BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6974
         (762 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|H96732|H96732 hypothetical protein F15H11.7 [imported] - Ara...   186   5e-46   Arabidopsis thaliana [mouse-ear cress]
pir|T09157|T09157 phosphoglucomutase precursor, chloroplast - sp...   164   1e-39   Spinacia oleracea
gb:AP004734_1843988 Oryza sativa (japonica cultivar-group) genom...   161   1e-38   
gb:AP003520_1830307 Oryza sativa (japonica cultivar-group) genom...   161   1e-38   
gb:AY061751_1564900 Arabidopsis thaliana AT5g17530/K10A8_10 mRNA...    90   4e-17   
pir|T51457|T51457 phosphoglucomutase-like protein - Arabidopsis ...    90   4e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AE017328_444321 Listeria monocytogenes str. 4b F2365, section...    84   2e-15   
pir|AG1308|AG1308 phosphoglucomutases homolog lmo1871 [imported]...    84   3e-15   Listeria monocytogenes
pir|AG1680|AG1680 phosphoglucomutases homolog lin1985 [imported]...    83   5e-15   Listeria innocua
gb:AP004668_1842988 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AE016949_364760 Enterococcus faecalis V583, section 3 of 11 o...    75   2e-12   
gb:AE013041_288418 Thermoanaerobacter tengcongensis MB4, section...    52   9e-06   
gb:AE016822_340943 Leifsonia xyli subsp. xyli str. CTCB07, compl...    51   3e-05   
pir|S72992|S72992 probable phosphorylating protein ureD - Mycoba...    47   3e-04   Mycobacterium leprae
gb:AP006618_557262 Nocardia farcinica IFM 10152 DNA, complete ge...    45   0.001   
gb:BX569689_775184 Synechococcus sp. WH8102 complete genome; seg...    45   0.002   
gb:AY596297_633831 Haloarcula marismortui ATCC 43049 chromosome ...    45   0.002   
gb:AE012040_278820 Xanthomonas axonopodis pv. citri str. 306, se...    44   0.003   
gb:AE010181_260155 Pyrococcus furiosus DSM 3638, section 56 of 1...    44   0.003   
gb:CP000003_860713 Streptococcus pyogenes MGAS10394, complete ge...    44   0.004   
gb:BA000034_714106 Streptococcus pyogenes SSI-1 DNA, complete ge...    44   0.004   
gb:AP006840_567383 Symbiobacterium thermophilum DNA, complete ge...    44   0.004   
gb:AE014975_313763 Streptococcus mutans UA159 section 123 of 185...    44   0.004   
gb:AE012804_285748 Chlorobium tepidum TLS section 25 of 194 of t...    44   0.004   
gb:AE010030_258541 Streptococcus pyogenes strain MGAS8232, secti...    44   0.004   
gb:AE006548_220055 Streptococcus pyogenes M1 GAS, section 77 of ...    44   0.004   
gb:SAG766847_170431 Streptococcus agalactiae NEM316 complete gen...    44   0.004   
gb:AE013598_294199 Xanthomonas oryzae pv. oryzae KACC10331, comp...    43   0.005   
gb:AE017242_414952 Mycobacterium avium subsp. paratuberculosis s...    43   0.007   
gb:AB126241_15279 Thermococcus kodakaraensis Tko1621 gene for ph...    43   0.007   
pir|H75104|H75104 phosphomannomutase (pmm) PAB0819 - Pyrococcus ...    43   0.007   Pyrococcus abyssi
gb:AE017282_429475 Methylococcus capsulatus str. Bath, complete ...    42   0.009   
pir|H98048|H98048 phosphoacetylglucosamine mutase (EC 5.4.2.3) [...    42   0.009   Streptococcus pneumoniae R6
pir|E95181|E95181 hypothetical protein SP1559 [imported] - Strep...    42   0.009   Streptococcus pneumoniae
gb:CP000025_879328 Campylobacter jejuni RM1221, complete genome.       42   0.012   
gb:AE012506_283077 Xanthomonas campestris pv. campestris str. AT...    42   0.012   
pir|G70976|G70976 probable phosphoglucomutase or phosphomannomut...    42   0.012   Mycobacterium tuberculosis
gb:AE016850_348670 Tropheryma whipplei str. Twist, section 1 of ...    42   0.016   
pir|E71082|E71082 probable phospho-sugar mutase 2 - Pyrococcus h...    42   0.016   Pyrococcus horikoshii
pir|C72408|C72408 phosphoglucomutase/phosphomannomutase family p...    42   0.016   Thermotoga maritima
sp|Q8CNH0|GLMM_STAEP|GLMM_STAEP Phosphoglucosamine mutase (EC 5.4.2.10).>gb...    42   0.016   Staphylococcus epidermidis
gb:BA000028_694619 Oceanobacillus iheyensis HTE831 DNA, complete...    41   0.027   
gb:AE010378_262525 Methanopyrus kandleri AV19 section 77 of 157 ...    41   0.027   
gb:CP000033_89004 Lactobacillus acidophilus NCFM, complete genome.     41   0.027   
sp|Q88BD4|ALGC_PSESM|ALGC_PSESM Phosphomannomutase/phosphoglucomutase (EC 5...    41   0.027   Pseudomonas syringae pv. tomato
gb:BA000043_736940 Geobacillus kaustophilus HTA426 DNA, complete...    40   0.035   
gb:AY575079_629569 Pseudomonas syringae pv. syringae phosphomann...    40   0.035   
gb:AE015937_319650 Clostridium tetani E88, section 2 of 10 of th...    40   0.035   
pir|H86677|H86677 phosphoglucosamine mutase [imported] - Lactoco...    40   0.035   Lactococcus lactis subsp. lactis
sp|Q88C93|ALGC_PSEPK|ALGC_PSEPK Phosphomannomutase/phosphoglucomutase (EC 5...    40   0.035   Pseudomonas putida
gb:AX283321_1465228 Sequence 1 from Patent WO0179476.                  40   0.046   
gb:CP000023_875133 Streptococcus thermophilus LMG 18311, complet...    40   0.046   
gb:BA000030_702846 Streptomyces avermitilis MA-4680 genomic DNA,...    40   0.046   
gb:BA000012_668963 Mesorhizobium loti MAFF303099 DNA, complete g...    40   0.046   
gb:AE017283_431560 Propionibacterium acnes KPA171202, complete g...    40   0.046   
pir|T35565|T35565 probable phospho-sugar mutase - Streptomyces c...    40   0.046   Streptomyces coelicolor
gb:AE011004_268333 Methanosarcina acetivorans str. C2A, section ...    40   0.061   
gb:CP000046_92243 Staphylococcus aureus subsp. aureus COL, compl...    40   0.061   
sp|Q99QR5|GLMM_STAAM|GLMM_STAAM Phosphoglucosamine mutase (EC 5.4.2.10).>pi...    40   0.061   Staphylococcus aureus
gb:AX763200_1474339 Sequence 17 from Patent WO03040291.                39   0.079   
gb:BA000036_718310 Corynebacterium glutamicum ATCC 13032 DNA, co...    39   0.079   
gb:AL935254_550751 Lactobacillus plantarum strain WCFS1 complete...    39   0.079   
gb:AL646060_545619 Ralstonia solanacearum GMI1000 chromosome, co...    39   0.079   
gb:AE013165_289773 Thermoanaerobacter tengcongensis MB4, section...    39   0.079   
gb:AE012553_283567 Xylella fastidiosa Temecula1, section 1 of 9 ...    39   0.079   
pir|F82840|F82840 phosphomannomutase XF0151 [imported] - Xylella...    39   0.079   Xylella fastidiosa
gb:CP000024_877043 Streptococcus thermophilus CNRZ1066, complete...    39   0.10    
gb:AE010381_262552 Methanopyrus kandleri AV19 section 80 of 157 ...    39   0.10    
gb:CP000010_866371 Burkholderia mallei ATCC 23344 chromosome 1, ...    39   0.13    
gb:BX571965_792462 Burkholderia pseudomallei strain K96243, chro...    39   0.13    
gb:BX248355_761856 Corynebacterium diphtheriae gravis NCTC13129,...    39   0.13    
gb:AE013255_290631 Methanosarcina mazei strain Goe1, section 37 ...    39   0.13    
gb:BX640430_810598 Bordetella parapertussis strain 12822, comple...    38   0.18    
gb:BX640416_806378 Bordetella pertussis strain Tohama I, complet...    38   0.18    
gb:BX321862_774223 Nitrosomonas europaea ATCC 19718, complete ge...    38   0.18    
gb:AE017264_421392 Bacillus cereus ATCC 10987, section 1 of 18 o...    38   0.18    
gb:AE017202_404104 Lactobacillus johnsonii NCC 533, section 3 of...    38   0.18    
gb:CP000002_855951 Bacillus licheniformis ATCC 14580, complete g...    38   0.23    
gb:BA000035_715373 Corynebacterium efficiens YS-314 DNA, complet...    38   0.23    
gb:AE017333_446129 Bacillus licheniformis DSM 13, complete genome.     38   0.23    
pir|B69745|B69745 phosphoglucomutase (glycolysis) homolog ybbT -...    38   0.23    Bacillus subtilis
sp|P40390|PGMU_NEIGO|PGMU_NEIGO Phosphoglucomutase (EC 5.4.2.2) (Glucose ph...    38   0.23    Neisseria gonorrhoeae
gb:BA000011_665061 Thermoplasma volcanium GSS1 DNA, complete gen...    37   0.30    
gb:TACID2_196338 Thermoplasma acidophilum complete genome; segme...    37   0.30    
gb:AB006424_905 Bacillus subtilis genomic DNA, 70 kb region betw...    37   0.30    
pir|G22845|G22845 hypothetical protein 7 - Trypanosoma brucei mi...    37   0.30    Trypanosoma brucei
pir|F98271|F98271 mrsA protein [imported] - Agrobacterium tumefa...    37   0.30    Agrobacterium fabrum str. C58
pir|C64679|C64679 phosphomannomutase - Helicobacter pylori (stra...    37   0.30    Helicobacter pylori
pir|E96959|E96959 phosphomannomutase [imported] - Clostridium ac...    37   0.30    Clostridium acetobutylicum
pir|A99162|A99162 phosphomannomutase (pmM) [imported] - Sulfolob...    37   0.30    Saccharolobus solfataricus
gb:AE017024_380451 Bacillus anthracis str. Ames section 1 of 18 ...    37   0.39    
gb:AE010962_267979 Methanosarcina acetivorans str. C2A, section ...    37   0.39    
pir|A40013|A40013 phosphomannomutase (EC 5.4.2.8) [validated] - ...    37   0.39    Pseudomonas aeruginosa
gb:BX842646_823067 Bdellovibrio bacteriovorus complete genome, s...    37   0.51    
gb:BX572603_802934 Rhodopseudomonas palustris CGA009 complete ge...    37   0.51    
gb:BX572100_799165 Prochlorococcus marinus MIT9313 complete geno...    37   0.51    
gb:AE016998_375213 Bacillus cereus ATCC 14579 section 1 of 18 of...    37   0.51    
gb:AE016917_357133 Chromobacterium violaceum ATCC 12472 section ...    37   0.51    
gb:AE015563_315608 Shewanella oneidensis MR-1 section 112 of 457...    37   0.51    
pir|C83683|C83683 phosphoglucosamine mutase BH0267 [imported] - ...    37   0.51    Bacillus halodurans
gb:BX842651_824812 Bdellovibrio bacteriovorus complete genome, s...    36   0.67    
gb:AP006627_562570 Bacillus clausii KSM-K16 DNA, complete genome.      36   0.67    
gb:AF214113_488911 Sphingomonas sp. S7 phosphoglucomutase gene, ...    36   0.67    
gb:AE017329_444571 Listeria monocytogenes str. 4b F2365, section...    36   0.67    
gb:AE017313_439533 Desulfovibrio vulgaris subsp. vulgaris str. H...    36   0.67    
gb:AE016791_334102 Pseudomonas putida KT2440 section 18 of 21 of...    36   0.67    
gb:AE014295_311567 Bifidobacterium longum NCC2705, complete genome.    36   0.67    
gb:AE010201_260428 Pyrococcus furiosus DSM 3638, section 76 of 1...    36   0.67    
gb:AE008692_240077 Zymomonas mobilis subsp. mobilis ZM4, complet...    36   0.67    
gb:MTU51624_151550 Methanobacterium thermoautotrophicum putative...    36   0.67    
gb:AE004969_60148 Neisseria gonorrhoeae FA 1090, complete genome.      36   0.67    
pir|AD1710|AD1710 phosphoglucomutase homolog lin2223 [imported] ...    36   0.67    Listeria innocua
pir|AF1339|AF1339 phosphoglucomutase homolog lmo2118 [imported] ...    36   0.67    Listeria monocytogenes
pir|A71840|A71840 phosphohexosemutase - Helicobacter pylori (str...    36   0.67    Helicobacter pylori J99
pir|D69078|D69078 probable phosphomannomutase 2 - Methanobacteri...    36   0.67    Methanothermobacter thermautotrophicus str. Delta H
pir|B69307|B69307 phosphomannomutase (pmm) homolog - Archaeoglob...    36   0.67    Archaeoglobus fulgidus
gb:AP006618_559551 Nocardia farcinica IFM 10152 DNA, complete ge...    36   0.87    
gb:AF167367_484940 Sphingomonas paucimobilis phosphoglucomutase/...    36   0.87    
gb:AE016872_353855 Pseudomonas syringae pv. tomato str. DC3000 s...    36   0.87    
gb:AE016822_340600 Leifsonia xyli subsp. xyli str. CTCB07, compl...    36   0.87    
gb:AE013386_291851 Methanosarcina mazei strain Goe1, section 168...    36   0.87    
gb:SME591791_186752 Sinorhizobium meliloti 1021 complete chromos...    36   0.87    
gb:CR555306_105934 Azoarcus sp. EbN1 complete genome.                  36   0.87    
pir|A97782|A97782 phosphomannomutase (EC 5.4.2.8) [imported] - R...    36   0.87    Rickettsia conorii
pir|H82979|H82979 phosphomannomutase AlgC PA5322 [imported] - Ps...    36   0.87    Pseudomonas aeruginosa
pir|S77135|S77135 hypothetical protein sll1758 - Synechocystis s...    36   0.87    Synechocystis sp. PCC 6803
sp|P95575|GLMM_PSESY|GLMM_PSESY Phosphoglucosamine mutase (EC 5.4.2.10).>gb...    36   0.87    Pseudomonas syringae pv. syringae
sp|P26276|ALGC_PSEAE|ALGC_PSEAE Phosphomannomutase/phosphoglucomutase (EC 5...    36   0.87    Pseudomonas aeruginosa
gb:BX897700_829373 Bartonella quintana str. Toulouse, complete g...    35   1.1     
gb:BX897699_828054 Bartonella henselae strain Houston-1, complet...    35   1.1     
gb:BA000043_736731 Geobacillus kaustophilus HTA426 DNA, complete...    35   1.1     
gb:AE016827_342596 Mannheimia succiniciproducens MBEL55E, comple...    35   1.1     
gb:AE016767_327911 Escherichia coli CFT073 section 13 of 18 of t...    35   1.1     
gb:AE015944_321566 Clostridium tetani E88, section 9 of 10 of th...    35   1.1     
gb:AE010548_264270 Fusobacterium nucleatum subsp. nucleatum ATCC...    35   1.1     
gb:CR543861_105244 Acinetobacter sp. ADP1 complete genome.             35   1.1     
gb:CP000031_85404 Silicibacter pomeroyi DSS-3, complete genome.        35   1.1     
pir|AE0425|AE0425 probable phosphoglucomutase/phosphomannomutase...    35   1.1     Yersinia pestis
pir|I41215|I41215 phosphoglucomutase (EC 5.4.2.2) [validated] - ...    35   1.1     Escherichia coli K-12
pir|B85981|B85981 hypothetical protein mrsA [imported] - Escheri...    35   1.1     Escherichia coli O157:H7
pir|E86611|E86611 phosphoglucomutase [imported] - Chlamydophila ...    35   1.1     Chlamydia pneumoniae
sp|Q9HN14|HIS4_HALN1|HIS4_HALN1 1-(5-phosphoribosyl)-5-[(5-phosphoribosylam...    35   1.1     Halobacterium sp.
sp|Q83Q15|GLMM_SHIFL|GLMM_SHIFL Phosphoglucosamine mutase (EC 5.4.2.10).>gb...    35   1.1     Shigella flexneri
sp|P31120|GLMM_ECOLI|GLMM_ECOLI Phosphoglucosamine mutase (EC 5.4.2.10).          35   1.1     Escherichia coli [E. coli]
gb:AY871968_2150132 Synthetic construct hypothetical protein (FT...    35   1.5     
gb:BX957222_844330 Methanococcus maripaludis S2 complete genome;...    35   1.5     
gb:BX640450_817100 Bordetella bronchiseptica strain RB50, comple...    35   1.5     
gb:BX640435_812214 Bordetella parapertussis strain 12822, comple...    35   1.5     
gb:BA000040_736532 Bradyrhizobium japonicum USDA 110 DNA, comple...    35   1.5     
gb:BA000040_736386 Bradyrhizobium japonicum USDA 110 DNA, comple...    35   1.5     
gb:BA000040_735668 Bradyrhizobium japonicum USDA 110 DNA, comple...    35   1.5     
gb:BA000037_723539 Vibrio vulnificus YJ016 DNA, chromosome I, co...    35   1.5     
gb:BA000031_707921 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    35   1.5     
gb:AJ749949_530536 Francisella tularensis subsp. tularensis comp...    35   1.5     
gb:AE017151_391797 Haemophilus ducreyi strain 35000HP section 1 ...    35   1.5     
gb:AE016802_336361 Vibrio vulnificus CMCP6 chromosome I section ...    35   1.5     
pir|G87529|G87529 hypothetical protein CC2264 [imported] - Caulo...    35   1.5     Caulobacter vibrioides
pir|G82299|G82299 phosphoglucomutase/phosphomannomutase family p...    35   1.5     Vibrio cholerae
gb:CP000020_870657 Vibrio fischeri ES114 chromosome I, complete ...    35   1.9     
gb:CP000009_863676 Gluconobacter oxydans 621H, complete genome.        35   1.9     
gb:BX950851_839451 Erwinia carotovora subsp. atroseptica SCRI104...    35   1.9     
gb:BX572606_803931 Rhodopseudomonas palustris CGA009 complete ge...    35   1.9     
gb:BA000043_736656 Geobacillus kaustophilus HTA426 DNA, complete...    35   1.9     
gb:AE016964_368543 Coxiella burnetii strain RSA 493, section 5 o...    35   1.9     
gb:NSU581792_156262 Neisseria subflava dedA gene (partial), manB...    35   1.9     
gb:CP000026_77870 Salmonella enterica subsp. enterica serovar Pa...    35   1.9     
pir|G71654|G71654 phosphomannomutase (exoC) RP509 - Rickettsia p...    35   1.9     Rickettsia prowazekii
pir|D72722|D72722 probable MRSA protein APE0317 - Aeropyrum pern...    35   1.9     Aeropyrum pernix
pir|AE0902|AE0902 PGM/PMM-family protein [imported] - Salmonella...    35   1.9     Salmonella enterica subsp. enterica serovar Typhi
gb:AE017344_1756313 Cryptococcus neoformans var. neoformans JEC2...    34   2.5     
gb:BX248584_763725 Blochmannia floridanus complete genome; segme...    34   2.5     
gb:AE016996_374845 Chlamydophila caviae GPIC section 3 of 4 of t...    34   2.5     
gb:AE013598_296950 Xanthomonas oryzae pv. oryzae KACC10331, comp...    34   2.5     
gb:AE010682_265630 Methanosarcina acetivorans str. C2A, section ...    34   2.5     
pir|C69079|C69079 probable phosphomannomutase 1 - Methanobacteri...    34   2.5     Methanothermobacter thermautotrophicus str. Delta H
sp|P45164|GLMM_HAEIN|GLMM_HAEIN Phosphoglucosamine mutase (EC 5.4.2.10).>pi...    34   2.5     Haemophilus influenzae
gb:AB012241_1511696 Arabidopsis thaliana genomic DNA, chromosome...    34   3.3     
gb:CP000010_866736 Burkholderia mallei ATCC 23344 chromosome 1, ...    34   3.3     
gb:BA000039_727556 Thermosynechococcus elongatus BP-1 DNA, compl...    34   3.3     
gb:BA000016_675369 Clostridium perfringens str. 13 DNA, complete...    34   3.3     
gb:AE012365_281767 Xanthomonas campestris pv. campestris str. AT...    34   3.3     
gb:AE011911_277630 Xanthomonas axonopodis pv. citri str. 306, se...    34   3.3     
gb:AE006080_215328 Pasteurella multocida subsp. multocida str. P...    34   3.3     
gb:CR555306_108138 Azoarcus sp. EbN1 complete genome.                  34   3.3     
pir|B53614|B53614 phosphoglucomutase (EC 5.4.2.2) - Neisseria me...    34   3.3     Neisseria meningitidis serogroup B
sp|P40391|PGMU_NEIMB|PGMU_NEIMB Phosphoglucomutase (EC 5.4.2.2) (Glucose ph...    34   3.3     Neisseria meningitidis
sp|P50901|HOX3_BRAFL|HOX3_BRAFL Homeobox protein HOX3.>pir|A49127|A49127 ho...    34   3.3     Branchiostoma floridae
gb:BX571874_789388 Photorhabdus luminescens subsp. laumondii TTO...    33   4.3     
gb:AE017340_456735 Idiomarina loihiensis L2TR, complete genome.        33   4.3     
gb:AE017145_390366 Helicobacter hepaticus ATCC 51449 section 2 o...    33   4.3     
gb:U01376_203442 Escherichia coli K12 ampicillin-binding protein...    33   4.3     
pir|C70502|C70502 hypothetical protein Rv1692 - Mycobacterium tu...    33   4.3     Mycobacterium tuberculosis
pir|A71467|A71467 probable phosphoglucomutase - Chlamydia tracho...    33   4.3     Chlamydia trachomatis
pir|D84371|D84371 phosphomannomutase [imported] - Halobacterium ...    33   4.3     Halobacterium salinarum
pir|A81729|A81729 phosphoglucomutase/phosphomannomutase family p...    33   4.3     Chlamydia muridarum [agent of mouse pneumonitis]
gb:CNS06C8G_1372660 chromosome I of strain GB-M1 of Encephalitoz...    33   5.7     
gb:BX571965_793040 Burkholderia pseudomallei strain K96243, chro...    33   5.7     
gb:AP008231_581655 Synechococcus elongatus PCC 6301 DNA, complet...    33   5.7     
gb:AP006840_570198 Symbiobacterium thermophilum DNA, complete ge...    33   5.7     
gb:AL646073_548050 Ralstonia solanacearum GMI1000 chromosome, co...    33   5.7     
gb:AE004969_61020 Neisseria gonorrhoeae FA 1090, complete genome.      33   5.7     
pir|C81823|C81823 probable phosphoglucomutase/phosphomannomutase...    33   5.7     Neisseria meningitidis serogroup A
pir|C81054|C81054 phosphoglucomutase/phosphomannomutase family p...    33   5.7     Neisseria meningitidis serogroup B
sp|P57002|PGMU_NEIMA|PGMU_NEIMA Phosphoglucomutase (EC 5.4.2.2) (Glucose ph...    33   5.7     Neisseria meningitidis
gb:BX640429_810321 Bordetella parapertussis strain 12822, comple...    33   7.4     
gb:BX640414_805502 Bordetella pertussis strain Tohama I, complet...    33   7.4     
gb:BX321857_772858 Nitrosomonas europaea ATCC 19718, complete ge...    33   7.4     
gb:BA000023_690786 Sulfolobus tokodaii str. 7 DNA, complete genome.    33   7.4     
gb:AY744396_644971 Uncultured proteobacterium RedeBAC7D11 contig...    33   7.4     
gb:AL646065_546456 Ralstonia solanacearum GMI1000 chromosome, co...    33   7.4     
gb:AE017175_397345 Porphyromonas gingivalis W83 section 4 of 8 o...    33   7.4     
gb:BA000040_731629 Bradyrhizobium japonicum USDA 110 DNA, comple...    32   9.7     
gb:BA000030_700428 Streptomyces avermitilis MA-4680 genomic DNA,...    32   9.7     
gb:AE017286_432160 Desulfovibrio vulgaris subsp. vulgaris str. H...    32   9.7     
gb:AE017197_402471 Rickettsia typhi str. Wilmington complete gen...    32   9.7     
gb:AE017180_400101 Geobacter sulfurreducens PCA, complete genome.      32   9.7     
gb:AE012555_284105 Xylella fastidiosa Temecula1, section 3 of 9 ...    32   9.7     
gb:AE012553_283652 Xylella fastidiosa Temecula1, section 1 of 9 ...    32   9.7     
pir|A75319|A75319 phosphoglucomutase and phosphomannomutase phos...    32   9.7     Deinococcus radiodurans
pir|A82679|A82679 phosphomannomutase XF1468 [imported] - Xylella...    32   9.7     Xylella fastidiosa


