BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6926
         (741 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003524_1830380 Oryza sativa (japonica cultivar-group) genom...    36   0.84    
gb:COL11A1G34_1992432 Homo sapiens collagen type XI alpha-1 (COL...    35   1.4     
gb:COL11A1G34_1992431 Homo sapiens collagen type XI alpha-1 (COL...    35   1.4     
gb:COL11A1G34_1992430 Homo sapiens collagen type XI alpha-1 (COL...    35   1.4     
pir|A35239|CGHU1E collagen alpha 1(XI) chain precursor - human>g...    35   1.4     
sp|P12107|CA1B_HUMAN|CA1B_HUMAN Collagen alpha 1(XI) chain precursor.             35   1.4     Homo sapiens [man]
gb:AY349919_1322034 Drosophila simulans strain Sim3 Toll gene, p...    34   3.2     
gb:PFMAL8P1_1192180 Plasmodium falciparum 3D7 chromosome 8, *** ...    34   3.2     
gb:BA000035_717132 Corynebacterium efficiens YS-314 DNA, complet...    33   4.2     
pir|A34374|A34374 DNA-directed RNA polymerase (EC 2.7.7.6) I lar...    33   4.2     Trypanosoma brucei
sp|P16355|RPA1_TRYBB|RPA1_TRYBB DNA-directed RNA polymerase I largest subun...    33   4.2     Trypanosoma brucei brucei
gb:AY349924_1322039 Drosophila simulans strain Sim8 Toll gene, p...    33   5.4     
gb:AY349922_1322037 Drosophila simulans strain Sim6 Toll gene, p...    33   5.4     
gb:AY349921_1322036 Drosophila simulans strain Sim5 Toll gene, p...    33   5.4     
gb:AY349920_1322035 Drosophila simulans strain Sim4 Toll gene, p...    33   5.4     
gb:AY349918_1322033 Drosophila simulans strain Sim2 Toll gene, p...    33   5.4     
gb:AY349917_1322032 Drosophila simulans strain Sim1 Toll gene, p...    33   5.4     
gb:BC052161_2100981 Mus musculus procollagen, type XI, alpha 1, ...    32   9.3     
gb:AL627203_1931037 Human DNA sequence from clone RP11-446M5 on ...    32   9.3     
gb:AY221640_1427306 Canis familiaris adaptor-related protein com...    32   9.3     
sp|Q61245|CA1B_MOUSE|CA1B_MOUSE Collagen alpha 1(XI) chain precursor.>gb:MU...    32   9.3     Mus musculus [mouse]


>gb:AP003524_1830380 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0501G08.
          Length = 860

 Score = 35.8 bits (81), Expect = 0.84
 Identities = 15/25 (60%), Positives = 21/25 (84%)
 Frame = +3

Query: 549 QQENPLMLLGQYSDDELDEGSSEGP 623
           ++ENPL LLGQYSDDE +E +++ P
Sbjct: 59  KKENPLALLGQYSDDEEEEEAADQP 83



 Score = 33.9 bits (76), Expect = 3.2
 Identities = 25/59 (42%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = +2

Query: 77  MGKRKEXXXXXXXXXXXX-VKLDLFAEPSGDLGGSSQDGVGGDEASKNQAELPNSPSSS 250
           MG+RKE             VKLDLF +PS   G  S++G  G E    Q  +P SPSSS
Sbjct: 1   MGRRKERRLAAKAAAGGRRVKLDLFLDPSPG-GTPSKEGERG-ENHDQQTGVPTSPSSS 57



>gb:COL11A1G34_1992432 Homo sapiens collagen type XI alpha-1 (COL11A1)
            gene, exon 67, alternatively spliced products, and
            complete cds.
          Length = 1767

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+LG + QDGVGGD+        P  P  SG
Sbjct: 1280 PPGELGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1312



>gb:COL11A1G34_1992431 Homo sapiens collagen type XI alpha-1 (COL11A1)
            gene, exon 67, alternatively spliced products, and
            complete cds.
          Length = 1818

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+LG + QDGVGGD+        P  P  SG
Sbjct: 1331 PPGELGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1363



>gb:COL11A1G34_1992430 Homo sapiens collagen type XI alpha-1 (COL11A1)
            gene, exon 67, alternatively spliced products, and
            complete cds.
          Length = 1806

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+LG + QDGVGGD+        P  P  SG
Sbjct: 1319 PPGELGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1351



>pir|A35239|CGHU1E collagen alpha 1(XI) chain precursor -
            human>gb:HUMCA1XIA_2029756 Human alpha-1 type XI collagen
            (COL11A1) mRNA, complete cds.
          Length = 1806

