +I+D++DP GPA ELF   F+  V R LRPGG
Sbjct: 142  GFANPCVTATVGDGAAFVKRAPDSVYDVIIIDTTDPKGPASELFGADFYTNVLRILRPGG 201

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQ-IFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            V+C Q ES+WLH  +IE ++   ++ I   +VNYA   +PTYP G IG ++C+ +    D
Sbjct: 202  VLCNQGESVWLHRPLIEMMMGFLKKDIGFATVNYAMIYIPTYPCGSIGTLVCA-KSADTD 260

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
               P+ P++    A     LK+Y+S++H AAF LP FA  + E
Sbjct: 261  VTVPMRPVESLGFA---DQLKYYSSDMHKAAFVLPRFAAHLNE 300



 Score =  110 bits (276), Expect(2) = 3e-57
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 8/137 (5%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSST---YGKVLVLDGVIQITERD 689
           GWF E S MWPG+A  LKVEK+L+   +++Q + VF+S     +G V+ LDG IQ+T+ D
Sbjct: 10  GWFREESTMWPGQAQGLKVEKVLYDQPTEFQHLTVFESDPSGPWGTVMTLDGAIQLTDYD 69

Query: 690 ECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHAS-----VDQIDICEIDKMVV 854
           E  Y EM+ +L L     P++VL+I      V+REV RH S     V  +++ +ID  V+
Sbjct: 70  EFVYHEMLANLSLTCHHKPERVLIIGGGDGGVVREVLRHKSEKDGIVQSVELVDIDGAVI 129

Query: 855 DVAKQFFPDVAVGYEDP 905
             +K+ FP +A G+ +P
Sbjct: 130 QQSKKHFPQIACGFANP 146



>gb:CR380959_1653850 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 298

 Score =  132 bits (333), Expect(2) = 3e-56
 Identities = 63/130 (48%), Positives = 95/130 (73%), Gaps = 1/130 (0%)
 Frame = +3

Query: 519 GWFSEISPM-WPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           GWF E+S   +PG+A +LKV+++L++ KS++QD++VF+S+ +G  LVLDG+IQ +ERDE 
Sbjct: 10  GWFYEMSDEHFPGQALALKVKQVLYQSKSEFQDILVFESTNHGVCLVLDGIIQCSERDEF 69

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           AYQEMI H+PL    NPKKVLVI      V+REV +H  V+ + + EIDK V+++AK++ 
Sbjct: 70  AYQEMIAHIPLYCHANPKKVLVIGGGDGGVVREVVKHDKVESVTMVEIDKTVIELAKKYL 129

Query: 876 PDVAVGYEDP 905
           P ++   + P
Sbjct: 130 PGMSCAMDHP 139



 Score =  110 bits (276), Expect(2) = 3e-56
 Identities = 56/165 (33%), Positives = 98/165 (59%), Gaps = 5/165 (3%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVA----EGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            P++ L++ DG  FLK  +    +  YD +I DSSDP GPA+  F+K +F+ +  AL+P G
Sbjct: 139  PKLKLNLCDGFKFLKEASMLSNDDKYDVIITDSSDPDGPAEAFFQKEYFELLQNALKPDG 198

Query: 1072 VVCTQA-ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            +V  QA E++WL ++ + ++     ++F  ++  ++TTVPTY SG +G ++C+       
Sbjct: 199  IVIAQASENVWLDINYLASLRKTANEVFTNTM-ISYTTVPTYTSGQLGLIVCTNSN---- 253

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
              + +           ++ L++YNS+IHSA+F LP++A  +I  K
Sbjct: 254  -DYDLTTPQRQPSVSEQNQLRYYNSQIHSASFVLPNWADMLIYDK 297



>sp|Q8EXA3|SPE2_LEPIN Spermidine synthase 2 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 2) (SPDSY 2).>gb:AE011617_274907
            Leptospira interrogans serovar lai str. 56601 chromosome
            II, section 29 of 34 of the complete
            sequence.>gb:AE010301_1003581 Leptospira interrogans
            serovar lai str. 56601 chromosome II, complete sequence.
          Length = 281

 Score =  122 bits (306), Expect(2) = 2e-55
 Identities = 68/163 (41%), Positives = 99/163 (60%)
 Frame = +1

Query: 895  MRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGV 1074
            M+ PRV     DG  ++K+  +  +D ++VDSSDP+GPA+ LF++PF++T+A  L+ GG+
Sbjct: 129  MKDPRVKHAYEDGAKYVKDY-QNYFDCIMVDSSDPVGPAEVLFKRPFYETMANCLKEGGI 187

Query: 1075 VCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFK 1254
              TQ ES + H  II  +     +IFK    Y +T VPTYPSG+IGF  CS +GP     
Sbjct: 188  CTTQGESFYYHGSIIRELFNFIPEIFK-HCGYYYTVVPTYPSGIIGFTYCS-KGP----- 240

Query: 1255 HPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
             P   + +    +    LK+Y++E+H AAF LP FA+K I  K
Sbjct: 241  DPYTVVPDPQ--RVPQGLKYYSAEMHKAAFVLPQFAQKHIVRK 281



 Score =  118 bits (295), Expect(2) = 2e-55
 Identities = 55/128 (42%), Positives = 82/128 (64%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           W  E   +  G A  +KV++ L    + +Q + VF+S  +G++  LDGV+ +TE DE AY
Sbjct: 5   WLDEALELKNGRALKIKVKEFLHSRTTPFQKIDVFESVGFGRMFTLDGVVMMTEADEFAY 64

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EMI H+P+ S PNP+KVLVI       +REV +H SV ++ +CEIDK V+DV  ++FP+
Sbjct: 65  HEMIVHVPMMSHPNPEKVLVIGGGDGGTVREVLKHPSVKEVHLCEIDKGVIDVCYEYFPE 124

Query: 882 VAVGYEDP 905
           +A   +DP
Sbjct: 125 IANAMKDP 132



>sp|Q12455|SPSY_YEAST Spermine synthase (EC 2.5.1.22) (Spermidine
           aminopropyltransferase) (SPMSY).>pir|S64995|S64995
           probable spermidine synthase (EC 2.5.1.16) YLR146c -
           yeast  (Saccharomyces cerevisiae)>gb:SCYLR146C_1713569
           S.cerevisiae chromosome XII reading frame ORF
           YLR146c.>gb:YSCL9634_1729738 Saccharomyces cerevisiae
           chromosome XII cosmid 9634.>gb:AF067970_1765631
           Saccharomyces cerevisiae spermine synthase (SPE4) gene,
           complete cds.
          Length = 300

 Score =  127 bits (320), Expect(2) = 1e-53
 Identities = 58/129 (44%), Positives = 94/129 (72%), Gaps = 1/129 (0%)
 Frame = +3

Query: 519 GWFSEISPM-WPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           GWF EI+   +PG+A ++ V+ +L++ +S++QD+++F++  YG VLVLDG++Q TE DE 
Sbjct: 13  GWFREINDKSFPGQAFTMTVDSILYEARSEFQDILIFRNKVYGTVLVLDGIVQCTEFDEF 72

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           AYQEMITH+ + +  NPK+VL+I      VLREVA+H+ V+ I + EID  V++++++F 
Sbjct: 73  AYQEMITHIAMFAHSNPKRVLIIGGGDGGVLREVAKHSCVEDITMVEIDSSVIELSRKFL 132

Query: 876 PDVAVGYED 902
           P ++ G  D
Sbjct: 133 PTLSNGAFD 141



 Score =  106 bits (265), Expect(2) = 1e-53
 Identities = 57/161 (35%), Positives = 93/161 (57%), Gaps = 5/161 (3%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGT----YDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGV 1074
            R+ L + DG  FL+++        +D +I DSSDP GPA+  F++ +F+ +  AL P GV
Sbjct: 144  RLDLKLCDGFKFLQDIGASDVHKKFDVIITDSSDPEGPAEAFFQERYFELLKDALNPNGV 203

Query: 1075 VCTQ-AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            V  Q +E+ WL++  + ++    +++F  +  Y +T VPTY SG +G ++CS        
Sbjct: 204  VIMQSSENFWLNLKYLHDLKNTAKKVFP-NTEYCYTMVPTYTSGQLGLIVCSNNA----- 257

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
              P+N        + +  LK+YN +IHS+AF LP++A KVI
Sbjct: 258  NIPLNIPQRKISEQEQGKLKYYNPQIHSSAFVLPTWADKVI 298



>gb:CR382137_1670260 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 314

 Score =  120 bits (302), Expect(2) = 1e-48
 Identities = 59/131 (45%), Positives = 93/131 (70%), Gaps = 3/131 (2%)
 Frame = +3

Query: 522 WFSEISPM-WPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           WF E S   +PG+A +L+++++L+   S YQD+++F+S+T+G VLVL+G+IQ TERDE A
Sbjct: 26  WFHETSAEGFPGQAFALEIDQILYHVHSQYQDILIFKSTTFGNVLVLNGIIQCTERDEFA 85

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARH--ASVDQIDICEIDKMVVDVAKQF 872
           YQE+ITHLP+    +P++VLVI      V+RE+ +H    VD+I + EID MV+ +  +F
Sbjct: 86  YQELITHLPIMCHASPRRVLVIGGGDCGVVRELIKHLDEGVDEITMVEIDDMVIKLLAKF 145

Query: 873 FPDVAVGYEDP 905
            P++A  ++ P
Sbjct: 146 LPEMAKFHDHP 156



 Score = 97.1 bits (240), Expect(2) = 1e-48
 Identities = 53/163 (32%), Positives = 95/163 (58%), Gaps = 4/163 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNV---AEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGV 1074
            PRV + I DG  +LK++   A   YD +I DSSDP GPA++ F+  +F+ ++ AL P G+
Sbjct: 156  PRVKMIIDDGFKYLKSLSAQAHEKYDVIITDSSDPDGPAEDFFQTNYFKLLSNALNPDGI 215

Query: 1075 VCTQ-AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            V  Q +E+IWL+++ +  ++    ++F  +V Y+   +P+Y SG +G ++ + +   V  
Sbjct: 216  VIMQSSENIWLNINYLSQLMQKANRVF-NNVAYSQCYMPSYTSGQLGLIVATNDTSNV-- 272

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
                 P  + +  K     K+Y+S +H A+F LP++A K + +
Sbjct: 273  --LSIPSRKFSPEKELHLFKYYSSSVHQASFVLPTWAHKTLNN 313



>gb:AP006840_567206 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 287

 Score =  105 bits (262), Expect(2) = 9e-44
 Identities = 46/115 (40%), Positives = 75/115 (65%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S++  ++L   K+ YQ+++V ++  +G+++ LDG  Q  +RDE  Y EM  H+PLC+ PN
Sbjct: 16  SVRATRVLHHEKTPYQELLVVETPQWGRLMALDGFFQTCDRDEFVYHEMGAHVPLCTHPN 75

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
           P++VL+I      + RE ARH  V+++D+ EID+ VV+  KQ+FP +AV     P
Sbjct: 76  PRRVLIIGGGDGGMAREAARHPEVERVDLVEIDERVVECCKQYFPQIAVALSGNP 130



 Score = 96.3 bits (238), Expect(2) = 9e-44
 Identities = 57/163 (34%), Positives = 89/163 (54%), Gaps = 1/163 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            P+V +HI DG+ +++   E  YD VI+DSS+PIGP + LF   F+  V R L+  G++  
Sbjct: 130  PKVHVHIADGIQWVQE-HEAEYDVVIIDSSEPIGPGEGLFTANFYARVFRCLKDDGILVA 188

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q ES W++  +I+      RQ F  +  Y    VPTYP+G+  F L S        K+  
Sbjct: 189  QTESPWVNAPVIQRAYRGIRQSFPITRLYT-CAVPTYPTGLWSFTLGSK-------KYDP 240

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI-ESKAE 1389
               +      +   L++Y  E+H AAF LP F ++++ E++AE
Sbjct: 241  LQAEPEKRVGTLGELRYYTPEVHRAAFQLPVFVQRILAEAEAE 283



>sp|Q9K6B8|SPEE_BACHD Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|C84126|C84126
           spermidine synthase BH3811 [imported] - Bacillus
           halodurans  (strain C-125)>gb:BA000004_657757 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 275

 Score =  102 bits (255), Expect(2) = 3e-43
 Identities = 45/112 (40%), Positives = 73/112 (65%)
 Frame = +3

Query: 570 KVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPK 749
           K+++ L   K+D+Q + V ++  +G +LVLDG++  TE+DE  Y EM+ H+PL + PNPK
Sbjct: 18  KIKRTLHTEKTDFQQLDVIETEEFGNMLVLDGMVMTTEKDEFVYHEMVAHVPLFTHPNPK 77

Query: 750 KVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
            VLV+      V+REV +H SV++  + EID  V++ +K++ P +A    DP
Sbjct: 78  HVLVVGGGDGGVIREVLKHPSVEKATLVEIDGKVIEYSKKYLPSIATALNDP 129



 Score = 97.1 bits (240), Expect(2) = 3e-43
 Identities = 52/158 (32%), Positives = 85/158 (53%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV + + DG   +   AE  YD ++VDS++P+GPA +LFEK F+Q +A+AL+  G+   
Sbjct: 129  PRVDVQVDDGFLHIAK-AESAYDVIMVDSTEPVGPAVKLFEKGFYQGIAKALKEDGIFVA 187

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q ++ W H  +I  + A+ ++IF  +  Y    +PTYPSG+  F + S            
Sbjct: 188  QTDNPWFHGELIRKVYADVQEIFPITRLYT-ANIPTYPSGLWTFTIGS---------KTY 237

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            +P+            K++  ++H AAF LP F   +I+
Sbjct: 238  DPLHVEPSRFYDIETKYFTKDLHKAAFALPRFVDDLIK 275



>sp|Q8XMY8|SPEE_CLOPE Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:BA000016_673590
           Clostridium perfringens str. 13 DNA, complete genome.
          Length = 283

 Score =  111 bits (277), Expect(2) = 1e-41
 Identities = 52/127 (40%), Positives = 82/127 (64%), Gaps = 6/127 (4%)
 Frame = +3

Query: 543 MWPGEAH------SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           +W  E H      S+KV++ L+ GKSD+Q + VF+S  +G    LDG++ +TE+DE  Y 
Sbjct: 3   LWYTEEHTDKVRFSIKVDEQLYSGKSDFQRIDVFKSQEFGTFFTLDGLMMVTEKDEFIYH 62

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDV 884
           +MI H+P+ + PN K VLVI       +RE+ R+ ++++ID+ EIDK+VVDV +++ P  
Sbjct: 63  DMIVHVPMATNPNIKNVLVIGAGDGGTVRELTRYETIEKIDMVEIDKLVVDVCREYLPQT 122

Query: 885 AVGYEDP 905
           A   +DP
Sbjct: 123 ANKLDDP 129



 Score = 83.2 bits (204), Expect(2) = 1e-41
 Identities = 54/165 (32%), Positives = 90/165 (54%), Gaps = 3/165 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV+L   DG+ F+++V E  YD +IVDS+DP GP + LF + F+    +AL+  G++  
Sbjct: 129  PRVSLFFEDGLKFVRSV-ENKYDLIIVDSTDPFGPGEGLFTREFYGNCFKALKEDGILVN 187

Query: 1084 QAESIWLHMHI--IENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q ES +   +   ++      ++ F     Y    +PTYPSG   F   S +        
Sbjct: 188  QHESPYYEEYARGMKRAHKRIKECFPVCRVYQ-AHIPTYPSGHWLFGFASKK------YD 240

Query: 1258 PIN-PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
            P+N  I++ ND   K+  K+YN+++H   F LP++ K+++E+  E
Sbjct: 241  PLNADIEKWNDLGLKT--KYYNTDLHKGCFALPNYVKEMLENVDE 283



>sp|Q8RA94|SPE1_THETN Spermidine synthase 1 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 1) (SPDSY
           1).>gb:AE013093_288981 Thermoanaerobacter tengcongensis
           MB4, section 120 of 244 of the complete
           genome.>gb:AE008691_1111046 Thermoanaerobacter
           tengcongensis strain MB4, complete genome.
          Length = 277

 Score =  101 bits (251), Expect(2) = 2e-41
 Identities = 47/114 (41%), Positives = 76/114 (66%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S+KV++ L   K+ YQ + +  S  +G+VLVLDG++Q TE+DE  Y EMI H+PL +  N
Sbjct: 16  SIKVKETLVVEKTPYQHLAILDSYQFGRVLVLDGILQTTEKDEFVYHEMIVHVPLFTHKN 75

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           PK VL+I       +REV +H+SV+++ + EID+ V+  +K++ P ++   +DP
Sbjct: 76  PKDVLIIGGGDGGSVREVLKHSSVERVVLAEIDEAVIRNSKKYLPTISSALDDP 129



 Score = 92.8 bits (229), Expect(2) = 2e-41
 Identities = 55/158 (34%), Positives = 85/158 (53%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV + IGDG+ ++ N  +  +D VIVDS+DPIGPA  LF   F++ V   LR  G++  
Sbjct: 129  PRVEIMIGDGIKYV-NEHKNEFDVVIVDSTDPIGPAVGLFTSDFYRAVYECLREDGIIVA 187

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q ES +++  +I  I    ++I+  +  Y   TVPTYP  +  F + S +          
Sbjct: 188  QTESPFIYGKLINKISKMFKEIYPITKAYI-ATVPTYPGSLWTFTMGSKK---------Y 237

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            +P +   ++  +   K+Y  EIH AAF LP F K + +
Sbjct: 238  DPEEVDINSIPRIQTKYYTPEIHKAAFVLPKFVKDIFD 275



>gb:AP006840_568802 Symbiobacterium thermophilum DNA, complete genome.
          Length = 284

 Score = 95.5 bits (236), Expect(2) = 1e-40
 Identities = 60/162 (37%), Positives = 92/162 (56%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            GM  P+V L +GDG+A++ + A+  YD +IVDSSDP+GPA+ LF + F++ V RAL+  G
Sbjct: 127  GMDHPKVNLVVGDGIAWVADHAD-EYDVIIVDSSDPVGPAKGLFNQAFYKNVFRALKADG 185

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            +   Q  S + H  +I ++      IF  ++ Y    VPTYPSG+  FML S        
Sbjct: 186  LFVCQVLSPFFHQSLIRDVYGVVSAIFPITMPYL-AVVPTYPSGLHCFMLGSK------- 237

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            +H  +P+ E     +  P ++Y   +H AAF LP    +++E
Sbjct: 238  RH--SPLREGVRTPA-WPTRWYTPAVHRAAFQLPPVVAQLLE 276



 Score = 95.5 bits (236), Expect(2) = 1e-40
 Identities = 43/115 (37%), Positives = 71/115 (61%)
 Frame = +3

Query: 570 KVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPK 749
           +V ++L + ++ YQ + V +   +G+ LVLD  +Q T  DE  Y EMI H+PL + P+P+
Sbjct: 20  RVREVLHEEQTPYQKLQVLELEDFGRALVLDDAVQTTVGDEFIYHEMIAHVPLFTHPHPE 79

Query: 750 KVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPPCN 914
           +VL+I        REV RH SV ++D+ EID+ V++  ++  P++A G + P  N
Sbjct: 80  RVLIIGGGDGGTAREVCRHESVQKVDMVEIDRAVIEACRKHLPEIACGMDHPKVN 134



>gb:AP006627_566213 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 275

 Score = 97.8 bits (242), Expect(2) = 3e-40
 Identities = 41/113 (36%), Positives = 74/113 (65%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           ++K+++ L   K+D+Q + + ++  +G +L+LDG++  TE+DE  Y EM+TH+PL + PN
Sbjct: 16  TMKIKRTLHTEKTDFQQLDMVETEEFGNMLLLDGMVMTTEKDEFVYHEMVTHVPLFTHPN 75

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYED 902
           PK VLV+       +RE+ +H SV++  + +ID  V++ +K + P +A   ED
Sbjct: 76  PKHVLVVGGGDGGAIREILKHPSVEKATLVDIDGKVIEYSKTYLPTIACALED 128



 Score = 92.4 bits (228), Expect(2) = 3e-40
 Identities = 49/157 (31%), Positives = 86/157 (54%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV + + DG   +   A   YD ++VDS++P+GPA +LFE+ F++ +++AL+  G+   Q
Sbjct: 130  RVDVKVADGFMHIAQSAN-EYDVIMVDSTEPVGPAAKLFERGFYEGISKALKEDGIFVAQ 188

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
             ++ W H  ++ N+  + ++IF  +  Y    +PTYPSG+  F + S        KH  +
Sbjct: 189  TDNPWFHQELVSNVYKDVKEIFPITRLYT-ANIPTYPSGMWTFTIGSK-------KH--D 238

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            P+            K+Y  +IH AAF LP F + +++
Sbjct: 239  PLAVEATRFHDVQTKYYTPDIHRAAFVLPKFVQDLLK 275



>sp|Q57761|SPEE_METJA Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>pir|B64339|B64339 spermidine synthase (EC
           2.5.1.16) - Methanococcus jannaschii>gb:U67486_206405
           Methanocaldococcus jannaschii DSM 2661 section 28 of 150
           of the complete genome.>gb:L77117_1099163
           Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 293

 Score =  101 bits (251), Expect(2) = 1e-39
 Identities = 47/131 (35%), Positives = 80/131 (61%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E        A S++V+ +L++ KS +Q++ +  +  +GK L+LD   Q TERDE  Y
Sbjct: 12  WFTEYHNN--NVALSVRVKDILYREKSGFQEIEIIDTYDFGKALILDNTFQTTERDEFIY 69

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            E+I+H+PL + PNP+ VLVI       +REV +H SV+ +D  E+D+ V++  K++ P 
Sbjct: 70  HELISHIPLFTHPNPRNVLVIGGGDGGTVREVVKHKSVETVDFVELDEKVIEACKKYMPK 129

Query: 882 VAVGYEDPPCN 914
           ++   ++   N
Sbjct: 130 LSCEIDNEKVN 140



 Score = 86.7 bits (213), Expect(2) = 1e-39
 Identities = 59/171 (34%), Positives = 90/171 (52%), Gaps = 10/171 (5%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            +V L I DG+ ++    E  YD +IVD  DP+GPA+ LFEK F++ V + L   G++  Q
Sbjct: 138  KVNLIITDGIKYVAET-EKKYDVIIVDCPDPVGPAKGLFEKEFYKNVFKCLNDDGIMVQQ 196

Query: 1087 AESIWLHMHIIENIVANCRQI----FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFK 1254
            +ES   ++ +I+NI   CR +    FK  + Y +  +PTYPSG   F L S +       
Sbjct: 197  SESPLYNLDLIQNI---CRYLKDAGFKIIMPYTY-PMPTYPSGFWSFTLASKK------- 245

Query: 1255 HPINPIDEANDAKSKSPL-----KFYNSEIHSAAF-CLPSFAKKVIESKAE 1389
               NP+ E ++A+ K  L     K+Y+ E+H   F   P F K  ++   E
Sbjct: 246  --YNPL-EVDEARIKEALKDMETKYYDEEVHKGIFLAAPKFLKDAVKKALE 293



>gb:AE017333_449750 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_859537 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 276

 Score = 93.6 bits (231), Expect(2) = 5e-39
 Identities = 51/158 (32%), Positives = 84/158 (53%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV + + DG   +   +E  YD ++VDS++P+GPA  LF K F+  +A+AL+  G+   
Sbjct: 130  PRVEVKVDDGFMHIAQ-SENEYDVIMVDSTEPVGPAVNLFTKGFYAGIAKALKEDGIFVA 188

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q ++ W    +I N+  + ++IF  +  Y    +PTYPSG+  F + S +          
Sbjct: 189  QTDNPWFTPELITNVQRDVKEIFPITKLYL-ANIPTYPSGLWTFTIGSKK---------Y 238

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            +P++  +        K+Y  EIH AAF LP F   +I+
Sbjct: 239  DPLEVEDSRFFDIETKYYTKEIHKAAFVLPKFVSDLIK 276



 Score = 92.4 bits (228), Expect(2) = 5e-39
 Identities = 39/114 (34%), Positives = 73/114 (64%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           ++K+ + L   ++D+Q + + ++  +G +L LDG++  +E+DE  Y EM+ H+PL + PN
Sbjct: 17  TMKINRTLHTEQTDFQKLEMAETEEFGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPN 76

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           P+ VLV+      V+RE+ +H SV +  + +ID  V++ +K+F P +A   +DP
Sbjct: 77  PEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSIAGKLDDP 130



>gb:AE005674_69700 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016978_370110 Shigella flexneri 2a str.
           2457T section 1 of 16 of the complete
           genome.>gb:AE014073_994860 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 288

 Score =  103 bits (258), Expect(2) = 6e-39
 Identities = 49/112 (43%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y EM+TH+PL +  + K 
Sbjct: 21  VDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKH 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+   G Y+DP
Sbjct: 81  VLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDP 132



 Score = 81.6 bits (200), Expect(2) = 6e-39
 Identities = 51/162 (31%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+   ++ T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 132  PRFQLVIDDGVNFVNQTSQ-TFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     E  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 191  QNGVCFLQQ---EEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 244

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                I +A    S    ++YN  IH+AAF LP + +  + S+
Sbjct: 245  LSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQ 286



>pir|A29778|SYECSD spermidine synthase (EC 2.5.1.16) - Escherichia
           coli (strain K-12)>gb:ECO82K_127917 Escherichia coli
           genomic DNA. (2.4 - 4.2 min).>gb:ECOSPDE_130309 E.coli
           speED operon speE and speD genes encoding S-adenosyl-
           methionine decarboxylase and spermidine synthase,
           complete cds.>gb:U00096_199227 Escherichia coli K-12
           MG1655 complete genome.
          Length = 288

 Score =  103 bits (258), Expect(2) = 6e-39
 Identities = 49/112 (43%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y EM+TH+PL +  + K 
Sbjct: 21  VDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKH 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+   G Y+DP
Sbjct: 81  VLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDP 132



 Score = 81.6 bits (200), Expect(2) = 6e-39
 Identities = 51/162 (31%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+   ++ T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 132  PRFKLVIDDGVNFVNQTSQ-TFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     E  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 191  QNGVCFLQQ---EEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 244

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                I +A    S    ++YN  IH+AAF LP + +  + S+
Sbjct: 245  LSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQ 286



>sp|Q83MF0|SPEE_SHIFL Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).
          Length = 287

 Score =  103 bits (258), Expect(2) = 6e-39
 Identities = 49/112 (43%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y EM+TH+PL +  + K 
Sbjct: 20  VDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKH 79

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+   G Y+DP
Sbjct: 80  VLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDP 131



 Score = 81.6 bits (200), Expect(2) = 6e-39
 Identities = 51/162 (31%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+   ++ T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 131  PRFQLVIDDGVNFVNQTSQ-TFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 189

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     E  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 190  QNGVCFLQQ---EEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 243

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                I +A    S    ++YN  IH+AAF LP + +  + S+
Sbjct: 244  LSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQ 285



>sp|P09158|SPEE_ECOLI Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).
          Length = 287