>pir|H96732|H96732 hypothetical protein F15H11.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_894666 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008148_1536550 Arabidopsis thaliana
           chromosome I BAC F15H11 genomic sequence, complete
           sequence.>gb:AY093163_1575117 Arabidopsis thaliana
           putative phosphoglucomutase (At1g70820) mRNA, complete
           cds.>gb:BT008376_1639593 Arabidopsis thaliana At1g70820
           gene, complete cds.
          Length = 615

 Score =  186 bits (471), Expect = 5e-46
 Identities = 113/191 (59%), Positives = 140/191 (73%), Gaps = 5/191 (2%)
 Frame = +1

Query: 73  MASTSTTP-QSLQTIASKPN-FPSFPIHKPLHRS-LGIAQSFPKIKLSLRVESSLTANKH 243
           MASTST+   + +T+ SK   F S P    + RS L  A + P +K  LR+ SS    K 
Sbjct: 1   MASTSTSSLMASKTVISKTALFSSLP--GIVSRSFLTFAPASPSVK-PLRIRSS-NVTKF 56

Query: 244 NEV--AVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLES 417
           +EV  ++DE+M++IRRLQNGSDVRGVAL+GEKGR+VDLTP AVEAIAESFGEWV +  ES
Sbjct: 57  DEVTNSLDEDMDQIRRLQNGSDVRGVALEGEKGRTVDLTPAAVEAIAESFGEWV-AATES 115

Query: 418 ERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPF 597
              G +    ++SLG DPR+SG  LS AVFAGL +AGCL FDMGLATTPACFMST+L PF
Sbjct: 116 NGNGVI----KISLGRDPRVSGGKLSTAVFAGLARAGCLAFDMGLATTPACFMSTLLSPF 171

Query: 598 QYDASIMVSVN 630
           +YDASIM++ +
Sbjct: 172 EYDASIMMTAS 182



>pir|T09157|T09157 phosphoglucomutase precursor, chloroplast -
           spinach>gb:SOPGM_1715833 S.oleracea pgm mRNA.
          Length = 583

 Score =  164 bits (416), Expect = 1e-39
 Identities = 82/127 (64%), Positives = 101/127 (79%), Gaps = 3/127 (2%)
 Frame = +1

Query: 259 DEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESE---RGG 429
           D+++E+I+RLQNGSDV  VAL+GEKGR VDLTPPAVEAIAESFGEW+I+ L  +   +  
Sbjct: 26  DDDIERIKRLQNGSDVSRVALEGEKGREVDLTPPAVEAIAESFGEWLIAKLRDDDDYKEK 85

Query: 430 AVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDA 609
             V+ V+VSLG DPR++G  LS AVF+GL +AGCL FDMGLATTPACFMSTV P F Y  
Sbjct: 86  QGVDVVKVSLGKDPRVTGAKLSVAVFSGLARAGCLAFDMGLATTPACFMSTVFPHFSYHG 145

Query: 610 SIMVSVN 630
           SIM++ +
Sbjct: 146 SIMMTAS 152



>gb:AP004734_1843988 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0026P23.
          Length = 625

 Score =  161 bits (408), Expect = 1e-38
 Identities = 87/147 (59%), Positives = 103/147 (70%)
 Frame = +1

Query: 190 PKIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVE 369
           PK     R+E+S  A         E+ + IRRLQNG DVRGVAL+GE GR+VDLTP AVE
Sbjct: 52  PKAATGGRLETSTDA----AAVAGEDGDVIRRLQNGPDVRGVALEGENGRAVDLTPLAVE 107

Query: 370 AIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMG 549
            IAESFGEW+   L+    G     VRVS+G DPR+SG  L AA+FAGL +AGC VFD+G
Sbjct: 108 VIAESFGEWLREELQQLESGRDGGEVRVSVGRDPRLSGARLGAALFAGLARAGCSVFDVG 167

Query: 550 LATTPACFMSTVLPPFQYDASIMVSVN 630
           LATTPACFMST LP F YDASIM++ +
Sbjct: 168 LATTPACFMSTKLPRFSYDASIMMTAS 194



>gb:AP003520_1830307 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0021H10.>gb:AP004734_1843989 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0026P23.
          Length = 495

 Score =  161 bits (408), Expect = 1e-38
 Identities = 87/147 (59%), Positives = 103/147 (70%)
 Frame = +1

Query: 190 PKIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVE 369
           PK     R+E+S  A         E+ + IRRLQNG DVRGVAL+GE GR+VDLTP AVE
Sbjct: 52  PKAATGGRLETSTDA----AAVAGEDGDVIRRLQNGPDVRGVALEGENGRAVDLTPLAVE 107

Query: 370 AIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMG 549
            IAESFGEW+   L+    G     VRVS+G DPR+SG  L AA+FAGL +AGC VFD+G
Sbjct: 108 VIAESFGEWLREELQQLESGRDGGEVRVSVGRDPRLSGARLGAALFAGLARAGCSVFDVG 167

Query: 550 LATTPACFMSTVLPPFQYDASIMVSVN 630
           LATTPACFMST LP F YDASIM++ +
Sbjct: 168 LATTPACFMSTKLPRFSYDASIMMTAS 194



>gb:AY061751_1564900 Arabidopsis thaliana AT5g17530/K10A8_10 mRNA,
           complete cds.>gb:AY129467_1581118 Arabidopsis thaliana
           AT5g17530/K10A8_10 mRNA, complete cds.
          Length = 581

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 57/157 (36%), Positives = 86/157 (54%), Gaps = 6/157 (3%)
 Frame = +1

Query: 178 AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEK--IRRLQNGSDVRGVALQGEKGRSVDL 351
           A +  K +  L  + +   N  +  A    ++K    +LQNGSD+RGVA+ G +G  V L
Sbjct: 22  AHTLSKYQFVLSKQRTFYCNATSSSATVPSLDKNDFLKLQNGSDIRGVAVTGVEGEPVSL 81

Query: 352 TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC 531
             P  EAIA +FG+W++   ++E        +RVS+G D RIS ++L  AV  GLG +G 
Sbjct: 82  PEPVTEAIAAAFGQWLLHKKKAES-----RRLRVSVGHDSRISAQTLLEAVSRGLGVSGL 136

Query: 532 LVFDMGLATTPACFMSTVLPPFQY----DASIMVSVN 630
            V   GLA+TPA F ST+     +    D +IM++ +
Sbjct: 137 DVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS 173



>pir|T51457|T51457 phosphoglucomutase-like protein - Arabidopsis
           thaliana>gb:ATK10A8_1553504 Arabidopsis thaliana DNA
           chromosome 5, BAC clone K10A8 (ESSA project).
          Length = 570

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 57/157 (36%), Positives = 86/157 (54%), Gaps = 6/157 (3%)
 Frame = +1

Query: 178 AQSFPKIKLSLRVESSLTANKHNEVAVDEEMEK--IRRLQNGSDVRGVALQGEKGRSVDL 351
           A +  K +  L  + +   N  +  A    ++K    +LQNGSD+RGVA+ G +G  V L
Sbjct: 11  AHTLSKYQFVLSKQRTFYCNATSSSATVPSLDKNDFLKLQNGSDIRGVAVTGVEGEPVSL 70

Query: 352 TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC 531
             P  EAIA +FG+W++   ++E        +RVS+G D RIS ++L  AV  GLG +G 
Sbjct: 71  PEPVTEAIAAAFGQWLLHKKKAES-----RRLRVSVGHDSRISAQTLLEAVSRGLGVSGL 125

Query: 532 LVFDMGLATTPACFMSTVLPPFQY----DASIMVSVN 630
            V   GLA+TPA F ST+     +    D +IM++ +
Sbjct: 126 DVVQFGLASTPAMFNSTLTEDESFLCPADGAIMITAS 162



>gb:AE017328_444321 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076677
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 503

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 51/122 (41%), Positives = 73/122 (59%)
 Frame = +1

Query: 265 EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES 444
           E + +  LQNGSD+RG+A+  EK + + LT   VE IA  F +W    L+ E+   V   
Sbjct: 5   ETKALEALQNGSDIRGIAIATEKYQ-ITLTDERVEKIAYGFAKW----LKEEK--KVEGQ 57

Query: 445 VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVS 624
            +V++G D R+S + L AA+  GL  AG  V D+GLATTPA FM+T    +  DA IM++
Sbjct: 58  AKVAIGHDSRLSAERLKAALVKGLTFAGINVVDVGLATTPAMFMATQYEDYDCDAGIMIT 117

Query: 625 VN 630
            +
Sbjct: 118 AS 119



>pir|AG1308|AG1308 phosphoglucomutases homolog lmo1871 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591981_536362
           Listeria monocytogenes strain EGD, complete genome,
           segment 9/12.
          Length = 503

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 51/122 (41%), Positives = 73/122 (59%)
 Frame = +1

Query: 265 EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES 444
           E + +  LQNGSD+RG+A+  EK + + LT   VE IA  F +W    L+ E+   V   
Sbjct: 5   ETKALEALQNGSDIRGIAIATEKYQ-ITLTDERVEKIAYGFAKW----LKEEK--KVEGQ 57

Query: 445 VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVS 624
            +V++G D R+S + L AA+  GL  AG  V D+GLATTPA FM+T    +  DA IM++
Sbjct: 58  AKVAIGHDSRLSAERLKAALVKGLTFAGIDVVDVGLATTPAMFMATQYEDYDCDAGIMIT 117

Query: 625 VN 630
            +
Sbjct: 118 AS 119



>pir|AG1680|AG1680 phosphoglucomutases homolog lin1985 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596170_539329
           Listeria innocua Clip11262 complete genome, segment
           8/12.
          Length = 503

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 49/122 (40%), Positives = 72/122 (59%)
 Frame = +1

Query: 265 EMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES 444
           E + +  LQNGSD+RG+A+  EK + + LT   VE IA  F +W+    + E  G     
Sbjct: 5   ETKALEALQNGSDIRGIAIATEKYQ-ITLTDERVEKIAYGFAKWLKEEKKVEGQG----- 58

Query: 445 VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVS 624
            +V++G D R+S + L AA+  GL  +G  V D+GLATTPA FM+T    +  DA IM++
Sbjct: 59  -KVAIGHDSRLSAERLKAALIKGLTFSGIDVVDVGLATTPAMFMATQYEDYDCDAGIMIT 117

Query: 625 VN 630
            +
Sbjct: 118 AS 119



>gb:AP004668_1842988 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0475E07.
          Length = 543

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 45/101 (44%), Positives = 63/101 (62%)
 Frame = +1

Query: 283 RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG 462
           +LQNGSD+RGVA+ G +G  V+LT P  EAIA +F  W+++  +++        +R+S+G
Sbjct: 20  KLQNGSDIRGVAVGGVEGEPVNLTEPVTEAIASAFAAWLLNKKKADGW----RRLRISVG 75

Query: 463 MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
            D RIS   L  AV  G+  AG  V   GLA+TPA F ST+
Sbjct: 76  HDSRISAHKLQDAVTLGITTAGHDVLQFGLASTPAMFNSTL 116



>gb:AE016949_364760 Enterococcus faecalis V583, section 3 of 11 of
           the complete genome.>gb:AE016830_991248 Enterococcus
           faecalis V583, complete genome.
          Length = 502

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 43/121 (35%), Positives = 69/121 (57%)
 Frame = +1

Query: 268 MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV 447
           M +++ LQNGSD+RG+AL  E+ ++  LT  AV  IA     W+    +  R     + +
Sbjct: 1   MAELKALQNGSDIRGIALDTEE-QTATLTATAVAEIAVGVVRWLQDKKQLPRKAQ--QRL 57

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
            +++G D R++ + +  A+       G  V D+GLATTPA FM+T  P  Q DA+IM++ 
Sbjct: 58  TIAIGHDSRLTAEPIKQALVDTFLSLGIQVIDVGLATTPAMFMATQFPTLQCDAAIMITA 117

Query: 628 N 630
           +
Sbjct: 118 S 118



>gb:AE013041_288418 Thermoanaerobacter tengcongensis MB4, section 68
           of 244 of the complete genome.>gb:AE008691_1110483
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 455

 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 39/110 (35%), Positives = 58/110 (52%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG+   GE     DLT    E I ++FG +V      ++G   + SV V  G D RIS
Sbjct: 12  DIRGI--WGE-----DLTEETAEVIGKAFGTYV-----KQKG---INSVLV--GRDNRIS 54

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            K +  A+  GL   GC V D+G+ TTPA + S +L  +   A +M++ +
Sbjct: 55  SKPIRDALIKGLTSTGCDVLDVGVLTTPAFYYSNIL--YNSQAGMMITAS 102



>gb:AE016822_340943 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 453

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 38/116 (32%), Positives = 57/116 (49%)
 Frame = +1

Query: 283 RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG 462
           RL     VRG+A       +  LT      +A++    +  G  +E   AV +     + 
Sbjct: 3   RLFGTDGVRGLA-------NGTLTADLALGLAQAAAAVLTRGRSAEARRAVGKRPLAIVA 55

Query: 463 MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            DPR+SG+ LSAAV AGL  +G  V+D G+  TPA   + ++  F  D  +MVS +
Sbjct: 56  RDPRVSGEFLSAAVAAGLASSGIDVYDAGVIPTPAA--AFLIADFDADFGVMVSAS 109



>pir|S72992|S72992 probable phosphorylating protein ureD -
           Mycobacterium leprae>gb:MLEPRTN2_146166 Mycobacterium
           leprae strain TN complete genome; segment
           2/10.>gb:U00020_199023 Mycobacterium leprae cosmid B229.
          Length = 463

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 41/119 (34%), Positives = 54/119 (45%)
 Frame = +1

Query: 283 RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG 462
           RL     VRGVA +       +LTP  V A+  +    + +  E  R  AV+       G
Sbjct: 3   RLFGTDGVRGVANR-------ELTPELVLALGAAAARCLANSGEPGRRVAVI-------G 48

Query: 463 MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
            DPR SG+ L AAV AGL  AG     +G+  TPA    T      YDA   V +++ H
Sbjct: 49  RDPRASGEMLEAAVIAGLTSAGVDALRVGVLPTPAVAYLT----GAYDADFGVMISASH 103



>gb:AP006618_557262 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 458

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 30/80 (37%), Positives = 41/80 (51%)
 Frame = +1

Query: 400 ISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMS 579
           +SG  ++  G         +G DPR SG+ L AAV AGL  AG  V  +G+  TPA    
Sbjct: 26  VSGAAAQVLGRGKTRALALVGRDPRASGEMLEAAVTAGLTAAGVNVLSVGVLPTPAVAYL 85

Query: 580 TVLPPFQYDASIMVSVNSCH 639
           T L    YDA + V +++ H
Sbjct: 86  TGL----YDACLGVMISASH 101



>gb:BX569689_775184 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 462

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 34/92 (36%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +1

