BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6744
         (1136 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T00593|T02480 sec13-related protein At2g30050 - Arabidopsis ...   530   e-149   
gb:AY087553_1572583 Arabidopsis thaliana clone 36577 mRNA, compl...   524   e-147   
gb:ATAC010676_1543135 Arabidopsis thaliana chromosome III BAC T2...   524   e-147   
gb:AY087647_1572676 Arabidopsis thaliana clone 37331 mRNA, compl...   515   e-145   
gb:AB055156_1521428 Oryza sativa mRNA for Sec13p, complete cds.>...   512   e-144   
gb:AP003738_1832698 Oryza sativa (japonica cultivar-group) genom...   422   e-117   
gb:AC133339_1741418 Oryza sativa chromosome 3 BAC OSJNBa0078D06 ...   415   e-114   
gb:BC061419_2553193 Xenopus tropicalis hypothetical protein MGC7...   340   2e-92   
gb:BC054585_2550996 Danio rerio zgc:63980, mRNA (cDNA clone MGC:...   339   7e-92   
gb:BC073381_2557223 Xenopus laevis cDNA clone MGC:80813 IMAGE:55...   338   2e-91   
gb:BC043755_2548217 Xenopus laevis SEC13-like 1 (S. cerevisiae),...   337   3e-91   
gb:BC084705_2109015 Rattus norvegicus SEC13-like 1, mRNA (cDNA c...   334   2e-90   
gb:BC002128_2088891 Mus musculus SEC13-like 1 (S. cerevisiae), m...   334   2e-90   
gb:AK003354_1151809 Mus musculus 18-day embryo whole body cDNA, ...   334   2e-90   
gb:AK009755_1155332 Mus musculus adult male tongue cDNA, RIKEN f...   333   3e-90   
gb:BC002634_1968276 Homo sapiens SEC13-like 1 (S. cerevisiae), t...   330   4e-89   
sp|P55735|SC13_HUMAN|SC13_HUMAN SEC13-related protein.                           328   2e-88   Homo sapiens [man]
gb:AF160909_1246212 Drosophila melanogaster LD03471 full insert ...   313   5e-84   
gb:AE014297_1140964 Drosophila melanogaster chromosome 3R, compl...   313   5e-84   
pir|T39905|T39905 protein transport protein sec13 homolog, WD do...   281   1e-74   Schizosaccharomyces pombe
gb:BC006167_1970075 Homo sapiens, clone IMAGE:3959959, mRNA, par...   278   1e-73   
gb:CR382132_1666174 Yarrowia lipolytica chromosome F of strain C...   266   4e-70   
pir|T10477|T10477 sec13 protein - yeast (Pichia pastoris)             266   7e-70   Komagataella phaffii GS115
sp|P53024|SC13_PICPA|SC13_PICPA Protein transport protein SEC13.>gb:PPU5243...   266   7e-70   Komagataella pastoris
sp|Q04491|SC13_YEAST|SC13_YEAST Protein transport protein SEC13.>pir|A45442...   263   4e-69   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382123_1656207 Kluyveromyces lactis strain NRRL Y-1140 chro...   263   6e-69   
gb:CR380956_1652367 Candida glabrata strain CBS138 chromosome J ...   263   6e-69   
gb:CR382139_1672363 Debaryomyces hansenii chromosome G of strain...   260   3e-68   
gb:AE016816_1746889 Ashbya gossypii (= Eremothecium gossypii) AT...   259   9e-68   
gb:AE017349_1758832 Cryptococcus neoformans var. neoformans JEC2...   253   7e-66   
gb:CR380955_1651661 Candida glabrata strain CBS138 chromosome I ...   222   1e-56   
gb:AC024214_1204313 Caenorhabditis elegans cosmid Y77E11A, compl...   218   1e-55   
gb:AE014188_968103 Plasmodium falciparum 3D7 chromosome 12, comp...   200   5e-50   
gb:AF206628_1776748 Cucumis melo sec13-like protein mRNA, partia...   176   8e-43   