 Score =  103 bits (258), Expect(2) = 6e-39
 Identities = 49/112 (43%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y EM+TH+PL +  + K 
Sbjct: 20  VDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKH 79

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+   G Y+DP
Sbjct: 80  VLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDP 131



 Score = 81.6 bits (200), Expect(2) = 6e-39
 Identities = 51/162 (31%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+   ++ T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 131  PRFKLVIDDGVNFVNQTSQ-TFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 189

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     E  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 190  QNGVCFLQQ---EEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 243

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                I +A    S    ++YN  IH+AAF LP + +  + S+
Sbjct: 244  LSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQ 285



>pir|E85495|E85495 hypothetical protein speE [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>pir|E90644|E90644 spermidine synthase [imported]
           - Escherichia coli (strain O157:H7, substrain RIMD
           0509952)>gb:AE005174_64358 Escherichia coli O157:H7
           EDL933, complete genome.>gb:AE016755_324213 Escherichia
           coli CFT073 section 1 of 18 of the complete
           genome.>gb:BA000007_658137 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_954797 Escherichia coli
           CFT073 complete genome.
          Length = 288

 Score =  103 bits (258), Expect(2) = 8e-39
 Identities = 49/112 (43%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y EM+TH+PL +  + K 
Sbjct: 21  VDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKH 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+   G Y+DP
Sbjct: 81  VLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDP 132



 Score = 81.3 bits (199), Expect(2) = 8e-39
 Identities = 50/162 (30%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+   ++ T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 132  PRFKLVIDDGVNFVNQTSQ-TFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     E  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 191  QNGVCFLQQ---EEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 244

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                I +A    S    ++YN  +H+AAF LP + +  + S+
Sbjct: 245  LSTEIIQARFLASGLKCRYYNPAVHTAAFALPQYLQDALASQ 286



>sp|Q8X951|SPEE_ECOL6 Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).
          Length = 287

 Score =  103 bits (258), Expect(2) = 8e-39
 Identities = 49/112 (43%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y EM+TH+PL +  + K 
Sbjct: 20  VDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKH 79

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+   G Y+DP
Sbjct: 80  VLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDP 131



 Score = 81.3 bits (199), Expect(2) = 8e-39
 Identities = 50/162 (30%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+   ++ T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 131  PRFKLVIDDGVNFVNQTSQ-TFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 189

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     E  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 190  QNGVCFLQQ---EEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 243

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                I +A    S    ++YN  +H+AAF LP + +  + S+
Sbjct: 244  LSTEIIQARFLASGLKCRYYNPAVHTAAFALPQYLQDALASQ 285



>gb:CP000009_863104 Gluconobacter oxydans 621H, complete genome.
          Length = 290

 Score =  117 bits (293), Expect(2) = 1e-38
 Identities = 59/122 (48%), Positives = 86/122 (70%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           W +E   ++P       V + L + KSD+QDV+VF+SS++G+VLVLDGVIQITERDE  Y
Sbjct: 5   WLNET--LYPDWGQRFLVTRELARVKSDFQDVVVFESSSHGRVLVLDGVIQITERDEFVY 62

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
           QEM+TH+PL + P  K+VL+I      VLR V +H +V++  + EID  V++++KQ+ PD
Sbjct: 63  QEMLTHVPLLAHPCAKRVLIIGAGDGGVLRRVLQHDTVEKAVMVEIDGAVIELSKQYLPD 122

Query: 882 VA 887
           +A
Sbjct: 123 IA 124



 Score = 67.4 bits (163), Expect(2) = 1e-38
 Identities = 43/152 (28%), Positives = 71/152 (46%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  + +GDG+ ++   A+G++D +IVDS+DPIG  + LF   F+   AR L   G++  
Sbjct: 131  PRAEVIVGDGIDYVAKAADGSFDVIIVDSTDPIGVGEVLFTDEFYSNCARILSAEGLIVN 190

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q    ++    +        + F     Y    VPTY  G +   + S +G A + +   
Sbjct: 191  QCGVPFMQADELYETSLRRAKFFPHVGAYV-AAVPTYVGGFMTLGVAS-KGQAPNTQTVE 248

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSF 1359
                 A  AK     +++  EIH  +F LP +
Sbjct: 249  QIRTRAEAAKILGTTRYWTPEIHVGSFNLPPY 280



>sp|Q8Z9E2|SPEE_SALTI Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|AD0523|AD0523
           spermidine synthase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:AE016834_344370 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 1 of 16 of the
           complete genome.>gb:AL627265_540499 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 1/20.>gb:AE014613_981702 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 286

 Score =  103 bits (258), Expect(2) = 1e-38
 Identities = 52/127 (40%), Positives = 80/127 (62%), Gaps = 6/127 (4%)
 Frame = +3

Query: 543 MWPGEAHS-----LKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQE 707
           MW    H        V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y E
Sbjct: 6   MWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHE 65

Query: 708 MITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVA 887
           M+TH+PL +  + K VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+  
Sbjct: 66  MMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETITMVEIDAGVVSFCRQYLPNHN 125

Query: 888 VG-YEDP 905
            G Y+DP
Sbjct: 126 AGSYDDP 132



 Score = 80.9 bits (198), Expect(2) = 1e-38
 Identities = 51/162 (31%), Positives = 84/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR TL I DGV F+ N    T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 132  PRFTLVIDDGVNFV-NQTHQTFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     +  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 191  QNGVCFLQQ---DEALDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 244

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
              + I +A    +    ++YNS IH+AAF LP +    + ++
Sbjct: 245  LSSEIIQARFHAAGLKCRYYNSAIHAAAFALPQYLHDALSAQ 286



>sp|P70998|SPEE_BACSU Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|G70057|G70057
           spermidine synthase homolog ywhF - Bacillus
           subtilis>gb:BSTHRZ_751309 B.subtilis thrZ downstream
           chromosomal region.>gb:BSUB0020_755715 Bacillus subtilis
           complete genome (section 20 of 21): from 3809641 to
           4010779.
          Length = 276

 Score = 92.8 bits (229), Expect(2) = 1e-38
 Identities = 40/114 (35%), Positives = 73/114 (64%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           ++KV K L   ++++Q + + ++  +G +L LDG++  +E+DE  Y EM+ H+PL + PN
Sbjct: 17  TMKVNKTLHTEQTEFQHLEMVETEEFGNMLFLDGMVMTSEKDEFVYHEMVAHVPLFTHPN 76

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           P+ VLV+      V+RE+ +H SV +  + +ID  V++ +K+F P +A   +DP
Sbjct: 77  PEHVLVVGGGDGGVIREILKHPSVKKATLVDIDGKVIEYSKKFLPSIAGKLDDP 130



 Score = 91.7 bits (226), Expect(2) = 1e-38
 Identities = 50/158 (31%), Positives = 83/158 (52%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV + + DG   +   +E  YD ++VDS++P+GPA  LF K F+  +A+AL+  G+   
Sbjct: 130  PRVDVQVDDGFMHIAK-SENQYDVIMVDSTEPVGPAVNLFTKGFYAGIAKALKEDGIFVA 188

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q ++ W    +I N+  + ++IF  +  Y    +PTYPSG+  F + S +          
Sbjct: 189  QTDNPWFTPELITNVQRDVKEIFPITKLYT-ANIPTYPSGLWTFTIGSKK---------Y 238

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            +P+   +        K+Y  +IH AAF LP F   +I+
Sbjct: 239  DPLAVEDSRFFDIETKYYTKDIHKAAFVLPKFVSDLIK 276



>sp|Q81JT0|SPE1_BACAN Spermidine synthase 1 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 1) (SPDSY 1).>gb:AE017041_385498
            Bacillus anthracis str. Ames section 18 of 18 of the
            complete genome.>gb:AE017225_410585 Bacillus anthracis
            str. Sterne, complete genome.>gb:AE017281_426699 Bacillus
            cereus ATCC 10987, section 18 of 18 of the complete
            genome.>gb:AE017334_455345 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE017355_466337 Bacillus
            thuringiensis serovar konkukian str. 97-27, complete
            genome.>gb:AE016879_1015203 Bacillus anthracis str. Ames
            complete genome.>gb:AE017194_1065118 Bacillus cereus ATCC
            10987, complete genome.
          Length = 275

 Score = 92.8 bits (229), Expect(2) = 2e-38
 Identities = 50/157 (31%), Positives = 87/157 (55%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV + +GDG   +   +E  YD ++VDS++P+GPA  LF K F+  +++AL+  G+   Q
Sbjct: 130  RVEVKVGDGFLHIAE-SENEYDVIMVDSTEPVGPAVNLFTKGFYAGISKALKEDGIFVAQ 188

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
             ++ W    +I  +  + ++IF  +  Y    +PTYPSG+  F + S        KH  +
Sbjct: 189  TDNPWFTPELITTVFKDVKEIFPITRLYT-ANIPTYPSGLWTFTIGSK-------KH--D 238

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            P++ + +   +   K+Y  E+H+AAF LP F   +I+
Sbjct: 239  PLEVSEERFHEIETKYYTKELHNAAFALPKFVGDLIK 275



 Score = 91.3 bits (225), Expect(2) = 2e-38
 Identities = 42/122 (34%), Positives = 75/122 (61%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E      G   + ++ + L   ++++Q + + ++  +G +L+LDG++  TE+DE  Y
Sbjct: 4   WFTEKQTKHFGI--TARINRTLHTEQTEFQKLDMVETEEFGNMLILDGMVMTTEKDEFVY 61

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM+ H+PL + PNP+ VLV+      V+REV +H SV +  + EID  V++ +KQ+ P 
Sbjct: 62  HEMVAHVPLFTHPNPENVLVVGGGDGGVIREVLKHPSVKKATLVEIDGKVIEYSKQYLPS 121

Query: 882 VA 887
           +A
Sbjct: 122 IA 123



>gb:CP000026_75086 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 286

 Score =  103 bits (258), Expect(2) = 2e-38
 Identities = 52/127 (40%), Positives = 80/127 (62%), Gaps = 6/127 (4%)
 Frame = +3

Query: 543 MWPGEAHS-----LKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQE 707
           MW    H        V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y E
Sbjct: 6   MWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHE 65

Query: 708 MITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVA 887
           M+TH+PL +  + K VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+  
Sbjct: 66  MMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETITMVEIDAGVVSFCRQYLPNHN 125

Query: 888 VG-YEDP 905
            G Y+DP
Sbjct: 126 AGSYDDP 132



 Score = 79.7 bits (195), Expect(2) = 2e-38
 Identities = 50/162 (30%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR TL I DGV F+ N    T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 132  PRFTLVIDDGVNFV-NQTHQTFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     +  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 191  QNGVCFLQQ---DEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 244

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
              + I +A    +    ++YN  IH+AAF LP +    + ++
Sbjct: 245  LSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHDALSAQ 286



>sp|O66473|SPE1_AQUAE Spermidine synthase 1 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 1) (SPDSY
           1).>pir|F70305|F70305 spermidine synthase - Aquifex
           aeolicus>gb:AE000672_25824 Aquifex aeolicus VF5 section
           4 of 109 of the complete genome.>gb:AE000657_976355
           Aquifex aeolicus VF5 complete genome.
          Length = 280

 Score =  111 bits (277), Expect(2) = 3e-38
 Identities = 48/115 (41%), Positives = 80/115 (69%)
 Frame = +3

Query: 561 HSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIP 740
           H   V K+L++GKS YQ++ V +S  +G++L+LDGV+Q+ E+ E  Y E + H+PL + P
Sbjct: 17  HCYTVSKILYQGKSPYQEIQVIESPEFGRMLILDGVVQLDEKYEFLYHEYLAHVPLHAHP 76

Query: 741 NPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           NP+ VL+I       LREV +H  V++  + +IDK V++V+K++ P ++VG++DP
Sbjct: 77  NPRNVLIIGGGDGGTLREVLKHDIVERAVLVDIDKEVIEVSKKYLPTLSVGFQDP 131



 Score = 72.0 bits (175), Expect(2) = 3e-38
 Identities = 47/165 (28%), Positives = 85/165 (51%)
 Frame = +1

Query: 889  LGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            +G + PR  +   DG  ++++  E  +D +IVDS+DP+G A  L  + FF+ V +AL+  
Sbjct: 126  VGFQDPRAIVVNEDGYKYVQDY-ENEFDVIIVDSTDPVGFAHVLTTEDFFRHVYKALKED 184

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            G+   Q ESI  H+ ++ NI    +++F   V+   + +P Y      F + S       
Sbjct: 185  GIFVAQTESIHYHLEMVSNIQQRLKKVFP-IVDLYTSVIPIYAGYWWTFSIASK------ 237

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
             K+P+     A + K ++  K Y++++H  AF   SF  K++  +
Sbjct: 238  -KYPVR--TPAREVKVQT--KIYDADMHEYAFLPESFYNKIVNGE 277



>gb:BA000043_739982 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 275

 Score = 93.6 bits (231), Expect(2) = 3e-38
 Identities = 50/158 (31%), Positives = 83/158 (52%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV + + DG   +   +E  YD ++VDS++P+GPA  LF K F+  +A AL+  G+   
Sbjct: 129  PRVEVKVDDGFMHIAK-SENEYDVIMVDSTEPVGPAVNLFTKGFYAGIANALKEDGIFVA 187

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q ++ W    +I N+  + ++IF  +  Y    +PTYPSG+  F L S +          
Sbjct: 188  QTDNPWFKADLIRNVYRDVKEIFPITRLYT-ANIPTYPSGLWTFTLGSKK---------Y 237

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            +P+  ++D       K+Y  E+H A F LP F   +++
Sbjct: 238  DPLAVSDDRFHDIETKYYTKELHKACFVLPKFVADLVK 275



 Score = 89.7 bits (221), Expect(2) = 3e-38
 Identities = 42/128 (32%), Positives = 78/128 (60%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E      G   + ++ + L   ++ +Q + + +++ +G +L+LDG++  T++DE  Y
Sbjct: 4   WFTEKQTEHFGI--TARIIRTLHTEQTPFQKLDMVETAEFGNMLILDGMVMTTQKDEFVY 61

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM+ H+PL + PNP+ VLV+      V+REV +H SV +  + EID  V++ +K + P+
Sbjct: 62  HEMVAHVPLFTHPNPENVLVVGGGDGGVIREVLKHPSVKKATLVEIDGKVIECSKTYLPE 121

Query: 882 VAVGYEDP 905
           +A   +DP
Sbjct: 122 IAGKLDDP 129



>gb:BA000043_738317 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 291

 Score = 92.0 bits (227), Expect(2) = 4e-38
 Identities = 46/114 (40%), Positives = 70/114 (61%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S ++++++F   S+YQ VM+  S  +G++LVLDGV+Q T  D   Y EMI+H+PL   P 
Sbjct: 32  SYRIKEVIFAEPSEYQHVMILDSYDFGRMLVLDGVVQTTSIDGHIYNEMISHVPLQFHPE 91

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
            K+VL+I        RE A++A ++ ID+ EID+ VV   K+  P V+    DP
Sbjct: 92  AKRVLIIGGGDCGAARETAKYAHLEAIDMVEIDEKVVRACKEHLPAVSGNLSDP 145



 Score = 90.9 bits (224), Expect(2) = 4e-38
 Identities = 51/158 (32%), Positives = 78/158 (49%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV     DGV F++   E  YD +++DSSDP+GPA+ LF   F+  V RAL+  G++  
Sbjct: 145  PRVRFVYDDGVVFVQE-KENVYDVIMIDSSDPVGPAEALFSPEFYANVHRALKADGLMVC 203

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q++S   H+ I++    N R++F   + Y    VPTYP G+  F + S            
Sbjct: 204  QSQSPIFHLDILKRTYRNIRELFPHVLVYT-AVVPTYPGGLWSFTIGSK----------- 251

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
             P+D        +  K+ N  +    F LP F +  +E
Sbjct: 252  RPLDFPAQTTIPNDTKYVNDAVFRQCFALPEFLRSALE 289



>sp|Q8ZRS3|SPEE_SALTY Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE008701_241902
           Salmonella typhimurium LT2, section 9 of 220 of the
           complete genome.>gb:AE006468_998984 Salmonella
           typhimurium LT2, complete genome.
          Length = 286

 Score =  103 bits (258), Expect(2) = 4e-38
 Identities = 52/127 (40%), Positives = 80/127 (62%), Gaps = 6/127 (4%)
 Frame = +3

Query: 543 MWPGEAHS-----LKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQE 707
           MW    H        V+ +L+  K+D+QD+++F+++ +G+V+ LDGV+Q TERDE  Y E
Sbjct: 6   MWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHE 65

Query: 708 MITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVA 887
           M+TH+PL +  + K VL+I      +LREV RH +V+ I + EID  VV   +Q+ P+  
Sbjct: 66  MMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVETITMVEIDAGVVSFCRQYLPNHN 125

Query: 888 VG-YEDP 905
            G Y+DP
Sbjct: 126 AGSYDDP 132



 Score = 79.0 bits (193), Expect(2) = 4e-38
 Identities = 50/162 (30%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR TL I DGV F+ N    T+D +I D +DPIGP + LF   F++   R L PGG+   
Sbjct: 132  PRFTLVIDDGVNFV-NQTHQTFDVIISDCTDPIGPGESLFTSAFYEGCKRCLNPGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     +  + + R++  +   V +    +PTY  G++ F   +T+  A+  +H
Sbjct: 191  QNGVCFLQQ---DEALDSHRKLSHYFSDVGFYQAAIPTYYGGIMTF-AWATDNDAL--RH 244

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
              + I +A    +    ++YN  IH+AAF LP +    + ++
Sbjct: 245  LSSEIIQARFHAAGLKCRYYNPAIHAAAFALPQYLHDALSAQ 286



>gb:BX957223_844837 Methanococcus maripaludis S2 complete genome;
           segment 5/5.
          Length = 280

 Score =  102 bits (255), Expect(2) = 4e-38
 Identities = 52/132 (39%), Positives = 83/132 (62%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           W++E  P     + S K++ +L+ G+S+YQ++ V  +  +G+VL+L+   Q TERDE  Y
Sbjct: 6   WYTE--PQTENLSLSTKLKDILYVGQSEYQEIQVLDTYEFGRVLILENTYQTTERDEFIY 63

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            E+I+H  L +  NPKKVLVI       +REV +H SV++ID  E+D  VV+VAK+F P 
Sbjct: 64  HELISHPALFTHGNPKKVLVIGGGDGGSVREVLKHKSVEKIDFVELDGQVVEVAKKFLPT 123

Query: 882 VAVGYEDPPCNS 917
           ++   ++   N+
Sbjct: 124 LSCEIDNEKVNT 135



 Score = 80.1 bits (196), Expect(2) = 4e-38
 Identities = 44/155 (28%), Positives = 76/155 (49%), Gaps = 1/155 (0%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            +V   I DG+ ++   +E  YD ++VD  DP+GPA  LFEK F+  + + L   G++  Q
Sbjct: 132  KVNTIITDGIKYVAETSE-KYDVILVDCPDPVGPAAGLFEKEFYNNLYKCLNDDGIMVQQ 190

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
             ES  LH  +I  I  + +     ++     ++PTYPSG   F L S +   ++     +
Sbjct: 191  TESPLLHEKLINKIKGHLKDAGFSTIRPLVCSIPTYPSGFWSFTLASKKNDPLN-----S 245

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAF-CLPSFAKK 1368
             + E  +       K+Y+ ++H   F   P + K+
Sbjct: 246  DVSEIENKLKDMTTKYYDQDVHKGVFLATPRYLKE 280



>sp|Q814Q1|SPE1_BACCR Spermidine synthase 1 (EC 2.5.1.16) (Putrescine
            aminopropyltransferase 1) (SPDSY 1).>gb:AE017015_380189
            Bacillus cereus ATCC 14579 section 18 of 18 of the
            complete genome.>gb:AE016877_1020439 Bacillus cereus ATCC
            14579 complete genome.
          Length = 275

 Score = 92.0 bits (227), Expect(2) = 4e-38
 Identities = 50/157 (31%), Positives = 86/157 (54%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV + +GDG   +   +E  YD ++VDS++P+GPA  LF K F+  +++AL+  G+   Q
Sbjct: 130  RVEVKVGDGFLHIAE-SENEYDVIMVDSTEPVGPAVNLFTKGFYAGISKALKEDGIFVAQ 188

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
             ++ W    +I  +  + ++IF  +  Y    +PTYPSG+  F + S        KH  +
Sbjct: 189  TDNPWFTPELITTVFKDVKEIFPITRLYT-ANIPTYPSGLWTFTIGSK-------KH--D 238

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            P++   +   +   K+Y  E+H+AAF LP F   +I+
Sbjct: 239  PLEVIEERFHEIETKYYTKELHNAAFALPKFVGDLIK 275



 Score = 90.9 bits (224), Expect(2) = 4e-38
 Identities = 41/122 (33%), Positives = 75/122 (61%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E      G   + ++ + L   ++++Q + + ++  +G +L+LDG++  TE+DE  Y
Sbjct: 4   WFTEKQTKHFGI--TARINRTLHTEQTEFQKLDMVETEEFGNMLILDGMVMTTEKDEFVY 61

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM+ H+PL + PNP+ VL++      V+REV +H SV +  + EID  V++ +KQ+ P 
Sbjct: 62  HEMVAHVPLFTHPNPENVLIVGGGDGGVIREVLKHPSVKKATLVEIDGKVIEYSKQYLPS 121

Query: 882 VA 887
           +A
Sbjct: 122 IA 123



>sp|Q97RA7|SPEE_STRPN Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|C97974|C97974
           spermidine synthase (EC 2.5.1.16) [imported] -
           Streptococcus pneumoniae (strain R6)>pir|A95106|A95106
           spermidine synthase [imported] - Streptococcus
           pneumoniae  (strain TIGR4)>gb:AE007397_226103
           Streptococcus pneumoniae TIGR4 section 80 of 194 of the
           complete genome.>gb:AE008458_237140 Streptococcus
           pneumoniae R6 section 74 of 184 of the complete
           genome.>gb:AE007317_943298 Streptococcus pneumoniae R6,
           complete genome.>gb:AE005672_1103871 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 286

 Score =  110 bits (274), Expect(2) = 5e-38
 Identities = 52/128 (40%), Positives = 81/128 (63%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WFSE+    P    SL+  K L+ GKS++QD+ V  +  +GK+L+L+G +  ++ D+  Y
Sbjct: 4   WFSEVHT--PDVKLSLRTAKQLYAGKSEWQDIEVLDTPAFGKILILNGHVLFSDADDFVY 61

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM  H+P+   PNPKKVLVI      V + +  +  ++QIDI E D+M+V+V +++FPD
Sbjct: 62  NEMTVHVPMAVHPNPKKVLVIGGGDGGVAQVLTLYPELEQIDIVEPDEMLVEVCREYFPD 121

Query: 882 VAVGYEDP 905
            A G +DP
Sbjct: 122 FAAGLDDP 129



 Score = 72.4 bits (176), Expect(2) = 5e-38
 Identities = 49/171 (28%), Positives = 83/171 (48%), Gaps = 7/171 (4%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G+  PRVT++  +G+ FL+N  E  YD +I D++DP G  + LF K F+    RAL+  G
Sbjct: 125  GLDDPRVTIYYQNGLRFLRN-CEDDYDIIINDATDPFGHTEGLFTKEFYGNSYRALKEDG 183

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAW-------TTVPTYPSGVIGFMLCST 1230
            ++  Q  S        +   + CR + +  VN A+         +PT P+G   F   S 
Sbjct: 184  IMIYQHGS-----PFFDEDESACRSMHR-KVNQAFPISRVYQAHIPTSPAGYWLFGFASK 237

Query: 1231 EGPAVDFKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
            +       HP+   D+    K +   ++Y + +H  AF LP + + ++E +
Sbjct: 238  K------YHPVKDFDKEGWKKRQLFTEYYTANLHVGAFMLPKYVEDILEEE 282



>gb:CP000001_855657 Bacillus cereus ZK, complete genome.
          Length = 275

 Score = 92.8 bits (229), Expect(2) = 5e-38
 Identities = 50/157 (31%), Positives = 87/157 (55%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV + +GDG   +   +E  YD ++VDS++P+GPA  LF K F+  +++AL+  G+   Q
Sbjct: 130  RVEVKVGDGFLHIAE-SENEYDVIMVDSTEPVGPAVNLFTKGFYAGISKALKEDGIFVAQ 188

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
             ++ W    +I  +  + ++IF  +  Y    +PTYPSG+  F + S        KH  +
Sbjct: 189  TDNPWFTPELITTVFKDVKEIFPITRLYT-ANIPTYPSGLWTFTIGSK-------KH--D 238

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            P++ + +   +   K+Y  E+H+AAF LP F   +I+
Sbjct: 239  PLEVSEERFHEIETKYYTKELHNAAFALPKFVGDLIK 275



 Score = 89.7 bits (221), Expect(2) = 5e-38
 Identities = 41/122 (33%), Positives = 75/122 (61%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E      G   + ++ + L   ++++Q + + ++  +G +L+LDG++  TE+DE  Y
Sbjct: 4   WFTEKQTKHFGI--TARINRTLHTEQTEFQKLDMVETEEFGNMLILDGMVMTTEKDEFVY 61

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM+ H+PL + PNP+ VLV+      V+REV +H SV +  + EID  V++ +K++ P 
Sbjct: 62  HEMVAHVPLFTHPNPENVLVVGGGDGGVIREVLKHPSVKKATLVEIDGKVIEYSKKYLPS 121

Query: 882 VA 887
           +A
Sbjct: 122 IA 123



>gb:BX950851_842068 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 287

 Score =  111 bits (277), Expect(2) = 1e-37
 Identities = 53/115 (46%), Positives = 81/115 (70%), Gaps = 1/115 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+++L+  K+D+QD+++F++   G+V+ LDGV+Q TERDE  Y EM+TH+PL S  N K+
Sbjct: 21  VDRVLYHEKTDHQDLIIFENDALGRVMALDGVVQTTERDEFIYHEMLTHVPLLSHGNAKR 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDPPCN 914
           VL+I      +LREV+RH  V+QI + EID  VV+  +Q+ P+ + G Y+DP  N
Sbjct: 81  VLIIGGGDGGMLREVSRHHGVEQITMVEIDAGVVEFCRQYLPNHSAGSYDDPRFN 135



 Score = 70.1 bits (170), Expect(2) = 1e-37
 Identities = 44/161 (27%), Positives = 80/161 (49%), Gaps = 2/161 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F++  +E  +D +I D +DPIGP + LF   F+Q  AR+L  GG+   
Sbjct: 132  PRFNLVIDDGVNFVRQCSE-KFDVIISDCTDPIGPGESLFTSDFYQGCARSLNEGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQI--FKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKH 1257
            Q    +L     +  + + +++  +   V++    +PTY  G++ F   S   PA+    
Sbjct: 191  QNGVCFLQQ---DEAIGSHKKLSHYFNDVSFYQAAIPTYYGGIMTFAWAS-NNPALRQMD 246