Query: 295 GSDVRGVALQGEKGRS-VDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           GS   G    G +GR+  +L+P    A+    G W+   L+++  G V+      +GMD 
Sbjct: 14  GSSAPGFGTDGIRGRAGTELSP----ALCLQVGYWIGRVLKAD--GPVL------IGMDS 61

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           R SG  L AA+ AGL  AG  V+++GL  TPA
Sbjct: 62  RSSGSMLVAALTAGLTAAGRDVWELGLCATPA 93



>gb:AY596297_633831 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 450

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 39/114 (34%), Positives = 54/114 (47%), Gaps = 1/114 (0%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAV-VESVRVSLGMDPRI 477
           D RG    G   R+V +T      I    GE V + L    G A+ ++  RV +G DPR 
Sbjct: 2   DFRG----GPTQRAV-MTQFGTSGIRGPVGETVTAELALSVGRALGIDCERVVVGRDPRA 56

Query: 478 SGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           SG+ L  A+ AGL ++G  V D+G A TP    +        DA   V+V + H
Sbjct: 57  SGEYLQTALVAGLRESGVDVIDLGGAATPTIGRAVA----WQDADAGVAVTASH 106



>gb:AE012040_278820 Xanthomonas axonopodis pv. citri str. 306,
           section 418 of 469 of the complete
           genome.>gb:AE008923_920595 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 467

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 35/114 (30%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWV-ISGLESERGGAVVESVRVSLGMDPRI 477
           D+RGV          DL P     I ++ G  +   GL             V +G D R+
Sbjct: 15  DIRGVV-------GKDLNPGVAALIGQAIGSVMQAQGLRD-----------VVVGRDGRL 56

Query: 478 SGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           SG  LS  +  GL +AGC V D+GLA TP  +       ++  A   V+V   H
Sbjct: 57  SGPELSNGLIEGLRRAGCNVTDIGLAPTPVVYFGA----YELRAGSCVAVTGSH 106



>gb:AE010181_260155 Pyrococcus furiosus DSM 3638, section 56 of 173
           of the complete genome.>gb:AE009950_900936 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 455

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 28/79 (35%), Positives = 42/79 (53%)
 Frame = +1

Query: 346 DLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQA 525
           D+TP     I  +FG   +   E ++   VV      +G D R+SG+ L +A+ +GL   
Sbjct: 17  DITPEFALKIGMAFG--TLLRREGKKKPVVV------VGRDTRVSGEMLKSALISGLLSV 68

Query: 526 GCLVFDMGLATTPACFMST 582
           GC V D+G+A TPA   +T
Sbjct: 69  GCDVIDVGIAPTPAIQWAT 87



>gb:CP000003_860713 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 451

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 31/97 (31%), Positives = 52/97 (53%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E+ER        +V +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFKLGR-FGGYVLSQHETERP-------KVFVARDTRISGEMLESALIAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++   +  A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTEKASAGVMISAS 101



>gb:BA000034_714106 Streptococcus pyogenes SSI-1 DNA, complete
           genome.
          Length = 451

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 31/97 (31%), Positives = 52/97 (53%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E+ER        +V +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFQLGR-FGGYVLSQHETERP-------KVFVARDTRISGEMLESALIAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++   +  A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTEKASAGVMISAS 101



>gb:AP006840_567383 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 447

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 39/113 (34%), Positives = 57/113 (50%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA       + DL+P    A+  +      + L  ER G  V  V   +G D 
Sbjct: 6   GTDGVRGVA------NTEDLSPELAFALGRA-----AATLARERSGGRVVGV---IGRDT 51

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           R SG  L+AA+ AG+  AG  V D+G+ TTP   ++ V    + D  +M+S +
Sbjct: 52  RRSGPMLAAALSAGICSAGGDVVDLGVITTPG--VAYVTTHLKADFGVMISAS 102



>gb:AE014975_313763 Streptococcus mutans UA159 section 123 of 185 of
           the complete genome.>gb:AE014133_940764 Streptococcus
           mutans UA159 complete genome.
          Length = 449

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 32/97 (32%), Positives = 51/97 (52%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E +R        RV +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFKLGR-FGGYVLSQHEPDRP-------RVFVARDTRISGELLESALVAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++   Q  A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTEQASAGVMISAS 101



>gb:AE012804_285748 Chlorobium tepidum TLS section 25 of 194 of the
           complete genome.>gb:AE006470_932916 Chlorobium tepidum
           TLS complete genome.
          Length = 476

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 26/88 (29%), Positives = 46/88 (52%)
 Frame = +1

Query: 319 LQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSA 498
           ++G  G+S  LTP  + A   +F  W+    ++   G++ + + V +G D R +G  ++ 
Sbjct: 10  IRGVVGKS--LTPENLTAFTMAFATWIRRRKQALNPGSLAKPIIV-IGRDSRPTGAVITG 66

Query: 499 AVFAGLGQAGCLVFDMGLATTPACFMST 582
            V   L   GC V D+G+ TTP   ++T
Sbjct: 67  LVSNALSLCGCDVIDVGMTTTPTVEIAT 94



>gb:AE010030_258541 Streptococcus pyogenes strain MGAS8232, section
           78 of 173 of the complete genome.>gb:AE009949_904923
           Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 451

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 31/97 (31%), Positives = 52/97 (53%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E+ER        +V +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFKLGR-FGGYVLSQHETERP-------KVFVARDTRISGEMLESALIAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++   +  A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTEKASAGVMISAS 101



>gb:AE006548_220055 Streptococcus pyogenes M1 GAS, section 77 of 167
           of the complete genome.>gb:AE004092_1105901
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 451

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 31/97 (31%), Positives = 52/97 (53%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E+ER        +V +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFKLGR-FGGYVLSQHETERP-------KVFVARDTRISGEMLESALIAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++   +  A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTEKASAGVMISAS 101



>gb:SAG766847_170431 Streptococcus agalactiae NEM316 complete
           genome, segment 5.>gb:AE014232_306207 Streptococcus
           agalactiae 2603V/R section 42 of 100 of the complete
           genome.>gb:AE009948_936320 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 450

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 31/97 (31%), Positives = 52/97 (53%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E++R        RV +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFKLGR-FGGYVLSQHETDRP-------RVFVARDTRISGEMLESALIAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++   +  A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTEKASAGVMISAS 101



>gb:AE013598_294199 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 796

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 15/109 (13%)
 Frame = +1

Query: 358 PAVEAIAESFGEWVISG------------LESERGGAVVESV---RVSLGMDPRISGKSL 492
           PAV+   E F  + I G            L  +  G+V+++     V +G D R+SG  L
Sbjct: 331 PAVQIATEMFRAYDIRGVVGKDLNPGVAALIGQAIGSVMQAQGLRHVVVGRDGRLSGPEL 390

Query: 493 SAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           +  +  GL +AGC V D+GLA TP  +       ++  A   V+V   H
Sbjct: 391 TNGLIEGLRRAGCNVTDIGLAPTPVVYFGA----YELRAGSCVAVTGSH 435



>gb:AE017242_414952 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 16 of 16 of the complete
           genome.>gb:AE016958_1058356 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 444

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 39/119 (32%), Positives = 51/119 (42%)
 Frame = +1

Query: 283 RLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLG 462
           RL     VRGVA +       +LT     A+  +    + SG    R  AV+       G
Sbjct: 3   RLFGTDGVRGVANR-------ELTAELALALGAAAARQLASGSAPGRRVAVI-------G 48

Query: 463 MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
            DPR SG+ L AAV AGL   G     +G+  TPA    T      YDA   V +++ H
Sbjct: 49  RDPRASGEMLEAAVIAGLTSQGVDALRVGVLPTPAVAYLT----GAYDADFGVMISASH 103



>gb:AB126241_15279 Thermococcus kodakaraensis Tko1621 gene for
           phosphoglucomutase, complete cds.>gb:AP006878_576260
           Thermococcus kodakaraensis strain KOD1 DNA, complete
           genome.
          Length = 456

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 32/93 (34%), Positives = 47/93 (50%)
 Frame = +1

Query: 304 VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISG 483
           VRG+A +       ++TP     I  +FG  +      +R G   E   V +G D R+SG
Sbjct: 10  VRGIANE-------EITPEFALKIGMAFGTLL------KREGR--ERPLVVVGRDTRVSG 54

Query: 484 KSLSAAVFAGLGQAGCLVFDMGLATTPACFMST 582
           + L  A+ +GL   GC V D+G+A TPA   +T
Sbjct: 55  EMLKDALISGLLSTGCDVIDVGIAPTPAIQWAT 87



>pir|H75104|H75104 phosphomannomutase (pmm) PAB0819 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX04_849993 Pyrococcus
           abyssi complete genome; segment 4/6.
          Length = 456

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 34/93 (36%), Positives = 47/93 (50%)
 Frame = +1

Query: 304 VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISG 483
           VRG+A   EK     +TP     I  +FG  +      +R G   E   V +G D R+SG
Sbjct: 10  VRGIA--NEK-----ITPEFTLKIGMAFGTLL------KREGR--EKPLVVVGRDTRVSG 54

Query: 484 KSLSAAVFAGLGQAGCLVFDMGLATTPACFMST 582
           + L  A+ +GL   GC V D+G+A TPA   +T
Sbjct: 55  EMLKEALISGLLSVGCDVIDVGIAPTPAIQWAT 87



>gb:AE017282_429475 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 463

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 30/94 (31%), Positives = 41/94 (43%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG+           LT  A  AI  + G   +   E +          V +  D R+S
Sbjct: 18  DIRGIV-------GDTLTEAAARAIGRAVGSEALDRGERQ----------VVVARDGRLS 60

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMST 582
             +L AA+  GL  AGC V D+GLA TP  +  T
Sbjct: 61  SPALGAALAEGLRMAGCQVTDLGLAPTPVLYFGT 94



>pir|H98048|H98048 phosphoacetylglucosamine mutase (EC 5.4.2.3)
           [imported] - Streptococcus pneumoniae (strain
           R6)>gb:AE008512_237737 Streptococcus pneumoniae R6
           section 128 of 184 of the complete
           genome.>gb:AE007317_943895 Streptococcus pneumoniae R6,
           complete genome.
          Length = 450

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +++LTP     +   FG +V+S  E+E       + +V +G D RISG+ L +A+ AGL 
Sbjct: 15  NLELTPELAFKLGR-FGGYVLSQHETE-------APKVFVGRDTRISGEMLESALVAGLL 66

Query: 520 QAGCLVFDMGLATTPA 567
             G  V+ +G+  TPA
Sbjct: 67  SVGIHVYKLGVLATPA 82



>pir|E95181|E95181 hypothetical protein SP1559 [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007451_226707 Streptococcus pneumoniae TIGR4
           section 134 of 194 of the complete
           genome.>gb:AE005672_1104475 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 450

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +++LTP     +   FG +V+S  E+E       + +V +G D RISG+ L +A+ AGL 
Sbjct: 15  NLELTPELAFKLGR-FGGYVLSQHETE-------APKVFVGRDTRISGEMLESALVAGLL 66

Query: 520 QAGCLVFDMGLATTPA 567
             G  V+ +G+  TPA
Sbjct: 67  SVGIHVYKLGVLATPA 82



>gb:CP000025_879328 Campylobacter jejuni RM1221, complete genome.
          Length = 456

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 21/58 (36%), Positives = 36/58 (62%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVS 624
           VS+G D R S   L   + +GL +AG  ++D+GLA TP  + S +    ++DA++M++
Sbjct: 43  VSVGYDARYSANELFNYLVSGLNKAGIKIYDIGLAPTPLGYFS-LYEGLKFDANVMIT 99



>gb:AE012506_283077 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 414 of 460 of the complete
           genome.>gb:AE008922_916359 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 464

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 33/114 (28%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWV-ISGLESERGGAVVESVRVSLGMDPRI 477
           D+RGV          DL P     I ++ G  +   GL             + +G D R+
Sbjct: 12  DIRGVV-------GKDLNPGIAALIGQAIGSVMQAQGLRD-----------IVVGRDGRL 53

Query: 478 SGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           SG  L+  +  GL +AGC V D+GLA TP  +       ++  A   V+V   H
Sbjct: 54  SGPELTNGLIEGLRRAGCNVTDIGLAPTPVVYFGA----YELRAGSCVAVTGSH 103



>pir|G70976|G70976 probable phosphoglucomutase or
           phosphomannomutasehighly - Mycobacterium tuberculosis
           (strain H37RV)>gb:AE000516_23658 Mycobacterium
           tuberculosis CDC1551, complete
           genome.>gb:BX248346_760827 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           13/14.>gb:BX842583_821548 Mycobacterium tuberculosis
           H37Rv complete genome; segment 12/13.
          Length = 448

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 30/73 (41%), Positives = 36/73 (49%)
 Frame = +1

Query: 421 RGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQ 600
           R GA    V V LG DPR SG+ L AAV AGL   G     +G+  TPA    T      
Sbjct: 36  RSGAPGRRVAV-LGRDPRASGEMLEAAVIAGLTSEGVDALRVGVLPTPAVAYLT----GA 90

Query: 601 YDASIMVSVNSCH 639
           YDA   V +++ H
Sbjct: 91  YDADFGVMISASH 103



>gb:AE016850_348670 Tropheryma whipplei str. Twist, section 1 of 3
           of the complete genome.>gb:BX251410_764362 Tropheryma
           whipplei TW08/27, complete genome; segment
           1/3.>gb:AE014184_1028866 Tropheryma whipplei str. Twist,
           complete genome.
          Length = 453

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +1

Query: 349 LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAG 528
           LTP    A+A +       G  ++R   + +     +  DPRISG  L AA+ AGL  +G
Sbjct: 19  LTPELAMAVARAAAVVFTHGRVAKRRQVLGKRPVAIVARDPRISGDFLVAAISAGLASSG 78

Query: 529 CLVFDMGLATTPA 567
             V D G+  TPA
Sbjct: 79  VDVLDAGVIPTPA 91



>pir|E71082|E71082 probable phospho-sugar mutase 2 - Pyrococcus
           horikoshii>gb:BA000001_649581 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 455

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMST 582
           V +G D R+SG+ L  A+ +GL   GC V D+G+A TPA   +T
Sbjct: 44  VVVGRDTRVSGEMLKEALISGLLSVGCDVIDVGIAPTPAVQWAT 87



>pir|C72408|C72408 phosphoglucomutase/phosphomannomutase family
           protein - Thermotoga maritima (strain
           MSB8)>gb:AE001703_38105 Thermotoga maritima MSB8 section
           15 of 136 of the complete genome.>gb:AE000512_1112578
           Thermotoga maritima MSB8, complete genome.
          Length = 429

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 29/75 (38%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +1

Query: 367 EAIAESFGEWVISGLESERGGAVVESV---RVSLGMDPRISGKSLSAAVFAGLGQAGCLV 537
           + I   FGE +   L  + G A+ E V   +V +G D R+SG SL AA+ AGL   G  V
Sbjct: 9   DGIRGIFGETLTDELAFKVGKALGEIVGEGKVIVGKDTRVSGDSLEAAISAGLTSMGVDV 68

Query: 538 FDMGLATTPACFMST 582
              G+  TPA  + T
Sbjct: 69  LLCGILPTPAVALLT 83



>sp|Q8CNH0|GLMM_STAEP Phosphoglucosamine mutase (EC
           5.4.2.10).>gb:CP000029_82354 Staphylococcus epidermidis
           RP62A, complete genome.>gb:AE016749_323402
           Staphylococcus epidermidis ATCC 12228, section 6 of 9 of
           the complete genome.>gb:AE015929_1148071 Staphylococcus
           epidermidis ATCC 12228, complete genome.
          Length = 451

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 1/120 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA Q       +LTP     +   +G +V++  + E+        RV +G D 
Sbjct: 6   GTDGVRGVANQ-------ELTPELAFKLGR-YGGYVLAHNKGEK------HPRVLVGRDT 51

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCHRLVS 651
           R+SG+ L +A+ AGL   G  V  +G+ +TP     T     + +A++ V +++ H  V+
Sbjct: 52  RVSGEMLESALIAGLISIGAEVMRLGVISTPGVAYLTK----EMEAALGVMISASHNPVA 107



>gb:BA000028_694619 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 446

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 38/113 (33%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA +G       LTP     +   FG +V++  +SER        R+ +G D 
Sbjct: 6   GTDGVRGVANEG-------LTPELAFKLGR-FGGYVLTK-DSERP-------RILIGRDT 49

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           R+SG  L  A+ AGL   G  V  +G+ +TP     T     Q  A +M+S +
Sbjct: 50  RVSGHMLEGALLAGLLSIGAEVMRLGVISTPGVAYLTKATSAQ--AGVMISAS 100



>gb:AE010378_262525 Methanopyrus kandleri AV19 section 77 of 157 of
           the complete genome.>gb:AE009439_903306 Methanopyrus
           kandleri AV19, complete genome.
          Length = 452

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
 Frame = +1

Query: 388 GEWVISGLESERGGAVVESV---RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLAT 558
           GE++   L    G A+ E +    V++G D R+   +L AAV +GL   GC V D+G+  
Sbjct: 15  GEFLTPELALRAGRALGEYLGGGTVAVGRDTRVHCDALRAAVISGLTAQGCDVVDIGVVC 74

Query: 559 TP--ACFMSTVLPPFQYDASIMVSVN 630
           TP   C+++T       DA +M++ +
Sbjct: 75  TPTLGCYVATE----GLDAGVMITAS 96



>gb:CP000033_89004 Lactobacillus acidophilus NCFM, complete genome.
          Length = 452

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 37/113 (32%), Positives = 59/113 (52%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA QG       LTP     +    G +V++  ++++ G   E  +V +  D 
Sbjct: 6   GTDGVRGVANQG-------LTPEMAFKLGRD-GGYVLT--KNKKDG---EQAKVLVSRDT 52

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           RISG+ L  A+ +GL   G  V ++G+ TTP   +S ++     DA I +S +
Sbjct: 53  RISGQMLEYALISGLLSVGIEVLEVGVITTPG--LSYLVRAQGADAGIQISAS 103



>sp|Q88BD4|ALGC_PSESM Phosphomannomutase/phosphoglucomutase (EC
           5.4.2.8) (EC 5.4.2.2) (PMM / PGM).>gb:AE016856_349549
           Pseudomonas syringae pv. tomato str. DC3000 section 1 of
           21 of the complete genome.>gb:AE016853_1034724
           Pseudomonas syringae pv. tomato str. DC3000 complete
           genome.
          Length = 465

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 24/79 (30%), Positives = 36/79 (45%)
 Frame = +1

Query: 337 RSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGL 516
           R+ D+     + +      W+   + SE          VS+G D R+SG  L   +  GL
Sbjct: 17  RAYDIRGVVEDTLNAETAYWIGRAIGSE--SLAQNEPNVSVGRDGRLSGPELVQQLIQGL 74

Query: 517 GQAGCLVFDMGLATTPACF 573
             +GC V D+GL  TPA +
Sbjct: 75  HDSGCHVSDVGLVPTPALY 93



>gb:BA000043_736940 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 469

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 3/99 (3%)
 Frame = +1

Query: 292 NGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWV---ISGLESERGGAVVESVRVSLG 462
           N S  +  A      +  D+   A E + ESF  W+    + +  + G       R  +G
Sbjct: 2   NTSTTKPFAWPAHVFKEYDIRGRAGEELDESFAYWLGRAFADMMQKEG-----EKRAVVG 56

Query: 463 MDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMS 579
            D R+S   L  A+  GL   GC V D+GL+TTP  + S
Sbjct: 57  HDNRLSSPGLHRALKDGLLDGGCDVVDIGLSTTPMFYYS 95



>gb:AY575079_629569 Pseudomonas syringae pv. syringae
           phosphomannomutase (algC) gene, promoter region and
           partial cds.
          Length = 181

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 24/79 (30%), Positives = 36/79 (45%)
 Frame = +1