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+LG + QDGVGGD+        P  P  SG
Sbjct: 1319 PPGELGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1351



>sp|P12107|CA1B_HUMAN Collagen alpha 1(XI) chain precursor.
          Length = 1806

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+LG + QDGVGGD+        P  P  SG
Sbjct: 1319 PPGELGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1351



>gb:AY349919_1322034 Drosophila simulans strain Sim3 Toll gene,
           partial cds.
          Length = 1027

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 392 LQTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDF 213
           L+  +IIF   +  +   ++      Y   S L Y+D+     +R H+ M  N + ++  
Sbjct: 411 LRNNSIIFVXNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 470

Query: 212 WKLHPLQLHLEKSHPNLQRVPRRGQALLCDWRRSW 108
            K     +HL + + NL  V      L+CD    W
Sbjct: 471 TK----DVHLGEDYTNLVHVDLNDNPLVCDCTILW 501



>gb:PFMAL8P1_1192180 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1833

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 20/75 (26%), Positives = 35/75 (46%)
 Frame = -2

Query: 389  QTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDFW 210
            + +N I    NN+S  K  NN H +   T  +L K  + K  ++  + M+V    +    
Sbjct: 1328 KVKNFILNFPNNLSREKAANNIHHFINETQPILLKSEIYKSLNKYQINMIVEGYEKFIMQ 1387

Query: 209  KLHPLQLHLEKSHPN 165
            KL+    +L + +PN
Sbjct: 1388 KLY---FYLYRMNPN 1399



>gb:BA000035_717132 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 556

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 8/74 (10%)
 Frame = -2

Query: 290 YKDVLLKKTH-RTHLKMMVNWVAQLDFWKLHPLQ----LHLEKSHPNLQRVPRRGQAL-- 132
           YK  +L  TH R  L  +  W+ ++D  KLHP +     +LEK    L+   ++ Q L  
Sbjct: 205 YKGAVLAVTHDRYFLDHVAQWICEVDRGKLHPYEGNYSTYLEKKSERLEVAGKKDQKLQK 264

Query: 131 -LCDWRRSWRRAGA 93
            L D   +W R+GA
Sbjct: 265 RLKD-ELAWVRSGA 277



>pir|A34374|A34374 DNA-directed RNA polymerase (EC 2.7.7.6) I largest
            chain - Trypanosoma brucei>gb:TRBPOLI_1400764 Trypanosoma
            brucei RNA polymerase I largest subunit (rpI196) gene,
            complete cds.
          Length = 1781

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = +3

Query: 537  PLGLQQENPLMLL--GQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGKVASTEDKNDAKG 710
            PLG    + +M +  G  SDD + E SS G  RAGSE SS+            D  D +G
Sbjct: 1408 PLGGTFGDEIMRIEEGTDSDDGMSERSSIGGGRAGSEVSSL----------HSDGTDTRG 1457

Query: 711  VIGSDT 728
            + GSDT
Sbjct: 1458 IAGSDT 1463



>sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I largest subunit
            (EC 2.7.7.6).>gb:TBRNPOL1_1399386 Trypanosoma brucei
            Trp11 gene for largest subunit of RNA polymerase I.
          Length = 1744

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = +3

Query: 537  PLGLQQENPLMLL--GQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGKVASTEDKNDAKG 710
            PLG    + +M +  G  SDD + E SS G  RAGSE SS+            D  D +G
Sbjct: 1371 PLGGTFGDEIMRIEEGTDSDDGMSERSSIGGGRAGSEVSSL----------HSDGTDTRG 1420

Query: 711  VIGSDT 728
            + GSDT
Sbjct: 1421 IAGSDT 1426



>gb:AY349924_1322039 Drosophila simulans strain Sim8 Toll gene,
           partial cds.
          Length = 1027

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 392 LQTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDF 213
           L+  +IIF   +  +   ++      Y   S L Y+D+     +R H+ M  N + ++  
Sbjct: 411 LRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 470

Query: 212 WKLHPLQLHLEKSHPNLQRVPRRGQALLCDWRRSW 108
            K     +HL + + NL  V      L+CD    W
Sbjct: 471 TK----DVHLGEDYTNLVHVDLNDNPLVCDCTILW 501



>gb:AY349922_1322037 Drosophila simulans strain Sim6 Toll gene,
           partial cds.>gb:AY349923_1322038 Drosophila simulans
           strain Sim7 Toll gene, partial cds.
          Length = 1027

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 392 LQTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDF 213
           L+  +IIF   +  +   ++      Y   S L Y+D+     +R H+ M  N + ++  
Sbjct: 411 LRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 470