gb:AC024214_1204314 Caenorhabditis elegans cosmid Y77E11A, compl...   167   5e-40   
gb:BC084902_2564141 Xenopus tropicalis hypothetical LOC496570, m...   159   1e-37   
gb:BC073561_2557390 Xenopus laevis MGC82845 protein, mRNA (cDNA ...   158   2e-37   
gb:AF255625_1893156 Homo sapiens putative nucleoporin protein SE...   158   2e-37   
gb:AF136976_1885786 Homo sapiens sec13-like protein mRNA, comple...   158   2e-37   
gb:CR858979_1183119 Pongo pygmaeus mRNA; cDNA DKFZp469H1823 (fro...   158   2e-37   
sp|Q96EE3|SEH1_HUMAN|SEH1_HUMAN Nucleoporin SEH1 (SEC13-like protein).>gb:A...   158   2e-37   Homo sapiens [man]
gb:AK088835_1175654 Mus musculus 2 days neonate thymus thymic ce...   157   5e-37   
gb:AK011330_1156335 Mus musculus 10 days embryo whole body cDNA,...   157   5e-37   
gb:AK056940_1911868 Homo sapiens cDNA FLJ32378 fis, clone SKMUS1...   156   6e-37   
gb:AY398414_2531944 Danio rerio clone RK075A4E03 sec13-like prot...   153   5e-36   
gb:CR382128_1661031 Yarrowia lipolytica chromosome B of strain C...   139   1e-31   
gb:AE013599_1130561 Drosophila melanogaster chromosome 2R, compl...   135   2e-30   
gb:AE016819_1748798 Ashbya gossypii (= Eremothecium gossypii) AT...   128   2e-28   
sp|P53011|SEH1_YEAST|SEH1_YEAST Nuclear pore protein SEH1.>pir|S62137|S6213...   128   2e-28   Saccharomyces cerevisiae [brewer's yeast]
gb:AC116977_1207008 Dictyostelium discoideum chromosome 2 map 55...   126   9e-28   
gb:CR382126_1658650 Kluyveromyces lactis strain NRRL Y-1140 chro...   124   4e-27   
gb:CR382135_1668187 Debaryomyces hansenii chromosome C of strain...   123   6e-27   
gb:CR380956_1652438 Candida glabrata strain CBS138 chromosome J ...   123   6e-27   
gb:AY325252_1177921 Rattus norvegicus Da1-6 mRNA, complete cds.       121   3e-26   
sp|Q10099|SEH1_SCHPO|SEH1_SCHPO Nuclear pore protein SEH1 homolog.>pir|T377...   119   1e-25   Schizosaccharomyces pombe
gb:AX885787_1481240 Sequence 1650 from Patent EP1033401.              118   2e-25   
gb:BC051159_2550412 Danio rerio SEH1-like (S. cerevisiae), mRNA ...   114   3e-24   
pir|T26842|T26842 hypothetical protein Y43F4B.4 - Caenorhabditis...   107   3e-22   Caenorhabditis elegans [roundworm]
gb:BA000045_742896 Gloeobacter violaceus PCC 7421 DNA, complete ...   106   1e-21   
gb:AF323584_1786294 Podospora anserina beta transducin-like prot...   102   1e-20   
gb:AF323582_1786292 Podospora anserina beta transducin-like prot...   102   1e-20   
gb:AF323583_1786293 Podospora anserina beta transducin-like prot...   100   7e-20   
gb:BA000045_744431 Gloeobacter violaceus PCC 7421 DNA, complete ...    98   4e-19   
gb:CNS07EGH_1374321 chromosome XI of strain GB-M1 of Encephalito...    97   8e-19   
sp|Q8YRI1|YY46_ANASP|YY46_ANASP Hypothetical WD-repeat protein alr3466.>pir...    96   1e-18   Anabaena sp.
pir|AG1889|AG1889 WD-40 repeat protein [imported] - Nostoc sp. (...    96   2e-18   Nostoc sp. PCC 7120
sp|Q00808|HET1_PODAN|HET1_PODAN Vegetatible incompatibility protein HET-E-1...    96   2e-18   Podospora anserina
sp|Q8YV57|YL24_ANASP|YL24_ANASP Hypothetical WD-repeat protein all2124.>pir...    95   2e-18   Anabaena sp.