Query: 337 RSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGL 516
           R+ D+     + +      W+   + SE          VS+G D R+SG  L   +  GL
Sbjct: 17  RAYDIRGVVGDTLNAETAYWIGRAIGSE--SLAQNEPNVSVGRDGRLSGPELVEQLIQGL 74

Query: 517 GQAGCLVFDMGLATTPACF 573
             +GC V D+GL  TPA +
Sbjct: 75  HDSGCHVSDVGLVPTPALY 93



>gb:AE015937_319650 Clostridium tetani E88, section 2 of 10 of the
           complete genome.>gb:AE015927_962439 Clostridium tetani
           E88, complete genome.
          Length = 451

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 31/110 (28%), Positives = 53/110 (48%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG+   GE     ++T    E + ++FG ++I   E           +V +GMD R S
Sbjct: 13  DIRGI--YGE-----EVTENFAELLGKTFGSFLIRKGEK----------KVIVGMDNRKS 55

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             S+  ++  GL   G  V D+G+  TP  + +T L  ++    IMV+ +
Sbjct: 56  SPSIKKSLIKGLTSTGVDVIDIGIVVTPIFYYATYL--YKIKGGIMVTAS 103



>pir|H86677|H86677 phosphoglucosamine mutase [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006279_217326 Lactococcus lactis subsp.
           lactis IL1403 section 41 of 218 of the complete
           genome.>gb:AE005176_1094399 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 452

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 25/75 (33%), Positives = 43/75 (57%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E       + + +V +G D RISG+ L++++ +GL 
Sbjct: 15  NVELTPEMAFKLGR-FGGYVLSQHE-------LGTPKVYVGRDTRISGQMLASSLISGLL 66

Query: 520 QAGCLVFDMGLATTP 564
             G  V+D+G+  TP
Sbjct: 67  SVGIEVYDLGVIATP 81



>sp|Q88C93|ALGC_PSEPK Phosphomannomutase/phosphoglucomutase (EC
           5.4.2.8) (EC 5.4.2.2) (PMM / PGM).>gb:AE016793_334667
           Pseudomonas putida KT2440 section 20 of 21 of the
           complete genome.>gb:AE015451_949744 Pseudomonas putida
           KT2440 complete genome.
          Length = 463

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 20/42 (47%), Positives = 26/42 (61%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
           +VS+G D R+SG  L   +  GL  AGC V D+GL  TPA +
Sbjct: 50  QVSVGRDGRLSGPMLVEQLIKGLVDAGCNVSDVGLVPTPALY 91



>gb:AX283321_1465228 Sequence 1 from Patent WO0179476.
          Length = 307

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 30/97 (30%), Positives = 50/97 (51%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E+ R        +V +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFKLGR-FGGYVLSQHETGRP-------KVFVARDTRISGEMLESALVAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++      A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTENASAGVMISAS 101



>gb:CP000023_875133 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 450

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 30/97 (30%), Positives = 50/97 (51%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V+LTP     +   FG +V+S  E+ R        +V +  D RISG+ L +A+ AGL 
Sbjct: 15  NVELTPELAFKLGR-FGGYVLSQHETGRP-------KVFVARDTRISGEMLESALVAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++      A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTENASAGVMISAS 101



>gb:BA000030_702846 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 452

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 38/98 (38%), Positives = 44/98 (44%), Gaps = 3/98 (3%)
 Frame = +1

Query: 283 RLQNGSDVRGVA---LQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRV 453
           RL     VRGVA   L  E    + +    V A A +F        E  R  AVV     
Sbjct: 3   RLFGTDGVRGVANADLTAELALGLSVAAAHVLAEAGTF--------EGHRPVAVV----- 49

Query: 454 SLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
             G DPR SG+ L AAV AGL  AG  V  +G+  TPA
Sbjct: 50  --GRDPRASGEFLEAAVVAGLASAGVDVLLVGVLPTPA 85



>gb:BA000012_668963 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 450

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 32/91 (35%), Positives = 45/91 (49%)
 Frame = +1

Query: 358 PAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLV 537
           P    IA   G  + +GL  +RG       RV LG D R+SG  +  A+ AGL  AG  V
Sbjct: 19  PMTAEIAMRVG--MAAGLSFQRGS---HRHRVVLGKDTRLSGYMIENAMVAGLCAAGMDV 73

Query: 538 FDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           F +G   TPA  M  ++   + D  +M+S +
Sbjct: 74  FLLGPIPTPAVAM--LVRSLRADIGVMISAS 102



>gb:AE017283_431560 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 450

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 3/119 (2%)
 Frame = +1

Query: 283 RLQNGSDVRGVALQGEKGR-SVDLTPPAVEAIAES--FGEWVISGLESERGGAVVESVRV 453
           RL     VRGVA Q      ++DL+  A   + E+  FG    + L              
Sbjct: 3   RLFGTDGVRGVANQDLTAELALDLSVAAAHVLGEAGAFGHRQPTAL-------------- 48

Query: 454 SLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            +  DPR SG+ L AAV AGL  AG  V  +G+  TPA   + ++  ++ D  +M+S +
Sbjct: 49  -VARDPRASGEFLEAAVCAGLASAGVDVLRVGVIPTPAA--AYLVNEYRTDLGVMLSAS 104



>pir|T35565|T35565 probable phospho-sugar mutase - Streptomyces
           coelicolor>gb:SCO939121_178408 Streptomyces coelicolor
           A3(2) complete genome; segment 18/29.
          Length = 452

 Score = 40.0 bits (92), Expect = 0.046
 Identities = 37/98 (37%), Positives = 43/98 (43%), Gaps = 3/98 (3%)
 Frame = +1

Query: 283 RLQNGSDVRGVA---LQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRV 453
           RL     VRGVA   L  E    + +    V A A +F           R  AVV     
Sbjct: 3   RLFGTDGVRGVANADLTAELALGLSVAAAHVLAEAGTFA--------GHRATAVV----- 49

Query: 454 SLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
             G DPR SG+ L AAV AGL  AG  V  +G+  TPA
Sbjct: 50  --GRDPRASGEFLEAAVVAGLASAGVDVLRVGVLPTPA 85



>gb:AE011004_268333 Methanosarcina acetivorans str. C2A, section 349
           of 534 of the complete genome.>gb:AE010299_908892
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 437

 Score = 39.7 bits (91), Expect = 0.061
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +1

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           +G DPR+S   +  A+ AGL  AGC V  +G+ TTP    +      +Y+  +MV+ +
Sbjct: 41  IGRDPRVSAPMIEHALVAGLTAAGCDVTKVGMVTTP----TLAYAAREYECGVMVTAS 94



>gb:CP000046_92243 Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:SAARGFEMD_169343 Staphylococcus aureus argI,
           glmM genes and ORF1 and ORF2.>gb:SAFEMD_169473 S.aureus
           femD gene.>gb:SAURED_172836 Staphylococcus aureus glmM
           gene cluster.
          Length = 451

 Score = 39.7 bits (91), Expect = 0.061
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA Q       +LTP     +   +G +V++  + E+        RV +G D 
Sbjct: 6   GTDGVRGVANQ-------ELTPELAFKLGR-YGGYVLAHNKGEK------HPRVLVGRDT 51

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTP 564
           R+SG+ L +A+ AGL   G  V  +G+ +TP
Sbjct: 52  RVSGEMLESALIAGLISIGAEVMRLGIISTP 82



>sp|Q99QR5|GLMM_STAAM Phosphoglucosamine mutase (EC
           5.4.2.10).>pir|E90011|E90011 phosphoglucosamine-mutase
           [imported] - Staphylococcus aureus (strain
           N315)>gb:BA000017_677846 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_680436
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.>gb:BA000033_712380 Staphylococcus
           aureus subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_781675 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_784291 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 451

 Score = 39.7 bits (91), Expect = 0.061
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA Q       +LTP     +   +G +V++  + E+        RV +G D 
Sbjct: 6   GTDGVRGVANQ-------ELTPELAFKLGR-YGGYVLAHNKGEK------HPRVLVGRDT 51

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTP 564
           R+SG+ L +A+ AGL   G  V  +G+ +TP
Sbjct: 52  RVSGEMLESALIAGLISIGAEVMRLGIISTP 82



>gb:AX763200_1474339 Sequence 17 from Patent WO03040291.
          Length = 456

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = +1

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           +G DPR+SG+ L+AA+ AG+   G  V  +G+  TPA  ++ +   +  D  +M+S +
Sbjct: 58  VGRDPRVSGEMLAAALSAGMASQGVDVIRVGVIPTPA--VAFLTDDYGADMGVMISAS 113



>gb:BA000036_718310 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927149_832167 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 2/10.
          Length = 447

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 20/58 (34%), Positives = 35/58 (60%)
 Frame = +1

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           +G DPR+SG+ L+AA+ AG+   G  V  +G+  TPA  ++ +   +  D  +M+S +
Sbjct: 49  VGRDPRVSGEMLAAALSAGMASQGVDVIRVGVIPTPA--VAFLTDDYGADMGVMISAS 104



>gb:AL935254_550751 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 3/11.
          Length = 451

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 35/113 (30%), Positives = 54/113 (47%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRG+A  G       LTP     +  + G  +    E++         RV +  D 
Sbjct: 5   GTDGVRGIANSG-------LTPEMAFRLGRAGGYVLTEHAENKS-----TQPRVLVARDT 52

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           RISG+ L  A+ AGL  AG  V  +G+ TTP   ++ ++     DA +M+S +
Sbjct: 53  RISGQMLEEALIAGLLSAGIEVLRLGVITTPG--VAYLVRIQDADAGVMISAS 103



>gb:AL646060_545619 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 4/19.
          Length = 461

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 34/113 (30%), Positives = 49/113 (43%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG+      G++VD        I  +FG    S   ++   AVV      +G D R+S
Sbjct: 12  DIRGIV-----GKNVDRE--TARLIGRAFG----SAARAKGEAAVV------IGRDGRLS 54

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           G  L   +  GL Q+G  V D+GL  TP  +  T +      A+  V V   H
Sbjct: 55  GPDLVGGLAEGLRQSGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSH 107



>gb:AE013165_289773 Thermoanaerobacter tengcongensis MB4, section
           192 of 244 of the complete genome.>gb:AE008691_1111838
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 447

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 23/61 (37%), Positives = 33/61 (54%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RIS   L  A+ AGL   G  V  +G+  TPA    T L  ++ DA +M+S 
Sbjct: 42  KVVVGKDSRISSDMLECALIAGLTSLGAEVVSVGIIPTPAVAYLTRL--YKADAGVMISA 99

Query: 628 N 630
           +
Sbjct: 100 S 100



>gb:AE012553_283567 Xylella fastidiosa Temecula1, section 1 of 9 of
           the complete genome.>gb:AE009442_960143 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 467

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +1

Query: 373 IAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGL 552
           +A+  G+ + S ++++    +V      +G D R+S   LSAA+  GL  AGC V D+GL
Sbjct: 27  VAKLIGQAIGSAMQAKGLSDIV------IGRDGRVSSSELSAALSDGLRHAGCNVVDIGL 80

Query: 553 ATTPACFMS 579
              P  + +
Sbjct: 81  VPIPVVYFA 89



>pir|F82840|F82840 phosphomannomutase XF0151 [imported] - Xylella
           fastidiosa  (strain 9a5c)>gb:AE003869_47793 Xylella
           fastidiosa 9a5c, section 15 of 229 of the complete
           genome.>gb:AE003849_1115003 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 467

 Score = 39.3 bits (90), Expect = 0.079
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +1

Query: 346 DLTPPAVEAIAESFGEWV-ISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQ 522
           +L P   + I ++ G  + + GL             + +G D R+S   LSAA+  GL  
Sbjct: 22  ELNPGVAKLIGQAIGSAIQVKGLSD-----------IVIGRDDRVSSFELSAALSDGLRH 70

Query: 523 AGCLVFDMGLATTPACFMS 579
           AGC V D+GL   P  + +
Sbjct: 71  AGCNVVDIGLVPIPVVYFA 89



>gb:CP000024_877043 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 450

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 30/97 (30%), Positives = 49/97 (50%)
 Frame = +1

Query: 340 SVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLG 519
           +V LTP     +   FG +V+S  E+ R        +V +  D RISG+ L +A+ AGL 
Sbjct: 15  NVGLTPELAFKLGR-FGGYVLSQHETGRP-------KVFVARDTRISGEMLESALVAGLL 66

Query: 520 QAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             G  V+ +G+  TP   +S ++      A +M+S +
Sbjct: 67  SVGIEVYKLGVLATPG--VSYLVRTENASAGVMISAS 101



>gb:AE010381_262552 Methanopyrus kandleri AV19 section 80 of 157 of
           the complete genome.>gb:AE009439_903333 Methanopyrus
           kandleri AV19, complete genome.
          Length = 456

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 32/88 (36%), Positives = 42/88 (47%)
 Frame = +1

Query: 304 VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISG 483
           VRGV   GE     DLT      +  +FG ++        GG       V +G D R S 
Sbjct: 10  VRGVV--GE-----DLTEDVARRLGLAFGTYL--------GG----DAEVLVGGDTRTST 50

Query: 484 KSLSAAVFAGLGQAGCLVFDMGLATTPA 567
            +L  A+ +GL  AGC V D+G+A TPA
Sbjct: 51  DTLKDALISGLTAAGCDVVDVGIAPTPA 78



>gb:CP000010_866371 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 472

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 30/97 (30%), Positives = 46/97 (47%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RGV      G+++D        +A S G    S + ++ G AVV      +  D R+S
Sbjct: 19  DIRGVI-----GKTLDAD------VARSIGRAFGSEVRAQGGDAVV------VARDGRLS 61

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLP 591
           G  L  A+  GL  AG  V D+G+  TP  + +  +P
Sbjct: 62  GPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVP 98



>gb:BX571965_792462 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 464

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 30/97 (30%), Positives = 46/97 (47%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RGV      G+++D        +A S G    S + ++ G AVV      +  D R+S
Sbjct: 11  DIRGVI-----GKTLDAD------VARSIGRAFGSEVRAQGGDAVV------VARDGRLS 53

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLP 591
           G  L  A+  GL  AG  V D+G+  TP  + +  +P
Sbjct: 54  GPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVP 90



>gb:BX248355_761856 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 2/8.
          Length = 447

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSC 636
           +G DPR+SG+ L+AA+ AG+   G  V  +G+  TPA    T      Y A + V +++ 
Sbjct: 49  VGRDPRVSGEMLAAALSAGMASRGVDVLRVGVLPTPAVAYLTDF----YGADMGVVISAS 104

Query: 637 H 639
           H
Sbjct: 105 H 105



>gb:AE013255_290631 Methanosarcina mazei strain Goe1, section 37 of
           379 of the complete genome.>gb:AE008384_964740
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 444

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +1

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           +G DPR+S   +  A+ AGL  AGC V   G+ TTP    +      +Y+  +MV+ +
Sbjct: 48  IGRDPRVSAPMIEHALVAGLTAAGCDVTKAGMVTTP----TLAYAARKYECGVMVTAS 101



>gb:BX640430_810598 Bordetella parapertussis strain 12822, complete
           genome; segment 8/14.>gb:BX640442_814451 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           6/16.
          Length = 475

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 22/61 (36%), Positives = 32/61 (52%)
 Frame = +1

Query: 406 GLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           GL   R      +  V +G D  +S  +L+AA+ AG+  AG  V D+G  TTP  + +T 
Sbjct: 44  GLTLGRRAVATHAGAVVVGRDATLSSVALAAALQAGIRAAGTHVIDIGRVTTPMMYYATR 103

Query: 586 L 588
           L
Sbjct: 104 L 104



>gb:BX640416_806378 Bordetella pertussis strain Tohama I, complete
           genome; segment 6/12.
          Length = 475

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 22/61 (36%), Positives = 32/61 (52%)
 Frame = +1

Query: 406 GLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           GL   R      +  V +G D  +S  +L+AA+ AG+  AG  V D+G  TTP  + +T 
Sbjct: 44  GLTLGRRAVATHAGAVVVGRDATLSSVALAAALQAGIRAAGTHVIDIGRVTTPMMYYATR 103

Query: 586 L 588
           L
Sbjct: 104 L 104



>gb:BX321862_774223 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 7/10.
          Length = 458

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 26/91 (28%), Positives = 42/91 (46%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG+           LTP  VE I  + G         ER     +   +++G D R+S
Sbjct: 13  DIRGIV-------ETALTPATVELIGHAIGSEA-----RER-----QLTTIAIGRDGRLS 55

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
           G  L+ A+  G+ ++G  V D+G+  TP  +
Sbjct: 56  GPELAQALTNGIRKSGIDVIDVGMVPTPVLY 86



>gb:AE017264_421392 Bacillus cereus ATCC 10987, section 1 of 18 of
           the complete genome.>gb:AE017194_1059811 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 448

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA Q       +LTP     I   FG +V++  +++R        +V +G D 
Sbjct: 6   GTDGVRGVANQ-------ELTPELAFKIGR-FGGYVLTK-DTDRP-------KVIIGRDT 49

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           RISG  L  A+ AGL   G  V  +G+ +TP   ++ +       A +M+S +
Sbjct: 50  RISGHMLEGALVAGLLSTGAEVMRLGVISTPG--VAYLTKALDAQAGVMISAS 100



>gb:AE017202_404104 Lactobacillus johnsonii NCC 533, section 3 of 7
           of the complete genome.>gb:AE017198_1122591
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 455

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 1/122 (0%)
 Frame = +1

Query: 268 MEKIRRLQNGSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVES 444
           M KI     G+D VRGVA  G       LTP     +    G +V++  + ++ G   E 
Sbjct: 1   MLKIMLKYFGTDGVRGVANAG-------LTPEMAFKLGRD-GGYVLT--KDKKDG---ER 47

Query: 445 VRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVS 624
            +V +  D RISG+ L  A+ +GL   G  V ++G+ TTP   +S ++     DA + +S
Sbjct: 48  AKVLVSRDTRISGQMLEYALISGLLSVGIEVLEVGVITTPG--LSYLVRAQGADAGVQIS 105

Query: 625 VN 630
            +
Sbjct: 106 AS 107



>gb:CP000002_855951 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 448

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA       + +LTP     +   FG +V++  +        E  +V +G D 
Sbjct: 6   GTDGVRGVA-------NSELTPELAFKVGR-FGGYVLTKDK--------ERPKVLIGRDT 49

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           RISG  L  A+ AGL   G  V  +G+ +TP   ++ +      +A +M+S +
Sbjct: 50  RISGHMLEGALVAGLLSIGAEVMRLGVISTPG--VAYLTKAMDAEAGVMISAS 100



>gb:BA000035_715373 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 462

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 19/58 (32%), Positives = 34/58 (58%)
 Frame = +1

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           +G DPR+SG+ L+AA+ AG+   G  V  +G+  TP   ++ +   +  D  +M+S +
Sbjct: 64  VGRDPRVSGEMLAAALAAGMASRGVDVLRVGVIPTPG--VAFLTDDYGADMGVMISAS 119



>gb:AE017333_446129 Bacillus licheniformis DSM 13, complete genome.
          Length = 456

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA       + +LTP     +   FG +V++  +        E  +V +G D 
Sbjct: 14  GTDGVRGVA-------NSELTPELAFKVGR-FGGYVLTKDK--------ERPKVLIGRDT 57

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           RISG  L  A+ AGL   G  V  +G+ +TP   ++ +      +A +M+S +
Sbjct: 58  RISGHMLEGALVAGLLSIGAEVMRLGVISTPG--VAYLTKAMDAEAGVMISAS 108



>pir|B69745|B69745 phosphoglucomutase (glycolysis) homolog ybbT -
           Bacillus subtilis>gb:BSUB0001_752142 Bacillus subtilis
           complete genome (section 1 of 21): from 1 to 213080.
          Length = 448

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 34/113 (30%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA       + +LTP     +   FG +V++  +        +  +V +G D 
Sbjct: 6   GTDGVRGVA-------NSELTPELAFKVGR-FGGYVLTKDK--------QRPKVLIGRDT 49