Query: 1258 PINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
             +      + A+S    ++Y  ++H  +F LP +    +++
Sbjct: 247  IVTL--RQHFAQSGITCRYYTPDVHIGSFALPQYLLSALQN 285



>gb:AJ749949_530888 Francisella tularensis subsp. tularensis
           complete genome.>gb:AY774445_2149158 Synthetic construct
           Francisella tularensis clone FLH157568.01X NT02FT1649
           gene, complete cds.
          Length = 289

 Score =  100 bits (248), Expect(2) = 1e-37
 Identities = 42/115 (36%), Positives = 76/115 (66%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S+ + ++L++ K+DYQ +++F +  +G V+VLDG++Q TE+DE  Y EM+ H+P+ +  N
Sbjct: 22  SIAISEILYEHKTDYQHLVIFNNPIFGNVMVLDGIVQTTEKDEFIYHEMLVHVPVIAHGN 81

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
            K +L+I      +LRE   H +V+ + + EID+ V+D+ +++FP  + G  D P
Sbjct: 82  VKNILIIGGGDGGMLREALSHKAVESVTLVEIDQAVIDMCQEYFPGHSKGAFDHP 136



 Score = 80.9 bits (198), Expect(2) = 1e-37
 Identities = 48/152 (31%), Positives = 77/152 (50%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            P+  + I DG  F+KN     YD +I DS+DPIGP + LF   F++    A+ PGG++ T
Sbjct: 136  PKAKIVIQDGCEFVKNPPR-KYDLIICDSTDPIGPGEVLFTSKFYKDCKEAINPGGIMVT 194

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q   I+  +  ++  +     ++K  V++    VPTY  G + F   + E   + +++  
Sbjct: 195  QNGVIYFQIDELKKTLERFEPLYK-DVSFYTAAVPTYVGGSMAFGWGTDE---LSYRNHD 250

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSF 1359
              +      KS    K+YN  IH AAF LP +
Sbjct: 251  IQVIAQRFLKSGIKTKYYNPAIHIAAFALPQY 282



>gb:BX842656_826362 Bdellovibrio bacteriovorus complete genome, strain
            HD100; segment 11/11.
          Length = 428

 Score =  105 bits (261), Expect(2) = 3e-37
 Identities = 61/164 (37%), Positives = 88/164 (53%), Gaps = 3/164 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            P++ L IGDG+ F+K+    +YD +IVD SDP+GPA+ LF   F+     AL+ GG+V T
Sbjct: 270  PKLNLIIGDGIQFVKDAPANSYDVIIVDGSDPVGPAKGLFTAEFYNNCKNALKDGGLVIT 329

Query: 1084 QAESIWLHMHIIENIVANCRQIF-KGSVNYAWTTVPTYPSGVIGFMLC--STEGPAVDFK 1254
            Q ES   H      +    + IF K SV+       TYPSG+    +    ++ PA DF 
Sbjct: 330  QGESPMFHEGTFVELNHCLKGIFGKQSVHTMLFHATTYPSGMWSLQVAVKGSKHPAKDFN 389

Query: 1255 HPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKA 1386
                  D+A        LK+YN ++H+AAF LP+F K ++   A
Sbjct: 390  K-----DQAAKFAQDKGLKYYNEDLHTAAFSLPTFVKTMLGDNA 428



 Score = 74.7 bits (182), Expect(2) = 3e-37
 Identities = 49/144 (34%), Positives = 78/144 (54%), Gaps = 1/144 (0%)
 Frame = +3

Query: 486 KGEQCFSSVIPGWFSEISPMWPGEAHSLKVE-KLLFKGKSDYQDVMVFQSSTYGKVLVLD 662
           KG Q   +V   WF++       +A SL+    +LF   + +Q V V  S ++GK L ++
Sbjct: 137 KGHQIDRNV---WFTDKDE---NQALSLRYTGDVLFDETNPFQRVRVLDSYSHGKFLAIN 190

Query: 663 GVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEID 842
            ++  TERDE  Y EMITH  + +  N K VLVI       +RE+ ++ +VD + + EID
Sbjct: 191 NMVMCTERDEYHYHEMITHPVMQTHGNAKNVLVIGGGDGGTIRELFKY-NVDNVTMVEID 249

Query: 843 KMVVDVAKQFFPDVAVGYEDPPCN 914
           + VV  +K+  P +A  + +P  N
Sbjct: 250 EAVVRASKEHLPKIACEFNNPKLN 273



>gb:AF143948_482979 Pseudomonas aeruginosa putative spermidine
           synthase, serine/threonine protein kinase homolog, and
           hypothetical integral membrane protein genes, complete
           cds.
          Length = 336

 Score =  101 bits (252), Expect(2) = 7e-37
 Identities = 51/145 (35%), Positives = 91/145 (62%), Gaps = 5/145 (3%)
 Frame = +3

Query: 495 QCFSSVIPGWFSEISP----MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLD 662
           +C  + +PG    +S     ++ G      ++ +L + ++++Q +++F+++  G+V+ LD
Sbjct: 38  RCQIAALPGRSRPMSDYQETLYQGYGQRFSIDNMLHEVRTEHQHLVIFENARMGRVMALD 97

Query: 663 GVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEID 842
           GVIQ TE DE  Y EM+TH+P+ +    ++VL+I      +LREVA+H SV++I + EID
Sbjct: 98  GVIQTTEADEFIYHEMLTHVPILAHGAARRVLIIGGGDGGMLREVAKHKSVERITMVEID 157

Query: 843 KMVVDVAKQFFPDVAVG-YEDPPCN 914
             VVD+ K+F P+ + G ++DP  N
Sbjct: 158 GTVVDMCKEFLPNHSQGAFDDPRLN 182



 Score = 77.0 bits (188), Expect(2) = 7e-37
 Identities = 50/158 (31%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ L I DG+ F+    E  +D +I DS+DPIGP + LF + F+Q   R L  GG++ T
Sbjct: 179  PRLNLVIDDGMRFVATTEE-RFDVIISDSTDPIGPGEVLFSENFYQACRRCLNEGGILVT 237

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST-EGPAVDFKHP 1260
            Q  + ++ +  +    A    +F    ++    VPTY  G + F   ST EG     + P
Sbjct: 238  QNGTPFMQLEEVRTTAARTDGLF-ADWHFYQAAVPTYIGGAMTFAWGSTHEGLR---RLP 293

Query: 1261 INPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            +  + +     S    ++YN++IH  AF LP +  + I
Sbjct: 294  LETLRQ-RFRDSGIATRYYNADIHLGAFALPQYVLQAI 330



>gb:AE013680_299104 Yersinia pestis KIM section 80 of 415 of the
           complete genome.>gb:AE017127_386127 Yersinia pestis
           biovar Medievalis str. 91001 section 1 of 16 of the
           complete genome.>gb:AE009952_929287 Yersinia pestis KIM
           complete genome.>gb:AE017042_1142693 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 324

 Score =  108 bits (271), Expect(2) = 7e-37
 Identities = 51/112 (45%), Positives = 80/112 (71%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           VE +LF+ K+++QD+++F++   G+V+ LDGV+Q TERDE  Y EM+TH+PL +    KK
Sbjct: 49  VENVLFREKTEHQDLVIFENPELGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGQAKK 108

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV+RH +++QI + EID  VV+  +Q+ P+ + G Y+DP
Sbjct: 109 VLIIGGGDGAMLREVSRHKNIEQITMVEIDAGVVEFCRQYLPNHSAGAYDDP 160



 Score = 69.7 bits (169), Expect(2) = 7e-37
 Identities = 48/156 (30%), Positives = 73/156 (46%), Gaps = 4/156 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+    E  +D +I D +DPIGP + LF   F++  AR+L  GG+   
Sbjct: 160  PRFKLVIDDGVNFVNQTTE-KFDVIISDCTDPIGPGESLFTSVFYEGCARSLNEGGIFVA 218

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q    +L      N        F   V++    +PTY  G++ F   +T+ PA      +
Sbjct: 219  QNGVCFLQQDEAVNSHNKLSHYF-SDVSFYQAAIPTYYGGIMTF-AWATQNPA------L 270

Query: 1264 NPIDEA----NDAKSKSPLKFYNSEIHSAAFCLPSF 1359
              +D A      A++    ++YN  IH  +F LP +
Sbjct: 271  RQLDLATLQNRFAQAGLACRYYNPAIHVGSFALPQY 306



>sp|Q8ZBJ8|SPEE_YERPE Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|AE0414|AE0414
           spermidine synthase (EC 2.5.1.16) [imported] - Yersinia
           pestis (strain CO92)>gb:AJ414157_525170 Yersinia pestis
           strain CO92 complete genome; segment 17/20.
          Length = 296

 Score =  108 bits (271), Expect(2) = 7e-37
 Identities = 51/112 (45%), Positives = 80/112 (71%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           VE +LF+ K+++QD+++F++   G+V+ LDGV+Q TERDE  Y EM+TH+PL +    KK
Sbjct: 21  VENVLFREKTEHQDLVIFENPELGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGQAKK 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV+RH +++QI + EID  VV+  +Q+ P+ + G Y+DP
Sbjct: 81  VLIIGGGDGAMLREVSRHKNIEQITMVEIDAGVVEFCRQYLPNHSAGAYDDP 132



 Score = 69.7 bits (169), Expect(2) = 7e-37
 Identities = 48/156 (30%), Positives = 73/156 (46%), Gaps = 4/156 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+    E  +D +I D +DPIGP + LF   F++  AR+L  GG+   
Sbjct: 132  PRFKLVIDDGVNFVNQTTE-KFDVIISDCTDPIGPGESLFTSVFYEGCARSLNEGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q    +L      N        F   V++    +PTY  G++ F   +T+ PA      +
Sbjct: 191  QNGVCFLQQDEAVNSHNKLSHYF-SDVSFYQAAIPTYYGGIMTF-AWATQNPA------L 242

Query: 1264 NPIDEA----NDAKSKSPLKFYNSEIHSAAFCLPSF 1359
              +D A      A++    ++YN  IH  +F LP +
Sbjct: 243  RQLDLATLQNRFAQAGLACRYYNPAIHVGSFALPQY 278



>gb:BX936398_835365 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 296

 Score =  107 bits (268), Expect(2) = 2e-36
 Identities = 50/112 (44%), Positives = 80/112 (71%), Gaps = 1/112 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           VE +L++ K+++QD+++F++   G+V+ LDGV+Q TERDE  Y EM+TH+PL +    KK
Sbjct: 21  VENVLYREKTEHQDLVIFENPELGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGQAKK 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDP 905
           VL+I      +LREV+RH +++QI + EID  VV+  +Q+ P+ + G Y+DP
Sbjct: 81  VLIIGGGDGAMLREVSRHKNIEQITMVEIDAGVVEFCRQYLPNHSAGAYDDP 132



 Score = 69.7 bits (169), Expect(2) = 2e-36
 Identities = 48/156 (30%), Positives = 73/156 (46%), Gaps = 4/156 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+    E  +D +I D +DPIGP + LF   F++  AR+L  GG+   
Sbjct: 132  PRFKLVIDDGVNFVNQTTE-KFDVIISDCTDPIGPGESLFTSVFYEGCARSLNEGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q    +L      N        F   V++    +PTY  G++ F   +T+ PA      +
Sbjct: 191  QNGVCFLQQDEAVNSHNKLSHYF-SDVSFYQAAIPTYYGGIMTF-AWATQNPA------L 242

Query: 1264 NPIDEA----NDAKSKSPLKFYNSEIHSAAFCLPSF 1359
              +D A      A++    ++YN  IH  +F LP +
Sbjct: 243  RQLDLATLQNRFAQAGLACRYYNPAIHVGSFALPQY 278



>gb:AY658708_2147718 Synthetic construct Peudomonas aeruginosa clone
           FLH034845.01F PA1687 gene, partial cds.
          Length = 287

 Score =  100 bits (249), Expect(2) = 2e-36
 Identities = 47/125 (37%), Positives = 83/125 (66%), Gaps = 1/125 (0%)
 Frame = +3

Query: 543 MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHL 722
           ++ G      ++ +L + ++++Q +++F+++  G+V+ LDGVIQ TE DE  Y EM+TH+
Sbjct: 8   LYQGYGQRFSIDNMLHEVRTEHQHLVIFENARMGRVMALDGVIQTTEADEFIYHEMLTHV 67

Query: 723 PLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YE 899
           P+ +    ++VL+I      +LREVA+H SV++I + EID  VVD+ K+F P+ + G ++
Sbjct: 68  PILAHGAARRVLIIGGGDGGMLREVAKHKSVERITMVEIDGTVVDMCKEFLPNHSQGAFD 127

Query: 900 DPPCN 914
           DP  N
Sbjct: 128 DPRLN 132



 Score = 77.0 bits (188), Expect(2) = 2e-36
 Identities = 50/158 (31%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ L I DG+ F+    E  +D +I DS+DPIGP + LF + F+Q   R L  GG++ T
Sbjct: 129  PRLNLVIDDGMRFVATTEE-RFDVIISDSTDPIGPGEVLFSENFYQACRRCLNEGGILVT 187

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST-EGPAVDFKHP 1260
            Q  + ++ +  +    A    +F    ++    VPTY  G + F   ST EG     + P
Sbjct: 188  QNGTPFMQLEEVRTTAARTDGLF-ADWHFYQAAVPTYIGGAMTFAWGSTHEGLR---RLP 243

Query: 1261 INPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            +  + +     S    ++YN++IH  AF LP +  + I
Sbjct: 244  LETLRQ-RFRDSGIATRYYNADIHLGAFALPQYVLQAI 280



>sp|Q9X6R0|SPE1_PSEAE Spermidine synthase 1 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 1) (SPDSY
           1).>pir|G83433|G83433 spermidine synthase PA1687
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004596_55923 Pseudomonas aeruginosa PAO1,
           section 157 of 529 of the complete
           genome.>gb:AE004091_970023 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 286

 Score =  100 bits (249), Expect(2) = 2e-36
 Identities = 47/125 (37%), Positives = 83/125 (66%), Gaps = 1/125 (0%)
 Frame = +3

Query: 543 MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHL 722
           ++ G      ++ +L + ++++Q +++F+++  G+V+ LDGVIQ TE DE  Y EM+TH+
Sbjct: 8   LYQGYGQRFSIDNMLHEVRTEHQHLVIFENARMGRVMALDGVIQTTEADEFIYHEMLTHV 67

Query: 723 PLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YE 899
           P+ +    ++VL+I      +LREVA+H SV++I + EID  VVD+ K+F P+ + G ++
Sbjct: 68  PILAHGAARRVLIIGGGDGGMLREVAKHKSVERITMVEIDGTVVDMCKEFLPNHSQGAFD 127

Query: 900 DPPCN 914
           DP  N
Sbjct: 128 DPRLN 132



 Score = 77.0 bits (188), Expect(2) = 2e-36
 Identities = 50/158 (31%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ L I DG+ F+    E  +D +I DS+DPIGP + LF + F+Q   R L  GG++ T
Sbjct: 129  PRLNLVIDDGMRFVATTEE-RFDVIISDSTDPIGPGEVLFSENFYQACRRCLNEGGILVT 187

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST-EGPAVDFKHP 1260
            Q  + ++ +  +    A    +F    ++    VPTY  G + F   ST EG     + P
Sbjct: 188  QNGTPFMQLEEVRTTAARTDGLF-ADWHFYQAAVPTYIGGAMTFAWGSTHEGLR---RLP 243

Query: 1261 INPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
            +  + +     S    ++YN++IH  AF LP +  + I
Sbjct: 244  LETLRQ-RFRDSGIATRYYNADIHLGAFALPQYVLQAI 280



>gb:AP008231_580591 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 286

 Score = 99.0 bits (245), Expect(2) = 1e-35
 Identities = 58/165 (35%), Positives = 91/165 (55%), Gaps = 5/165 (3%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ + IGDG+AF++   + +YD ++VD SDP GPA  LF + F++   R L+PGGV  +
Sbjct: 132  PRLNVKIGDGIAFVQTAPDASYDVILVDGSDPAGPAAGLFNREFYENCRRVLKPGGVFAS 191

Query: 1084 QAES----IWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCS-TEGPAVD 1248
            QAES    + +H+ +IE + A      +    Y W  VP YPSG   ++  S T G    
Sbjct: 192  QAESPDSFLAVHLEMIETLSA---VFAEAKPYYGW--VPMYPSGWWSWLYASDTPG---Q 243

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
            F+ P         A  +  ++ YN +IH AAF  P+F ++ + ++
Sbjct: 244  FQKP----QSDRLAAIEPQVEIYNRDIHQAAFAQPNFVRRGLSAR 284



 Score = 75.9 bits (185), Expect(2) = 1e-35
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 5/131 (3%)
 Frame = +3

Query: 537 SPMWPGEAHSLKVE-----KLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           +P+W  E    +V      ++L++  S +Q + +  +  YG+ L+LD      ER E  Y
Sbjct: 5   APVWIDEVFEDRVRYGLRGQILWEETSPFQKITIVDTEHYGRGLLLDDCWMTAERCEVCY 64

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            E + H PL +  +  +VLVI       +REV R+A V+Q+D+ EID  VV++++++   
Sbjct: 65  HEYLVHPPLTTAASIARVLVIGGGDGGTVREVLRYAEVEQVDLVEIDGRVVELSQEYLGA 124

Query: 882 VAVGYEDPPCN 914
           +   + DP  N
Sbjct: 125 IGTAWADPRLN 135



>gb:AE014297_1138707 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003683_1220700 Drosophila melanogaster
            chromosome 3R, section 21 of 118 of the complete
            sequence.>gb:AY059440_1292041 Drosophila melanogaster
            GH08387 full length cDNA.
          Length = 217

 Score =  110 bits (274), Expect(2) = 1e-35
 Identities = 61/159 (38%), Positives = 94/159 (59%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            G    ++ L IGDG  ++K   +  +D +I DSSDPIGPA  LF++ +++ +  AL+  G
Sbjct: 62   GFANEKLKLTIGDGFDYMKK-HKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKDDG 120

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            +VC+Q  S WL +  I+  ++ C++ F   V YA T+VP+YP G IGF++ S      DF
Sbjct: 121  IVCSQGGSFWLDLDYIKKTMSGCKEHF-AKVAYAVTSVPSYPCGHIGFVMGSL-NKNQDF 178

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKK 1368
              P     E +       L++Y+SE+HSAAF LP + +K
Sbjct: 179  ATPKLGKSEIDSI----DLRYYSSEVHSAAFALPRWVQK 213



 Score = 64.3 bits (155), Expect(2) = 1e-35
 Identities = 29/63 (46%), Positives = 43/63 (68%)
 Frame = +3

Query: 708 MITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVA 887
           MI+ LPLC+ PNPKKVL++      V REV +H  V+++   EID  VV+++KQ+ P +A
Sbjct: 1   MISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVELSKQYLPAMA 60

Query: 888 VGY 896
            G+
Sbjct: 61  CGF 63



>sp|Q891W4|SPEE_CLOTE Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE015943_321293
           Clostridium tetani E88, section 8 of 10 of the complete
           genome.>gb:AE015927_964082 Clostridium tetani E88,
           complete genome.
          Length = 281

 Score =  101 bits (251), Expect(2) = 2e-35
 Identities = 47/115 (40%), Positives = 76/115 (66%), Gaps = 1/115 (0%)
 Frame = +3

Query: 570 KVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPK 749
           K+++ L + K++YQD+ +  +   G++LVLDG++Q + +DE  Y EMITH+PL + PNPK
Sbjct: 18  KIKETLVRKKTEYQDLAIVDTYALGRMLVLDGIVQTSIKDEYVYHEMITHIPLYTHPNPK 77

Query: 750 KVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVA-VGYEDPPC 911
           KVLV+       +RE+ +H SV++  +CEID+ VV   K+  P+++    ED  C
Sbjct: 78  KVLVVGGGDGGTIREILKHPSVEKAVLCEIDEEVVKECKKHLPEISNNALEDSRC 132



 Score = 72.4 bits (176), Expect(2) = 2e-35
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 2/158 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R  + IGDG+ ++ N  +  +D VI+DS+DP G A+ LF   F+  ++  L   G+   Q
Sbjct: 131  RCEVFIGDGIKYV-NEHKNEFDVVIIDSTDPFGAAEGLFGGSFYGKISECLTEDGIFVAQ 189

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
             E+ +    I++ +  + + +F  +  +    +PTYPSG   F + S        KH   
Sbjct: 190  TETPFYLPEIVKRVYDDSKAVFPVTKLF-MAAIPTYPSGYWSFTIGSK-------KHDPE 241

Query: 1267 --PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
              P+ E    ++    K+Y   +HSA+F LP F + +I
Sbjct: 242  KAPVPEVLPFET----KYYTPRLHSASFVLPKFVENLI 275



>sp|Q884N3|SPEE_PSESM Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE016863_351485
           Pseudomonas syringae pv. tomato str. DC3000 section 8 of
           21 of the complete genome.>gb:AE016853_1036660
           Pseudomonas syringae pv. tomato str. DC3000 complete
           genome.
          Length = 286

 Score = 99.4 bits (246), Expect(2) = 4e-35
 Identities = 47/120 (39%), Positives = 79/120 (65%)
 Frame = +3

Query: 543 MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHL 722
           ++ G     ++EK+L + ++++Q +++FQ+   G+V+ LDGVIQ TE DE  Y EM+TH+
Sbjct: 8   LYEGYGQRFRMEKMLHEVRTEHQHLVIFQNPRMGRVMALDGVIQTTEADEFIYHEMLTHV 67

Query: 723 PLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYED 902
           P+ +    K+VL+I      +LREVA+H +V+ I + EID  VV++ K+F P+ + G  D
Sbjct: 68  PILAHGAAKRVLIIGGGDGGMLREVAKHLTVEHITMVEIDATVVEMCKEFLPNHSSGAFD 127



 Score = 73.6 bits (179), Expect(2) = 4e-35
 Identities = 45/153 (29%), Positives = 76/153 (49%), Gaps = 2/153 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R+ L I DG+ F+    E  +D +I DS+DPIGP + LF + F+Q   R L  GG++ TQ
Sbjct: 130  RLNLVIDDGMRFVATTEE-KFDVIISDSTDPIGPGEVLFSENFYQACHRCLNEGGILVTQ 188

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
              + ++ +  ++        +F    ++    +PTY  G + F   +T     D  +   
Sbjct: 189  NGTPFMQLSGVQTTAGRMNGLF-ADWHFYQAAIPTYIGGAMTFAWGAT-----DKSYRKL 242

Query: 1267 PIDEANDAKSKSPL--KFYNSEIHSAAFCLPSF 1359
            P++      S S +  ++YN E+H  AF LP +
Sbjct: 243  PLETLRQRFSGSGIVTRYYNPEVHIGAFALPQY 275



>sp|Q9WZC2|SPEE_THEMA Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|C72348|C72348
           spermidine synthase - Thermotoga maritima (strain
           MSB8)>gb:AE001739_38566 Thermotoga maritima MSB8 section
           51 of 136 of the complete genome.>gb:AE000512_1113039
           Thermotoga maritima MSB8, complete genome.
          Length = 296

 Score =  103 bits (257), Expect(2) = 6e-35
 Identities = 43/113 (38%), Positives = 74/113 (65%)
 Frame = +3

Query: 567 LKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNP 746
           +K+ ++++ G+SD Q + +F++   G V  LDG+   TE+DE  Y EM+ H+P+   PNP
Sbjct: 32  MKMNRVIYSGQSDIQRIDIFENPDLGVVFALDGITMTTEKDEFMYHEMLAHVPMFLHPNP 91

Query: 747 KKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDP 905
           KKVL+I       LREV +H SV++  +CE+D +V++ A+++    + G++DP
Sbjct: 92  KKVLIIGGGDGGTLREVLKHDSVEKAILCEVDGLVIEAARKYLKQTSCGFDDP 144



 Score = 68.6 bits (166), Expect(2) = 6e-35
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 1/160 (0%)
 Frame = +1

Query: 892  GMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI-GPAQELFEKPFFQTVARALRPG 1068
            G   PR  + I +G  +++   +  +D +I+DS+DP  G    LF + F+Q    AL+  
Sbjct: 140  GFDDPRAEIVIANGAEYVRKF-KNEFDVIIIDSTDPTAGQGGHLFTEEFYQACYDALKED 198

Query: 1069 GVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVD 1248
            GV   + E  +  +   +       ++F  +  Y    + TYPSG+  +   S     +D
Sbjct: 199  GVFSAETEDPFYDIGWFKLAYRRISKVFPITRVYLGF-MTTYPSGMWSYTFASK---GID 254

Query: 1249 FKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKK 1368
               PI   D     K    LK+YN E+H A+F LP+F KK
Sbjct: 255  ---PIKDFDPEKVRKFNKELKYYNEEVHVASFALPNFVKK 291



>sp|Q97FX3|SPEE_CLOAB Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|C97220|C97220
           spermidine synthase [imported] - Clostridium
           acetobutylicum>gb:AE007757_229911 Clostridium
           acetobutylicum ATCC 824 section 245 of 356 of the
           complete genome.>gb:AE001437_1092866 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 286

 Score = 88.2 bits (217), Expect(2) = 2e-34
 Identities = 41/116 (35%), Positives = 72/116 (62%), Gaps = 6/116 (5%)
 Frame = +3

Query: 543 MWPGEAH------SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           +W  E+H      S++V++ L+  K+ +Q +  F+S T+G    LDG I +TE+DE  Y 
Sbjct: 4   LWYSESHADDTKFSIRVKEHLYSEKTPFQQIDFFKSETFGTFFTLDGYIMMTEKDEFIYH 63

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           EMITH+P+   P  KKVL++        RE+ R+ +++++D+ EID+ VV + +++
Sbjct: 64  EMITHVPMAVNPKIKKVLIVGGGDGGTSREILRYNTIEKVDMVEIDERVVRLCQKY 119



 Score = 82.4 bits (202), Expect(2) = 2e-34
 Identities = 50/159 (31%), Positives = 81/159 (50%), Gaps = 2/159 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R+T+H  DG  F+K    G YD ++VDS+DPIGP + LF   F++   R L   G++  Q
Sbjct: 132  RLTMHFEDGKEFVKRAETGFYDLILVDSTDPIGPGEGLFTNEFYRDCERILSDDGILINQ 191

Query: 1087 AESIWL--HMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHP 1260
             ES +   + H ++   +  +  F  S+ Y +  +PTY SG   F   S +       HP
Sbjct: 192  HESPYYKDYCHEMKRAHSKIKDKFPISMVYQF-HMPTYASGHWLFGFASKK------YHP 244

Query: 1261 INPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
            +N ++  +        K+YN+ +H  AF LP++    +E
Sbjct: 245  LNNLNADSWNSLGLKTKYYNTNLHKGAFALPNYVIDELE 283



>sp|Q7N892|SPEE_PHOLL Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:BX571861_785702
           Photorhabdus luminescens subsp. laumondii TTO1 complete
           genome; segment 3/17.
          Length = 289