Query: 212 WKLHPLQLHLEKSHPNLQRVPRRGQALLCDWRRSW 108
            K     +HL + + NL  V      L+CD    W
Sbjct: 471 TK----DVHLGEDYTNLVHVDLNDNPLVCDCTILW 501



>gb:AY349921_1322036 Drosophila simulans strain Sim5 Toll gene,
           partial cds.
          Length = 1027

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 392 LQTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDF 213
           L+  +IIF   +  +   ++      Y   S L Y+D+     +R H+ M  N + ++  
Sbjct: 411 LRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 470

Query: 212 WKLHPLQLHLEKSHPNLQRVPRRGQALLCDWRRSW 108
            K     +HL + + NL  V      L+CD    W
Sbjct: 471 TK----DVHLGEDYTNLVHVDLNDNPLVCDCTILW 501



>gb:AY349920_1322035 Drosophila simulans strain Sim4 Toll gene,
           partial cds.
          Length = 1027

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 392 LQTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDF 213
           L+  +IIF   +  +   ++      Y   S L Y+D+     +R H+ M  N + ++  
Sbjct: 411 LRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 470

Query: 212 WKLHPLQLHLEKSHPNLQRVPRRGQALLCDWRRSW 108
            K     +HL + + NL  V      L+CD    W
Sbjct: 471 TK----DVHLGEDYTNLVHVDLNDNPLVCDCTILW 501



>gb:AY349918_1322033 Drosophila simulans strain Sim2 Toll gene,
           partial cds.
          Length = 1027

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 392 LQTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDF 213
           L+  +IIF   +  +   ++      Y   S L Y+D+     +R H+ M  N + ++  
Sbjct: 411 LRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 470

Query: 212 WKLHPLQLHLEKSHPNLQRVPRRGQALLCDWRRSW 108
            K     +HL + + NL  V      L+CD    W
Sbjct: 471 TK----DVHLGEDYTNLVHVDLNDNPLVCDCTILW 501



>gb:AY349917_1322032 Drosophila simulans strain Sim1 Toll gene,
           partial cds.
          Length = 1027

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 392 LQTENIIFCGTNNMSCTKKINNFHQYYAVTSCLLYKDVLLKKTHRTHLKMMVNWVAQLDF 213
           L+  +IIF   +  +   ++      Y   S L Y+D+     +R H+ M  N + ++  
Sbjct: 411 LRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 470

Query: 212 WKLHPLQLHLEKSHPNLQRVPRRGQALLCDWRRSW 108
            K     +HL + + NL  V      L+CD    W
Sbjct: 471 TK----DVHLGEDYTNLVHVDLNDNPLVCDCTILW 501



>gb:BC052161_2100981 Mus musculus procollagen, type XI, alpha 1, mRNA
            (cDNA clone MGC:59348 IMAGE:6393164), complete cds.
          Length = 1804

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+ G + QDGVGGD+        P  P  SG
Sbjct: 1317 PPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1349



>gb:AL627203_1931037 Human DNA sequence from clone RP11-446M5 on
            chromosome 1 Contains part of the COL11A1 gene for
            collagen type XI alpha 1, complete sequence.
          Length = 1806

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+ G + QDGVGGD+        P  P  SG
Sbjct: 1319 PPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1351



>gb:AY221640_1427306 Canis familiaris adaptor-related protein
           complex AP3 beta 1 subunit (Ap3b1) mRNA, complete cds.
          Length = 1091

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 495 RHQRLVEIK*RVFSPLG-LQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQG 671
           R+  ++E++ + ++P G  ++ENP      YSD E +E SS+    + SE  S + +   
Sbjct: 649 RNVEVIELQAKEWTPAGKAKKENPARKF--YSDSEEEEDSSDSSSDSESESGSASGEQDE 706

Query: 672 KVASTEDKND 701
           +  S+ED ++
Sbjct: 707 EGDSSEDSSE 716



>sp|Q61245|CA1B_MOUSE Collagen alpha 1(XI) chain
            precursor.>gb:MUSA1CC_2124940 Mouse mRNA for mouse a1(XI)
            collagen chain.
          Length = 1804

 Score = 32.3 bits (72), Expect = 9.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 155  PSGDLGGSSQDGVGGDEASKNQAELPNSPSSSG 253
            P G+ G + QDGVGGD+        P  P  SG
Sbjct: 1317 PPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSG 1349


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 777,559,463
Number of Sequences: 1806583
Number of extensions: 16738277
Number of successful extensions: 55554
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 52368
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55477
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 45415179000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)