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           RISG  L  A+ AGL   G  V  +G+ +TP   +S +      +A +M+S +
Sbjct: 50  RISGHMLEGALVAGLLSIGAEVMRLGVISTPG--VSYLTKAMDAEAGVMISAS 100



>sp|P40390|PGMU_NEIGO Phosphoglucomutase (EC 5.4.2.2) (Glucose
           phosphomutase) (PGM).>pir|A53614|A53614
           phosphoglucomutase (EC 5.4.2.2) - Neisseria gonorrhoeae 
           (strain 1291)>gb:NGOPHOSPHO_152510 Neisseria gonorrhoeae
           phosphoglucomutoase (pgm) gene, complete
           cds.>gb:NGU02489_152676 Neisseria gonorrhoeae strain
           1291 phosphoglucomutase (pgm) gene, complete cds.
          Length = 460

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           R++LG D R+SG  L   +  GL  +G  V ++G+ TTP  + + V
Sbjct: 45  RIALGRDGRLSGPELMEHIQRGLTDSGISVLNVGMVTTPMLYFAAV 90



>gb:BA000011_665061 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 447

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 24/97 (24%), Positives = 44/97 (45%)
 Frame = +1

Query: 277 IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS 456
           + RL   + +RG+        + D++P    ++ ++ G +V              S  ++
Sbjct: 3   VERLFGTNGIRGIP-------NDDMSPDFAMSVGKAIGTYV--------------SGEIA 41

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
            G D R++G  +  AV AG+   G  V D+G+  TPA
Sbjct: 42  FGTDTRLTGDMIKNAVIAGILSTGISVIDLGVLPTPA 78



>gb:TACID2_196338 Thermoplasma acidophilum complete genome; segment
           2/5.
          Length = 453

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 17/39 (43%), Positives = 26/39 (66%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           V++G D RISG  ++++V AGL   G  + D+G+  TPA
Sbjct: 46  VAVGRDTRISGDMIASSVLAGLMATGHNIIDLGILPTPA 84



>gb:AB006424_905 Bacillus subtilis genomic DNA, 70 kb region between
           17 and 23 degree.
          Length = 448

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 32/109 (29%), Positives = 52/109 (47%)
 Frame = +1

Query: 304 VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISG 483
           VRGVA       + +LTP     +   FG +V++  +        +  +V +G D RISG
Sbjct: 10  VRGVA-------NSELTPELAFKVGR-FGGYVLTKDK--------QRPKVLIGRDTRISG 53

Query: 484 KSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
             L  A+ AGL   G  V  +G+ +TP   +S +      +A +M+S +
Sbjct: 54  HMLEGALVAGLLSIGAEVMRLGVISTPG--VSYLTKAMDAEAGVMISAS 100



>pir|G22845|G22845 hypothetical protein 7 - Trypanosoma brucei
           mitochondrion
          Length = 129

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 2/71 (2%)
 Frame = +1

Query: 46  PNFPQKSFTMASTSTTPQSLQTIAS--KPNFPSFPIHKPLHRSLGIAQSFPKIKLSLRVE 219
           P  P K  T + T T   +  +I+S  KPNFP  P   P +    I QS P +K      
Sbjct: 48  PLLPTKPHTFSPTKTPQSNSPSISSSSKPNFPKSPFLSPTNPPFLIDQSQPNLKPLFNKY 107

Query: 220 SSLTANKHNEV 252
           + +T N   E+
Sbjct: 108 TKITINYKKEI 118



>pir|F98271|F98271 mrsA protein [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>pir|AI3012|AI3012
           phosphoglucomutase/phosphomannomutase [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE008312_235638 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 116 of 187 of the
           complete sequence.>gb:AE009302_250546 Agrobacterium
           tumefaciens str. C58 linear chromosome, section 72 of
           187 of the complete sequence.>gb:AE007870_1080751
           Agrobacterium tumefaciens str. C58 linear chromosome,
           complete sequence.>gb:AE008689_1088389 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 458

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 24/61 (39%), Positives = 32/61 (52%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           RV +G D R+SG  L  A+ AG   AG  VF +G   TPA  M T     + D  +M+S 
Sbjct: 52  RVVIGKDTRLSGYMLENALVAGFTAAGLDVFLLGPIPTPAVAMLT--RSLRADIGVMISA 109

Query: 628 N 630
           +
Sbjct: 110 S 110



>pir|C64679|C64679 phosphomannomutase - Helicobacter pylori (strain
           26695)>gb:AE000631_25439 Helicobacter pylori 26695
           section 109 of 134 of the complete
           genome.>gb:AE000511_880878 Helicobacter pylori 26695
           complete genome.
          Length = 459

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 2/60 (3%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV--LPPFQYDASIMVS 624
           V +G D R+ G+ L  A+ AGL  +G  V+D+GL  TP  + +    +   Q   SIM++
Sbjct: 42  VFVGHDARVHGRFLFEALSAGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMIT 101



>pir|E96959|E96959 phosphomannomutase [imported] - Clostridium
           acetobutylicum>gb:AE007563_227825 Clostridium
           acetobutylicum ATCC 824 section 51 of 356 of the
           complete genome.>gb:AE001437_1090780 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 448

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           ++ +GMD RISG  L AA+ +G+   G     +G+  TPA  ++ +   ++ DA +++S 
Sbjct: 42  KILVGMDTRISGDMLEAALVSGILSVGAEAVCVGIVPTPA--VAYLTRKYKADAGVVISA 99

Query: 628 N 630
           +
Sbjct: 100 S 100



>pir|A99162|A99162 phosphomannomutase (pmM) [imported] - Sulfolobus
           solfataricus>gb:AE006658_221150 Sulfolobus solfataricus
           P2 section 17 of 272 of the complete
           genome.>gb:AE006641_1106998 Sulfolobus solfataricus P2,
           complete genome.
          Length = 455

 Score = 37.4 bits (85), Expect = 0.30
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = +1

Query: 439 ESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIM 618
           +  R+ +G D R  G  L  AV +GL  +G LV++ G+A TPA      +    YD  ++
Sbjct: 36  KGARILIGRDVRAGGDMLLKAVESGLLSSGVLVYEAGMAPTPA--FQYGVKALGYDGGVI 93

Query: 619 VSVN 630
           ++ +
Sbjct: 94  ITAS 97



>gb:AE017024_380451 Bacillus anthracis str. Ames section 1 of 18 of
           the complete genome.>gb:AE017225_405570 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_450300 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_461483 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_850786 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1010156 Bacillus anthracis str. Ames
           complete genome.
          Length = 448

 Score = 37.0 bits (84), Expect = 0.39
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA       + +LTP     I   FG +V++  +++R        +V +G D 
Sbjct: 6   GTDGVRGVA-------NKELTPELAFKIGR-FGGYVLTK-DTDRP-------KVIIGRDT 49

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           RISG  L  A+ AGL   G  V  +G+ +TP   ++ +       A +M+S +
Sbjct: 50  RISGHMLEGALVAGLLSTGAEVMRLGVISTPG--VAYLTKALDAQAGVMISAS 100



>gb:AE010962_267979 Methanosarcina acetivorans str. C2A, section 307
           of 534 of the complete genome.>gb:AE010299_908538
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 491

 Score = 37.0 bits (84), Expect = 0.39
 Identities = 25/73 (34%), Positives = 36/73 (49%)
 Frame = +1

Query: 349 LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAG 528
           +TP     +A S G ++     S +G        V++G D RISG+ L +A  AG    G
Sbjct: 56  ITPELSVNLARSLGTYM-----SSKG-------TVAIGCDTRISGQMLKSAAIAGALSTG 103

Query: 529 CLVFDMGLATTPA 567
             V D+G A TP+
Sbjct: 104 LNVIDVGSAPTPS 116



>pir|A40013|A40013 phosphomannomutase (EC 5.4.2.8) [validated] -
           Pseudomonas aeruginosa>gb:PSEALGC_160299 Pseudomonas
           aeruginosa phosphomannomutase (algC) gene, complete cds.
          Length = 463

 Score = 37.0 bits (84), Expect = 0.39
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 3/95 (3%)
 Frame = +1

Query: 298 SDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESE---RGGAVVESVRVSLGMD 468
           S V+   L     R+ D+     + +      W+   + SE   RG   V     ++G D
Sbjct: 2   STVKAPTLPASIFRAYDIRRVVGDTLTAETAYWIGRAIGSESLARGEPCV-----AVGRD 56

Query: 469 PRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
            R+SG  L   +  GL   GC V D+G+  TP  +
Sbjct: 57  GRLSGPELVKQLIQGLVDCGCQVSDVGMVPTPVLY 91



>gb:BX842646_823067 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 1/11.
          Length = 455

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           V+LG D R S  ++   +  GL  +G  V  +GL TTP C+ +T    F+      V V 
Sbjct: 47  VALGCDARESSPAIIKNLAKGLMDSGAKVIHLGLVTTPVCYFAT----FELKVDGAVQVT 102

Query: 631 SCH 639
             H
Sbjct: 103 GSH 105



>gb:BX572603_802934 Rhodopseudomonas palustris CGA009 complete
           genome; segment 11/16.
          Length = 498

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +1

Query: 460 GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           G D R    S+  A+ AGL  +GC V D+GLA TP  + +     F+ D   +  V + H
Sbjct: 68  GHDFRGYSASIKYALIAGLMASGCKVHDIGLAVTPMAYFA----QFELDVPCVAMVTASH 123



>gb:BX572100_799165 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 468

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 19/39 (48%), Positives = 26/39 (66%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           V +GMD R SG  +++A+ AGL  AG  V+ +GL  TPA
Sbjct: 55  VLIGMDSRSSGAMVASALTAGLTAAGREVWTLGLCPTPA 93



>gb:AE016998_375213 Bacillus cereus ATCC 14579 section 1 of 18 of
           the complete genome.>gb:AE016877_1015463 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 448

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 1/113 (0%)
 Frame = +1

Query: 295 GSD-VRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+D VRGVA       + +LTP     I   FG +V++  +++R        +V +G D 
Sbjct: 6   GTDGVRGVA-------NKELTPELAFKIGR-FGGYVLTK-DTDRP-------KVIIGRDT 49

Query: 472 RISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           R+SG  L  A+ AGL   G  V  +G+ +TP   ++ +       A +M+S +
Sbjct: 50  RVSGHMLEGALVAGLLSTGAEVMRLGVISTPG--VAYLTKALDAQAGVMISAS 100



>gb:AE016917_357133 Chromobacterium violaceum ATCC 12472 section 8
           of 16 of the complete genome.>gb:AE016825_1042287
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 458

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = +1

Query: 370 AIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMG 549
           A+A   G+ V S     +  A+V      +G D R+SG  LS A+  G+  AG  V D+G
Sbjct: 25  AVARQIGQAVASEAIDRKVKAIV------IGRDGRLSGPELSEALAEGIRAAGVDVIDVG 78

Query: 550 LATTPACFMS 579
              TP  + +
Sbjct: 79  RVATPMLYFA 88



>gb:AE015563_315608 Shewanella oneidensis MR-1 section 112 of 457 of
           the complete genome.>gb:AE014299_951205 Shewanella
           oneidensis MR-1 complete genome.
          Length = 445

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG    +A+ AGL  AG  V  MG   TPA  ++ +   F+ +A +++S 
Sbjct: 44  KVIIGKDTRISGYMFESALEAGLSAAGLNVMLMGPMPTPA--VAYLTRTFRAEAGVVISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>pir|C83683|C83683 phosphoglucosamine mutase BH0267 [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_654213
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 447

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = +1

Query: 439 ESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIM 618
           E+ +V +G D RISG+ L  A+ AGL   G  V  +G+ +TP   ++ +       A +M
Sbjct: 39  ENPKVLIGRDTRISGEMLEGALVAGLLSIGVEVMRLGVISTPG--VAFLTKAVSASAGVM 96

Query: 619 VSVN 630
           +S +
Sbjct: 97  ISAS 100



>gb:BX842651_824812 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 6/11.
          Length = 457

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 31/99 (31%), Positives = 45/99 (45%)
 Frame = +1

Query: 268 MEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESV 447
           MEK  RL     +RG A Q        +TP  V  I ++ G   +   E+E   + V   
Sbjct: 1   MEKKTRLFGTDGIRGTANQ------YPMTPDMVVKIGQAIG--YLLRKEAEEKSSSVR-- 50

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTP 564
           +V +G D R+SG  +  A+ +GL   G  V  +G   TP
Sbjct: 51  KVVIGKDTRLSGYMIEQALASGLNSMGVFVQLVGPLPTP 89



>gb:AP006627_562570 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 446

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG+ L A++ AGL   G  V  +G+ +TP   ++ +       A IM+S 
Sbjct: 42  KVLIGRDTRISGEMLEASLVAGLLSIGAEVMRLGVISTPG--VAFLTKQLSATAGIMISA 99

Query: 628 N 630
           +
Sbjct: 100 S 100



>gb:AF214113_488911 Sphingomonas sp. S7 phosphoglucomutase gene,
           complete cds.
          Length = 462

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
           RV++G D RIS   L AA+  GL  +GC V   G+  TP  +
Sbjct: 46  RVAVGRDGRISSPMLEAALIEGLTASGCDVVRTGMGPTPMLY 87



>gb:AE017329_444571 Listeria monocytogenes str. 4b F2365, section 8
           of 10 of the complete genome.>gb:AE017262_1076927
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 450

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 23/66 (34%), Positives = 36/66 (54%)
 Frame = +1

Query: 433 VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS 612
           V E  RV +  D RISG+ L +A+ AGL   G  V  +G+ +TP   ++ +       AS
Sbjct: 38  VGEHPRVLVARDTRISGEMLESALIAGLVSVGIEVMRLGVISTPG--VAYLTKAQGASAS 95

Query: 613 IMVSVN 630
           +M+S +
Sbjct: 96  VMISAS 101



>gb:AE017313_439533 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 5 of 12 of the complete
           genome.>gb:AE017285_1072694 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 450

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           RV +G D R+SG    +A+ AGL  AG  VF +G   TPA  +S +    + D  +++S 
Sbjct: 44  RVVIGKDTRLSGYMFESALTAGLCAAGMDVFQVGPLPTPA--ISFLTRNMRADLGVVISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>gb:AE016791_334102 Pseudomonas putida KT2440 section 18 of 21 of
           the complete genome.>gb:AE015451_949179 Pseudomonas
           putida KT2440 complete genome.
          Length = 446

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 23/61 (37%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           RV +G D RISG    +A+ AGL  AG  V  +G   TPA  ++ +   F  +A I++S 
Sbjct: 43  RVLVGKDTRISGYMFESALEAGLSAAGADVMLLGPMPTPA--IAYLTRTFHAEAGIVISA 100

Query: 628 N 630
           +
Sbjct: 101 S 101



>gb:AE014295_311567 Bifidobacterium longum NCC2705, complete genome.
          Length = 461

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA-CFMSTVL 588
           R  +G D R+SG  L++A+ AG+   G  V D G+  TP   F+++VL
Sbjct: 49  RALVGRDTRVSGDFLASALSAGMAAGGFDVIDAGIIPTPGIAFLTSVL 96



>gb:AE010201_260428 Pyrococcus furiosus DSM 3638, section 76 of 173
           of the complete genome.>gb:AE009950_901209 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 452

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = +1

Query: 427 GAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYD 606
           G  +   RV +G+D R S + +  A+ +GL   G  V D+GLA TP    +  L    Y+
Sbjct: 31  GTYLGEGRVVVGIDTRTSSEMIKHALVSGLLATGIEVVDIGLAPTPLTGFAIKL----YN 86

Query: 607 ASIMVSVNSCH 639
           A   V++ + H
Sbjct: 87  ADAGVTITASH 97



>gb:AE008692_240077 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.>gb:AF180145_486071 Zymomonas mobilis GTP-binding
           protein CgpA (cgpA), 60KD inner-membrane protein yidC
           (yidC), hypothetical protein, glutamine-pyruvate
           aminotransferase gltB (gltB), glutamate synthase small
           subunit gltS (gltS), undecaprenol kinase udk (udk),
           hypothetical protein, NADH dehydrogenase, hypothetical
           protein; zm12orf5, hypothetical protein, aspartate
           aminotransferase A, beta-hydroxysteroid dehydrogenase,
           phosphomannomutase pmm (pmm), thiamine-phosphate
           pyrophosphorylase, hypothetical protein, hypothetical
           protein, elongation factor P efp (efp),
           cystathionine-gamma-lyase, hypothetical protein,
           isoleucyl-tRNA synthetase, riboflavin kinase ribF
           (ribF), and dihydrofolate reductase typeIII genes,
           complete cds; tRNA-Pro gene, complete sequence;
           3-oxoacyl-(acyl carrier ptn) reductase gene, partial
           cds; and unknown genes.
          Length = 459

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 17/44 (38%), Positives = 28/44 (63%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMS 579
           R+++G D R S  +L  A+  GL +AG  V ++GLA+TP  + +
Sbjct: 46  RIAVGYDGRTSSPALKDALIKGLTEAGVDVVNIGLASTPMLYFA 89



>gb:MTU51624_151550 Methanobacterium thermoautotrophicum putative
           DNA ligase (lig) gene, complete cds.
          Length = 174

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 19/47 (40%), Positives = 29/47 (61%)
 Frame = +1

Query: 427 GAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           G+ VE  ++++G D R S   +  AV +GL  +GC V D+G+  TPA
Sbjct: 31  GSTVEG-KIAVGGDTRTSTVMIKNAVISGLLSSGCDVVDLGILPTPA 76



>gb:AE004969_60148 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 460

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           R+++G D R+SG  L   +  GL  +G  V ++G+ TTP  + + V
Sbjct: 45  RIAIGRDGRLSGPELMEHIQRGLTDSGIGVLNVGMVTTPMLYFAAV 90



>pir|AD1710|AD1710 phosphoglucomutase homolog lin2223 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596171_539566
           Listeria innocua Clip11262 complete genome, segment
           9/12.
          Length = 450

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 23/66 (34%), Positives = 36/66 (54%)
 Frame = +1

Query: 433 VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS 612
           V E  RV +  D RISG+ L +A+ AGL   G  V  +G+ +TP   ++ +       AS
Sbjct: 38  VGEHPRVLVARDTRISGEMLESALIAGLVSVGIEVMRLGVISTPG--VAYLTKAQGASAS 95

Query: 613 IMVSVN 630
           +M+S +
Sbjct: 96  VMISAS 101



>pir|AF1339|AF1339 phosphoglucomutase homolog lmo2118 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591982_536609
           Listeria monocytogenes strain EGD, complete genome,
           segment 10/12.
          Length = 450

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 23/66 (34%), Positives = 36/66 (54%)
 Frame = +1

Query: 433 VVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDAS 612
           V E  RV +  D RISG+ L +A+ AGL   G  V  +G+ +TP   ++ +       AS
Sbjct: 38  VGEHPRVLVARDTRISGEMLESALIAGLVSVGIEVMRLGVISTPG--VAYLTKAQGASAS 95

Query: 613 IMVSVN 630
           +M+S +
Sbjct: 96  VMISAS 101



>pir|A71840|A71840 phosphohexosemutase - Helicobacter pylori (strain
           J99)>gb:AE001545_36187 Helicobacter pylori, strain J99
           section 106 of 132 of the complete
           genome.>gb:AE001439_884957 Helicobacter pylori, strain
           J99 complete genome.
          Length = 459

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV--LPPFQYDASIMVS 624
           V +G D R+ G+ L   + AGL  +G  V+D+GL  TP  + +    +   Q   SIM++
Sbjct: 42  VFVGHDARVHGRFLFEVLSAGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMIT 101



>pir|D69078|D69078 probable phosphomannomutase 2 - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000918_29253
           Methanobacterium thermoautotrophicum from bases 1444576
           to 1460617 (section 124 of 148) of the complete
           genome.>gb:AE000666_926335 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 455