 Score =  102 bits (255), Expect(2) = 7e-34
 Identities = 48/115 (41%), Positives = 78/115 (67%), Gaps = 1/115 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           V+K+L+  K+++QD+++F+++T G+++ LDG +Q TERDE  Y EM+ H+PL +  N K+
Sbjct: 21  VDKVLYHDKTEHQDLIIFENATLGRIMALDGTVQTTERDEFIYHEMMAHVPLFAHGNAKR 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG-YEDPPCN 914
           VL+I      +LREV RH  ++ I + EID  VV+  +Q+ P+   G Y+DP  N
Sbjct: 81  VLIIGGGDGGMLREVCRHQYLESITMVEIDAGVVEFCRQYLPNHNAGAYDDPRFN 135



 Score = 65.9 bits (159), Expect(2) = 7e-34
 Identities = 45/152 (29%), Positives = 67/152 (44%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L I DGV F+ N  +  +D +I D +DPIGP + LF   F+Q   R L  GG+   
Sbjct: 132  PRFNLIIDDGVNFV-NTTDQKFDVIISDCTDPIGPGEGLFTSEFYQGCQRCLNEGGIFVA 190

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q    +L               F  S  Y    +PTY  G++ F   S + PA+  +H  
Sbjct: 191  QNGVCFLQQDEAVTSHKKLSNYFADSGFYQ-AAIPTYYGGIMTFAWAS-QNPAL--RHVD 246

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSF 1359
                +     +    ++YN  +H  +F LP +
Sbjct: 247  LATLQQRFDNASFTCRYYNPAVHVGSFALPQY 278



>gb:AE017282_428774 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 285

 Score = 85.5 bits (210), Expect(2) = 1e-33
 Identities = 43/128 (33%), Positives = 76/128 (59%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E  P   G A SLK+   L + ++ +Q + ++ + ++GK++V+DG   +++RD   Y
Sbjct: 7   WFTESYPD-NGSALSLKIRAKLHEEQTPFQRIEIYDTESFGKLMVIDGCTMVSDRDNFLY 65

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM+TH  L + P PK V +I       LREV +H+ V++    +ID+ V  +A+++FP+
Sbjct: 66  HEMMTHPVLYTHPAPKTVWIIGGGDCGSLREVLKHSEVEKAVQIDIDERVTRLAERYFPE 125

Query: 882 VAVGYEDP 905
           +     DP
Sbjct: 126 LCEANGDP 133



 Score = 82.4 bits (202), Expect(2) = 1e-33
 Identities = 51/153 (33%), Positives = 79/153 (51%), Gaps = 1/153 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L   DG+ ++K   +G  D +IVDS+DP+GPA+ LF + FF+   R LR  G++  
Sbjct: 133  PRAELLFIDGIQWVKEAPDGCVDVIIVDSTDPVGPAEGLFNEAFFRQCHRCLRTDGILVQ 192

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q+ES   H+ +I ++    RQ         +     YPSG     +          K  +
Sbjct: 193  QSESPLFHLPLIASMHRIMRQAGFAQTRTLFFPQFIYPSGWWSATMAG--------KGDL 244

Query: 1264 NPIDEANDAKSK-SPLKFYNSEIHSAAFCLPSF 1359
            N    A+ A++K  P ++YN++IH AAF +P F
Sbjct: 245  NRF-RADAAEAKLFPTRYYNADIHRAAFAVPEF 276



>sp|Q8K9T5|SPEE_BUCAP Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE014096_303127
           Buchnera aphidicola str. Sg (Schizaphis graminum)
           section 21 of 57 of the complete
           genome.>gb:AE013218_935105 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 286

 Score =  101 bits (252), Expect(2) = 6e-32
 Identities = 42/102 (41%), Positives = 71/102 (69%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           ++K+L++ K+ Y D+++FQ+S  G+++ +DGV+Q TE+DE  Y EM+TH+P+      K 
Sbjct: 21  IDKILYQKKNKYHDIIIFQNSIMGRIMAIDGVVQTTEKDEFIYHEMLTHVPIFYHGLIKN 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           VL++      +LRE+ RH S++ I + EID  ++D+ KQFFP
Sbjct: 81  VLIVGGGDGGILREICRHKSIENITMVEIDLNIIDLCKQFFP 122



 Score = 60.5 bits (145), Expect(2) = 6e-32
 Identities = 43/152 (28%), Positives = 71/152 (46%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ + I +G+ F++   E  +D +I DS+DPIG  ++LF   F+      L   G+   
Sbjct: 132  PRLKIVIDNGLNFVQKTKE-KFDLIISDSTDPIGCGKDLFLSDFYFHCKNCLVKNGIFVG 190

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q    +L  + I     N ++ F   V++   T+P+Y  G    M+ S     +DF+   
Sbjct: 191  QNGVFFLQKNDINQSYKNLKKNFH-DVSFYQATIPSYYGGT---MMFSWGTDNIDFRQIN 246

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSF 1359
                E      K    +YNS IH ++F LP +
Sbjct: 247  IKNLEKRIKDKKLTFNYYNSNIHISSFYLPQY 278



>sp|P57305|SPEE_BUCAI Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|F84954|F84954
           spermidine synthase (EC 2.5.1.16) [imported] - Buchnera
           sp.  (strain APS)>gb:BA000003_653580 Buchnera aphidicola
           str. APS (Acyrthosiphon pisum) genomic DNA, complete
           sequence.
          Length = 286

 Score =  100 bits (250), Expect(2) = 5e-31
 Identities = 45/115 (39%), Positives = 78/115 (67%), Gaps = 1/115 (0%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           +EK+L+K K+ +  VM+F++S +GK++V+D ++Q TERDE  Y EM+TH+P+ +  + K 
Sbjct: 21  IEKMLYKKKTPHHQVMIFKNSVFGKIMVIDDIVQTTERDEFIYHEMLTHVPIIAHGSIKS 80

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVA-VGYEDPPCN 914
           VL+I      +LREV R+  ++ I + EID  ++D+ K++FP+ +   Y+D   N
Sbjct: 81  VLIIGGGDGGILREVCRYKMIENITMVEIDVNIIDLCKKYFPNHSNQAYQDSRLN 135



 Score = 58.2 bits (139), Expect(2) = 5e-31
 Identities = 41/151 (27%), Positives = 69/151 (45%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R+ L I DG+ F+K   E  +D +I DS+DPIG  + LF   F+      L   G+   Q
Sbjct: 133  RLNLIIDDGLNFIKRTKE-KFDLIISDSTDPIGCGKNLFRSEFYFNCKNHLEENGIFVAQ 191

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
                +L  +       N ++ F  +  Y    VPTY  GV+ F   +     ++++    
Sbjct: 192  NGVFFLQKNETILTYKNLKKYFYDTRFYQ-ANVPTYYGGVMVFAWGTNN---IEYRKNSL 247

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSF 1359
               +     +K    +YN++IH ++F LP +
Sbjct: 248  EKIQIRIKNTKLDFNYYNAKIHISSFYLPQY 278



>gb:BX572101_799554 Prochlorococcus marinus MIT9313 complete genome;
            segment 7/7.
          Length = 311

 Score = 88.2 bits (217), Expect(2) = 1e-30
 Identities = 51/156 (32%), Positives = 86/156 (55%), Gaps = 1/156 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ L++ +G+A++ N  E +YD +++D SDP GPA+ LF + FF+   R LRPGGV  T
Sbjct: 160  PRLQLNLENGIAWVANATESSYDVILIDGSDPAGPAEGLFNQTFFEHCRRILRPGGVFAT 219

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q+ES      +  + V   RQ+F G  +  +  VP YPSG   +   + +GP   +++P+
Sbjct: 220  QSESPEAFRQVHIDTVRLIRQVF-GYADPLYGWVPMYPSGWWSWTFAAIDGPR--YRNPL 276

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAF-CLPSFAKK 1368
                 A  A   +  + ++      AF  +P+F ++
Sbjct: 277  ----PARAAAISAGCEIWSPRWQQGAFEAIPAFIER 308



 Score = 69.7 bits (169), Expect(2) = 1e-30
 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 1/135 (0%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           S+   GW  E      G  + L+  ++L    S YQ + V  SS YGK L+LDG     E
Sbjct: 30  STTANGWIDEHHQ---GVRYGLQ-GRVLVDETSPYQRITVIDSSRYGKGLLLDGCWMTAE 85

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
             E  Y E + H  LCS    ++VLVI        RE  R+  V  +D+ EID+ VV+++
Sbjct: 86  HQERHYHESLVHPALCSAAQLERVLVIGGGDGGTARECLRYQDVKHLDMVEIDRRVVELS 145

Query: 864 KQFFPDV-AVGYEDP 905
           ++  P + +  + DP
Sbjct: 146 QKHLPSLGSHAWSDP 160



>sp|Q7V3X3|SPEE_PROMM Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).
          Length = 286

 Score = 88.2 bits (217), Expect(2) = 1e-30
 Identities = 51/156 (32%), Positives = 86/156 (55%), Gaps = 1/156 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ L++ +G+A++ N  E +YD +++D SDP GPA+ LF + FF+   R LRPGGV  T
Sbjct: 135  PRLQLNLENGIAWVANATESSYDVILIDGSDPAGPAEGLFNQTFFEHCRRILRPGGVFAT 194

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q+ES      +  + V   RQ+F G  +  +  VP YPSG   +   + +GP   +++P+
Sbjct: 195  QSESPEAFRQVHIDTVRLIRQVF-GYADPLYGWVPMYPSGWWSWTFAAIDGPR--YRNPL 251

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAF-CLPSFAKK 1368
                 A  A   +  + ++      AF  +P+F ++
Sbjct: 252  ----PARAAAISAGCEIWSPRWQQGAFEAIPAFIER 283



 Score = 69.7 bits (169), Expect(2) = 1e-30
 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 1/135 (0%)
 Frame = +3

Query: 504 SSVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITE 683
           S+   GW  E      G  + L+  ++L    S YQ + V  SS YGK L+LDG     E
Sbjct: 5   STTANGWIDEHHQ---GVRYGLQ-GRVLVDETSPYQRITVIDSSRYGKGLLLDGCWMTAE 60

Query: 684 RDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
             E  Y E + H  LCS    ++VLVI        RE  R+  V  +D+ EID+ VV+++
Sbjct: 61  HQERHYHESLVHPALCSAAQLERVLVIGGGDGGTARECLRYQDVKHLDMVEIDRRVVELS 120

Query: 864 KQFFPDV-AVGYEDP 905
           ++  P + +  + DP
Sbjct: 121 QKHLPSLGSHAWSDP 135



>sp|Q97BN7|SPEE_THEVO Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>gb:BA000011_664860 Thermoplasma volcanium GSS1
           DNA, complete genome.
          Length = 273

 Score = 79.0 bits (193), Expect(2) = 1e-30
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 1/136 (0%)
 Frame = +3

Query: 510 VIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERD 689
           +I  WFSE          S +V   L   K+DYQ + +F +  +GK+L +DG +Q+TERD
Sbjct: 3   LIENWFSERYS--DNLQLSFRVSDQLLSIKTDYQRIDLFDTYDFGKLLAIDGTVQLTERD 60

Query: 690 ECAYQEMITHLPLCSIPN-PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
           E  Y E+IT +P     N P+  LVI        R +     +++I   EID  VV+V+K
Sbjct: 61  EYIYHELITMIPYHMTKNPPQSALVIGGGDGGAARRLL-DLGLNKIVNVEIDGQVVEVSK 119

Query: 867 QFFPDVAVGYEDPPCN 914
           +FFPD++  + D   N
Sbjct: 120 RFFPDLSSAFTDKRVN 135



 Score = 78.6 bits (192), Expect(2) = 1e-30
 Identities = 49/156 (31%), Positives = 75/156 (48%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV L I DG+ +++   E  +D VI+DS+DP GPA+ LF   F+  + + L  GGV+ +Q
Sbjct: 133  RVNLIIDDGIKYVRKCNE-KFDLVIIDSTDPEGPAEGLFSMEFYSDITKILSDGGVIVSQ 191

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            + S +     ++      R++FK  V      +PTYPSG   F + S             
Sbjct: 192  SGSPFYQPKALKLAYTGMRRLFK-DVKVYTGFIPTYPSGFWSFTIASE------------ 238

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
              D  N  K     K++N ++    F LP F K +I
Sbjct: 239  --DAMNPRKPAIKGKYFNEDVLDGVFKLPQFVKDLI 272



>sp|Q975S5|SPEE_SULTO Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>gb:BA000023_690908 Sulfolobus tokodaii str. 7
           DNA, complete genome.
          Length = 300

 Score = 87.4 bits (215), Expect(2) = 2e-30
 Identities = 44/129 (34%), Positives = 71/129 (55%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           W   I    P E H   + K++ + K+ YQ  ++ + + +GK L+LDG IQ T  DE  Y
Sbjct: 4   WHWHIEWQTPYEFHGHAITKVIAEEKTPYQRALLVELARFGKALILDGKIQSTITDEFIY 63

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            E + H  L SI NP+K+L++       LREV +H ++  + + +ID +V+D AK++  +
Sbjct: 64  HEALVHPLLLSINNPEKILILGGGEGATLREVLKHKTIKNVTMVDIDPVVIDFAKKYLQE 123

Query: 882 VAVGYEDPP 908
              G  D P
Sbjct: 124 WHQGAFDNP 132



 Score = 69.3 bits (168), Expect(2) = 2e-30
 Identities = 56/164 (34%), Positives = 82/164 (50%), Gaps = 4/164 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVARALRPGGVV 1077
            P+  L I DG  F+K   E  +DAV++D +DPI   P+Q L+ K F++ V R  + G  +
Sbjct: 132  PKSKLVIEDGYKFIKETKE-KFDAVVIDLTDPIKDSPSQMLYTKEFYEEVKRISKWG--I 188

Query: 1078 CTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTE-GPAVDFK 1254
             TQA S    +     I    + +FK  V+   T VP +  G+ GF+  S E  PA   K
Sbjct: 189  VTQATSPSFSLETFSIIYNTIKHVFK-KVSAGITYVPAF-DGLWGFVYASDEVNPAEFSK 246

Query: 1255 HPINP-IDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
              IN  I E  D      L+FY+ E H   F +P   ++V+E +
Sbjct: 247  EEINNRIKERIDGS----LRFYDGETHITMFSIPKHIREVLEKE 286



>sp|Q8PFQ4|SPEE_XANAC Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE012042_278832
           Xanthomonas axonopodis pv. citri str. 306, section 420
           of 469 of the complete genome.>gb:AE008923_920607
           Xanthomonas axonopodis pv. citri str. 306, complete
           genome.
          Length = 285

 Score = 83.2 bits (204), Expect(2) = 2e-30
 Identities = 37/117 (31%), Positives = 70/117 (59%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           G A   ++   L + +S +Q + ++Q++ +GK++++DG + +T RD   Y EMI+H  L 
Sbjct: 16  GSAIGFRISGKLDEVQSPFQKIEIYQTTDWGKLMLIDGAVMLTSRDNFFYHEMISHPALF 75

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYED 902
           + P PK+V++I       LREV +H  V+    C+ID+ V  +++++FP++     D
Sbjct: 76  THPAPKRVVIIGGGDCGTLREVLKHPGVESATQCDIDEQVTRMSEKYFPELCDSNHD 132



 Score = 73.6 bits (179), Expect(2) = 2e-30
 Identities = 48/156 (30%), Positives = 75/156 (48%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R  L   DGVA++ N   G+ D VIVDS+DP+GPA+ LF K F+++  +AL+  G++  Q
Sbjct: 134  RAELLFDDGVAYMANCQAGSVDIVIVDSTDPVGPAEGLFNKAFYESCFKALKDDGILVQQ 193

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            +ES    + +I  +     +    S        P YP+G     + S +  A DF     
Sbjct: 194  SESPLALLDLINEMRTEMGKAGFQSFKTLPFPQPCYPTGWWSVTMASKQAKA-DFAFR-- 250

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
               +A  AK    L +Y + +H+     P F  K +
Sbjct: 251  --QDAAQAKGFDTL-YYTAHLHTGVLVAPPFVAKAL 283



>sp|Q87F26|SPEE_XYLFT Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE012553_283559
           Xylella fastidiosa Temecula1, section 1 of 9 of the
           complete genome.>gb:AE009442_960135 Xylella fastidiosa
           Temecula1, complete genome.
          Length = 285

 Score = 86.3 bits (212), Expect(2) = 5e-30
 Identities = 43/128 (33%), Positives = 73/128 (57%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E      G A   +V   L + +S +Q + ++ S+ +GK++V+DG + +T RD   Y
Sbjct: 7   WFTEHFQT-TGSAIGFRVTGKLDEVQSPFQKIEIYNSTDWGKLMVIDGALMLTSRDNFLY 65

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EMI+H  L +   PK V++I       LREV +H  ++Q+  C+ID+ V  +A++ FP+
Sbjct: 66  HEMISHPALFTHTAPKCVVIIGGGDCGTLREVLKHPDIEQVTQCDIDEQVTRMAEKHFPE 125

Query: 882 VAVGYEDP 905
           +     DP
Sbjct: 126 LCTSNNDP 133



 Score = 69.3 bits (168), Expect(2) = 5e-30
 Identities = 45/153 (29%), Positives = 76/153 (49%), Gaps = 1/153 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR TL   DGVA++ +    + D +IVDS+DP+GPA+ LF + F+++  RAL+  G++  
Sbjct: 133  PRATLLFSDGVAYMADCPTNSVDVIIVDSTDPVGPAKGLFNRTFYESCFRALKNDGLLIQ 192

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q+ES    + +I+ +     +    +        P YP+G     L S++ P  +F    
Sbjct: 193  QSESPLALLELIKEMRHEMSKAGFKAFKTLPFPQPCYPTGWWSVTL-SSKQPNANFAF-- 249

Query: 1264 NPIDEANDAKSKS-PLKFYNSEIHSAAFCLPSF 1359
                   DA++K     +YN+ +H      P F
Sbjct: 250  ----RQTDAQTKPFDTLYYNAHLHHGVLVPPPF 278



>sp|Q9PH03|SPEE_XYLFA Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>pir|B82842|B82842
           spermidine synthase XF0143 [imported] - Xylella
           fastidiosa  (strain 9a5c)>gb:AE003868_47785 Xylella
           fastidiosa 9a5c, section 14 of 229 of the complete
           genome.>gb:AE003849_1114995 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 285

 Score = 85.9 bits (211), Expect(2) = 7e-30
 Identities = 42/128 (32%), Positives = 73/128 (57%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF+E      G A   ++   L + +S +Q + ++ S+ +GK++V+DG + +T RD   Y
Sbjct: 7   WFTEHFQA-TGSAIGFRITGKLDEVQSPFQKIEIYNSTDWGKLMVIDGALMLTSRDNFLY 65

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EMI+H  L +   PK V++I       LREV +H  ++Q+  C+ID+ V  +A++ FP+
Sbjct: 66  HEMISHPALFTHTAPKCVVIIGGGDCGTLREVLKHPDIEQVTQCDIDEQVTRMAEKHFPE 125

Query: 882 VAVGYEDP 905
           +     DP
Sbjct: 126 LCTSNNDP 133



 Score = 69.3 bits (168), Expect(2) = 7e-30
 Identities = 45/153 (29%), Positives = 76/153 (49%), Gaps = 1/153 (0%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR TL   DGVA++ +    + D +IVDS+DP+GPA+ LF + F+++  RAL+  G++  
Sbjct: 133  PRATLLFSDGVAYMTDCPTNSVDVIIVDSTDPVGPAKGLFNRTFYESCFRALKNDGLLVQ 192

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            Q+ES    + +I+ +     +    +        P YP+G     L S++ P  +F    
Sbjct: 193  QSESPLALLELIKEMRHEMSKAGFKAFKTLPFPQPCYPTGWWSVTL-SSKQPNANFAF-- 249

Query: 1264 NPIDEANDAKSKS-PLKFYNSEIHSAAFCLPSF 1359
                   DA++K     +YN+ +H      P F
Sbjct: 250  ----RQTDAQTKPFDTLYYNAHLHHGVLVPPPF 278



>gb:AE013598_293920 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 285

 Score = 82.8 bits (203), Expect(2) = 1e-29
 Identities = 37/117 (31%), Positives = 70/117 (59%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           G A   ++   L + +S +Q + ++Q++ +GK++++DG + +T RD   Y EMI+H  L 
Sbjct: 16  GSAIGFRISGKLDEVQSLFQKIEIYQTTDWGKLMLIDGAVMLTSRDNFFYHEMISHPALF 75

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYED 902
           + P PK+V++I       LREV +H  V+    C+ID+ V  +++++FP++     D
Sbjct: 76  THPTPKRVVIIGGGDCGTLREVLKHPGVESATQCDIDEQVTRMSEKYFPELCDSNHD 132



 Score = 71.6 bits (174), Expect(2) = 1e-29
 Identities = 48/156 (30%), Positives = 75/156 (48%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R  L   DGVA++ N   G+ D VIVDS+DP+GPA+ LF K F+++  +AL+  G++  Q
Sbjct: 134  RAELLFDDGVAYMANCPAGSVDIVIVDSTDPVGPAEGLFNKAFYESCFKALKDDGLLVQQ 193

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            +ES    + +I+ +     +    S        P YP+G     + S +  A DF     
Sbjct: 194  SESPLALLDLIKEMRTEMGKAGFQSFKTLPFPQPCYPTGWWSVTMASKQAKA-DFAFR-- 250

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
                A  AK    L +Y + +H+     P F  K +
Sbjct: 251  --QGAAQAKGFETL-YYTAHLHTGVLVAPPFVAKAL 283



>sp|Q9V277|SPEE_PYRAB Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>pir|B75209|B75209 spermidine synthase (spee)
           PAB2221 - Pyrococcus abyssi  (strain
           Orsay)>gb:CNSPAX01_848960 Pyrococcus abyssi complete
           genome; segment 1/6.
          Length = 279

 Score = 82.0 bits (201), Expect(2) = 1e-29
 Identities = 38/107 (35%), Positives = 67/107 (62%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           G   + KV++ +F+G S +Q + V+++  +G++L LDG +Q+    E +Y E + H  + 
Sbjct: 10  GYGVAFKVKEKIFEGHSKFQKIEVYETEGFGRLLALDGTVQLVTEGEESYHESLVHPVML 69

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           + PNP++VLVI       +REV RH  V++  + EID+ V++VA +F
Sbjct: 70  AHPNPRRVLVIGGGDGGTIREVLRHEEVEEAIMVEIDEEVIEVAIKF 116



 Score = 72.4 bits (176), Expect(2) = 1e-29
 Identities = 49/157 (31%), Positives = 76/157 (48%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R  L IGDGV F+K      +D VIVDS+DP+GPA+ LF + F++    AL   G+  TQ
Sbjct: 134  RAKLIIGDGVEFIKE--NSGFDVVIVDSTDPVGPAKMLFSREFYERAYEALNDPGIYVTQ 191

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            A S++L    +     N  ++F          V  Y   VIG+   S     V  K  ++
Sbjct: 192  AGSVYLFTDELVTAYENMSRVF--------DKVYAYSFPVIGY--ASPWAFLVGIKGDLD 241

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
                  +   K  LK+Y+ E H   F +P + +++++
Sbjct: 242  FRKIDLERAKKLNLKYYDPENHETIFQMPRYVREMLK 278



>gb:AB198392_18215 Selenomonas ruminantium gene for putative
           spermidine synthase, complete cds.
          Length = 286

 Score = 97.1 bits (240), Expect(2) = 2e-29
 Identities = 45/127 (35%), Positives = 80/127 (62%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WFS++         S++V++ LF  +S+YQ + VF+S  +G+++VLDG I  +E DE  Y
Sbjct: 4   WFSQMDT--ENVKTSVRVDRQLFSRQSEYQRINVFESREFGRMIVLDGEIIFSEADEFIY 61

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM+ H+P+   P  K VL+I      V + + ++  ++ ID+ E D+M ++V+++FFP+
Sbjct: 62  NEMVVHVPMAVHPCVKNVLIIGGGDGGVAKVLTQYPEIEAIDVVEPDEMFIEVSREFFPE 121

Query: 882 VAVGYED 902
            A G++D
Sbjct: 122 TARGFDD 128



 Score = 57.0 bits (136), Expect(2) = 2e-29
 Identities = 44/167 (26%), Positives = 73/167 (43%), Gaps = 8/167 (4%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV +   DG+ FL+   +  YD +I DS+DP G  + LF + F+    RAL   G++  Q
Sbjct: 130  RVKITNMDGLRFLRRCRD-KYDLIINDSTDPFGHTEGLFTREFYGNCYRALHDDGIMVYQ 188

Query: 1087 --------AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPA 1242
                     E+ +  MH          Q F  S  Y   ++PT P+G+  F   S +   
Sbjct: 189  HGSPFYDEDEAAFRAMH------RKAYQSFPVSRVYQ-ASIPTCPAGIWMFGFASKK--- 238

Query: 1243 VDFKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
                HP+   D     + +    +Y + +H  AF LP + + ++  +
Sbjct: 239  ---YHPLKDFDAQRWNERQLETWYYTTHLHKGAFMLPKYVEDILSEE 282



>gb:AP006878_575299 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 288

 Score = 84.0 bits (206), Expect(2) = 2e-29
 Identities = 44/112 (39%), Positives = 72/112 (64%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           G     KV++ LF+ +++YQ + ++++  +GK+LVLDG +Q+ E  E +Y E++ H  + 
Sbjct: 17  GYGVGFKVKRRLFETQTEYQRLEIYETEGFGKLLVLDGTVQLVEVGEESYHEVLVHPVML 76

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVA 887
           + PNP+KVLVI       LREV RH +V++  + EID+ VV+ A   + DVA
Sbjct: 77  AHPNPRKVLVIGGGDGGTLREVLRHDTVEKAIMVEIDEGVVE-ASYLYLDVA 127



 Score = 69.7 bits (169), Expect(2) = 2e-29
 Identities = 46/160 (28%), Positives = 80/160 (50%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR  L IGDGV +L+   E  +D +IVDS+DP+GPA+ LF + F++     L   G+  T
Sbjct: 140  PRAELIIGDGVKYLRETDE-RFDVIIVDSTDPVGPAKLLFSEEFYRDAYEKLNEKGLYVT 198

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
            QA S++L  + + +     +++F     +++         VIG+   S     V  K  +
Sbjct: 199  QAGSVYLFTNELLDAYKAMKKVFDRVYYFSFP--------VIGY--ASPWSFLVGVKGDV 248

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESK 1383
            +      +   K  L +Y+ E H   F +P + +K++E +
Sbjct: 249  DFTRIDLERAKKLDLYYYDPERHETLFQMPRYVRKLLEGQ 288



>sp|Q8P447|SPEE_XANCP Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE012508_283089
           Xanthomonas campestris pv. campestris str. ATCC 33913,
           section 416 of 460 of the complete
           genome.>gb:AE008922_916371 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 285