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 19/47 (40%), Positives = 29/47 (61%)
 Frame = +1

Query: 427 GAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           G+ VE  ++++G D R S   +  AV +GL  +GC V D+G+  TPA
Sbjct: 31  GSTVEG-KIAVGGDTRTSTVMIKNAVISGLLSSGCDVVDLGILPTPA 76



>pir|B69307|B69307 phosphomannomutase (pmm) homolog - Archaeoglobus
           fulgidus>gb:AE001073_31446 Archaeoglobus fulgidus DSM
           4304 section 34 of 172 of the complete
           genome.>gb:AE000782_974353 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 446

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           ++++  D RIS   L +AV AG+   G  V D+G+A TPA
Sbjct: 42  KIAIACDTRISSSMLKSAVSAGIMSTGSDVVDIGIAPTPA 81



>gb:AP006618_559551 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 201

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = +1

Query: 280 RRLQNGSDVRGVALQGEKGRSVDLTPPA-VEAIAE-SFGEWVISGLESERGGAVVESVRV 453
           R   NG++VR VA   + GRS+ LTP A V A+ + S  +W  + L+    GA V +V  
Sbjct: 98  RDAANGAEVRLVAAVDDAGRSLTLTPQAEVVAVKDISAQQWFFAELQRASLGAAVGAVIG 157

Query: 454 SL-GMDPRISGKSLSAAVFAGLG---QAGCLVFDMGLA 555
            L G+   + G    AA+ A +G     G  + D G+A
Sbjct: 158 GLIGLLGLVVGVIPGAAIGAVIGLLVAGGPALIDSGIA 195



>gb:AF167367_484940 Sphingomonas paucimobilis
           phosphoglucomutase/phosphomannomutase gene, complete
           cds.
          Length = 462

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 17/42 (40%), Positives = 24/42 (57%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
           RV++G D R+S   L AA+  GL  +GC V   G+  TP  +
Sbjct: 46  RVAVGRDGRVSSPMLEAALIEGLTASGCDVVRTGMGPTPMLY 87



>gb:AE016872_353855 Pseudomonas syringae pv. tomato str. DC3000
           section 17 of 21 of the complete
           genome.>gb:AE016853_1039030 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 447

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           R+ +G D RISG    +A+ AGL  AG  V  +G   TPA  ++ +   F  +A I++S 
Sbjct: 44  RILVGKDTRISGYMFESALEAGLSAAGADVLLLGPMPTPA--IAYLTRTFHAEAGIVISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>gb:AE016822_340600 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 292

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 33/112 (29%), Positives = 49/112 (43%)
 Frame = +1

Query: 193 KIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEA 372
           ++ LS  +  S   +   E   DE  E++R+L        +A + E+G SVD        
Sbjct: 186 ELALSSALMESFAGDFQPETFADEYQEELRKL--------IAAKIEQGESVD-------- 229

Query: 373 IAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAG 528
           +AE+FGE    G     GGAV++ +        R  GK+ SA   A    AG
Sbjct: 230 VAETFGE----GAAPAGGGAVIDLMEALQRSVERSGGKAASAFPAAEKAPAG 277



>gb:AE013386_291851 Methanosarcina mazei strain Goe1, section 168 of
           379 of the complete genome.>gb:AE008384_965960
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 448

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 23/73 (31%), Positives = 34/73 (46%)
 Frame = +1

Query: 349 LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAG 528
           +TP     +A+S G ++ S               V++G D RISG+ L +A  AG    G
Sbjct: 17  ITPELAVNVAKSLGTYMGS------------KGTVAIGCDTRISGQMLKSAAIAGALATG 64

Query: 529 CLVFDMGLATTPA 567
             V D+G   TP+
Sbjct: 65  LSVIDVGTVPTPS 77



>gb:SME591791_186752 Sinorhizobium meliloti 1021 complete
           chromosome; segment 10/12.
          Length = 450

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 23/61 (37%), Positives = 31/61 (50%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           RV +G D R+SG  L  A+ AG   AG  VF +G   TP   M T     + D  +M+S 
Sbjct: 44  RVVIGKDTRLSGYMLENAMVAGFTAAGLDVFLLGPIPTPGVAMLT--RSLRADIGVMISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>gb:CR555306_105934 Azoarcus sp. EbN1 complete genome.
          Length = 484

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 31/113 (27%), Positives = 46/113 (40%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG+           LT  AV AI  + G        S+R         +++G D R+S
Sbjct: 39  DIRGIV-------DKTLTAEAVGAIGHALGSEARK--RSQRA--------IAIGRDGRLS 81

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           G  L+ A+  G+  AG  V D+G   TP  + +     +       VSV   H
Sbjct: 82  GPELAGALADGIRAAGVDVIDIGCVPTPLTYFAA----YHLGTDSCVSVTGSH 130



>pir|A97782|A97782 phosphomannomutase (EC 5.4.2.8) [imported] -
           Rickettsia conorii (strain Malish 7)>gb:AE008625_239021
           Rickettsia conorii str. Malish 7, section 57 of 114 of
           the complete genome.>gb:AE006914_1121139 Rickettsia
           conorii str. Malish 7, complete genome.
          Length = 462

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 29/108 (26%), Positives = 49/108 (45%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG +L+       DLT      I   F E  I+           ++ ++ +G+D R+S
Sbjct: 12  DIRGNSLK-------DLTEEVAYKIGFGFAEMTITK----------DNDKICVGLDGRLS 54

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVS 624
             +L  A+  GL  AG  + ++G+  TP  + +     F    SIMV+
Sbjct: 55  SPTLCKALELGLTNAGAEIINIGVVPTPVLYFAD--KHFTPAGSIMVT 100



>pir|H82979|H82979 phosphomannomutase AlgC PA5322 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004945_59554
           Pseudomonas aeruginosa PAO1, section 506 of 529 of the
           complete genome.>gb:AE004091_973654 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 463

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
           V++G D R+SG  L   +  GL   GC V D+G+  TP  +
Sbjct: 51  VAVGRDGRLSGPELVKQLIQGLVDCGCQVSDVGMVPTPVLY 91



>pir|S77135|S77135 hypothetical protein sll1758 - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_688472 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 481

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 3/83 (3%)
 Frame = +1

Query: 325 GEKGRSVDL-TPPAVEAIAESFGEWVISGL--ESERGGAVVESVRVSLGMDPRISGKSLS 495
           G +G++ +L T P    +A S G W    L  +++  G V+      +G D R+S   L+
Sbjct: 36  GIRGKAGELLTAP----LALSLGFWAGQVLREQTDTAGPVI------IGQDSRLSSDMLA 85

Query: 496 AAVFAGLGQAGCLVFDMGLATTP 564
            A+ AGL  AG  V+ +GL  TP
Sbjct: 86  NAMAAGLNSAGVEVWQLGLCPTP 108



>sp|P95575|GLMM_PSESY Phosphoglucosamine mutase (EC
           5.4.2.10).>gb:PSU85643_161899 Pseudomonas syringae pv.
           syringae putative dihydropteroate synthase gene, partial
           cds, regulatory protein MrsA (mrsA), triose phosphate
           isomerase (tpiA), transport protein SecG (secG),
           tRNA-Leu, tRNA-Met, and 15 kDa protein genes, complete
           cds.
          Length = 447

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           R+ +G D RISG    +A+ AGL  AG  V  +G   TPA  ++ +   F  +A I++S 
Sbjct: 44  RILVGKDTRISGYMFESALEAGLSAAGADVLLLGPMPTPA--IAYLTRTFHAEAGIVISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>sp|P26276|ALGC_PSEAE Phosphomannomutase/phosphoglucomutase (EC
           5.4.2.8) (EC 5.4.2.2) (PMM / PGM).
          Length = 462

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
           V++G D R+SG  L   +  GL   GC V D+G+  TP  +
Sbjct: 50  VAVGRDGRLSGPELVKQLIQGLVDCGCQVSDVGMVPTPVLY 90



>gb:BX897700_829373 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 459

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/64 (34%), Positives = 33/64 (51%)
 Frame = +1

Query: 439 ESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIM 618
           +S RV +G D R+SG  L  A+ +G   AG   F +G   TPA  M  +    + D  +M
Sbjct: 41  QSRRVVIGKDTRLSGYMLENALVSGFTAAGMEAFLLGPVPTPAVAM--LCRSLRADLGVM 98

Query: 619 VSVN 630
           +S +
Sbjct: 99  ISAS 102



>gb:BX897699_828054 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 459

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/64 (34%), Positives = 33/64 (51%)
 Frame = +1

Query: 439 ESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIM 618
           +S RV +G D R+SG  L  A+ +G   AG   F +G   TPA  M  +    + D  +M
Sbjct: 41  QSRRVVIGKDTRLSGYMLENALVSGFTAAGMEAFLLGPVPTPAVAM--LCRSLRADLGVM 98

Query: 619 VSVN 630
           +S +
Sbjct: 99  ISAS 102



>gb:BA000043_736731 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 449

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/64 (34%), Positives = 33/64 (51%)
 Frame = +1

Query: 439 ESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIM 618
           E  +V +G D RISG  L  A+ AGL   G  V  +G+ +TP   ++ +       A IM
Sbjct: 39  ERPKVLIGRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPG--VAYLTKALGAQAGIM 96

Query: 619 VSVN 630
           +S +
Sbjct: 97  ISAS 100



>gb:AE016827_342596 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 444

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 23/63 (36%), Positives = 36/63 (57%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S +V +G D RISG  L +A+ AGL  AG     +G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRQVLIGKDTRISGYMLESALEAGLAAAGLSAAFIGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>gb:AE016767_327911 Escherichia coli CFT073 section 13 of 18 of the
           complete genome.>gb:AE014075_958495 Escherichia coli
           CFT073 complete genome.
          Length = 445

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>gb:AE015944_321566 Clostridium tetani E88, section 9 of 10 of the
           complete genome.>gb:AE015927_964355 Clostridium tetani
           E88, complete genome.
          Length = 448

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 19/61 (31%), Positives = 35/61 (57%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           ++ +GMD RISG  L +A+ AG+   G     +G+  TPA  ++ +   +  DA +++S 
Sbjct: 42  KIVVGMDTRISGHMLESALVAGILSMGGEAICLGIVPTPA--VAHLTRKYGADAGVVISA 99

Query: 628 N 630
           +
Sbjct: 100 S 100



>gb:AE010548_264270 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 90 of 197 of the complete
           genome.>gb:AE009951_911438 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 452

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = +1

Query: 439 ESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIM 618
           E ++V +G D RISG  L +A+ AGL   G  +  +G+  TP   ++ +    +  A IM
Sbjct: 42  EKIKVIMGSDTRISGYMLRSALTAGLTSMGIYIDFVGVIPTPG--VAYITKQKKAKAGIM 99

Query: 619 VSVN 630
           +S +
Sbjct: 100 ISAS 103



>gb:CR543861_105244 Acinetobacter sp. ADP1 complete genome.
          Length = 443

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 23/60 (38%), Positives = 33/60 (55%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           V LG D R+SG  L +A+ AGL  AG  V  +G   TPA  ++ +      DA I++S +
Sbjct: 45  VVLGKDTRLSGYILESALQAGLNAAGVYVHLLGPLPTPA--IAHLTRALHADAGIVISAS 102



>gb:CP000031_85404 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 448

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 35/118 (29%), Positives = 47/118 (39%)
 Frame = +1

Query: 277 IRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVS 456
           +R+L     VRG A           T P    +A   G  V      E GG      RV 
Sbjct: 1   MRKLFGTDGVRGTAN----------THPMTAEMALRIGAAVGRYFRREAGGVH----RVV 46

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           +G D R+SG     A+ AGL   G  V  +G   TPA  + T     + D  +M+S +
Sbjct: 47  IGKDTRLSGYMFENALTAGLASTGMNVLLLGPVPTPAVGLMT--RSMRADLGVMISAS 102



>pir|AE0425|AE0425 probable phosphoglucomutase/phosphomannomutase
           [imported] - Yersinia pestis (strain
           CO92)>gb:AE013670_299014 Yersinia pestis KIM section 70
           of 415 of the complete genome.>gb:AE017129_386430
           Yersinia pestis biovar Medievalis str. 91001 section 3
           of 16 of the complete genome.>gb:AJ414157_525258
           Yersinia pestis strain CO92 complete genome; segment
           17/20.>gb:BX936398_835121 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.>gb:AE009952_929197
           Yersinia pestis KIM complete genome.>gb:AE017042_1142996
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 446

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>pir|I41215|I41215 phosphoglucomutase (EC 5.4.2.2) [validated] -
           Escherichia coli (strain K-12)>gb:ECOFOLPA_128691
           Escherichia coli dihydropteroate synthase (folP) gene;
           and yhbF gene, complete cds's.>gb:ECOUW67_130737
           Escherichia coli K-12 chromosomal region from 67.4 to
           76.0 minutes.>gb:U00096_202185 Escherichia coli K-12
           MG1655 complete genome.>gb:AE016989_372943 Shigella
           flexneri 2a str. 2457T section 12 of 16 of the complete
           genome.>gb:AE014073_997693 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 445

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>pir|B85981|B85981 hypothetical protein mrsA [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>pir|G91135|G91135 hypothetical protein ECs4055
           [imported] - Escherichia coli  (strain O157:H7,
           substrain RIMD 0509952)>gb:AE005174_68309 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:BA000007_662067
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 445

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>pir|E86611|E86611 phosphoglucomutase [imported] - Chlamydophila
           pneumoniae  (strain J138)>pir|D72012|D72012
           phosphoglucomutase/phosphomannomutase family protein
           CP0893 [imported] - Chlamydophila pneumoniae (strains
           CWL029 and AR39)>gb:AE001677_37815 Chlamydia pneumoniae
           section 93 of 103 of the complete
           genome.>gb:AE002247_44366 Chlamydophila pneumoniae AR39,
           section 74 of 94 of the complete
           genome.>gb:AE017160_394345 Chlamydophila pneumoniae
           TW-183, section 4 of 4 of the complete
           genome.>gb:BA000008_664338 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886491
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_942372 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028607 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 458

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 31/102 (30%), Positives = 46/102 (45%)
 Frame = +1

Query: 325 GEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAV 504
           G +GR+ +  P  VE      G+ V   L   R G      RV +G D R+SG     A+
Sbjct: 13  GVRGRA-NFEPMTVETTV-LLGKAVARVLREGRSG----KHRVVVGKDTRLSGYMFENAL 66

Query: 505 FAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            AGL   G     +G   TP   ++ +   ++ DA IM+S +
Sbjct: 67  IAGLNSMGIETLVLGPIPTPG--VAFITRAYRADAGIMISAS 106


>sp|Q9HN14|HIS4_HALN1
           1-(5-phosphoribosyl)-5-[(5-
           phosphoribosylamino)methylideneamino]
           imidazole-4-carboxamide isomerase (EC 5.3.1.16)
           (Phosphoribosylformimino-5-aminoimidazole carboxamide
           ribotide isomerase).>pir|C84380|C84380 hypothetical
           protein hisA [imported] - Halobacterium sp.
           NRC-1>gb:AE005113_63567 Halobacterium sp. NRC-1 section
           144 of 170 of the complete genome.>gb:AE004437_888486
           Halobacterium sp. NRC-1 complete genome.
          Length = 242

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 23/65 (35%), Positives = 33/65 (50%)
 Frame = +1

Query: 352 TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC 531
           TP  V  IA ++ + V+  L+++ G  VVE      GMDP       +A  +A LG AG 
Sbjct: 113 TPDIVGEIAAAYSDGVLVSLDAKDGEVVVEGWTEGTGMDP-----VAAAQRYADLGAAGI 167

Query: 532 LVFDM 546
           L  D+
Sbjct: 168 LFTDV 172



>sp|Q83Q15|GLMM_SHIFL Phosphoglucosamine mutase (EC
           5.4.2.10).>gb:AE005674_72800 Shigella flexneri 2a str.
           301, complete genome.
          Length = 445

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>sp|P31120|GLMM_ECOLI Phosphoglucosamine mutase (EC 5.4.2.10).
          Length = 444

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 41  SRKIIIGKDTRISGYMLESALEAGLAAAGLSALFTGPMPTPA--VAYLTRTFRAEAGIVI 98

Query: 622 SVN 630
           S +
Sbjct: 99  SAS 101



>gb:AY871968_2150132 Synthetic construct hypothetical protein
           (FTT0079) gene, complete cds.
          Length = 478

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 19/45 (42%), Positives = 24/45 (53%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           V +G D R SG  L  A+ +GL  AG  V D+G+  TP     TV
Sbjct: 70  VIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPTPVVAFMTV 114



>gb:BX957222_844330 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 447

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +1

Query: 457 LGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           +G D R +G  + +A+ AGL   GC V  +G+  TP    S       YD  IM++ +
Sbjct: 35  IGRDTRTTGNLIESAITAGLLNGGCDVTTIGMVPTPVLGYSAK----DYDLGIMITAS 88



>gb:BX640450_817100 Bordetella bronchiseptica strain RB50, complete
           genome; segment 14/16.
          Length = 1202

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +1

Query: 349 LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAG 528
           L  P  +A+A  +G + I+G+    GG  V ++   LGM   + GK  S    AGL Q G
Sbjct: 732 LPAPRADALAGHYGVF-IAGV----GGTGVVTIGQLLGMAAHLEGKGCSVLDMAGLAQKG 786

Query: 529 CLVFD-MGLATTPACFMST 582
             V+  + LA TP   ++T
Sbjct: 787 GAVYSHVVLAPTPGELLNT 805



>gb:BX640435_812214 Bordetella parapertussis strain 12822, complete
           genome; segment 13/14.
          Length = 1224

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +1

Query: 349 LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAG 528
           L  P  +A+A  +G + I+G+    GG  V ++   LGM   + GK  S    AGL Q G
Sbjct: 754 LPAPRADALAGHYGVF-IAGV----GGTGVVTIGQLLGMAAHLEGKGCSVLDMAGLAQKG 808

Query: 529 CLVFD-MGLATTPACFMST 582
             V+  + LA TP   ++T
Sbjct: 809 GAVYSHVVLAPTPGELLNT 827



>gb:BA000040_736532 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 542

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 21/60 (35%), Positives = 28/60 (46%)
 Frame = +1

Query: 460 GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           G D R    S+  A+ +GL  AGC V D+GLA TP  + +     F  D      V + H
Sbjct: 93  GHDFRGYSASIKYALISGLMAAGCKVHDIGLAVTPMAYFA----QFDLDVPCCAMVTASH 148



>gb:BA000040_736386 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 499

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 21/60 (35%), Positives = 28/60 (46%)
 Frame = +1

Query: 460 GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCH 639
           G D R    S+  A+ +GL  AGC V D+GLA TP  + +     F  D      V + H
Sbjct: 68  GHDFRGYSASIKYALISGLMAAGCKVHDIGLAVTPMAYFA----QFDLDVPCCAMVTASH 123



>gb:BA000040_735668 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 451

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 32/102 (31%), Positives = 47/102 (46%)
 Frame = +1

Query: 325 GEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAV 504
           G +GR+  L  P    +A   G+   +GL  +RG       RV +G D R+SG  +  A+
Sbjct: 14  GIRGRANGLITPE---LALKVGQ--AAGLAFQRGD---HRHRVVIGKDTRLSGYMIEYAM 65

Query: 505 FAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            AG    G  V  +G   TPA  M T     + D  +M+S +
Sbjct: 66  VAGFTSVGMDVLLVGPMPTPAVAMLT--KSMRADLGVMISAS 105



>gb:BA000037_723539 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 446

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++S 
Sbjct: 45  KVIIGKDTRISGYMLESALEAGLAAAGLKATFTGPMPTPA--VAYLTQTFRAEAGIVISA 102

Query: 628 N 630
           +
Sbjct: 103 S 103



>gb:BA000031_707921 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 446

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++S 
Sbjct: 45  KVIIGKDTRISGYMLESALEAGLAAAGLKATFTGPMPTPA--VAYLTQTFRAEAGIVISA 102