 Score = 81.3 bits (199), Expect(2) = 2e-29
 Identities = 36/117 (30%), Positives = 70/117 (59%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           G A   ++   L + +S +Q + ++Q++ +GK++++DG + +T RD   Y EMI+H  L 
Sbjct: 16  GSAIGYRISGKLDEVQSPFQKIEIYQTTDWGKLMIIDGAVMLTSRDNFFYHEMISHPALF 75

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYED 902
           +   PK+V++I       LREV +H  V+    C+ID+ V  +++++FP++    +D
Sbjct: 76  THAAPKRVVIIGGGDCGTLREVLKHPGVESATQCDIDEQVTRMSEKYFPELCDSNDD 132



 Score = 72.4 bits (176), Expect(2) = 2e-29
 Identities = 47/157 (29%), Positives = 76/157 (48%), Gaps = 1/157 (0%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R  L   DGVA++ N   G+ D VIVDS+DP+GPA+ LF K F+++  +AL+  G++  Q
Sbjct: 134  RAELLFDDGVAYMANCPAGSVDIVIVDSTDPVGPAEGLFNKSFYESCFKALKDDGILVQQ 193

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            +ES    + +I+ +     +    S        P YP+G     + S +  A DF     
Sbjct: 194  SESPLALLDLIKEMRTEMGKAGFQSFKTLPFPQPCYPTGWWSVTMASKQANA-DFAF--- 249

Query: 1267 PIDEANDAKSKS-PLKFYNSEIHSAAFCLPSFAKKVI 1374
                  DA++K     +Y + +H+     P F  K +
Sbjct: 250  ---RQADAQAKGFDTLYYTAHLHTGVLVAPPFVAKAL 283



>sp|Q9HL75|SPEE_THEAC Probable spermidine synthase (EC 2.5.1.16)
            (Putrescine aminopropyltransferase)
            (SPDSY).>gb:TACID2_196129 Thermoplasma acidophilum
            complete genome; segment 2/5.
          Length = 273

 Score = 77.8 bits (190), Expect(2) = 3e-29
 Identities = 48/155 (30%), Positives = 79/155 (50%)
 Frame = +1

Query: 910  VTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQA 1089
            V L I DG+ ++KN +E  +D +I+DS+DP GPA+ LF K F+    + +  G V+ +Q+
Sbjct: 134  VKLLIQDGIKYVKNTSE-KFDLIIIDSTDPEGPAEGLFSKDFYNDTRKIMNEGAVIVSQS 192

Query: 1090 ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPINP 1269
             S +     I+   +  R++F   V      +PTYPSG   F + S   P      P+N 
Sbjct: 193  GSPFYQPKAIKLAYSGMREVF-SDVRVYTGFIPTYPSGFWSFTVAS---PWTMKPRPVNM 248

Query: 1270 IDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
                         K++N+++   +F LP F K++I
Sbjct: 249  SG-----------KYFNADVMEGSFRLPQFVKELI 272



 Score = 75.1 bits (183), Expect(2) = 3e-29
 Identities = 46/132 (34%), Positives = 69/132 (52%), Gaps = 1/132 (0%)
 Frame = +3

Query: 510 VIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERD 689
           +I  WFSE          S +V   L   K+DYQ + +F +  +GK+L +DG +Q+TERD
Sbjct: 3   LIENWFSERYS--DNLQLSFRVSDQLLSIKTDYQRIDLFDTYDFGKLLAIDGTVQLTERD 60

Query: 690 ECAYQEMITHLPLCSIPN-PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
           E  Y E+IT +P    P  P+  L+I        R +     +  I   EID  VV+V+K
Sbjct: 61  EFIYHELITMVPYHLTPRPPENALIIGGGDGGAARRLI-DLGLKHIVNVEIDDQVVEVSK 119

Query: 867 QFFPDVAVGYED 902
           +FFP ++  + D
Sbjct: 120 RFFPSLSSAFND 131



>gb:AE017261_419630 Picrophilus torridus DSM 9790, complete genome.
          Length = 275

 Score = 81.6 bits (200), Expect(2) = 5e-29
 Identities = 47/157 (29%), Positives = 81/157 (51%)
 Frame = +1

Query: 910  VTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQA 1089
            V L IGDG+ ++K+  E ++D +I+DS+DP+GPA+ LF K F++     L   G++ TQ+
Sbjct: 133  VELIIGDGIKYVKDTDE-SFDLIIIDSTDPVGPAEGLFNKSFYENARARLSDDGIIVTQS 191

Query: 1090 ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPINP 1269
             S +     ++        +F     Y    +PTYPSG+  F + S            + 
Sbjct: 192  GSPYYQPEALKMATKGMLDVFSNVRTYI-AFIPTYPSGLWSFTMASK-----------SE 239

Query: 1270 IDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
            I +  D  +  P +++N ++   +F LP F K +I+S
Sbjct: 240  IMQRKD--NIIPGRYFNEDVLKGSFYLPEFVKNIIKS 274



 Score = 70.9 bits (172), Expect(2) = 5e-29
 Identities = 40/131 (30%), Positives = 70/131 (53%)
 Frame = +3

Query: 510 VIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERD 689
           +I  WFSE          S +V+  L   K+DYQ + +F +  +GK+L +DG +Q+TE+D
Sbjct: 3   LIENWFSERYS--DNLQLSFRVQDQLLSVKTDYQRIDLFNTYDFGKLLSIDGTVQLTEKD 60

Query: 690 ECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQ 869
           E  Y EMIT +P          L+I        + +     + +I   EID+ VV+++++
Sbjct: 61  EYIYHEMITMVPYYCTAKSDSALIIGGGDGGAAKRLI-DLGIKRIVNVEIDQNVVEISRK 119

Query: 870 FFPDVAVGYED 902
           +FP++A  + +
Sbjct: 120 YFPELADSFNN 130



>sp|O27950|SPEE_ARCFU Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>pir|F69541|F69541 spermidine synthase (speE)
           homolog - Archaeoglobus fulgidus>gb:AE000943_29581
           Archaeoglobus fulgidus DSM 4304 section 164 of 172 of
           the complete genome.>gb:AE000782_976209 Archaeoglobus
           fulgidus DSM 4304 complete genome.
          Length = 269

 Score = 84.7 bits (208), Expect(2) = 1e-28
 Identities = 47/127 (37%), Positives = 79/127 (62%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF E    + G   ++KV+K L++ +   Q V ++++ + GK+LV+DG IQ+TE DE  Y
Sbjct: 3   WFFEY---YDGCGLAIKVKKKLYEAEG-VQKVEIYETESMGKMLVIDGKIQLTELDEPFY 58

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            EM+ H+P+ S  NP+KV VI       LREV +H +V++  + +ID+ V+D++++F   
Sbjct: 59  HEMLVHVPMLSHENPRKVAVIGGGDGGALREVLKH-NVERAVLVDIDRNVIDLSRKFLKI 117

Query: 882 VAVGYED 902
               +ED
Sbjct: 118 DHGAFED 124



 Score = 66.6 bits (161), Expect(2) = 1e-28
 Identities = 47/158 (29%), Positives = 77/158 (48%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            RV + I DG  FL++     +D +IVDS+DP+G +  LF++ FF+    A +   V+  Q
Sbjct: 126  RVEIAIMDGKEFLRDCE--IFDVIIVDSTDPVGVSDTLFDREFFEL---ARQKCDVISLQ 180

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPIN 1266
            ++S  +       ++ N     +  V    + VPTYP  +  F++    G   DF +   
Sbjct: 181  SQSPLIQKEYFRTLLVNSAPFERRDVYL--SCVPTYPLALWSFII----GGEYDFSNL-- 232

Query: 1267 PIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIES 1380
               E    + K     YN ++H AAF LP + KK +E+
Sbjct: 233  ---EERFERIKGKTVHYNPDVHRAAFALPEWLKKEVEA 267



>sp|Q7U3L0|SPEE_SYNPX Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>gb:BX569695_777323
            Synechococcus sp. WH8102 complete genome; segment 7/7.
          Length = 280

 Score = 84.7 bits (208), Expect(2) = 4e-28
 Identities = 44/111 (39%), Positives = 64/111 (57%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R  L +GDG+A+  N  + +YD V+VD SDP GPA+ LF + FF+   R L+PGGV  TQ
Sbjct: 129  RCQLTVGDGIAWAANAPDQSYDVVLVDGSDPAGPAEGLFNRAFFEHCRRILKPGGVFATQ 188

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGP 1239
            +ES      +   +V   R++F G  +  +  VP YPSG   +   + +GP
Sbjct: 189  SESPEAFREVHVAMVRLLREVF-GHADPLYGWVPMYPSGWWSWTFAAVDGP 238



 Score = 64.7 bits (156), Expect(2) = 4e-28
 Identities = 35/101 (34%), Positives = 54/101 (53%)
 Frame = +3

Query: 582 LLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLV 761
           +L +  S +Q + V +S  YGK L+LDG     E+ E  Y E + H  LCS    ++VLV
Sbjct: 20  VLVEETSPFQRISVIRSERYGKGLLLDGCWMTAEQQERHYHEALVHPALCSAEAIERVLV 79

Query: 762 IXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDV 884
           I        RE  R+  V  +D+ EID  VV+++++  P +
Sbjct: 80  IGGGDGGTARECLRYPEVIHLDLVEIDGRVVELSQEHLPGI 120



>gb:AE017302_436112 Thermus thermophilus HB27 section 2 of 7 of the
           complete genome.>gb:AP008226_578281 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1078090
           Thermus thermophilus HB27 complete genome.
          Length = 314

 Score = 91.7 bits (226), Expect(2) = 1e-27
 Identities = 45/120 (37%), Positives = 73/120 (60%)
 Frame = +3

Query: 549 PGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPL 728
           P E    ++E+++  GK+ +QD  +F+S  +GKVL+LD  +Q TERDE  Y E + H  +
Sbjct: 13  PYETLVRRMERVIASGKTPFQDYFLFESKGFGKVLILDKDVQSTERDEYIYHETLVHPAM 72

Query: 729 CSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
            + P PK+VL++       LREV +H +V++  + +ID  +V+VAK+  P+   G  D P
Sbjct: 73  LTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEWHQGAFDDP 132



 Score = 56.2 bits (134), Expect(2) = 1e-27
 Identities = 39/109 (35%), Positives = 56/109 (51%), Gaps = 3/109 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIG---PAQELFEKPFFQTVARALRPGGV 1074
            PR  L I D  A+L+   E  YD VI+D +DP+G   PA+ L+   F++ V   L PGGV
Sbjct: 132  PRAVLVIDDARAYLERTEE-RYDVVIIDLTDPVGEDNPARLLYTVEFYRLVKAHLNPGGV 190

Query: 1075 VCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFML 1221
            +  QA  I L  H +  +V         +V  A+  V +Y + + GF L
Sbjct: 191  MGMQAGMILLTHHRVHPVVHR-------TVREAFRYVRSYKNHIPGFFL 232



>sp|O57950|SPEE_PYRHO Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>pir|A71244|A71244 probable spermidine synthase
           - Pyrococcus horikoshii>gb:BA000001_648842 Pyrococcus
           horikoshii OT3 DNA, complete genome.
          Length = 280

 Score = 81.3 bits (199), Expect(2) = 1e-27
 Identities = 33/107 (30%), Positives = 68/107 (63%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           G   + KV++ + + +S+YQ + V+++  +GK+L +DG +Q+    E +Y E + H  + 
Sbjct: 13  GYGVAFKVKRKILEEQSEYQKIEVYETEGFGKLLAIDGTVQLVTEGEKSYHEPLVHPAML 72

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           + PNP++VL+I       +REV +H  V+++ + EIDK V++++ ++
Sbjct: 73  AHPNPRRVLIIGGGDGGAIREVLKHEEVEEVIMVEIDKKVIEISAKY 119



 Score = 66.6 bits (161), Expect(2) = 1e-27
 Identities = 45/153 (29%), Positives = 75/153 (49%)
 Frame = +1

Query: 916  LHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQAES 1095
            L IGDGV F++      +D +IVDS+DP+GPA+ LF + F++   RAL   G+  TQA S
Sbjct: 140  LIIGDGVKFIEE--NSGFDVIIVDSTDPVGPAEMLFSEEFYKNAYRALNDPGIYVTQAGS 197

Query: 1096 IWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPINPID 1275
            ++L            R++F     Y++         VIG+   S     V  K  I+ + 
Sbjct: 198  VYLFTDEFLTAYRKMRKVFDKVYYYSFP--------VIGY--ASPWAFLVGVKGSIDFMK 247

Query: 1276 EANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
               +   K  L++Y+ + H   F +P +  +++
Sbjct: 248  VDAEKGKKLGLEYYDPDKHETLFQMPRYIVQML 280



>sp|Q82XD4|SPEE_NITEU Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>gb:BX321857_772675
            Nitrosomonas europaea ATCC 19718, complete genome;
            segment 2/10.
          Length = 325

 Score = 75.9 bits (185), Expect(2) = 4e-27
 Identities = 50/161 (31%), Positives = 78/161 (48%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PR+ LH+GDG AF  N  +  +D +++D +DP GPA  L+ + F++   RAL+PGGV+  
Sbjct: 143  PRLELHLGDGRAFTGN-CKNQFDQIVLDLTDPFGPAISLYTRDFYRACRRALKPGGVLSL 201

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
              +S      I+  ++A+ R +F G V      VP Y  G +  M  +++  A       
Sbjct: 202  HIQSPIYRSPIMARLLASLRDVF-GVVRPYLQYVPLY--GTLWAMAMASDS-ADPLSLSA 257

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKA 1386
              ID          LK Y+   H A   LP F + ++   A
Sbjct: 258  TEIDARLTQNGLIDLKLYSGGTHHALLNLPPFVQTLLSEPA 298



 Score = 70.1 bits (170), Expect(2) = 4e-27
 Identities = 34/125 (27%), Positives = 69/125 (55%), Gaps = 1/125 (0%)
 Frame = +3

Query: 534 ISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMI 713
           + P+ P     L+  +LL +  S  Q + + Q+  +G+ + +DG    +E+DE  Y E +
Sbjct: 19  VEPLSPDFGFYLRTTELLAERHSPVQHIEIVQTPLFGRAMRIDGCFMTSEQDEFFYHEPM 78

Query: 714 THLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG 893
            HLP  +  +P++ LV+          + R+ +++++ + E+D+ V+D+A+ + P V  G
Sbjct: 79  VHLPAITHGDPRQALVVGGGDGGTAYNLLRYPNMERVVLAELDRDVIDMARTWLPKVHRG 138

Query: 894 -YEDP 905
            +EDP
Sbjct: 139 AFEDP 143



>sp|Q7UZI0|SPEE_PROMP Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:BX572094_797311
           Prochlorococcus marinus MED4 complete genome; segment
           5/5.
          Length = 283

 Score = 76.3 bits (186), Expect(2) = 2e-25
 Identities = 37/105 (35%), Positives = 59/105 (56%)
 Frame = +3

Query: 579 KLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVL 758
           K+L K  S YQ++++ ++  YGK L+LDG    + RDE  Y E + H  L SI     +L
Sbjct: 22  KVLLKKNSKYQEILIIETDFYGKALMLDGCWMTSVRDEKYYHECLVHPALSSIDKKSHIL 81

Query: 759 VIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVG 893
           +I        RE  +++ V +ID+ EID+ V+ V+K F  ++  G
Sbjct: 82  IIGGGDGGTARECLKYSQVSKIDLVEIDEEVIKVSKTFLKEIGGG 126



 Score = 64.3 bits (155), Expect(2) = 2e-25
 Identities = 36/109 (33%), Positives = 60/109 (55%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R+ +HI DGV +++   + +YD + +D SDP   +  LF   F++   R L   G++ TQ
Sbjct: 132  RLAIHIDDGVKWVETTKDNSYDVIFIDCSDPSEFSNLLFTDSFYKECKRILTKKGILATQ 191

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTE 1233
            +ES     +I  +I+ +  +IFK S    ++ VP YPSG+  +   S E
Sbjct: 192  SESPESFENIHIHILKSLNKIFKLS-ETMYSFVPIYPSGIWSWTFASDE 239



>sp|Q7V9I5|SPEE_PROMA Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>gb:AE017166_396303
            Prochlorococcus marinus subsp. marinus str. CCMP1375
            section 6 of 6 of the complete
            genome.>gb:AE017126_1031972 Prochlorococcus marinus
            subsp. marinus str. CCMP1375 complete genome.
          Length = 287

 Score = 73.9 bits (180), Expect(2) = 2e-25
 Identities = 40/111 (36%), Positives = 63/111 (56%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQ 1086
            R+ L + +G+ ++K+  + +YD +I+D SDP GPA+ LF K FF+   R L+P GV+  Q
Sbjct: 136  RLNLKLTNGINWVKDAKDNSYDVIIIDGSDPKGPAKGLFNKDFFKDCHRILKPDGVLGAQ 195

Query: 1087 AESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGP 1239
             ES      I  N V   +++FK   +  +  VP YPSG+  +   S + P
Sbjct: 196  TESPESFEDIHINTVKMIKEVFK-YADPLYGYVPIYPSGIWSWTFASIKKP 245



 Score = 66.2 bits (160), Expect(2) = 2e-25
 Identities = 35/104 (33%), Positives = 58/104 (55%)
 Frame = +3

Query: 561 HSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIP 740
           + LK +K++ +  S++Q + +F+S+ YGK L+LD      E  E  Y E I H  LC   
Sbjct: 21  YGLKGKKII-EEISNFQKITIFESNRYGKALLLDNCWMTAEYQEKQYHECIVHPALCGSK 79

Query: 741 NPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
              KVL+I        RE  ++  +  +D+ EIDK VV++++Q+
Sbjct: 80  EINKVLIIGGGDGGSARECLKYQELKNLDLIEIDKRVVELSQQY 123



>sp|Q8U4G1|SPEE_PYRFU Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>gb:AE010139_259694 Pyrococcus furiosus DSM
           3638, section 14 of 173 of the complete
           genome.>gb:AE009950_900475 Pyrococcus furiosus DSM 3638,
           complete genome.
          Length = 281

 Score = 72.4 bits (176), Expect(2) = 4e-25
 Identities = 36/105 (34%), Positives = 64/105 (60%)
 Frame = +3

Query: 552 GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLC 731
           G   + K++K +++  S YQ + V+++  +G++L LDG +Q+    E +Y E + H  + 
Sbjct: 12  GYGVAFKIKKKIYEKLSKYQKIEVYETEGFGRLLALDGTVQLVTLGERSYHEPLVHPAML 71

Query: 732 SIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
           + P PK+VLVI       +REV +H  VD++ + EID+ V+ V+K
Sbjct: 72  AHPKPKRVLVIGGGDGGTVREVLQH-DVDEVIMVEIDEDVIMVSK 115



 Score = 67.0 bits (162), Expect(2) = 4e-25
 Identities = 45/164 (27%), Positives = 80/164 (48%)
 Frame = +1

Query: 886  LLGMRIPRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRP 1065
            +L  +  +  L IGDG  F+KN     +D +I DS+DP+GPA+ LF + F++ V  AL  
Sbjct: 128  MLNGKHEKAKLTIGDGFEFIKN--NRGFDVIIADSTDPVGPAKVLFSEEFYRYVYDALNN 185

Query: 1066 GGVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAV 1245
             G+  TQA S++L    + +     +++F     Y++         VIG+   S     V
Sbjct: 186  PGIYVTQAGSVYLFTDELISAYKEMKKVFDRVYYYSFP--------VIGY--ASPWAFLV 235

Query: 1246 DFKHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIE 1377
              K  I+      +   K  L++Y+  +H   F +P + ++ ++
Sbjct: 236  GVKGDIDFTKIDRERAKKLQLEYYDPLMHETLFQMPKYIRETLQ 279



>gb:AB076744_1523518 Arabis gemmifera ACL5 gene for spermine
           synthase, complete cds.
          Length = 339

 Score = 86.7 bits (213), Expect(2) = 2e-24
 Identities = 38/103 (36%), Positives = 63/103 (61%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S  +  +L +G S+YQD+ +  +  +GKVLV+DG +Q  ERDE  Y E + H  L   PN
Sbjct: 47  SFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPN 106

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           PK V ++        RE+ +H +++++ +C+ID+ VVD  ++F
Sbjct: 107 PKTVFIMGGGEGSAAREILKHTTIEKVVMCDIDQEVVDFCRRF 149



 Score = 50.1 bits (118), Expect(2) = 2e-24
 Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 5/166 (3%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L P G+ 
Sbjct: 161  KLELVIKDAKAELEK-REEKFDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIF 219

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
             TQA    I+ H  +  +I    +Q+FK    Y    VP++ +   G+++ S      +F
Sbjct: 220  VTQAGPAGIFTHKEVFTSIYNTMKQVFKYVKAYT-AHVPSF-ADTWGWVMASDH----EF 273

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
               ++ +D   + + K  L + N+    +A  L       +E + E
Sbjct: 274  DVEVDEMDRRIEERVKGELMYLNAPSFVSAATLNKTISLALEKETE 319



>sp|Q9YE02|SPEE_AERPE Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>pir|A72668|A72668 probable spermidine synthase
           APE0767 - Aeropyrum pernix  (strain
           K1)>gb:BA000002_651489 Aeropyrum pernix K1 DNA, complete
           genome.
          Length = 306

 Score = 83.2 bits (204), Expect(2) = 3e-24
 Identities = 47/129 (36%), Positives = 74/129 (57%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           WF E   + P  A    +E ++F+G+S +Q++ V + S  GKVLVLDG  Q +E DE  Y
Sbjct: 7   WFLEW--LTPDRATLKHIEDVIFQGRSRFQEIAVVRVSGEGKVLVLDGKTQSSESDEFMY 64

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPD 881
            E + H  +    +P+KVL++       LREV +H SV++  + +ID+ VV+VA++   +
Sbjct: 65  HEALVHPAMILHGSPRKVLILGGGEGATLREVLKHRSVEKAVMVDIDETVVNVAREHLRE 124

Query: 882 VAVGYEDPP 908
              G  D P
Sbjct: 125 WHRGAFDDP 133



 Score = 53.1 bits (126), Expect(2) = 3e-24
 Identities = 38/113 (33%), Positives = 61/113 (53%), Gaps = 3/113 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVARALRPGGVV 1077
            PR  + I D   ++ + AE  +D VI D  DP+  GPA  L+ + +++ V   + PGGV 
Sbjct: 133  PRAEVVIDDAWNYVASKAETGFDVVIADLVDPLEAGPATRLYSEEYYRMVKDVMNPGGVF 192

Query: 1078 CTQAESIWLHMHIIENIVAN-CRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTE 1233
             TQA SI  H+     I+ N   ++FK   +Y    VP++ S + GF++ S +
Sbjct: 193  VTQAVSI-SHLTEYHAIIRNTVARVFKHVESYG-VYVPSFDS-MWGFVVASDD 242



>gb:AB076737_1523511 Arabidopsis thaliana ACL5 gene for spermine
           synthase, complete cds, strain:Bl-1.
          Length = 339

 Score = 86.7 bits (213), Expect(2) = 4e-24
 Identities = 38/103 (36%), Positives = 63/103 (61%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S  +  +L +G S+YQD+ +  +  +GKVLV+DG +Q  ERDE  Y E + H  L   PN
Sbjct: 47  SFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPN 106

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           PK V ++        RE+ +H +++++ +C+ID+ VVD  ++F
Sbjct: 107 PKTVFIMGGGEGSAAREILKHTTIEKVVMCDIDQEVVDFCRRF 149



 Score = 49.3 bits (116), Expect(2) = 4e-24
 Identities = 41/166 (24%), Positives = 78/166 (46%), Gaps = 5/166 (3%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L P G+ 
Sbjct: 161  KLELVIKDAKAELEK-REEKFDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIF 219

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
             TQA    I+ H  +  +I +  +Q+FK    Y    VP++ +   G+++ S      +F
Sbjct: 220  VTQAGPAGIFTHKEVFTSIYSTMKQVFKYVKAYT-AHVPSF-ADTWGWVMASDH----EF 273

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
               ++ +D   + +    L + N+    +A  L       +E + E
Sbjct: 274  DVEVDEMDRRIEERVNGELMYLNAPSFVSAATLNKTISLALEKETE 319



>gb:AB076739_1523513 Arabidopsis thaliana ACL5 gene for spermine
           synthase, complete cds,
           strain:Ost-0.>gb:AB076740_1523514 Arabidopsis thaliana
           ACL5 gene for spermine synthase, complete cds,
           strain:Bus-1.>gb:AB076741_1523515 Arabidopsis thaliana
           ACL5 gene for spermine synthase, complete cds,
           strain:Kas-1.>gb:AB076742_1523516 Arabidopsis thaliana
           ACL5 gene for spermine synthase, complete cds,
           strain:Ci-0.>gb:AB076743_1523517 Arabidopsis thaliana
           ACL5 gene for spermine synthase, complete cds,
           strain:Cvi-0.
          Length = 339

 Score = 86.7 bits (213), Expect(2) = 8e-24
 Identities = 38/103 (36%), Positives = 63/103 (61%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S  +  +L +G S+YQD+ +  +  +GKVLV+DG +Q  ERDE  Y E + H  L   PN
Sbjct: 47  SFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPN 106

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           PK V ++        RE+ +H +++++ +C+ID+ VVD  ++F
Sbjct: 107 PKTVFIMGGGEGSAAREILKHTTIEKVVMCDIDQEVVDFCRRF 149



 Score = 48.1 bits (113), Expect(2) = 8e-24
 Identities = 41/166 (24%), Positives = 77/166 (46%), Gaps = 5/166 (3%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L P G+ 
Sbjct: 161  KLELVIKDAKAELEK-REEKFDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIF 219

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
             TQA    I+ H  +  +I    +Q+FK    Y    VP++ +   G+++ S      +F
Sbjct: 220  VTQAGPAGIFTHKEVFTSIYNTMKQVFKYVKAYT-AHVPSF-ADTWGWVMASDH----EF 273

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
               ++ +D   + +    L + N+    +A  L       +E + E
Sbjct: 274  DVEVDEMDRRIEERVNGELMYLNAPSFVSAATLNKTISLALEKETE 319



>gb:AB076723_1523497 Arabidopsis thaliana ACL5 gene for spermine
           synthase, complete cds, strain:Ag-0.>gb:AB076724_1523498
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Nok-4.>gb:AB076725_1523499
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Shokei.>gb:AB076726_1523500
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Ws-0.>gb:AB076727_1523501
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Su-0.>gb:AB076728_1523502
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Ts-1.>gb:AB076729_1523503
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Dra-0.>gb:AB076730_1523504
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Rou-0.>gb:AB076731_1523505
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Mr-0.>gb:AB076732_1523506
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Hau-0.>gb:AB076733_1523507
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Ita-0.>gb:AB076734_1523508
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:In-0.>gb:AB076736_1523510
           Arabidopsis thaliana ACL5 gene for spermine synthase,
           complete cds, strain:Edi-0 a.>gb:AY087927_1572952
           Arabidopsis thaliana clone 3968 mRNA, complete
           sequence.>gb:AY127003_1580460 Arabidopsis thaliana
           AT5g19530/T20D1_50 mRNA, complete
           cds.>gb:BT002254_1635857 Arabidopsis thaliana
           At5g19530/T20D1_50 mRNA, complete
           cds.>gb:AF184093_1775013 Arabidopsis thaliana spermine
           synthase (ACL5) gene, complete cds.>gb:AF184094_1775014
           Arabidopsis thaliana spermine synthase (ACL5) mRNA,
           complete cds.
          Length = 339

 Score = 86.7 bits (213), Expect(2) = 8e-24
 Identities = 38/103 (36%), Positives = 63/103 (61%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S  +  +L +G S+YQD+ +  +  +GKVLV+DG +Q  ERDE  Y E + H  L   PN
Sbjct: 47  SFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPN 106

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           PK V ++        RE+ +H +++++ +C+ID+ VVD  ++F
Sbjct: 107 PKTVFIMGGGEGSAAREILKHTTIEKVVMCDIDQEVVDFCRRF 149



 Score = 48.1 bits (113), Expect(2) = 8e-24
 Identities = 41/166 (24%), Positives = 77/166 (46%), Gaps = 5/166 (3%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L P G+ 
Sbjct: 161  KLELVIKDAKAELEK-REEKFDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIF 219

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
             TQA    I+ H  +  +I    +Q+FK    Y    VP++ +   G+++ S      +F
Sbjct: 220  VTQAGPAGIFTHKEVFTSIYNTMKQVFKYVKAYT-AHVPSF-ADTWGWVMASDH----EF 273

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
               ++ +D   + +    L + N+    +A  L       +E + E
Sbjct: 274  DVEVDEMDRRIEERVNGELMYLNAPSFVSAATLNKTISLALEKETE 319



>sp|Q9UXE4|SPEE_SULSO Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>pir|D90224|D90224 spermidine synthase
           [imported] - Sulfolobus solfataricus>gb:SSU18930_191173
           Sulfolobus solfataricus 281 kb genomic DNA fragment,
           strain P2.>gb:AE006699_221649 Sulfolobus solfataricus P2
           section 58 of 272 of the complete
           genome.>gb:AE006641_1107497 Sulfolobus solfataricus P2,
           complete genome.
          Length = 301

 Score = 77.4 bits (189), Expect(2) = 1e-23
 Identities = 45/134 (33%), Positives = 75/134 (55%), Gaps = 2/134 (1%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           GW   +    P E H   +EK+L + K+ YQ V + + + +GK L++DG +Q T  DE  
Sbjct: 3   GWHWLLEWQTPYEFHGHLIEKVLAEEKTPYQHVTLVEFTRFGKGLIIDGKVQSTLYDEHI 62

Query: 699 YQEMITHLPLCSIPN-PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           Y E++ H  L S+   PK VL++       LREV ++ SV++  + +ID+ V++ AK++ 
Sbjct: 63  YHELLVHPLLLSLTKPPKSVLILGGGEGATLREVLKYKSVEKAVMVDIDEKVIEFAKKYL 122

Query: 876 PDVAVG-YEDPPCN 914
            +   G +ED   N
Sbjct: 123 YEWHQGAFEDKRTN 136



 Score = 56.6 bits (135), Expect(2) = 1e-23
 Identities = 43/155 (27%), Positives = 74/155 (47%), Gaps = 2/155 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVARALRPGGVVC 1080
            R  L I DG+ F+K   E  YDA+I+D +DPI    +  L+ K F++ +   L   G + 
Sbjct: 134  RTNLVITDGLKFIKETKE-KYDAIILDLTDPIKNSTSYMLYTKEFYEKLREILNERGGIV 192

Query: 1081 TQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHP 1260
            TQA S    + +   I    +++FK   + ++T + ++  G+ GF+        +     
Sbjct: 193  TQATSPSFSLEVYVTIYNTIKEVFK-EASASYTYMASF-DGLWGFVYGGVRPDLLSEDEV 250

Query: 1261 INPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAK 1365
             + I+E  D +    L+FY+   H  +F LP   K
Sbjct: 251  DSKINERIDGQ----LRFYDGYSHKISFSLPKNIK 281



>gb:CP000010_866630 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 323

 Score = 76.6 bits (187), Expect(2) = 2e-23
 Identities = 40/120 (33%), Positives = 66/120 (55%)
 Frame = +3

Query: 549 PGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPL 728
           P  A+     + L + +S+YQ++ V+++S  G++  LDG    +  DE  Y E +TH   
Sbjct: 49  PDVAYGFPNARRLARIESEYQEIEVWETSLLGRLFTLDGRPMTSVGDEFVYHECMTHPAA 108

Query: 729 CSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
            + P PKK LV+        R++ RH  +++I + E+D  VVD+A++F  DV  G  D P
Sbjct: 109 LAHPAPKKALVLGGGDGGAARQLLRHPCIERIVVAELDAAVVDMARRFLGDVHQGALDDP 168



 Score = 57.0 bits (136), Expect(2) = 2e-23
 Identities = 46/150 (30%), Positives = 66/150 (44%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV L IGD   ++ +  E  +D  + D + P  PA  L+   F+  + R L P G V  
Sbjct: 168  PRVELAIGDAARYVDHACEH-FDLAVFDLTPPDSPAAGLYTPAFYTRLKRILTPQGAVSL 226

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
               S   H   I  ++A  R+ F   V      VP Y S  +  +   T   A  F H I
Sbjct: 227  HLGSPLYHGARIAALLAGLRERF-AVVAPLCAHVPLYGSPWLMAIASDTLDAASLFSHDI 285

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLP 1353
               D     +    L+FY++++HSA F LP
Sbjct: 286  ---DARLAERHIEGLRFYDAKLHSALFTLP 312



>gb:BX571965_792752 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 285

 Score = 76.6 bits (187), Expect(2) = 2e-23
 Identities = 40/120 (33%), Positives = 66/120 (55%)
 Frame = +3

Query: 549 PGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPL 728
           P  A+     + L + +S+YQ++ V+++S  G++  LDG    +  DE  Y E +TH   
Sbjct: 11  PDVAYGFPNARRLARIESEYQEIEVWETSLLGRLFTLDGRPMTSVGDEFVYHECMTHPAA 70

Query: 729 CSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
            + P PKK LV+        R++ RH  +++I + E+D  VVD+A++F  DV  G  D P
Sbjct: 71  LAHPAPKKALVLGGGDGGAARQLLRHPCIERIVVAELDAAVVDMARRFLGDVHQGALDDP 130



 Score = 57.0 bits (136), Expect(2) = 2e-23
 Identities = 46/150 (30%), Positives = 66/150 (44%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            PRV L IGD   ++ +  E  +D  + D + P  PA  L+   F+  + R L P G V  
Sbjct: 130  PRVELAIGDAARYVDHACEH-FDLAVFDLTPPDSPAAGLYTPAFYTRLKRILTPQGAVSL 188

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPI 1263
               S   H   I  ++A  R+ F   V      VP Y S  +  +   T   A  F H I
Sbjct: 189  HLGSPLYHGARIAALLAGLRERF-AVVAPLCAHVPLYGSPWLMAIASDTLDAASLFSHDI 247

Query: 1264 NPIDEANDAKSKSPLKFYNSEIHSAAFCLP 1353
               D     +    L+FY++++HSA F LP
Sbjct: 248  ---DARLAERHIEGLRFYDAKLHSALFTLP 274



>gb:AB076738_1523512 Arabidopsis thaliana ACL5 gene for spermine
           synthase, complete cds, strain:Edi-0 b.
          Length = 339

 Score = 86.7 bits (213), Expect(2) = 2e-23
 Identities = 38/103 (36%), Positives = 63/103 (61%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S  +  +L +G S+YQD+ +  +  +GKVLV+DG +Q  ERDE  Y E + H  L   PN
Sbjct: 47  SFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPN 106

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           PK V ++        RE+ +H +++++ +C+ID+ VVD  ++F
Sbjct: 107 PKTVFIMGGGEGSAAREILKHTTIEKVVMCDIDQEVVDFCRRF 149



 Score = 46.6 bits (109), Expect(2) = 2e-23
 Identities = 41/166 (24%), Positives = 76/166 (45%), Gaps = 5/166 (3%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L P G+ 
Sbjct: 161  KLELVIKDAKAELEK-REEKFDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIF 219

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
             TQA    I+ H  +  +I    +Q+FK    Y    VP+  +   G+++ S      +F
Sbjct: 220  VTQAGPAGIFTHKEVFTSIYNTMKQVFKYVKAYT-AHVPSL-ADTWGWVMASDH----EF 273

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
               ++ +D   + +    L + N+    +A  L       +E + E
Sbjct: 274  DVEVDEMDRRIEERVNGELMYLNAPSFVSAATLNKTISLALEKETE 319



>gb:CR555306_106599 Azoarcus sp. EbN1 complete genome.
          Length = 441

 Score = 67.0 bits (162), Expect(2) = 3e-23
 Identities = 33/110 (30%), Positives = 61/110 (55%)
 Frame = +3

Query: 579 KLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVL 758
           KL+ KG+S YQ+  V+++  +G++  LDG    +ERDE  Y E +  +P  + P P + L
Sbjct: 176 KLIEKGRSRYQEYEVWETPQFGRLFRLDGCFMTSERDEFHYHENLIQVPCIAHPAPARAL 235

Query: 759 VIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
           ++         E+ +  ++ +I I E+D+ V+++A++    V  G  D P
Sbjct: 236 ILGGGDGGSAEELLKQPAMAKIVIAELDEKVIEIAREHLQAVHRGALDDP 285



 Score = 65.9 bits (159), Expect(2) = 3e-23
 Identities = 46/161 (28%), Positives = 74/161 (45%), Gaps = 4/161 (2%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGT---YDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGV 1074
            PR+ L IGDG  ++   A      +D +++D +DP+GPA+ L+ + FF+     L PGG 
Sbjct: 285  PRIELRIGDGFRYVMEEAPAAAERFDLIVLDLTDPVGPAEALYSEDFFRGCRALLAPGGA 344

Query: 1075 VCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCS-TEGPAVDF 1251
            +     S       +  +VA  R +F   V   +  VP Y + + GF   S T  PA   
Sbjct: 345  ISLHIGSPAFQPERLRTLVARLRDVF-AIVRPYFLYVPLYGT-LWGFATASDTLDPAA-- 400

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
                  +D     +    L+ YN  +H A F LP+  + ++
Sbjct: 401  -LSAAEVDRRLAERRIGALQHYNGAVHCAQFALPNHLRTLL 440



>gb:AB076735_1523509 Arabidopsis thaliana ACL5 gene for spermine
           synthase, complete cds, strain:Pog-0.
          Length = 339

 Score = 84.7 bits (208), Expect(2) = 3e-23
 Identities = 37/103 (35%), Positives = 63/103 (61%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           S  +  +L +G S+YQ++ +  +  +GKVLV+DG +Q  ERDE  Y E + H  L   PN
Sbjct: 47  SFALNSVLHQGTSEYQNIALLDTKRFGKVLVIDGKMQSAERDEFIYHECLIHPALLFHPN 106

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           PK V ++        RE+ +H +++++ +C+ID+ VVD  ++F
Sbjct: 107 PKTVFIMGGGEGSAAREILKHTTIEKVVMCDIDQEVVDFCRRF 149



 Score = 48.1 bits (113), Expect(2) = 3e-23
 Identities = 41/166 (24%), Positives = 77/166 (46%), Gaps = 5/166 (3%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L P G+ 
Sbjct: 161  KLELVIKDAKAELEK-REEKFDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLSPNGIF 219

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
             TQA    I+ H  +  +I    +Q+FK    Y    VP++ +   G+++ S      +F
Sbjct: 220  VTQAGPAGIFTHKEVFTSIYNTMKQVFKYVKAYT-AHVPSF-ADTWGWVMASDH----EF 273

Query: 1252 KHPINPIDEANDAKSKSPLKFYNSEIHSAAFCLPSFAKKVIESKAE 1389
               ++ +D   + +    L + N+    +A  L       +E + E
Sbjct: 274  DVEVDEMDRRIEERVNGELMYLNAPSFVSAATLNKTISLALEKETE 319



>gb:AJ606077_1811954 Lycopersicon esculentum mRNA for putative
           spermine synthase (spe4 gene).
          Length = 349

 Score = 86.3 bits (212), Expect(2) = 4e-22
 Identities = 44/119 (36%), Positives = 65/119 (54%), Gaps = 3/119 (2%)
 Frame = +3

Query: 522 WFSE---ISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDE 692
           WF E   +   W     S  +  +L KG S+YQD+ +  +  +GK+LV+DG +Q  E DE
Sbjct: 46  WFEEEIDVDLKW-----SFALNSVLHKGTSEYQDIALLDTKHFGKILVIDGKMQSAEVDE 100

Query: 693 CAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQ 869
             Y E + H  L   PNPK V ++        RE  RH S++++ +C+IDK VVD  K+
Sbjct: 101 FIYHECLIHPALLCHPNPKNVFIMGGGEGSAAREALRHKSMEKVVMCDIDKEVVDFCKK 159



 Score = 42.7 bits (99), Expect(2) = 4e-22
 Identities = 29/101 (28%), Positives = 52/101 (51%), Gaps = 5/101 (4%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L   G+ 
Sbjct: 172  KLNLVINDAKAELEQRQE-KFDIIVGDLADPVEGGPCYQLYTKSFYQNILKPKLNDTGIF 230

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTY 1194
             TQA    ++ H  +  +I    +Q+FK  + Y    VP++
Sbjct: 231  VTQAGPAGVFTHKEVFSSIYNTTKQVFKYVLAYT-AHVPSF 270



>gb:AY743326_1626432 Sclerotinia sclerotiorum spermidine synthase
           gene, partial cds.
          Length = 80

 Score =  102 bits (254), Expect = 2e-20
 Identities = 52/74 (70%), Positives = 58/74 (78%)
 Frame = +3

Query: 543 MWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHL 722
           MWPG+A SLKVEK+L   KS YQDV+VF+S+ YG VLVLD  IQ TERDE +YQEMI HL
Sbjct: 1   MWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTDYGNVLVLDDCIQCTERDEFSYQEMIAHL 60

Query: 723 PLCSIPNPKKVLVI 764
            L S PNPKK LVI
Sbjct: 61  ALNSHPNPKKALVI 74



>sp|Q9HV34|SPE2_PSEAE Spermidine synthase 2 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 2) (SPDSY
           2).>pir|D83048|D83048 hypothetical protein PA4774
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004891_59007 Pseudomonas aeruginosa PAO1,
           section 452 of 529 of the complete
           genome.>gb:AE004091_973107 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 349

 Score = 74.3 bits (181), Expect(2) = 8e-20
 Identities = 38/132 (28%), Positives = 74/132 (56%), Gaps = 1/132 (0%)
 Frame = +3

Query: 519 GWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           G  + I    P + +  ++ ++L++G++ +Q+V++  +  Y +VL+LDG IQ  E DE  
Sbjct: 30  GAITAIEDSDPFDQYVYRLRRVLYQGRTRWQNVLIADTYNYDRVLMLDGAIQSAESDESL 89

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQ-FF 875
           Y E++    + +   P+ VL+I       LREV  HASV +  + ++D+ +V++ ++  F
Sbjct: 90  YHELLVQPAMLAHDEPRDVLIIGGGEGATLREVLSHASVRRAVMVDLDRELVELCREHLF 149

Query: 876 PDVAVGYEDPPC 911
                 ++DP C
Sbjct: 150 QWHQGAFDDPRC 161



 Score = 47.0 bits (110), Expect(2) = 8e-20
 Identities = 39/114 (34%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVARALRPGGVV 1077
            PR  L   DG A+L+      YD VI+D  D +  GPAQ L+ + F++ +   LRPGGVV
Sbjct: 159  PRCELLAEDGRAYLER-DPSLYDVVIIDVVDMLDNGPAQALYTRQFYELLHSRLRPGGVV 217

Query: 1078 CTQAESIWLHMHIIEN----IVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCS 1227
              Q        H  +     +    R +F    +Y   TVP++ S   GF+L S
Sbjct: 218  AVQGLEF---SHSDDKPHAALARTLRSVFSQVHSYR-ATVPSFLSS-WGFLLAS 266



>gb:AP003991_1836038 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1077_A12.>gb:AP005698_1856255 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0006L10.
          Length = 344

 Score = 80.9 bits (198), Expect(2) = 1e-19
 Identities = 37/100 (37%), Positives = 59/100 (59%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           +  +L +G S YQ++ +  +  +GK L++DG +Q TE DE  Y E + H PL   PNPK 
Sbjct: 56  LNSVLHRGASKYQEIALIDTKHFGKALIIDGKMQSTEVDEFIYHESLIHPPLLFHPNPKT 115

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
           V ++        REV RH +V ++ +C+ID+ VVD  + +
Sbjct: 116 VFIMGGGEGSAAREVLRHNTVHRVVMCDIDQEVVDFCRTY 155



 Score = 40.0 bits (92), Expect(2) = 1e-19
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 5/88 (5%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI--GPAQELFEKPFFQTVAR-ALRPGGVV 1077
            ++ L I D  A L+   E  +D ++ D +DP+  GP  +L+ K F+Q + +  L   GV 
Sbjct: 167  KLCLIINDARAELEKSRE-KFDVIVGDLADPVEGGPCYQLYTKSFYQHIVKPKLNDRGVF 225

Query: 1078 CTQA--ESIWLHMHIIENIVANCRQIFK 1155
             TQA    +  H  +  +I    R +FK
Sbjct: 226  VTQAGPAGVLTHKEVFSSIYNTLRHVFK 253



>sp|Q8ZXM4|SPEE_PYRAE Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>gb:AE009809_255947 Pyrobaculum aerophilum
           strain IM2 section 64 of 201 of the complete
           genome.>gb:AE009441_898573 Pyrobaculum aerophilum strain
           IM2 complete genome.
          Length = 291

 Score = 75.9 bits (185), Expect(2) = 1e-19
 Identities = 40/134 (29%), Positives = 70/134 (52%)
 Frame = +3

Query: 507 SVIPGWFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITER 686
           S +PG    + P+    +  +K+  +    +S YQ +++  +  YG+ LVLD  IQ +  
Sbjct: 2   SKVPGPIVLMEPLSGKTSLIIKINAIHVSKRSKYQGILIVDTDDYGRTLVLDDYIQSSYY 61

Query: 687 DECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
           DE  Y E + H  + + P P  VL++       LREV +H +V +  + +ID  VV+++K
Sbjct: 62  DEIYYHESLVHPAVTTHPRPSDVLILGGGEGATLREVLKHNTVKRAVMVDIDGDVVELSK 121

Query: 867 QFFPDVAVGYEDPP 908
           ++ P +  G  D P
Sbjct: 122 KYLPQMHQGAFDDP 135



 Score = 44.7 bits (104), Expect(2) = 1e-19
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 8/162 (4%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEG--TYDAVIVDSSDPIGP--AQELFEKPFFQTVARALRPGG 1071
            PR  + I DG  +++N  +    +D VI+D +DP     A++L+   FF  V R LR  G
Sbjct: 135  PRSEVRIEDGFVYVENALKRGEKFDVVIMDLTDPYSSDIAKQLYTPEFFGKVKRLLREDG 194

Query: 1072 VVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDF 1251
            +V TQA + +      + ++   +  F     Y+   +P++    + F+L S        
Sbjct: 195  IVVTQAGNSFYFPEAYDYVLQGVKGNFPIIAEYS-VWIPSF-GYAVNFVLGS-------L 245

Query: 1252 KHPINPIDEANDAKSKSP----LKFYNSEIHSAAFCLPSFAK 1365
            KH  + +      K  S      +FY+ + H A   +P   K
Sbjct: 246  KHDPHSLSAEEVDKRLSERGVRAEFYSGKTHIALMNMPVIKK 287



>gb:AB004325_1509074 Nicotiana sylvestris NsPMT2 mRNA for putrescine
            N-methyltransferase, partial cds.
          Length = 62

 Score = 91.7 bits (226), Expect = 4e-17
 Identities = 46/62 (74%), Positives = 52/62 (83%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1201 GVIGFMLCSTEGPAVDFKHPINPID-EANDAKSK-SPLKFYNSEIHSAAFCLPSFAKKVI 1374
            GVIG+MLCSTEGP VDFK+PINPID E    KSK +PLKFYNS+IH AAF LPSFA+ +I
Sbjct: 1    GVIGYMLCSTEGPEVDFKNPINPIDKETTQVKSKLAPLKFYNSDIHKAAFILPSFARSMI 60

Query: 1375 ES 1380
            ES
Sbjct: 61   ES 62



>sp|Q8R977|SPE2_THETN Spermidine synthase 2 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 2) (SPDSY
           2).>gb:AE013128_289367 Thermoanaerobacter tengcongensis
           MB4, section 155 of 244 of the complete
           genome.>gb:AE008691_1111432 Thermoanaerobacter
           tengcongensis strain MB4, complete genome.
          Length = 297

 Score = 66.6 bits (161), Expect(2) = 4e-13
 Identities = 34/100 (34%), Positives = 60/100 (60%)
 Frame = +3

Query: 570 KVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPK 749
           KV+ ++ + +S YQ + + +  T+GK L LDG +Q TE DE  Y E++ H  +   P+PK
Sbjct: 40  KVKSVIIEHQSLYQKIDIVELETWGKSLFLDGSLQSTESDEFIYHELLVHPAMRVHPSPK 99

Query: 750 KVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQ 869
           +VL+        +REV ++ +V ++   +IDK VV + ++
Sbjct: 100 RVLICGVGEGKSVREVLKYPTVKEVIGVDIDKEVVALCQK 139



 Score = 32.0 bits (71), Expect(2) = 4e-13
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPI-GPAQELFEKPFFQTVARALRPGGVVCT 1083
            RV L   D   F+KN     +D  IVD +D + GPA+ + +  F++ +   L     V  
Sbjct: 150  RVRLVYQDVAEFIKNYRGEPFDVAIVDVTDDLDGPARSVHQLDFYKRLYEILGEKATVVV 209

Query: 1084 QAES 1095
            Q  S
Sbjct: 210  QGTS 213



>gb:AB096270_1525480 Cryptomeria japonica Acl5 gene for putative
           spermine synthase, partial cds,
           isolate:Kita-shitara2.>gb:AB096271_1525481 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds,
           isolate:Minami-shitara2.>gb:AB096272_1525482 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds,
           isolate:Minami-shitara6.>gb:AB096273_1525483 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Amagi1.>gb:AB096274_1525484
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Amagi3.>gb:AB096275_1525485 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Amagi6.>gb:AB096276_1525486 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Amagi7.>gb:AB096277_1525487 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Higashi-kamo2.>gb:AB096278_1525488 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Higashi-kamo3.>gb:AB096279_1525489
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Higashi-kamo6.>gb:AB096280_1525490 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Higashi-kamo7.>gb:AB096281_1525491
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Kanra1.>gb:AB096282_1525492 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Keta4.>gb:AB096283_1525493 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Tenryu10.>gb:AB096284_1525494 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Nishikawa7.>gb:AB096285_1525495
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Senzu2.>gb:AB096286_1525496 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Kita-kabahara1.>gb:AB096287_1525497 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Kita-kabahara2.>gb:AB096288_1525498
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Higashi-kabahara1.>gb:AB096289_1525499
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Higashi-kubiki2.>gb:AB096290_1525500 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Nagaoka-shi2.>gb:AB096291_1525501
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Kashiwazaki-shi2.>gb:AB096292_1525502
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Naoetsu1.>gb:AB096293_1525503 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Iwafune5.>gb:AB096294_1525504
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Ohara7.>gb:AB096295_1525505 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Ohara15.>gb:AB096296_1525506 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Ohara504.>gb:AB096297_1525507
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Johana1.>gb:AB096298_1525508 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Isurugi2.>gb:AB096299_1525509
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Ohyama1.>gb:AB096300_1525510 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Hayatsuki17.>gb:AB096301_1525511
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Kamiichi3.>gb:AB096302_1525512 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Kami-hei2.>gb:AB096303_1525513
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Kami-hei4.>gb:AB096304_1525514 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Kami-hei5.>gb:AB096305_1525515
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Kami-hei8.>gb:AB096306_1525516 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Kami-hei11.>gb:AB096307_1525517
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Shimo-hei1.>gb:AB096308_1525518 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Kesen5.>gb:AB096309_1525519
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Kesen6.>gb:AB096310_1525520 Cryptomeria japonica
           Acl5 gene for putative spermine synthase, partial cds,
           isolate:Ninohe1.>gb:AB096311_1525521 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Iwateken1.>gb:AB096312_1525522
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Iwateken9.>gb:AB096313_1525523 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Iwateken10.>gb:AB096314_1525524
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Iwateken12.>gb:AB096315_1525525 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Higashi-iwai1.>gb:AB096316_1525526
           Cryptomeria japonica Acl5 gene for putative spermine
           synthase, partial cds,
           isolate:Higashi-iwai2.>gb:AB096317_1525527 Cryptomeria
           japonica Acl5 gene for putative spermine synthase,
           partial cds, isolate:Nishi-iwai1.
          Length = 380

 Score = 77.0 bits (188), Expect = 1e-12
 Identities = 36/100 (36%), Positives = 56/100 (56%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           + ++L  G S+YQD+ +  +  +GK LV+DG +Q TE DE  Y E + H  L     PK 
Sbjct: 92  LNRILHTGVSEYQDIALIDTRPFGKALVIDGKMQSTEVDEFIYHESLVHPALVYHSQPKS 151

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             ++        RE+ RH  V ++ +C+IDK VVD  K++
Sbjct: 152 AFIMGGGEGSTAREILRHKCVKKVVMCDIDKEVVDFCKKY 191



>gb:AB096606_1525816 Taxodium distichum Acl5 gene for putative
           spermine synthase, partial cds, isolate:St. Mark01.
          Length = 378

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 35/100 (35%), Positives = 57/100 (57%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           + +++  G S+YQD+ +  +  +GK LV+DG +Q TE DE  Y E + H  L    +PK 
Sbjct: 90  LNRIIHTGVSEYQDIALIDTRPFGKALVIDGKMQSTEVDEFIYHESLVHPALVYHSHPKS 149

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             ++        RE+ RH  V ++ +C+IDK VVD  K++
Sbjct: 150 AFIMGGGEGSTAREILRHKCVKKVVMCDIDKEVVDFCKKY 189



>gb:AY550925_1431356 Sus scrofa spermidine synthase mRNA, partial cds.
          Length = 89

 Score = 75.1 bits (183), Expect = 4e-12
 Identities = 36/89 (40%), Positives = 59/89 (66%)
 Frame = +1

Query: 1108 MHIIENIVANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPAVDFKHPINPIDEAND 1287
            + +I+ +   C+ +F   V+YA+ T+PTYPSG IGFMLCS + P+ +F+ P+  + +   
Sbjct: 1    LDLIKEMRQFCKSLFP-VVDYAYCTIPTYPSGQIGFMLCS-KNPSTNFREPVQLLTQKQ- 57