Query: 628 N 630
           +
Sbjct: 103 S 103



>gb:AJ749949_530536 Francisella tularensis subsp. tularensis
           complete genome.>gb:AY774344_2149057 Synthetic construct
           Francisella tularensis clone FLH152841.01X NT02FT1787
           gene, complete cds.
          Length = 443

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 19/45 (42%), Positives = 24/45 (53%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           V +G D R SG  L  A+ +GL  AG  V D+G+  TP     TV
Sbjct: 44  VIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPTPVVAFMTV 88



>gb:AE017151_391797 Haemophilus ducreyi strain 35000HP section 1 of
           6 of the complete genome.>gb:AE017143_1026059
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 444

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG  L +A+ AGL  AG     +G   TPA  ++ +   F+ +A I++S 
Sbjct: 44  QVLIGKDTRISGYMLESALEAGLAAAGLSAAFVGPMPTPA--VAYLTRTFRAEAGIVISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>gb:AE016802_336361 Vibrio vulnificus CMCP6 chromosome I section 6
           of 11 of the complete sequence.>gb:AE016795_1046085
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 446

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++S 
Sbjct: 45  KVIIGKDTRISGYMLESALEAGLAAAGLKATFTGPMPTPA--VAYLTQTFRAEAGIVISA 102

Query: 628 N 630
           +
Sbjct: 103 S 103



>pir|G87529|G87529 hypothetical protein CC2264 [imported] -
           Caulobacter crescentus>gb:AE005896_213398 Caulobacter
           crescentus CB15 section 222 of 359 of the complete
           genome.>gb:AE005673_923297 Caulobacter crescentus CB15
           complete genome.
          Length = 498

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           ++ +G D R    S+  A+  GL  AGC V D+GLA +P  + +     F  D   +  V
Sbjct: 63  KIVVGHDFRSYSTSIKNALILGLISAGCEVHDIGLALSPTAYFA----QFDLDIPCVAMV 118

Query: 628 NSCH 639
            + H
Sbjct: 119 TASH 122



>pir|G82299|G82299 phosphoglucomutase/phosphomannomutase family
           protein MrsA VC0639 [imported] - Vibrio cholerae (strain
           N16961 serogroup O1)>gb:AE004149_51035 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, section 57 of
           251 of the complete chromosome.>gb:AE003852_1051809
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, complete chromosome.
          Length = 446

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++S 
Sbjct: 45  KVIIGKDTRISGYMLESALEAGLAAAGLKATFTGPMPTPA--VAYLTQTFRAEAGIVISA 102

Query: 628 N 630
           +
Sbjct: 103 S 103



>gb:CP000020_870657 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 320

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           +V +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++S 
Sbjct: 44  KVIIGKDTRISGYMLESALEAGLAAAGLQAKFTGPMPTPA--VAYLTQTFRAEAGIVISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>gb:CP000009_863676 Gluconobacter oxydans 621H, complete genome.
          Length = 452

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 33/93 (35%), Positives = 42/93 (45%)
 Frame = +1

Query: 352 TPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGC 531
           T P    IA+  G+   +GL   R      SV   LG D R+SG  L  A+ AG   AG 
Sbjct: 19  TAPMTVEIAQRLGQ--AAGLYFMRSQNRRHSV--VLGKDTRLSGYMLECALVAGFLSAGM 74

Query: 532 LVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            V  +G   TPA  M T     + D  +MVS +
Sbjct: 75  DVILVGPLPTPAIAMLT--RSLRADLGVMVSAS 105



>gb:BX950851_839451 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 445

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>gb:BX572606_803931 Rhodopseudomonas palustris CGA009 complete
           genome; segment 14/16.
          Length = 450

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 32/102 (31%), Positives = 47/102 (46%)
 Frame = +1

Query: 325 GEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAV 504
           G +GR+  L  P    +A   G+   +GL  +RG       RV +G D R+SG  +  A+
Sbjct: 10  GIRGRANGLITPE---LALKVGQ--AAGLAFQRGE---HRHRVVIGKDTRLSGYMIENAL 61

Query: 505 FAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            AG    G  V  +G   TPA  M T     + D  +M+S +
Sbjct: 62  VAGFTSVGMDVLLVGPMPTPAVAMLT--KSMRADLGVMISAS 101



>gb:BA000043_736656 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 457

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 27/81 (33%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +1

Query: 289 QNGSDVRGVALQGEKGRSVDLTP-PAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM 465
           Q    VRG  L  E+  S    P  AVEA+ E   +   + L+   GG +V+   V +G 
Sbjct: 39  QEKPTVRGAFLHSERAGSAKPVPITAVEAVQEPRMKTNSAELDRVLGGGIVKGSLVLIGG 98

Query: 466 DPRISGKSLSAAVFAGLGQAG 528
           DP I   +L     A L  AG
Sbjct: 99  DPGIGKSTLLLQTSAQLAAAG 119



>gb:AE016964_368543 Coxiella burnetii strain RSA 493, section 5 of 7
           of the complete genome.>gb:AE016828_1009279 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 446

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/66 (34%), Positives = 35/66 (53%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S  V +G D RISG  + +A+ AGL  AG  +   G   TPA  ++ +    + DA I++
Sbjct: 41  SATVLIGKDTRISGYMIESALQAGLSAAGVNIKLTGPMPTPA--IAYLTHSVRADAGIVI 98

Query: 622 SVNSCH 639
           S +  H
Sbjct: 99  SASHNH 104



>gb:NSU581792_156262 Neisseria subflava dedA gene (partial), manB
           gene, folP gene, tyrB gene and cyt5 gene, strain
           ATCC19243.
          Length = 445

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 30/104 (28%), Positives = 49/104 (47%)
 Frame = +1

Query: 319 LQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSA 498
           ++GE G+   +TP  V  +  + G+ ++       GG   +   V +G D RISG  L A
Sbjct: 11  VRGEVGQ-FPITPDFVLKLGYAAGQVLVQ----HDGG---QKPTVLIGKDTRISGYMLEA 62

Query: 499 AVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           A+ AG   AG  V   G   TP   ++ +    +  A +M+S +
Sbjct: 63  ALVAGFTAAGVNVIQTGPLPTPG--VAYLTRALRLSAGVMISAS 104



>gb:CP000026_77870 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 445

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>pir|G71654|G71654 phosphomannomutase (exoC) RP509 - Rickettsia
           prowazekii>gb:RPXX03_167295 Rickettsia prowazekii strain
           Madrid E, complete genome; segment 3/4.
          Length = 508

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVS 624
           ++ +G+D RIS  +L  A+  GL  AG  + ++G+  TP  + +     F    SIMV+
Sbjct: 53  KICVGLDGRISSPTLCKALELGLTDAGAEIINIGVVPTPVLYFAD--KHFMPSGSIMVT 109



>pir|D72722|D72722 probable MRSA protein APE0317 - Aeropyrum pernix
           (strain K1)>gb:BA000002_651016 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 469

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 34/117 (29%), Positives = 46/117 (39%)
 Frame = +1

Query: 280 RRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSL 459
           RRL     VRGV          +LTP  V  +A + G +   G             R+ +
Sbjct: 9   RRLFGTDGVRGVI-------GSELTPEFVLRLARAIGAYFGRGS------------RILV 49

Query: 460 GMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           G D R  G+     V AGL   G  V   G   TPA  +   +    YDA +MV+ +
Sbjct: 50  GRDTRSGGELFEGLVAAGLAFEGVEVHLAGTLPTPA--LQLYVRDHGYDAGVMVTAS 104



>pir|AE0902|AE0902 PGM/PMM-family protein [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain
           CT18)>gb:AE008852_244936 Salmonella typhimurium LT2,
           section 156 of 220 of the complete
           genome.>gb:AE016844_347203 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 11 of 16 of the
           complete genome.>gb:AL627278_543533 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 14/20.>gb:AE014613_984535 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1002018 Salmonella typhimurium LT2,
           complete genome.
          Length = 445

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>gb:AE017344_1756313 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 261

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 3/57 (5%)
 Frame = -1

Query: 534 QAPSLTQPSEHSRTQRFP*NSRIHSQRNPNAFYHRPTSLTL*PTNHP---FTKALRY 373
           ++P+  +PS+ +R +     SRIH+Q    A  H PT   L    HP   FT AL Y
Sbjct: 37  ESPARPRPSDLTRQRIIEYASRIHAQHRRLAIVHSPTIRRLLQQEHPASHFTSALLY 93



>gb:BX248584_763725 Blochmannia floridanus complete genome; segment
           1/3.
          Length = 452

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 32/102 (31%), Positives = 50/102 (49%)
 Frame = +1

Query: 325 GEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAV 504
           G +GR V L+P   + I +    W    + S  G     S +V +G D RISG  L +A+
Sbjct: 11  GIRGR-VGLSPITPDFILKL--GWAAGKVLSNYGSG--RSKQVIIGKDTRISGYMLESAL 65

Query: 505 FAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            AGL  +G      G   TPA  ++ +   F+ +A I++S +
Sbjct: 66  EAGLAASGLSAALTGPMPTPA--IAYLTRTFRAEAGIVISAS 105



>gb:AE016996_374845 Chlamydophila caviae GPIC section 3 of 4 of the
           complete genome.>gb:AE015925_994524 Chlamydophila caviae
           GPIC complete genome.
          Length = 458

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 30/102 (29%), Positives = 49/102 (48%)
 Frame = +1

Query: 325 GEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAV 504
           G +GR+ +  P  VE ++   G+ V   L+  + G      RV +G D R+SG     A+
Sbjct: 13  GIRGRA-NYEPMTVE-LSVLLGKAVAGVLQERKPG----KHRVVVGKDTRLSGYMFENAL 66

Query: 505 FAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
            AGL   G     +G   TP   ++ +   ++ DA IM+S +
Sbjct: 67  VAGLTSMGIETLVLGPIPTPG--VAFITRAYRADAGIMISAS 106



>gb:AE013598_296950 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 449

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 6/74 (8%)
 Frame = +1

Query: 427 GAVVESVR-----VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA-CFMSTVL 588
           G V+  +R     V +G D RISG    AA+ AGL  AG  V  +G   TPA  F+++ L
Sbjct: 34  GRVLTQIRGKRPLVLIGKDTRISGYMFEAALEAGLVAAGADVQLIGPMPTPAIAFLTSTL 93

Query: 589 PPFQYDASIMVSVN 630
              + DA +++S +
Sbjct: 94  ---RADAGVVISAS 104



>gb:AE010682_265630 Methanosarcina acetivorans str. C2A, section 27
           of 534 of the complete genome.>gb:AE010299_906189
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 448

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           V++G D RISG  L +A  AG    G  V D+G   TP+
Sbjct: 39  VAIGCDTRISGHMLKSAAIAGALATGLNVIDVGTVPTPS 77



>pir|C69079|C69079 probable phosphomannomutase 1 - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000918_29259
           Methanobacterium thermoautotrophicum from bases 1444576
           to 1460617 (section 124 of 148) of the complete
           genome.>gb:AE000666_926341 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 449

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 4/64 (6%)
 Frame = +1

Query: 385 FGEWVISGLESERGGAVVESV----RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGL 552
           FGE V   L +E   A+   +     V +G D R S + L  A+ AG+ + GC V  +G+
Sbjct: 18  FGEKVTLELTAEHRKALATHLGGDGEVVVGYDTRTSSQLLENALIAGIVECGCDVTRLGM 77

Query: 553 ATTP 564
             TP
Sbjct: 78  VPTP 81



>sp|P45164|GLMM_HAEIN Phosphoglucosamine mutase (EC
           5.4.2.10).>pir|C64172|C64172 hypothetical protein HI1463
           - Haemophilus influenzae (strain Rd
           KW20)>gb:U32813_204995 Haemophilus influenzae Rd KW20
           section 128 of 163 of the complete
           genome.>gb:U32824_205123 Haemophilus influenzae Rd KW20
           section 139 of 163 of the complete
           genome.>gb:L42023_1097544 Haemophilus influenzae Rd KW20
           complete genome.>gb:L42023_1097672 Haemophilus
           influenzae Rd KW20 complete genome.
          Length = 445

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 23/63 (36%), Positives = 34/63 (53%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S  V +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SKMVLIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPA--IAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>gb:AB012241_1511696 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18L3.>gb:AY072436_1567253 Arabidopsis
           thaliana putative protein (At5g37890) mRNA, complete
           cds.>gb:AY114722_1578764 Arabidopsis thaliana putative
           protein (At5g37890) mRNA, complete cds.
          Length = 286

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 3/86 (3%)
 Frame = +1

Query: 424 GGAVVESVRVSLGMDPRISGK---SLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPP 594
           G A++ES    +G +  +S K   S S A      +   ++ D+ +   P C+ +  +P 
Sbjct: 3   GAAILESPGEGIGSNSILSQKRQLSSSDAAKRDAKKRSTMLMDLEILDCPICYEAFTIPI 62

Query: 595 FQYDASIMVSVNSCHRLVSLTTSCTA 672
           FQ D   +   + C +L +   +CT+
Sbjct: 63  FQCDNGHLACSSCCPKLNNKCPACTS 88



>gb:CP000010_866736 Burkholderia mallei ATCC 23344 chromosome 1,
            complete sequence.
          Length = 1193

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 7/130 (5%)
 Frame = +1

Query: 304  VRGVALQGEKGRSVD------LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM 465
            V G  L+  K  S D      +  P + AI  ++G  +++G+    GG  V ++   LGM
Sbjct: 714  VEGGRLRKPKAVSADASALPPMPEPVLPAIDRAYGV-LVTGV----GGTGVVTIGALLGM 768

Query: 466  DPRISGKSLSAAVFAGLGQAGCLVFD-MGLATTPACFMSTVLPPFQYDASIMVSVNSCHR 642
               + GK ++     GL Q G  V   + +A  PA   +T +   + D  I      C  
Sbjct: 769  AAHLEGKGVTVLDVTGLAQKGSAVMSHVQIAHAPADIHATRIAMGEADLVI-----GCDA 823

Query: 643  LVSLTTSCTA 672
            +V+    CT+
Sbjct: 824  IVTAGDECTS 833



>gb:BA000039_727556 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 465

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 27/80 (33%), Positives = 37/80 (46%)
 Frame = +1

Query: 325 GEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAV 504
           G +GR+ +L  P    +A S G WV   L           +   +G D R S   L+ A+
Sbjct: 22  GIRGRAGELLTPN---LALSLGYWVGEVLRQTTDAPQRPFI---IGQDSRNSSDMLATAL 75

Query: 505 FAGLGQAGCLVFDMGLATTP 564
            AGL  AG  V+ +GL  TP
Sbjct: 76  AAGLTAAGFEVWHVGLCPTP 95



>gb:BA000016_675369 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 448

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/61 (31%), Positives = 33/61 (54%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           ++ +  D RISG  L AA+ AG+   G     +G+  TPA  ++ +   +  DA +M+S 
Sbjct: 42  KILVAKDTRISGDMLEAALVAGILSVGAEAVCLGVVPTPA--VAHLTRVYGADAGVMISA 99

Query: 628 N 630
           +
Sbjct: 100 S 100



>gb:AE012365_281767 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 273 of 460 of the complete
           genome.>gb:AE008922_915049 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 449

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA-CFMSTVLPPFQYDASIMVSV 627
           V +G D RISG    AA+ AGL  AG  V  +G   TPA  F+++ L   + DA +++S 
Sbjct: 47  VLIGKDTRISGYMFEAALEAGLVAAGADVQLIGPMPTPAIAFLTSTL---RADAGVVISA 103

Query: 628 N 630
           +
Sbjct: 104 S 104



>gb:AE011911_277630 Xanthomonas axonopodis pv. citri str. 306,
           section 289 of 469 of the complete
           genome.>gb:AE008923_919405 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 449

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA-CFMSTVLPPFQYDASIMVSV 627
           V +G D RISG    AA+ AGL  AG  V  +G   TPA  F+++ L   + DA +++S 
Sbjct: 47  VLIGKDTRISGYMFEAALEAGLVAAGADVQLIGPMPTPAIAFLTSTL---RADAGVVISA 103

Query: 628 N 630
           +
Sbjct: 104 S 104



>gb:AE006080_215328 Pasteurella multocida subsp. multocida str. Pm70
           section 47 of 204 of the complete
           genome.>gb:AE004439_1118058 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 444

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 22/60 (36%), Positives = 33/60 (55%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           V +G D RISG  L +A+ AGL  AG      G   TPA  ++ +   F+ +A I++S +
Sbjct: 45  VLIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPA--IAYLTRTFRAEAGIVISAS 102



>gb:CR555306_108138 Azoarcus sp. EbN1 complete genome.
          Length = 450

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 28/83 (33%), Positives = 38/83 (45%), Gaps = 2/83 (2%)
 Frame = +1

Query: 325 GEKGRSVD--LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSA 498
           G +GR  D  +TP  V  +  + G  ++   +   G    E   + +G D RISG  L A
Sbjct: 10  GVRGRVGDSTITPEFVMRLGYAAGVTLVGREQLPPG----ERPAILIGKDTRISGYMLEA 65

Query: 499 AVFAGLGQAGCLVFDMGLATTPA 567
           A+ AG   AG  V   G   TPA
Sbjct: 66  ALEAGFAAAGVDVMLAGPVPTPA 88



>pir|B53614|B53614 phosphoglucomutase (EC 5.4.2.2) - Neisseria
           meningitidis  (strain NMB)>gb:NMU02490_155753 Neisseria
           meningitidis strain NMB phosphoglucomutase(pgm) gene,
           complete cds.
          Length = 460

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           R++LG D R+SG  L   +  G   +G  V ++G+  TP  + + V
Sbjct: 45  RIALGRDGRLSGPELMEHIRRGFTDSGINVLNVGMVATPMLYFAAV 90



>sp|P40391|PGMU_NEIMB Phosphoglucomutase (EC 5.4.2.2) (Glucose
           phosphomutase) (PGM).>pir|C81159|C81159
           phosphoglucomutase NMB0790 [imported] - Neisseria
           meningitidis (strain MC58 serogroup B)>gb:AE002432_46242
           Neisseria meningitidis serogroup B strain MC58 section
           74 of 206 of the complete genome.>gb:AE002098_896355
           Neisseria meningitidis serogroup B strain MC58 complete
           genome.
          Length = 460

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           R++LG D R+SG  L   +  G   +G  V ++G+  TP  + + V
Sbjct: 45  RIALGRDGRLSGPELMEHIRRGFTDSGINVLNVGMVATPMLYFAAV 90



>sp|P50901|HOX3_BRAFL Homeobox protein HOX3.>pir|A49127|A49127
           homeotic protein AmphiHox3 - Florida
           lancelet>gb:BFHOMEOG_1355225 B.floridae gene for
           amphihox3.
          Length = 411

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 24/85 (28%), Positives = 32/85 (37%), Gaps = 2/85 (2%)
 Frame = -3

Query: 547 PYQTPSTQPDPTQRTQPHSKISLKF*DPFPAKP*RFLPPPHLSHSLTH*SPIHQXXXXXX 368
           P   P+TQP  +Q     + +S+              PPPHL+HSL H +P H       
Sbjct: 226 PLPHPTTQPSLSQSNNMSNHMSMMGSLQQTQPAYSQYPPPHLNHSLPHQAPPHSVGLTMS 285

Query: 367 XXXXXXXXXXXLS--PPAGQPHGRP 299
                       S  PP+  PH  P
Sbjct: 286 GPVSPQCYQSNHSPCPPSSAPHPVP 310



>gb:BX571874_789388 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 16/17.
          Length = 445

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +++ AGL  AG      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESSLEAGLAAAGLSASFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>gb:AE017340_456735 Idiomarina loihiensis L2TR, complete genome.
          Length = 446

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           RV +G D R+SG  L +A+ AGL  AG  V  +G   TP   ++ +   F+  A I++S 
Sbjct: 44  RVLVGKDTRVSGYMLESALEAGLAAAGVGVDFLGPMPTPG--IAYLTRTFRAAAGIVISA 101

Query: 628 N 630
           +
Sbjct: 102 S 102



>gb:AE017145_390366 Helicobacter hepaticus ATCC 51449 section 2 of 6
           of the complete genome.>gb:AE017125_1024628 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 482

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 23/79 (29%), Positives = 35/79 (44%)
 Frame = +1

Query: 346 DLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQA 525
           DLT   V  I +  GE++I   ES+    +       +G D R    +L   +  G    
Sbjct: 28  DLTHEVVCGIGQLLGEYII---ESKLPPCIY------IGYDARTHSPTLLTWLAEGFAST 78

Query: 526 GCLVFDMGLATTPACFMST 582
           G  V+D+GL  TP  + +T
Sbjct: 79  GIEVYDLGLIPTPVAYFAT 97



>gb:U01376_203442 Escherichia coli K12 ampicillin-binding protein
           (dacB), transcription elongation factor (greA),
           regulatory protein (mrsF), ATP-binding protein (mrsC),
           dihydropteroate synthase, regulatory protein (mrsA), and
           membrane protein genes, complete cds.
          Length = 445

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 21/63 (33%), Positives = 34/63 (53%)
 Frame = +1

Query: 442 SVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMV 621
           S ++ +G D RISG  L +A+ AGL   G      G   TPA  ++ +   F+ +A I++
Sbjct: 42  SRKIIIGKDTRISGYMLESALEAGLAARGLSALFTGPMPTPA--VAYLTRTFRAEAGIVI 99

Query: 622 SVN 630
           S +
Sbjct: 100 SAS 102



>pir|C70502|C70502 hypothetical protein Rv1692 - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_21773
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248339_759075 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           6/14.>gb:BX842577_819762 Mycobacterium tuberculosis
           H37Rv complete genome; segment 6/13.
          Length = 353

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 13/113 (11%)
 Frame = +1

Query: 244 NEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLE--- 414
           NEVA    +  +RR ++  D     L    G S DL   A+   A +   WV + ++   
Sbjct: 101 NEVAA-VGLRPVRRFEDRPDAVVQGLSMTTGWS-DLAEAALAIRAGAL--WVAANVDPTL 156

Query: 415 -SERG-----GAVVESVRVSLGMDPRISGKS----LSAAVFAGLGQAGCLVFD 543
            +ERG     G++V ++R + GMDPR++GK     ++ AV  G  +A  +V D
Sbjct: 157 PTERGLLPGNGSMVAALRTATGMDPRVAGKPAPALMTEAVARGDFRAALVVGD 209



>pir|A71467|A71467 probable phosphoglucomutase - Chlamydia
           trachomatis  (serotype D, strain
           UW3/Cx)>gb:AE001354_34758 Chlamydia trachomatis
           D/UW-3/CX section 81 of 87 of the complete
           genome.>gb:AE001273_1098784 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 458

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           RV +G D R+SG     A+ AGL   G     +G   TP   ++ +   ++ DA IM+S 
Sbjct: 48  RVVVGKDTRLSGYMFENALIAGLTSMGIETLMLGPIPTPG--VAFITRAYRADAGIMISA 105

Query: 628 N 630
           +
Sbjct: 106 S 106



>pir|D84371|D84371 phosphomannomutase [imported] - Halobacterium sp.
           NRC-1>gb:AE005107_63496 Halobacterium sp. NRC-1 section
           138 of 170 of the complete genome.>gb:AE004437_888415
           Halobacterium sp. NRC-1 complete genome.
          Length = 455

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 28/90 (31%), Positives = 41/90 (45%)
 Frame = +1

Query: 298 SDVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRI 477
           S  RGVA +       +LTP  V  +A++              G+V  + RV++  D R 
Sbjct: 7   SGTRGVANE-------ELTPGFVLRVAKA-------------AGSVWRADRVAVARDTRT 46

Query: 478 SGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           +G+ L  A  AGL   G  V  +G+  TPA
Sbjct: 47  TGRMLENAAVAGLQSIGVDVDRLGVVPTPA 76



>pir|A81729|A81729 phosphoglucomutase/phosphomannomutase family
           protein TC0202 [imported] - Chlamydia muridarum (strain
           Nigg)>gb:AE002287_44793 Chlamydia muridarum Nigg section
           19 of 85 of the complete genome.>gb:AE002160_1148933
           Chlamydia muridarum Nigg, complete genome.
          Length = 459

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           RV +G D R+SG     A+ AGL   G     +G   TP   ++ +   ++ DA IM+S 
Sbjct: 48  RVVVGKDTRLSGYMFENALIAGLTSMGIETLMLGPIPTPG--VAFITRAYRADAGIMISA 105

Query: 628 N 630
           +
Sbjct: 106 S 106



>gb:CNS06C8G_1372660 chromosome I of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 530

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
 Frame = +1

Query: 439 ESVR--VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTP 564
           E VR  V LG D R SG+ L   + + LG+  C V D G+ TTP
Sbjct: 119 EGVRGHVVLGRDTRDSGERLCNNIRSVLGKLNCTVDDYGVVTTP 162



>gb:BX571965_793040 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.
          Length = 1193

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 33/130 (25%), Positives = 57/130 (43%), Gaps = 7/130 (5%)
 Frame = +1

Query: 304  VRGVALQGEKGRSVD------LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGM 465
            V G  L+  K  S D      +  P + AI  ++G  +++G+    GG  V ++   LGM
Sbjct: 714  VEGGRLRKPKAVSADASALPPMPEPVLPAIDRAYGV-LVTGV----GGTGVVTIGALLGM 768

Query: 466  DPRISGKSLSAAVFAGLGQ-AGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVNSCHR 642
               + GK ++     GL Q  G ++  + +A  PA   +T +   + D  I      C  
Sbjct: 769  AAHLEGKGVTVLDVTGLAQKGGAVMSHVQIAHAPADIHATRIAMGEADLVI-----GCDA 823

Query: 643  LVSLTTSCTA 672
            +V+    CT+
Sbjct: 824  IVTAGDECTS 833



>gb:AP008231_581655 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 475

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 4/84 (4%)
 Frame = +1

Query: 325 GEKGRSVD-LTPPAVEAIAESFGEW---VISGLESERGGAVVESVRVSLGMDPRISGKSL 492
           G +GR  + LT P    +A+  G W   V+     +RG  VV       G D R S   L
Sbjct: 34  GIRGRVGEHLTAP----LAQQVGFWTGQVLRQAGGDRGPVVV-------GQDSRNSSNML 82

Query: 493 SAAVFAGLGQAGCLVFDMGLATTP 564
           + A+ +GL  AG  V  +GL  TP
Sbjct: 83  AMALSSGLAAAGVEVLHLGLCPTP 106



>gb:AP006840_570198 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 392

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 33/125 (26%), Positives = 44/125 (35%)
 Frame = +1

Query: 214 VESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPPAVEAIAESFGE 393
           VE     +    V  D  ME + +L+      G    G   ++ D     V   AE   E
Sbjct: 206 VEKEFVFDTDEGVRRDTSMEALAKLRPAFSANGNVTAGNSSQTTDGAAAVVVMSAEKAQE 265

Query: 394 WVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACF 573
             +  L   R  AV        G+DP + G     AV   L QAG  + D+ L      F
Sbjct: 266 MGLKPLAIFRSFAVG-------GVDPEVMGIGPVVAVPKALKQAGITLADVDLIELNEAF 318

Query: 574 MSTVL 588
            S  L
Sbjct: 319 ASQSL 323



>gb:AL646073_548050 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 17/19.
          Length = 1187

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +1

Query: 295 GSDVRGVALQGEKGRSVDLTP-PAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDP 471
           G+ VR    +G    S+ L P P + AI  ++G  +++G+    GG  V ++   LGM  
Sbjct: 711 GAQVRKPESRGVSTDSLPLLPHPDLPAIRRAYGV-LVTGV----GGTGVVTIGGLLGMAA 765

Query: 472 RISGKSLSAAVFAGLGQAG 528
            I GK ++    AGL Q G
Sbjct: 766 HIEGKGVTVLDMAGLAQKG 784



>gb:AE004969_61020 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 445

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           V +G D RISG  L AA+ AG   AG  V   G   TP   ++ +    +  A +M+S +
Sbjct: 48  VLIGKDTRISGYMLEAALVAGFTAAGVNVVQTGPLPTPG--VAYLTRALRLSAGVMISAS 105



>pir|C81823|C81823 probable phosphoglucomutase/phosphomannomutase
           NMA1949 [imported] - Neisseria meningitidis (strain
           Z2491 serogroup A)>gb:NMA6Z2491_154825 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 6/7.
          Length = 444

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           V +G D RISG  L AA+ AG   AG  V   G   TP   ++ +    +  A +M+S +
Sbjct: 47  VLIGKDTRISGYMLEAALVAGFTAAGVNVVQTGPLPTPG--VAYLTRALRLSAGVMISAS 104



>pir|C81054|C81054 phosphoglucomutase/phosphomannomutase family
           protein NMB1690 [imported] - Neisseria meningitidis
           (strain MC58 serogroup B)>gb:AE002519_47092 Neisseria
           meningitidis serogroup B strain MC58 section 161 of 206
           of the complete genome.>gb:AE002098_897205 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 444

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSVN 630
           V +G D RISG  L AA+ AG   AG  V   G   TP   ++ +    +  A +M+S +
Sbjct: 47  VLIGKDTRISGYMLEAALVAGFTAAGVNVVQTGPLPTPG--VAYLTRALRLSAGVMISAS 104



>sp|P57002|PGMU_NEIMA Phosphoglucomutase (EC 5.4.2.2) (Glucose
           phosphomutase) (PGM).>pir|G81947|G81947
           phosphoglucomutase (EC 5.4.2.2) NMA1001 [imported] -
           Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA3Z2491_153926 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 3/7.
          Length = 460

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTV 585
           R++LG D R+SG  L   +  G   +G  V ++G+  TP  + + +
Sbjct: 45  RIALGRDGRLSGPELMEHIQRGFTDSGIGVLNVGMVATPMLYFAAI 90



>gb:BX640429_810321 Bordetella parapertussis strain 12822, complete
           genome; segment 7/14.>gb:BX640441_814113 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           5/16.
          Length = 452

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 19/40 (47%), Positives = 23/40 (57%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           +V +G D RISG  L +A+ AGL  AG  V   G   TPA
Sbjct: 54  QVVIGKDTRISGYMLESALEAGLSAAGIDVLLAGPVPTPA 93



>gb:BX640414_805502 Bordetella pertussis strain Tohama I, complete
           genome; segment 4/12.
          Length = 452

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 19/40 (47%), Positives = 23/40 (57%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           +V +G D RISG  L +A+ AGL  AG  V   G   TPA
Sbjct: 54  QVVIGKDTRISGYMLESALEAGLSAAGIDVLLAGPVPTPA 93



>gb:BX321857_772858 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 2/10.
          Length = 458

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 22/53 (41%), Positives = 27/53 (50%)
 Frame = +1

Query: 409 LESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA 567
           L S+R  A  +   V +G D RISG  L +A+ AG   AG  V   G   TPA
Sbjct: 37  LASDRQLAADKRPTVLIGKDTRISGYMLESALEAGFSAAGVDVLLSGPLPTPA 89



>gb:BA000023_690786 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 455

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           ++ +G D R  G  L   V  GL   G  V+D G+A TPA  +   +    YD  ++++ 
Sbjct: 39  KILVGRDVRAGGDMLVKIVEGGLLSVGVEVYDGGMAPTPA--LQYAVKTLGYDGGVVITA 96

Query: 628 N 630
           +
Sbjct: 97  S 97



>gb:AY744396_644971 Uncultured proteobacterium RedeBAC7D11 contig 0,
           complete sequence.
          Length = 457

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 26/94 (27%), Positives = 41/94 (43%)
 Frame = +1

Query: 301 DVRGVALQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRIS 480
           D+RG+  +        LT   +  I  + G ++I+      G + + + R     D RIS
Sbjct: 12  DIRGIVDEA-------LTEDGIFQIGRAIGSYIIA-----EGRSSILTAR-----DGRIS 54

Query: 481 GKSLSAAVFAGLGQAGCLVFDMGLATTPACFMST 582
           G  L      G+  +GC V D+G   TP  + ST
Sbjct: 55  GPRLLNQFQKGVMSSGCNVVDIGEVPTPLLYFST 88



>gb:AL646065_546456 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 9/19.
          Length = 447

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 27/82 (32%), Positives = 37/82 (45%)
 Frame = +1

Query: 319 LQGEKGRSVDLTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSA 498
           ++G  G S  +TP  V  +  + G  +  G E+   G       V +G D R+SG  L A
Sbjct: 11  IRGRVGES-PITPDFVLRLGYAAGRVLAHGSEAHGHGRPT----VLIGKDTRLSGYMLEA 65

Query: 499 AVFAGLGQAGCLVFDMGLATTP 564
           A+ AG   AG  V   G   TP
Sbjct: 66  ALEAGFTAAGVDVLMSGPLPTP 87



>gb:AE017175_397345 Porphyromonas gingivalis W83 section 4 of 8 of
           the complete genome.>gb:AE015924_1032956 Porphyromonas
           gingivalis W83 complete genome.
          Length = 462

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMS 579
           + +G D R SG  +   VF  L   GC V D+ LATTP   M+
Sbjct: 49  IVVGRDARPSGLMVKNVVFGTLMGMGCDVVDIDLATTPTTEMA 91



>gb:BA000040_731629 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 524

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 27/78 (34%), Positives = 36/78 (46%), Gaps = 15/78 (19%)
 Frame = +1

Query: 268 MEKIRRLQNGSDVRGVAL--------QGEKGRSVDLTPPAVEAIAESF----GEW---VI 402
           +E +RRL   +  RGVA+         G  G  V L  P  E + +S     G W    +
Sbjct: 365 VENVRRLAEAARARGVAIIHVWFVVEPGAPG--VTLNAPLFEGLVDSKAMVRGSWGAAPV 422

Query: 403 SGLESERGGAVVESVRVS 456
           SGLE   G  VVE +R+S
Sbjct: 423 SGLEPRPGDFVVEKMRMS 440



>gb:BA000030_700428 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 445

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 44/211 (20%), Positives = 80/211 (37%), Gaps = 3/211 (1%)
 Frame = +1

Query: 1   GSSLPNIFYIHTCCNPNFPQKSFTMASTSTTPQSLQTIASKPNFPSFPIHKPLHRSLGIA 180
           G SLP              + + T     T P     +   P+  ++       R +GI 
Sbjct: 101 GRSLPEWLGTARALKARQRRAASTPIPPGTEPGLAPAVECDPSLRTYAYGGRDRRPVGII 160

Query: 181 QSFPKIKLSLRVESSLTANKHNEVAVDEEMEKIRRLQNGSDVRGVALQGEKGRSVDLTPP 360
                +   L+VE+  TA +         +  +R   +  +V G+ L+  +        P
Sbjct: 161 GDGTFVTAVLQVEADATALRAERSRQPLPLGLVR---DALEVDGIRLESAQIVLHTQPAP 217

Query: 361 AVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAGCLVF 540
           A+    +S      + L+++ G   V    ++L +DP +  +++SA     +G   C+V 
Sbjct: 218 ALHLPQQSVAVTNYAPLQAQTGAPAVRITWIALKLDPELCPEAVSARGGGLVGAQKCVVR 277

Query: 541 DMGLAT---TPACFMSTVLPPFQYDASIMVS 624
                T   T A F +TVL   +  A+I  S
Sbjct: 278 AADHLTSRLTGAGFRTTVLNEEELTAAIATS 308



>gb:AE017286_432160 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough plasmid pDV, complete sequence.
          Length = 470

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 9/72 (12%)
 Frame = +1

Query: 154 PLHRSLGIAQSFPKIKLSLRVESSLTANKHNEVAVDEEM---------EKIRRLQNGSDV 306
           P+H +L I+ S P    ++R       N   EV VD  +         ++ R + +G  V
Sbjct: 156 PIHEALRISMSIPLFFTAVR-------NSRGEVLVDGSVIWNYPISLYDRARYVMHGDHV 208

Query: 307 RGVALQGEKGRS 342
           RG A  GE GRS
Sbjct: 209 RGDAGHGEAGRS 220



>gb:AE017197_402471 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 497

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 13/44 (29%), Positives = 26/44 (59%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMS 579
           ++ +G+D RIS  +L  A+  GL  +G  + ++G+  TP  + +
Sbjct: 44  KICVGLDGRISSPTLCKALELGLTDSGAKIINIGVVPTPVLYFA 87



>gb:AE017180_400101 Geobacter sulfurreducens PCA, complete genome.
          Length = 451

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 448 RVSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMSTVLPPFQYDASIMVSV 627
           R+ +G D R+SG  L  A+ AG+   G  V  +G   TP   ++ +    + DA +++S 
Sbjct: 43  RIVIGKDTRLSGYMLENALVAGICSMGVDVLVVGPLPTPG--IANITSSMRADAGVVISA 100

Query: 628 N 630
           +
Sbjct: 101 S 101



>gb:AE012555_284105 Xylella fastidiosa Temecula1, section 3 of 9 of
           the complete genome.>gb:AE009442_960681 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 448

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA-CFMSTVLPPFQYDASIMVSV 627
           V +G D RISG    +A+ AGL  AG  V  +G   TPA  F++  L   + DA +++S 
Sbjct: 47  VLIGKDTRISGYMFESALEAGLVAAGADVQLIGPMPTPAIAFLTNTL---RADAGVVISA 103

Query: 628 N 630
           +
Sbjct: 104 S 104



>gb:AE012553_283652 Xylella fastidiosa Temecula1, section 1 of 9 of
           the complete genome.>gb:AE009442_960228 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 449

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPACFMST 582
           V LG D R++  SL  A+ AGL  +G  V D+GL  T   +  T
Sbjct: 41  VVLGHDVRLTSPSLQEALSAGLRASGREVIDIGLCGTEEVYFQT 84



>pir|A75319|A75319 phosphoglucomutase and phosphomannomutase
           phosphoserine family protein - Deinococcus radiodurans
           (strain R1)>gb:AE002043_42318 Deinococcus radiodurans R1
           section 180 of 229 of the complete chromosome
           1.>gb:AE000513_883213 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 444

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 25/72 (34%), Positives = 33/72 (45%)
 Frame = +1

Query: 349 LTPPAVEAIAESFGEWVISGLESERGGAVVESVRVSLGMDPRISGKSLSAAVFAGLGQAG 528
           LTP  V A+  + GE  +    + R   V+       G D R SG  L AA+ AGL   G
Sbjct: 21  LTPAWVMALGAAAGE--VFKRRNPRASVVI-------GKDTRQSGDMLEAALAAGLTSRG 71

Query: 529 CLVFDMGLATTP 564
             V  +G+  TP
Sbjct: 72  VNVVHLGVLPTP 83



>pir|A82679|A82679 phosphomannomutase XF1468 [imported] - Xylella
           fastidiosa  (strain 9a5c)>gb:AE003976_49106 Xylella
           fastidiosa 9a5c, section 122 of 229 of the complete
           genome.>gb:AE003849_1116316 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 448

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 1/61 (1%)
 Frame = +1

Query: 451 VSLGMDPRISGKSLSAAVFAGLGQAGCLVFDMGLATTPA-CFMSTVLPPFQYDASIMVSV 627
           V +G D RISG    +A+ AGL  AG  V  +G   TPA  F++  L   + DA +++S 
Sbjct: 47  VLIGKDTRISGYMFESALEAGLVAAGADVQLIGPMPTPAIAFLTNTL---RADAGVVISA 103

Query: 628 N 630
           +
Sbjct: 104 S 104


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 832,619,581
Number of Sequences: 1806583
Number of extensions: 17744546
Number of successful extensions: 50016
Number of sequences better than 10.0: 220
Number of HSP's better than 10.0 without gapping: 47936
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49954
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 47358445219
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)