Query: 1288 AKSKSPLKFYNSEIHSAAFCLPSFAKKVI 1374
               +  L++YNS++H AAF LP FA+K +
Sbjct: 58   -VEQRQLRYYNSDVHRAAFVLPEFARKAL 85



>sp|Q7TY95|SPEE_MYCBO Probable spermidine synthase (EC 2.5.1.16)
            (Putrescine aminopropyltransferase)
            (SPDSY).>sp|O33279|SPEE_MYCTU Probable spermidine
            synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>pir|H70886|H70886
            probable spermidine synthase - Mycobacterium tuberculosis
             (strain H37RV)>gb:AE000516_22762 Mycobacterium
            tuberculosis CDC1551, complete genome.>gb:BX248343_759989
            Mycobacterium bovis subsp. bovis AF2122/97 complete
            genome; segment 10/14.>gb:BX842580_820689 Mycobacterium
            tuberculosis H37Rv complete genome; segment 9/13.
          Length = 523

 Score = 47.4 bits (111), Expect(2) = 2e-11
 Identities = 41/113 (36%), Positives = 55/113 (48%), Gaps = 7/113 (6%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVA--EGTYDAVIVDSSDPIGPAQ-ELFEKPFFQTVARALRPGGV 1074
            PRV + I D +++L+  A     +DAVIVD  DP  P    L+   F+   ARAL PGG+
Sbjct: 357  PRVHVVIDDAMSWLRGAAVPPAGFDAVIVDLRDPDTPVLGRLYSTEFYALAARALAPGGL 416

Query: 1075 VCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTT----VPTYPSGVIGFML 1221
            +  QA S +        I++  R     S  YA T     VPT+  G  GF L
Sbjct: 417  MVVQAGSPYSTPTAFWRIISTIR-----SAGYAVTPYHVHVPTF--GDWGFAL 462



 Score = 45.8 bits (107), Expect(2) = 2e-11
 Identities = 33/103 (32%), Positives = 51/103 (49%)
 Frame = +3

Query: 600 SDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXX 779
           S YQ+++V +     + L LDG +Q   RDE  Y E + + P  S    + VLV+     
Sbjct: 258 SAYQEIVVTRRGDDLR-LYLDGGLQFCTRDEYRYTESLVY-PAVS-DGARSVLVLGGGDG 314

Query: 780 XVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
              RE+ R   ++QI   E+D  V+++A+    DV  G  D P
Sbjct: 315 LAARELLRQPGIEQIVQVELDPAVIELARTTLRDVNAGSLDNP 357



>gb:AF055854_474048 Synechococcus PCC7002 clone SK1.4E15 spermidine
           synthase (speE) gene, partial cds.
          Length = 125

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 39/117 (33%), Positives = 63/117 (53%)
 Frame = +3

Query: 522 WFSEISPMWPGEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAY 701
           W +E    W   +H   + K+L   ++ +Q++ + +S  YGK LVLDG  Q    DE  Y
Sbjct: 11  WINEYITPWDIYSHG--ITKILAYKQTQFQEMAIVESGAYGKALVLDGKWQSCTGDEFLY 68

Query: 702 QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
            E + H  + +   PKKVL++       +REV R  SV+++ + +ID  VV+  K+F
Sbjct: 69  HEPLVHPAMIAHGAPKKVLILGAGEGATVREVLRWQSVEKVMMVDIDGEVVEACKEF 125



>gb:BA000036_720429 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927156_834234 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 9/10.>gb:AX064065_1458946 Sequence 347
           from Patent WO0100843.
          Length = 513

 Score = 44.7 bits (104), Expect(2) = 4e-10
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +3

Query: 576 EKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKV 755
           + +++  +SDYQD++V +     + L L+G +Q + RD+  Y E + +  L   P  + V
Sbjct: 238 DPVIYSHQSDYQDIVVTERGK-DRRLYLNGGLQYSTRDQHRYTESLVYPSL--NPEAESV 294

Query: 756 LVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF-PDVAVGYEDP 905
           L+I        RE+ R  S+ QI   E+D  V++VA      D     EDP
Sbjct: 295 LIIGGGDGLAARELLRFPSM-QITQVELDPEVIEVANTVLRSDNGGAMEDP 344



 Score = 43.9 bits (102), Expect(2) = 4e-10
 Identities = 37/139 (26%), Positives = 59/139 (42%), Gaps = 8/139 (5%)
 Frame = +1

Query: 895  MRIPRVTLHIGDGVAFLKNVAEG--TYDAVIVDSSDPIGPAQELFEKPFFQTVARA-LRP 1065
            M  PRV++ + D   +L++      TYD++I+D  DP            F T+ARA L  
Sbjct: 341  MEDPRVSIIVDDAFTWLRSGGNNGETYDSIIIDLPDPNNDTMARLYSEEFYTLARARLNE 400

Query: 1066 GGVVCTQAESIWLHMHIIENI-----VANCRQIFKGSVNYAWTTVPTYPSGVIGFMLCST 1230
             G +  Q+ S +    +   +      A C Q+    V+     VPT+  G  GF LC  
Sbjct: 401  QGRMVVQSSSAYTTPDVFWRVGATLKSAGCEQVIPYHVH-----VPTF--GDWGFQLCGP 453

Query: 1231 EGPAVDFKHPINPIDEAND 1287
                ++ +    P+   ND
Sbjct: 454  ADMELELREDTPPLTFLND 472



>gb:AE017230_411736 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 4 of 16 of the complete
            genome.>gb:AE016958_1055140 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 523

 Score = 47.8 bits (112), Expect(2) = 6e-10
 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPA-QELFEKPFFQTVARALRPGGVVC 1080
            PRV +  GD +A+L+      +DAVIVD  DP  P    L+   F+   A AL PGG++ 
Sbjct: 359  PRVRVLTGDAMAWLRGPNPDRFDAVIVDLPDPDTPVLGRLYSTEFYALAAHALAPGGLLV 418

Query: 1081 TQAES 1095
             QA S
Sbjct: 419  VQAGS 423



 Score = 40.0 bits (92), Expect(2) = 6e-10
 Identities = 28/101 (27%), Positives = 48/101 (47%)
 Frame = +3

Query: 606 YQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXV 785
           YQ+++V +     + L LDG +Q + RDE  Y E + +  L +    + VLV+       
Sbjct: 262 YQEIVVTRRGDDTR-LYLDGGLQFSTRDEYRYTESLVYPALGN--GARSVLVLGGGDGLA 318

Query: 786 LREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPP 908
            RE+ R   + +I   E+D  V+++A+        G  D P
Sbjct: 319 ARELLRQPGISRIVQVELDPAVIEIARSTLRAANGGSLDNP 359



>sp|Q815E8|SPE2_BACCR Spermidine synthase 2 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 2) (SPDSY
           2).>gb:AE017014_380033 Bacillus cereus ATCC 14579
           section 17 of 18 of the complete
           genome.>gb:AE016877_1020283 Bacillus cereus ATCC 14579
           complete genome.
          Length = 366

 Score = 56.2 bits (134), Expect(2) = 9e-10
 Identities = 35/126 (27%), Positives = 66/126 (52%), Gaps = 13/126 (10%)
 Frame = +3

Query: 528 SEISPMWPGEAHSLKV-------------EKLLFKGKSDYQDVMVFQSSTYGKVLVLDGV 668
           SE   + P ++HSL V                LF+ KS+YQ++ + Q +     L LD  
Sbjct: 60  SENVTIVPTDSHSLDVWDEISLKEIQAGEHTSLFEEKSNYQNINLVQVNDVR--LYLDKQ 117

Query: 669 IQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKM 848
           +Q +  DE  Y E + H  +  + +PK+VL++       LREV ++ +V  +D+ ++D+ 
Sbjct: 118 LQFSSVDEQIYHEALVHPIMAKVIDPKRVLILGGGDGLALREVLKYETVLHVDLVDLDEA 177

Query: 849 VVDVAK 866
           ++++A+
Sbjct: 178 MINMAR 183



 Score = 31.2 bits (69), Expect(2) = 9e-10
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 1/64 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGP-AQELFEKPFFQTVARALRPGGVVCT 1083
            RV +H+ D   FL N     YD +I+D  DP       L+    F  +A  L   G    
Sbjct: 200  RVNVHVCDAKEFL-NSPSSLYDVIIIDFPDPATELLSTLYTSELFARIATFLTEDGAFVC 258

Query: 1084 QAES 1095
            Q+ S
Sbjct: 259  QSNS 262



>sp|Q9L091|SPE1_STRCO Probable spermidine synthase 1 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 1) (SPDSY
           1).>gb:SCO939112_176129 Streptomyces coelicolor A3(2)
           complete genome; segment 9/29.
          Length = 531

 Score = 48.5 bits (114), Expect(2) = 2e-08
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
 Frame = +3

Query: 576 EKLLFKGKSDYQDVMVFQSSTYGKV----LVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           + ++    + YQD++V +S+ +       L L+G +Q +  DE  Y E + H P  S P+
Sbjct: 252 DPIIHSETTQYQDIVVTRSTAFTGEPDVRLFLNGDLQFSSVDEYRYHESLVH-PALSGPH 310

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
              VL++       LREV RH  V  + + E+D  +  +A+ F P
Sbjct: 311 -SNVLIMGGGDGLALREVLRHEGVRHVTLVELDPAMTRLARTFEP 354



 Score = 34.3 bits (77), Expect(2) = 2e-08
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 1/65 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPA-QELFEKPFFQTVARALRPGGVVC 1080
            PR  +   D   +L+  A   YDAVI+D  DP   +  +L+   F+  + R L P G V 
Sbjct: 366  PRAKVVNADAFTWLRE-ARQQYDAVIIDFPDPDSASLAKLYSVEFYDLLRRVLAPDGQVM 424

Query: 1081 TQAES 1095
             Q+ S
Sbjct: 425  VQSGS 429



>gb:AP006618_559891 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 523

 Score = 42.7 bits (99), Expect(2) = 2e-08
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 1/65 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPA-QELFEKPFFQTVARALRPGGVVC 1080
            PRV +   D  A+L+  + G +DA+IVD  DP   +  +L+ K F+  VA+ L PGG V 
Sbjct: 362  PRVRVINEDAFAWLRGQS-GRFDAIIVDLPDPDQTSIAKLYTKEFYAMVAQVLAPGGTVA 420

Query: 1081 TQAES 1095
             Q+ S
Sbjct: 421  VQSGS 425



 Score = 40.0 bits (92), Expect(2) = 2e-08
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 4/91 (4%)
 Frame = +3

Query: 606 YQDVMVFQS----STYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXX 773
           YQ +++ +S    +T    L L+G +Q +  DE  Y E + H P+ + P  + VLV+   
Sbjct: 258 YQSIVLTESLSPFATPDVRLYLNGDLQFSSVDEYRYHEALVH-PVLAGPRAR-VLVLGGG 315

Query: 774 XXXVLREVARHASVDQIDICEIDKMVVDVAK 866
               LRE+ R+  V ++ + E+D  ++ +A+
Sbjct: 316 DGLALREILRYPDVAEVTLVELDPGMIHLAR 346



>gb:CP000001_855495 Bacillus cereus ZK, complete genome.
          Length = 369

 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 30/94 (31%), Positives = 55/94 (58%)
 Frame = +3

Query: 585 LFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVI 764
           LF  +SDYQ++ + Q S     L LD  +Q +  DE  Y E + H  +  + +PK+VL++
Sbjct: 95  LFAEQSDYQNINLLQVSDIR--LYLDKQLQFSSVDEQIYHEALVHPIMSKVIDPKRVLIL 152

Query: 765 XXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
                  LREV ++ +V  +D+ ++D +++D+A+
Sbjct: 153 GGGDGLALREVLKYETVLHVDLVDLDGLMIDMAR 186



>gb:AE017288_432668 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 2 of 14 of the
           complete sequence.>gb:AE016823_1065679 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 498

 Score = 58.2 bits (139), Expect = 5e-07
 Identities = 28/99 (28%), Positives = 56/99 (56%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           SL  ++++   ++ YQ ++V +     + L L+G +Q + RDE  Y E + H  L + P 
Sbjct: 219 SLYTDEIILSKQTQYQRIIVTRWKNEIR-LFLNGHLQFSSRDEYRYHETLVHPALLAHPT 277

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDV 860
           PKKVLV+       +RE+ +H +V+ + + ++D  + ++
Sbjct: 278 PKKVLVLGGGDGLAVREILKHKNVESVTLVDLDSAITNL 316



>sp|Q8EZP1|SPE1_LEPIN Probable spermidine synthase 1 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 1) (SPDSY
           1).>gb:AE011536_274046 Leptospira interrogans serovar
           lai str. 56601 chromosome I, section 345 of 397 of the
           complete sequence.>gb:AE010300_1007445 Leptospira
           interrogans serovar lai str. 56601 chromosome I,
           complete sequence.
          Length = 498

 Score = 57.4 bits (137), Expect = 9e-07
 Identities = 28/99 (28%), Positives = 56/99 (56%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPN 743
           SL  ++++   ++ YQ ++V +     + L L+G +Q + RDE  Y E + H  L + P 
Sbjct: 219 SLYTDEIILSKQTQYQRIIVTRWKNEIR-LFLNGHLQFSSRDEYRYHETLVHPALLAHPA 277

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDV 860
           PKKVLV+       +RE+ +H +V+ + + ++D  + ++
Sbjct: 278 PKKVLVLGGGDGLAVREILKHKNVESVTLVDLDSAITNL 316



>gb:AE017355_466175 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 405

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 29/94 (30%), Positives = 54/94 (57%)
 Frame = +3

Query: 585 LFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVI 764
           LF  +S+YQ++ + Q S     L LD  +Q +  DE  Y E + H  +  + +PK+VL++
Sbjct: 131 LFAEQSNYQNINLLQVSDIR--LYLDKQLQFSSIDEQIYHEALVHPIMSKVIDPKRVLIL 188

Query: 765 XXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
                  LREV ++ +V  +D+ ++D  ++D+A+
Sbjct: 189 GGGDGLALREVLKYETVLHVDLVDLDGSMIDMAR 222



>sp|Q81X05|SPE2_BACAN Spermidine synthase 2 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 2) (SPDSY
           2).>gb:AE017040_385341 Bacillus anthracis str. Ames
           section 17 of 18 of the complete
           genome.>gb:AE017225_410426 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017334_455188 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE016879_1015046 Bacillus anthracis str. Ames
           complete genome.
          Length = 360

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 29/94 (30%), Positives = 54/94 (57%)
 Frame = +3

Query: 585 LFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVI 764
           LF  +S+YQ++ + Q S     L LD  +Q +  DE  Y E + H  +  + +PK+VL++
Sbjct: 86  LFAEQSNYQNINLLQVSDIR--LYLDKQLQFSSVDEQIYHEALVHPIMSKVIDPKRVLIL 143

Query: 765 XXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
                  LREV ++ +V  +D+ ++D  ++D+A+
Sbjct: 144 GGGDGLALREVLKYETVLHVDLVDLDGSMIDMAR 177



>sp|O67365|SPE2_AQUAE Probable spermidine synthase 2 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 2) (SPDSY
           2).>pir|B70417|B70417 conserved hypothetical protein
           aq_1350 - Aquifex aeolicus>gb:AE000736_26717 Aquifex
           aeolicus VF5 section 68 of 109 of the complete
           genome.>gb:AE000657_977248 Aquifex aeolicus VF5 complete
           genome.
          Length = 493

 Score = 41.2 bits (95), Expect(2) = 4e-06
 Identities = 24/100 (24%), Positives = 54/100 (54%), Gaps = 2/100 (2%)
 Frame = +3

Query: 576 EKLLFKGKSDYQDVMVFQSSTYGK--VLVLDGVIQITERDECAYQEMITHLPLCSIPNPK 749
           E+++   ++ YQ +++   + +GK   L LDG +Q +  DE  Y E + H+P   +   +
Sbjct: 222 EEIIHFEQTPYQKIVL---TRFGKHYSLYLDGHLQFSTLDEKRYHETLVHVPASFLKRYE 278

Query: 750 KVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQ 869
           K L++       LRE+ ++    +I + ++D  +++ +K+
Sbjct: 279 KALILGGGDGLALRELRKY-PFGEIHLVDLDPKMIEFSKK 317



 Score = 33.5 bits (75), Expect(2) = 4e-06
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 2/111 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQ-ELFEKPFFQTVARALRPGGVVCT 1083
            R+ +   D   F+K   E  YD VIVD  DP  P+   ++   F+ ++   L+  G+  T
Sbjct: 333  RLKVFSEDAFNFVKKTKE-KYDFVIVDLIDPRTPSSARVYSLEFYMSLKNKLKEDGIFIT 391

Query: 1084 QAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPS-GVIGFMLCSTE 1233
            QA   +    +  +I+    +  K +  YA+  V   P+ G  G ++ S E
Sbjct: 392  QAGDTFYKREVFCSIL----KTIKKAGFYAYPLVVYIPTFGEWGMVIGSKE 438



>sp|Q9X8S2|SPE2_STRCO Probable spermidine synthase 2 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 2) (SPDSY
           2).>pir|T36545|T36545 probable spermidine synthase -
           Streptomyces coelicolor>gb:SCO939117_177327 Streptomyces
           coelicolor A3(2) complete genome; segment 14/29.
          Length = 554

 Score = 39.7 bits (91), Expect(2) = 7e-06
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +3

Query: 651 LVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDI 830
           L LDG +++   DE +Y E + H P    P+ + VL++        REV RH  V ++D+
Sbjct: 296 LFLDGRLRVRGSDERSYHEALVH-PAMGGPHAR-VLILGGGDGLAAREVLRHPGVRRVDV 353

Query: 831 CEIDKMVVDVAK 866
            E D  +  +A+
Sbjct: 354 LEADPGLARLAR 365



 Score = 34.3 bits (77), Expect(2) = 7e-06
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDP-IGPAQELFEKPFFQTVARALRPGGVVCT 1083
            RV +  GD    L+     TYD VI D  DP +  + +L+ + F+  + R L P G +  
Sbjct: 382  RVRVLSGDAFHRLRATPSATYDVVISDLPDPGVTASTKLYSQEFYGLLRRVLAPDGRLAV 441

Query: 1084 QA 1089
             A
Sbjct: 442  HA 443



>sp|Q8CV14|SPEE_OCEIH Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>gb:BA000028_695330 Oceanobacillus iheyensis
           HTE831 DNA, complete genome.
          Length = 512

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 31/118 (26%), Positives = 61/118 (51%), Gaps = 6/118 (5%)
 Frame = +3

Query: 534 ISPMWPGEAHSLKVEKLLFKG------KSDYQDVMVFQSSTYGKVLVLDGVIQITERDEC 695
           I+ ++ GE  +   E+ L++       +S YQ + V Q     + L LDG +Q +  DE 
Sbjct: 214 IAGLFFGEEMAFNFEQKLYQDPIIHMEESSYQKITVTQDEKDIR-LYLDGSLQFSSVDEH 272

Query: 696 AYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQ 869
            Y E++ H  + ++  P+ VL++        +EV ++  V Q+ + ++D  VV++A +
Sbjct: 273 RYHEVLVHPAMANVETPENVLILGGGDGIAAKEVLKYQDVKQVTLVDLDPAVVELANE 330



>gb:AE017282_427807 Methylococcus capsulatus str. Bath, complete
            genome.
          Length = 268

 Score = 40.4 bits (93), Expect(2) = 4e-04
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAE-GTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGV 1074
            PR+++ +GD   F+K       YD ++ D  D  G A  + E+ F+   A ALRP GV
Sbjct: 125  PRLSITVGDAGTFVKEAGRLAAYDLILADLFDGEGMASPVAEESFYFGCASALRPAGV 182



 Score = 27.7 bits (60), Expect(2) = 4e-04
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +3

Query: 738 PNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           P P  VL++      + + + +H    +ID+ E    VV+VA +FF
Sbjct: 74  PEPSGVLLLGLGGGSLAKALFQHFPACRIDVVERRGEVVEVAHRFF 119



>gb:TFL009863_2580551 Tetraodon fluviatilis mRNA for spermine
           synthase.
          Length = 359

 Score = 48.1 bits (113), Expect = 5e-04
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 3/116 (2%)
 Frame = +3

Query: 528 SEISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           +E+   WP   G      ++K+++   S YQ + +  S  YG +LVL+G + + E D  A
Sbjct: 115 AEVDRYWPTSDGRLMEYDIDKVVYDEDSVYQKIQILHSKQYGNILVLNGNVNLAESD-LA 173

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
           Y + I      +    K+VL++      +L EV +      I + EID+ V+D  K
Sbjct: 174 YTKAIMGSGKENYAG-KEVLILGGGDGGILAEVVKQ-KPKMITMLEIDQKVIDGCK 227



>gb:FRU009865_2572056 Fugu rubripes spermine synthase gene.
          Length = 359

 Score = 48.1 bits (113), Expect = 5e-04
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 3/116 (2%)
 Frame = +3

Query: 528 SEISPMWPGEAHSL---KVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECA 698
           +E+   WP     L    ++++L++  S YQ++ +  S  YG +LVL+G I + + D  A
Sbjct: 115 AEVDRYWPTSDDRLIEYDIDQVLYEEDSAYQNIQILHSKQYGNILVLNGDINLADSD-TA 173

Query: 699 YQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAK 866
           Y   I      S  + K+VL++      +L EV +      I + EID+ V+D  K
Sbjct: 174 YTHAIMGSGKESY-SGKEVLILGGGDGGILAEVVKQ-KPKMITMLEIDQKVIDGCK 227



>sp|Q7M7Q6|SPEE_WOLSU Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:BX571662_779397
           Wolinella succinogenes, complete genome; segment 6/7.
          Length = 262

 Score = 47.8 bits (112), Expect = 7e-04
 Identities = 25/102 (24%), Positives = 49/102 (48%)
 Frame = +3

Query: 573 VEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKK 752
           +E  +   +S+   + +F+S  + ++ +L+    + +       E++ H+PLC  P PK+
Sbjct: 17  IENKILDARSEKNTLEIFKSPAFEEIALLNQKQLLLKTLLSQESELLAHVPLCVHPTPKR 76

Query: 753 VLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           VL+       V  E  RH    Q+D  + D+ ++     FFP
Sbjct: 77  VLIAGSFNLEVAFEALRHEET-QVDFLQKDEKILHSLISFFP 117



>sp|Q7UWD1|SPEE_RHOBA Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>gb:BX294136_766094 Pirellula sp. strain 1
           complete genome; segment 4/24.
          Length = 514

 Score = 47.8 bits (112), Expect = 7e-04
 Identities = 26/100 (26%), Positives = 51/100 (51%)
 Frame = +3

Query: 579 KLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVL 758
           ++++   S YQ + V ++   G  L L+G +Q    DE  Y E + H  +    + ++VL
Sbjct: 231 RIVYADTSPYQRIAVTRNEK-GFQLYLNGHLQFNSVDEYRYHEALVHPVMSVCKDARRVL 289

Query: 759 VIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           V+       +RE+ R+  V+ + + ++D  +  +A QF P
Sbjct: 290 VLGGGDGLAVREILRYDHVESVTLVDLDPAMTRLATQFEP 329



>sp|Q8FMF7|SPEE_COREF Probable spermidine synthase (EC 2.5.1.16)
            (Putrescine aminopropyltransferase)
            (SPDSY).>gb:BA000035_717328 Corynebacterium efficiens
            YS-314 DNA, complete genome.
          Length = 519

 Score = 46.6 bits (109), Expect = 0.002
 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 3/130 (2%)
 Frame = +1

Query: 856  MLPNNFSLM*LLGMRIPRVTLHIGDGVAFLKNVAEG--TYDAVIVDSSDPIGPAQ-ELFE 1026
            +LP+N        M+ PRVT+   D   +L+   +G   YDA+ VD  DP       L+ 
Sbjct: 339  LLPDNGG-----AMQDPRVTVITDDAFTWLRAGGDGGQRYDAIFVDLPDPNNDTMARLYS 393

Query: 1027 KPFFQTVARALRPGGVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAWTTVPTYPSGV 1206
            + F+      L  GG +  Q+ S +    +   I +       G+V      VPT+  G 
Sbjct: 394  QEFYTLALARLNDGGRMVVQSSSAYTTPDVFWRIASTMSAAGCGAVIPYHVHVPTF--GD 451

Query: 1207 IGFMLCSTEG 1236
             GF LC  EG
Sbjct: 452  WGFQLCGPEG 461



 Score = 42.7 bits (99), Expect = 0.023
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 1/111 (0%)
 Frame = +3

Query: 576 EKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKV 755
           + +++  +SDYQD++V Q     + L L+G +Q + RDE  Y E + +  L    + +  
Sbjct: 244 DPVIYAHQSDYQDIVVTQRGA-DRRLYLNGGLQYSTRDEHRYTESLVYPGLSD--SARTA 300

Query: 756 LVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQ-FFPDVAVGYEDP 905
           L+I        RE+ R   + +I   E+D  V++VA     PD     +DP
Sbjct: 301 LIIGGGDGLAARELLRFPDM-RITQVELDPEVIEVANTILLPDNGGAMQDP 350



>gb:CR555306_109097 Azoarcus sp. EbN1 complete genome.
          Length = 251

 Score = 33.9 bits (76), Expect(2) = 0.002
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +3

Query: 744 PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           P+  LVI      ++R + RH    +I + EI+  VV  A+QFF
Sbjct: 56  PRNALVIGLGAASLVRFLHRHCPQTRIQVVEIEPQVVAAARQFF 99



 Score = 32.0 bits (71), Expect(2) = 0.002
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCT 1083
            R ++H+GDG  ++    +  +D ++VD  D    A  L   PF+      L   G++ T
Sbjct: 107  RFSIHVGDGARYVTET-DNRFDLILVDGFDRHARAGVLDTAPFYAAARVCLSDAGLMST 164



>sp|Q82EU4|SPEE_STRAW Probable spermidine synthase (EC 2.5.1.16)
           (Putrescine aminopropyltransferase)
           (SPDSY).>gb:BA000030_702406 Streptomyces avermitilis
           MA-4680 genomic DNA, complete genome.
          Length = 548

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 26/73 (35%), Positives = 41/73 (56%)
 Frame = +3

Query: 651 LVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDI 830
           L LDG ++++  DE  Y E + H P  S     +VLV+        REV R+A V ++D+
Sbjct: 292 LFLDGRLRVSGHDERRYHEALVH-PAMSDGRHARVLVLGGGDGLAAREVLRYADVARVDV 350

Query: 831 CEIDKMVVDVAKQ 869
            E+D  VV +A++
Sbjct: 351 VELDAGVVRLARR 363



>gb:CR522870_101952 Desulfotalea psychrophila LSv54 chromosome.
          Length = 278

 Score = 36.6 bits (83), Expect(2) = 0.005
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +1

Query: 916  LHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVV 1077
            LH   G  FL+   E  YD ++VD+ D  G A+E++   FF+     L+PGG +
Sbjct: 131  LHCCCGKHFLEETEE-KYDLILVDAFDQQGMAKEIYCSEFFRLCHDHLQPGGAI 183



 Score = 27.7 bits (60), Expect(2) = 0.005
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +3

Query: 720 LPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
           LPL  +  PKKVL+I       LR          I+  +    V+ +AK+FF
Sbjct: 74  LPLLLL-KPKKVLIIGLGGGSFLRFFRHFLPEAHIEAVDFSAEVIKIAKEFF 124



>gb:MMAJ87_2114100 Mus musculus gene encoding spermine synthase,
           exon 1 (and joined CDS, partial).
          Length = 288

 Score = 43.5 bits (101), Expect = 0.013
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)
 Frame = +3

Query: 534 ISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           I   WP   G      ++++++   S YQ++ +  S  +G +L+L G + + E D  AY 
Sbjct: 120 IDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESD-LAYT 178

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             I           K VL++      +L E+ +      + + EID+MV+D  K++
Sbjct: 179 RAIMGSGKEDYTG-KDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKY 232



>gb:AF136179_2055933 Mus musculus spermine synthase gene, partial
           cds.
          Length = 258

 Score = 43.5 bits (101), Expect = 0.013
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)
 Frame = +3

Query: 534 ISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           I   WP   G      ++++++   S YQ++ +  S  +G +L+L G + + E D  AY 
Sbjct: 63  IDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESD-LAYT 121

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             I           K VL++      +L E+ +      + + EID+MV+D  K++
Sbjct: 122 RAIMGSGKEDYTG-KDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKY 175



>gb:U53331_2042627 Homo sapiens cosmid clone U129A10 from
           Xp22.1-22.2, complete sequence.
          Length = 349

 Score = 43.5 bits (101), Expect = 0.013
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)
 Frame = +3

Query: 534 ISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           I   WP   G      ++++++   S YQ++ +  S  +G +L+L G + + E D  AY 
Sbjct: 103 IDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESD-LAYT 161

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             I           K VL++      +L E+ +      + + EID+MV+D  K++
Sbjct: 162 RAIMGSGKEDYTG-KDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKY 215



>pir|S54160|S54160 spermine synthase (EC 2.5.1.22) -
           human>gb:HSSPMSYN_2020499 H.sapiens mRNA for spermine
           synthase.
          Length = 368

 Score = 43.5 bits (101), Expect = 0.013
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)
 Frame = +3

Query: 534 ISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           I   WP   G      ++++++   S YQ++ +  S  +G +L+L G + + E D  AY 
Sbjct: 122 IDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESD-LAYT 180

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             I           K VL++      +L E+ +      + + EID+MV+D  K++
Sbjct: 181 RAIMGSGKEDYTG-KDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKY 234



>sp|P97355|SPSY_MOUSE Spermine synthase (EC 2.5.1.22) (Spermidine
           aminopropyltransferase) (SPMSY).>gb:AK017775_1159314 Mus
           musculus 8 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:5730518J22
           product:spermine synthase, full insert
           sequence.>gb:AF031486_2051585 Mus musculus spermidine
           aminopropyltransferase (Mspmsy) mRNA, complete
           cds.>gb:BC046623_2099323 Mus musculus spermine synthase,
           mRNA (cDNA clone MGC:54761 IMAGE:6315420), complete
           cds.>gb:BC058688_2103417 Mus musculus spermine synthase,
           mRNA (cDNA clone MGC:64736 IMAGE:6413869), complete
           cds.>gb:MMSPERMSY_2117423 M.musculus mRNA for spermine
           synthase.
          Length = 366

 Score = 43.5 bits (101), Expect = 0.013
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)
 Frame = +3

Query: 534 ISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           I   WP   G      ++++++   S YQ++ +  S  +G +L+L G + + E D  AY 
Sbjct: 120 IDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESD-LAYT 178

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             I           K VL++      +L E+ +      + + EID+MV+D  K++
Sbjct: 179 RAIMGSGKEDYTG-KDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKY 232



>sp|P52788|SPSY_HUMAN Spermine synthase (EC 2.5.1.22) (Spermidine
           aminopropyltransferase) (SPMSY).>gb:BC009898_1972332
           Homo sapiens spermine synthase, mRNA (cDNA clone
           MGC:2071 IMAGE:3506022), complete
           cds.>gb:BC085621_1989925 Homo sapiens spermine synthase,
           mRNA (cDNA clone MGC:87819 IMAGE:5540463), complete
           cds.>gb:HUMSAPT_2036498 Homo sapiens spermidine
           aminopropyltransferase mRNA, complete cds.
          Length = 366

 Score = 43.5 bits (101), Expect = 0.013
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 3/116 (2%)
 Frame = +3

Query: 534 ISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           I   WP   G      ++++++   S YQ++ +  S  +G +L+L G + + E D  AY 
Sbjct: 120 IDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESD-LAYT 178

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             I           K VL++      +L E+ +      + + EID+MV+D  K++
Sbjct: 179 RAIMGSGKEDYTG-KDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKY 232



>gb:AK049787_1168968 Mus musculus 12 days embryo spinal cord cDNA,
           RIKEN full-length enriched library, clone:C530049P05
           product:spermine synthase, full insert sequence.
          Length = 366

 Score = 42.0 bits (97), Expect = 0.039
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 3/116 (2%)
 Frame = +3

Query: 534 ISPMWP---GEAHSLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQ 704
           I   WP   G      + ++++   S YQ++ +  S  +G +L+L G + + E D  AY 
Sbjct: 120 IDRYWPTADGRLVEYDIXEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESD-LAYT 178

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQF 872
             I           K VL++      +L E+ +      + + EID+MV+D  K++
Sbjct: 179 RAIMGSGKEHYTG-KDVLILGGGDGGILCEIVK-LKPKMVTMVEIDQMVIDGCKKY 232



>gb:AE017180_400795 Geobacter sulfurreducens PCA, complete genome.
          Length = 1017

 Score = 42.0 bits (97), Expect = 0.039
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +3

Query: 660 DGVIQITERDECAY-QEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICE 836
           +G I+ ++ +E    Q  + HLP+    NP+KVLVI       L  V+ H SV ++ + E
Sbjct: 539 NGRIEASDHNESLQNQYALGHLPMLLHRNPRKVLVIGAGSGITLGAVSLHPSVSEMTLAE 598

Query: 837 IDKMVVDVAKQF 872
           ++  V+ V + F
Sbjct: 599 VEPKVLGVTRSF 610



>gb:NSY271871_1691219 Nicotiana sylvestris Ext1.2A gene for putative
           extensin.
          Length = 311

 Score = 21.2 bits (43), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 275 KSPPPPPPV 283



 Score = 21.2 bits (43), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 235 KSPPPPPPV 243



 Score = 21.2 bits (43), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 213 KSPPPPPPV 221



 Score = 21.2 bits (43), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 163 KSPPPPPPV 171



 Score = 21.2 bits (43), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 143 KSPPPPPPV 151



 Score = 21.2 bits (43), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 113 KSPPPPPPV 121



 Score = 21.2 bits (43), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 83  KSPPPPPPV 91



 Score = 20.4 bits (41), Expect(8) = 0.096
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -1

Query: 787 KTPPSPPPI 761
           K+PP PPP+
Sbjct: 193 KSPPPPPPM 201



>gb:AE013598_295289 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 508

 Score = 40.4 bits (93), Expect = 0.11
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 3/114 (2%)
 Frame = +3

Query: 600 SDYQDVMVFQSSTYGKVLVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXX 779
           +D Q  +VF  + Y      DG I +  R      + + +  + ++PNPK+VLVI     
Sbjct: 248 ADPQGNIVFGGNVY------DGRINVDLRSNSNKIDRV-YAAMAAVPNPKRVLVIGLGGG 300

Query: 780 XVLREVARHASVDQIDICEIDKMVVDVAKQFFPDVAVGYEDPPCN---SPHRRW 932
              R +A   +VD++D+ EI+   +++     P VA   +DP  +      RRW
Sbjct: 301 SWTRVIASFPTVDRVDVVEINPGYLELIAG-HPQVAPILQDPRVHIHIDDGRRW 353



 Score = 35.4 bits (80), Expect = 3.7
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = +1

Query: 904  PRVTLHIGDGVAFLKNVAEGTYDAVIVDSS-DPIGPAQELFEKPFFQTVARALRPGGVVC 1080
            PRV +HI DG  +L+      YDA++V+S+      A  L  + FF+ V   L   GV  
Sbjct: 341  PRVHIHIDDGRRWLRAQGGARYDAIVVNSTFHWRSGATTLLSQEFFRLVGAHLSDSGVAL 400

Query: 1081 TQA 1089
              A
Sbjct: 401  VNA 403



>gb:AE017149_391452 Helicobacter hepaticus ATCC 51449 section 6 of 6
           of the complete genome.>gb:AE017125_1025714 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 220

 Score = 39.7 bits (91), Expect = 0.19
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 705 EMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFFP 878
           E++ H+PLCSIP PK  L+       +  E  +H    ++D  + DK  +D    F P
Sbjct: 18  ELLAHIPLCSIPAPKNALLFNSFNIEIAYECFKHNV--KVDCVQADKKSLDSLVSFLP 73



>gb:AE008919_246251 Uncultured proteobacterium BAC EBAC000-65D09
           complete sequence.
          Length = 590

 Score = 39.3 bits (90), Expect = 0.25
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +3

Query: 651 LVLDGVIQITERDECAYQEMITHLPLCSIPN-PKKVLVIXXXXXXVLREVARHASVDQID 827
           L L+G  Q++   E  Y E   H P+ +  + P +VLV+      +LRE+ ++A +  I 
Sbjct: 307 LFLNGDFQLSSNYEEYYHEFFAHFPIITNGSVPSRVLVMGGGDGLLLRELVKYADIQSIV 366

Query: 828 ICEIDKMVVDVA 863
             ++D+ +V++A
Sbjct: 367 HVDLDRELVELA 378



>gb:AB020666_1865264 Homo sapiens mRNA for KIAA0859 protein, partial
            cds.
          Length = 707

 Score = 33.9 bits (76), Expect(2) = 0.35
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 552  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 611

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 612  ILTPEGV 618



 Score = 23.9 bits (50), Expect(2) = 0.35
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
 Frame = +3

Query: 699 YQEMITHLPLCSIPN-----PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           ++ MI  L L   P      P  +LV+      +   V  H     ID  EID  +++VA
Sbjct: 482 HKAMIAGLALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVA 541

Query: 864 KQFF 875
            Q+F
Sbjct: 542 TQWF 545



>gb:BC029083_1979401 Homo sapiens KIAA0859, transcript variant 1, mRNA
            (cDNA clone MGC:21094 IMAGE:4509086), complete
            cds.>gb:HS612B18_1999148 Human DNA sequence from clone
            RP4-612B18 on chromosome 1q24-25.3 Contains the gene for
            CGI-01 protein (CGI-01), two processed pseudogenes and
            the 5' end of DNM3 gene for dynamin 3, complete sequence.
          Length = 699

 Score = 33.9 bits (76), Expect(2) = 0.35
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 544  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 603

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 604  ILTPEGV 610



 Score = 23.9 bits (50), Expect(2) = 0.35
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
 Frame = +3

Query: 699 YQEMITHLPLCSIPN-----PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           ++ MI  L L   P      P  +LV+      +   V  H     ID  EID  +++VA
Sbjct: 474 HKAMIAGLALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVA 533

Query: 864 KQFF 875
            Q+F
Sbjct: 534 TQWF 537



>gb:AF132936_1885523 Homo sapiens CGI-01 protein mRNA, complete cds.
          Length = 642

 Score = 33.9 bits (76), Expect(2) = 0.35
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 544  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 603

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 604  ILTPEGV 610



 Score = 23.9 bits (50), Expect(2) = 0.35
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
 Frame = +3

Query: 699 YQEMITHLPLCSIPN-----PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           ++ MI  L L   P      P  +LV+      +   V  H     ID  EID  +++VA
Sbjct: 474 HKAMIAGLALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVA 533

Query: 864 KQFF 875
            Q+F
Sbjct: 534 TQWF 537



>gb:HS612B18_1999150 Human DNA sequence from clone RP4-612B18 on
            chromosome 1q24-25.3 Contains the gene for CGI-01 protein
            (CGI-01), two processed pseudogenes and the 5' end of
            DNM3 gene for dynamin 3, complete sequence.
          Length = 613

 Score = 33.9 bits (76), Expect(2) = 0.35
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 458  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 517

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 518  ILTPEGV 524



 Score = 23.9 bits (50), Expect(2) = 0.35
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
 Frame = +3

Query: 699 YQEMITHLPLCSIPN-----PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           ++ MI  L L   P      P  +LV+      +   V  H     ID  EID  +++VA
Sbjct: 388 HKAMIAGLALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVA 447

Query: 864 KQFF 875
            Q+F
Sbjct: 448 TQWF 451



>gb:AX881035_1478518 Sequence 15940 from Patent EP1074617.
          Length = 613

 Score = 33.9 bits (76), Expect(2) = 0.35
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 458  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 517

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 518  ILTPEGV 524



 Score = 23.9 bits (50), Expect(2) = 0.35
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
 Frame = +3

Query: 699 YQEMITHLPLCSIPN-----PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           ++ MI  L L   P      P  +LV+      +   V  H     ID  EID  +++VA
Sbjct: 388 HKAMIAGLALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVA 447

Query: 864 KQFF 875
            Q+F
Sbjct: 448 TQWF 451



>gb:HS612B18_1999149 Human DNA sequence from clone RP4-612B18 on
            chromosome 1q24-25.3 Contains the gene for CGI-01 protein
            (CGI-01), two processed pseudogenes and the 5' end of
            DNM3 gene for dynamin 3, complete
            sequence.>gb:HS612B181_1999157 Human gene from PAC
            612B18, chromosome 1.
          Length = 543

 Score = 33.9 bits (76), Expect(2) = 0.36
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 388  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 447

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 448  ILTPEGV 454



 Score = 23.9 bits (50), Expect(2) = 0.36
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
 Frame = +3

Query: 699 YQEMITHLPLCSIPN-----PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           ++ MI  L L   P      P  +LV+      +   V  H     ID  EID  +++VA
Sbjct: 318 HKAMIAGLALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVA 377

Query: 864 KQFF 875
            Q+F
Sbjct: 378 TQWF 381



>gb:BC006814_1970412 Homo sapiens KIAA0859, mRNA (cDNA clone
            IMAGE:3448012), partial cds.
          Length = 331

 Score = 33.9 bits (76), Expect(2) = 0.37
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 176  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 235

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 236  ILTPEGV 242



 Score = 23.9 bits (50), Expect(2) = 0.37
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 5/64 (7%)
 Frame = +3

Query: 699 YQEMITHLPLCSIPN-----PKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVA 863
           ++ MI  L L   P      P  +LV+      +   V  H     ID  EID  +++VA
Sbjct: 106 HKAMIAGLALLRNPELLLEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVA 165

Query: 864 KQFF 875
            Q+F
Sbjct: 166 TQWF 169



>sp|Q8XQC8|SPE2_RALSO Probable spermidine synthase 2 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 2) (SPDSY
           2).>gb:AL646084_549676 Ralstonia solanacearum GMI1000
           megaplasmid, complete sequence; segment 9/11.
          Length = 525

 Score = 38.1 bits (87), Expect = 0.56
 Identities = 17/64 (26%), Positives = 35/64 (54%)
 Frame = +3

Query: 651 LVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDI 830
           L ++G +Q + RDE  Y E +    L S+   ++VLV+       LR++ ++  V+ + +
Sbjct: 272 LYINGNLQFSSRDEYRYHEALVLPALESVRGARRVLVLGGGDGLALRQILKYPQVEHVTL 331

Query: 831 CEID 842
            ++D
Sbjct: 332 VDLD 335



>sp|Q8XQC5|SPE1_RALSO Probable spermidine synthase 1 (EC 2.5.1.16)
           (Putrescine aminopropyltransferase 1) (SPDSY
           1).>gb:AL646084_549707 Ralstonia solanacearum GMI1000
           megaplasmid, complete sequence; segment 9/11.
          Length = 510

 Score = 38.1 bits (87), Expect = 0.56
 Identities = 17/64 (26%), Positives = 35/64 (54%)
 Frame = +3

Query: 651 LVLDGVIQITERDECAYQEMITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDI 830
           L ++G +Q + RDE  Y E +    L S+   ++VLV+       LR++ ++  V+ + +
Sbjct: 257 LYINGNLQFSSRDEYRYHEALVLPALESVRGARRVLVLGGGDGLALRQILKYPQVEHVTL 316

Query: 831 CEID 842
            ++D
Sbjct: 317 VDLD 320



>gb:AF145038_483114 Streptomyces spectabilis glycosyltransferase
            (spcG) and N-methyltransferase (spcM) genes, complete
            cds.
          Length = 267

 Score = 37.4 bits (85), Expect = 0.96
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 10/72 (13%)
 Frame = +1

Query: 919  HIGDGVAFLKNVAEGTYDAVI----------VDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            H GD +A L+ V +G+  AV+          +   D  G     +  PFF    R LRP 
Sbjct: 22   HWGDSLALLEGVPDGSVRAVVCSPPFEGPQLIADEDRAGACSSDWLMPFFGQFERVLRPD 81

Query: 1069 GVVCTQAESIWL 1104
            G V  +   +WL
Sbjct: 82   GCVAFELGGLWL 93



>gb:AE012474_282765 Xanthomonas campestris pv. campestris str. ATCC
            33913, section 382 of 460 of the complete
            genome.>gb:AE008922_916047 Xanthomonas campestris pv.
            campestris str. ATCC 33913, complete genome.
          Length = 293

 Score = 37.4 bits (85), Expect = 0.96
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGG 1071
            R+ L  GD    +  +A+  +DA++ D     G A EL+ + F+  +AR LRPGG
Sbjct: 192  RLHLTHGDVAQHITTLADAAFDAILHDPPR-FGIAGELYSQVFYDQLARVLRPGG 245



>gb:AX879853_1478013 Sequence 14758 from Patent EP1074617.
          Length = 699

 Score = 34.7 bits (78), Expect(2) = 0.97
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 11/101 (10%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 544  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 603

Query: 1054 ALRPGGVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAW 1176
             L P GV       +   + + ++++A  + +F   + Y W
Sbjct: 604  ILTPEGVFILNL--VCRDLGLKDSVLAGLKAVF--PLLYVW 640



 Score = 21.6 bits (44), Expect(2) = 0.97
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 822 IDICEIDKMVVDVAKQFF 875
           ID  EID  +++VA Q+F
Sbjct: 520 IDAVEIDPSMLEVATQWF 537



>gb:AX876151_1476393 Sequence 11056 from Patent EP1074617.
          Length = 353

 Score = 34.7 bits (78), Expect(2) = 1.0
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 11/101 (10%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 198  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 257

Query: 1054 ALRPGGVVCTQAESIWLHMHIIENIVANCRQIFKGSVNYAW 1176
             L P GV       +   + + ++++A  + +F   + Y W
Sbjct: 258  ILTPEGVFILNL--VCRDLGLKDSVLAGLKAVF--PLLYVW 294



 Score = 21.6 bits (44), Expect(2) = 1.0
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 822 IDICEIDKMVVDVAKQFF 875
           ID  EID  +++VA Q+F
Sbjct: 174 IDAVEIDPSMLEVATQWF 191



>gb:AX877044_1476810 Sequence 11949 from Patent
            EP1074617.>gb:AK027621_1911101 Homo sapiens cDNA FLJ14715
            fis, clone NT2RP3001119.
          Length = 613

 Score = 33.9 bits (76), Expect(2) = 1.6
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 458  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 517

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 518  ILTPEGV 524



 Score = 21.6 bits (44), Expect(2) = 1.6
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 822 IDICEIDKMVVDVAKQFF 875
           ID  EID  +++VA Q+F
Sbjct: 434 IDAVEIDPSMLEVATQWF 451



>sp|Q7MF74|SPEE_VIBVY Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:BA000038_724534
           Vibrio vulnificus YJ016 DNA, chromosome II, complete
           sequence.
          Length = 300

 Score = 36.6 bits (83), Expect = 1.6
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 12/116 (10%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDE-CAYQE----------- 707
           S+    ++ + KS YQD++VF+   +     L    +  ER + C YQ+           
Sbjct: 22  SIGQSTIIHEQKSLYQDIVVFEHQDFR---CLSFTAKKGERVQTCEYQDPQDKRIYFPYV 78

Query: 708 MITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
            +T   L   P P+++L+I      V   +A       +DI EID +V  +A+++F
Sbjct: 79  RMTLAGLLFNPKPERILIIGLGGGSVPSALAELYPESHMDIVEIDPVVSQIAERYF 134



>sp|Q8D3Q3|SPEE_VIBVU Spermidine synthase (EC 2.5.1.16) (Putrescine
           aminopropyltransferase) (SPDSY).>gb:AE016813_339283
           Vibrio vulnificus CMCP6 chromosome II section 6 of 6 of
           the complete sequence.>gb:AE016796_1049007 Vibrio
           vulnificus CMCP6 chromosome II complete sequence.
          Length = 299

 Score = 36.6 bits (83), Expect = 1.6
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 12/116 (10%)
 Frame = +3

Query: 564 SLKVEKLLFKGKSDYQDVMVFQSSTYGKVLVLDGVIQITERDE-CAYQE----------- 707
           S+    ++ + KS YQD++VF+   +     L    +  ER + C YQ+           
Sbjct: 21  SIGQSTIIHEQKSLYQDIVVFEHQDFR---CLSFTAKKGERVQTCEYQDPQDKRIYFPYV 77

Query: 708 MITHLPLCSIPNPKKVLVIXXXXXXVLREVARHASVDQIDICEIDKMVVDVAKQFF 875
            +T   L   P P+++L+I      V   +A       +DI EID +V  +A+++F
Sbjct: 78  RMTLAGLLFNPKPERILIIGLGGGSVPSALAELYPESHMDIVEIDPVVSQIAERYF 133



>gb:HS612B18_1999151 Human DNA sequence from clone RP4-612B18 on
            chromosome 1q24-25.3 Contains the gene for CGI-01 protein
            (CGI-01), two processed pseudogenes and the 5' end of
            DNM3 gene for dynamin 3, complete sequence.
          Length = 396

 Score = 33.9 bits (76), Expect(2) = 1.7
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 241  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 300

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 301  ILTPEGV 307



 Score = 21.6 bits (44), Expect(2) = 1.7
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 822 IDICEIDKMVVDVAKQFF 875
           ID  EID  +++VA Q+F
Sbjct: 217 IDAVEIDPSMLEVATQWF 234



>gb:AP006618_560183 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 406

 Score = 36.2 bits (82), Expect = 2.1
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 5/65 (7%)
 Frame = +1

Query: 910  VTLHIGDGVAFLKNVAE-GT-YDAVIVDSSDP-IGPAQE--LFEKPFFQTVARALRPGGV 1074
            +T+H  DG  FL+   + GT YD +++D  D  +  AQ   L+E  F       L PGGV
Sbjct: 257  ITVHYADGWDFLEQAQQAGTRYDVIVIDLPDERVEDAQHNRLYEAEFLSRCRALLAPGGV 316

Query: 1075 VCTQA 1089
            +  QA
Sbjct: 317  LSAQA 321



>sp|Q7NQK7|SPEE_CHRVO Spermidine synthase (EC 2.5.1.16) (Putrescine
            aminopropyltransferase) (SPDSY).>gb:AE016924_359091
            Chromobacterium violaceum ATCC 12472 section 15 of 16 of
            the complete genome.>gb:AE016825_1044245 Chromobacterium
            violaceum ATCC 12472 complete genome.
          Length = 261

 Score = 36.2 bits (82), Expect = 2.1
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = +1

Query: 928  DGVAFLKNVAEGTYDAVIVDSSDPIGPAQELFEKPFFQTVARALRPGGVVCTQAESIWLH 1107
            DG  ++K +  G+ DA++VD  D +     L  + FF+   RAL P GV  T   + W  
Sbjct: 124  DGADYVK-IFRGSTDAILVDGFDGLQIVDALTTEDFFEDCKRALSPKGVFVT---NWWSG 179

Query: 1108 MHIIENIVANCRQIFKGSV 1164
                ++ +     +F+G V
Sbjct: 180  DKRYQSFIERLLNVFEGRV 198



>gb:CQ783942_1452704 Sequence 4082 from Patent
            EP1396543.>gb:AK074552_1912541 Homo sapiens cDNA FLJ90071
            fis, clone HEMBA1004067.
          Length = 396

 Score = 33.9 bits (76), Expect(2) = 2.8
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 11/67 (16%)
 Frame = +1

Query: 907  RVTLHIGDGVAFLKNVAEG-----TYDAVI--VDSSDP-IG---PAQELFEKPFFQTVAR 1053
            R+ +HI DG+ ++ ++A G      YD ++  VDS DP +G   P     E+ F Q V  
Sbjct: 241  RMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKS 300

Query: 1054 ALRPGGV 1074
             L P GV
Sbjct: 301  ILTPEGV 307



 Score = 20.8 bits (42), Expect(2) = 2.8
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 822 IDICEIDKMVVDVAKQFF 875
           ID  EID  +++VA Q+F
Sbjct: 217 IDAVEIDPSMLEVAFQWF 234



>gb:U70376_207822 Streptomyces flavopersicus spectinomycin
            biosynthesis gene cluster, complete sequence.
          Length = 272

 Score = 35.8 bits (81), Expect = 2.8
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 10/72 (13%)
 Frame = +1

Query: 919  HIGDGVAFLKNVAEGTYDAVI----------VDSSDPIGPAQELFEKPFFQTVARALRPG 1068
            H G+ +  +K + + + DAV+          +      G A   + +PFF+   R LRP 
Sbjct: 21   HWGNSLELMKGIPDASVDAVVCSPPFEGDALISDEGRRGDAFVAWIEPFFRQFQRVLRPA 80

Query: 1069 GVVCTQAESIWL 1104
            G V  +   IWL
Sbjct: 81   GCVAFELGGIWL 92



>gb:AY458648_620088 Uncultured bacterium 581 clone EBAC000-69B03
           genomic sequence.
          Length = 591

 Score = 34.7 bits (78), Expect = 6.2
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +3

Query: 651 LVLDGVIQITERDECAYQEMITHLPLCSIPN-PKKVLVIXXXXXXVLREVARHASVDQID 827
           L L+G  Q+    E  Y E   H+P+ +    P+ VLV+      +LRE+ +++ +  I 
Sbjct: 307 LFLNGDFQLASNYEEYYHEFFAHIPIMTNGAVPRHVLVMGGGDGLLLRELVKYSDIKTIV 366

Query: 828 ICEIDKMVVDVA 863
             ++D+ +++ A
Sbjct: 367 HVDLDRELIEQA 378


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,920,774,204
Number of Sequences: 1806583
Number of extensions: 43481041
Number of successful extensions: 111543
Number of sequences better than 10.0: 224
Number of HSP's better than 10.0 without gapping: 102879
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111141
length of database: 581,917,975
effective HSP length: 130
effective length of database: 347,062,185
effective search space used: 151666174845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)