gb:AE013599_1131923 Drosophila melanogaster chromosome 2R, compl...    95   3e-18   
gb:BC044534_2548836 Danio rerio zgc:55911, mRNA (cDNA clone MGC:...    94   7e-18   
gb:BC088474_2110592 Rattus norvegicus WD40 protein Ciao1 (predic...    93   9e-18   
gb:AE017342_1754685 Cryptococcus neoformans var. neoformans JEC2...    93   9e-18   
sp|O76071|CIA1_HUMAN|CIA1_HUMAN WD-repeat containing protein Ciao 1.>gb:BC0...    92   1e-17   Homo sapiens [man]
gb:AK028376_1160958 Mus musculus 18 days pregnant adult female p...    92   3e-17   
gb:BC065658_2554103 Danio rerio zgc:55911, mRNA (cDNA clone MGC:...    91   4e-17   
gb:AK002314_1151117 Mus musculus adult male kidney cDNA, RIKEN f...    91   4e-17   
pir|T39094|T39094 WD domain, G-beta repeat protein - fission yea...    91   6e-17   Schizosaccharomyces pombe
gb:AP005824_1858512 Oryza sativa (japonica cultivar-group) genom...    89   2e-16   
gb:AE016816_1746781 Ashbya gossypii (= Eremothecium gossypii) AT...    89   2e-16   
gb:BA000045_742040 Gloeobacter violaceus PCC 7421 DNA, complete ...    88   4e-16   
pir|AE1810|AE1810 WD-40 repeat protein [imported] - Nostoc sp. (...    87   8e-16   Nostoc sp. PCC 7120
pir|AH2154|AH2154 WD-repeat protein [imported] - Nostoc sp. (str...    86   1e-15   Nostoc sp. PCC 7120
gb:BA000045_744426 Gloeobacter violaceus PCC 7421 DNA, complete ...    86   1e-15   
gb:CR382125_1658200 Kluyveromyces lactis strain NRRL Y-1140 chro...    85   2e-15   
gb:AY123095_1579963 Griffithsia japonica protein stansport prote...    85   3e-15   
gb:BA000045_741250 Gloeobacter violaceus PCC 7421 DNA, complete ...    83   9e-15   
pir|AG1837|AG1837 WD-40 repeat protein [imported] - Nostoc sp. (...    83   9e-15   Nostoc sp. PCC 7120
sp|Q8YTC2|YS00_ANASP|YS00_ANASP Hypothetical WD-repeat protein alr2800.>pir...    82   2e-14   Anabaena sp.
pir|AE1866|AE1866 WD-40 repeat protein [imported] - Nostoc sp. (...    81   3e-14   Nostoc sp. PCC 7120
gb:BA000045_742963 Gloeobacter violaceus PCC 7421 DNA, complete ...    81   4e-14   
pir|S70127|S70127 hypothetical protein YDR267c - yeast (Saccharo...    81   4e-14   Saccharomyces cerevisiae [brewer's yeast]
pir|AD1842|AD1842 WD-40 repeat protein [imported] - Nostoc sp. (...    81   4e-14   Nostoc sp. PCC 7120
gb:CR382129_1662049 Yarrowia lipolytica chromosome C of strain C...    80   6e-14   
gb:SCO939118_177541 Streptomyces coelicolor A3(2) complete genom...    79   1e-13   
pir|T42045|T42045 beta transducin-like protein homolog - Strepto...    79   1e-13   Streptomyces coelicolor
gb:AX765828_1474603 Sequence 37 from Patent WO03008440.>gb:AC004...    79   2e-13   
pir|AH2195|AH2195 hypothetical protein alr3119 [imported] - Nost...    78   4e-13   Nostoc sp. PCC 7120
gb:AB007645_1510148 Arabidopsis thaliana genomic DNA, chromosome...    77   5e-13   
gb:AF323585_1786295 Podospora anserina beta transducin-like prot...    77   6e-13   
gb:AE017347_1757920 Cryptococcus neoformans var. neoformans JEC2...    76   1e-12   
pir|T02617|T02617 hypothetical protein At2g26060 [imported] - Ar...    76   1e-12   Arabidopsis thaliana [mouse-ear cress]
pir|AC1842|AC1842 WD-40 repeat protein [imported] - Nostoc sp. (...    76   1e-12   Nostoc sp. PCC 7120
gb:BA000045_742730 Gloeobacter violaceus PCC 7421 DNA, complete ...    75   2e-12   
gb:AP004312_555846 Synechocystis sp. PCC 6803 plasmid pSYSG DNA,...    75   2e-12   
sp|Q95RJ9|EBI_DROME|EBI_DROME F-box-like/WD-repeat protein ebi.>gb:AE01413...    75   2e-12   Drosophila melanogaster
pir|AE1861|AE1861 serine/threonine kinase with WD-40 repeat [imp...    75   3e-12   Nostoc sp. PCC 7120
gb:AY339886_1320854 Crassostrea gigas WD40 protein Ciao1-like pr...    74   4e-12   
pir|AI2493|AI2493 WD-repeat protein [imported] - Nostoc sp. (str...    74   4e-12   Nostoc sp. PCC 7120
gb:CZA382_119892 Amycolatopsis orientalis cosmid pCZA382.              74   5e-12   
gb:AP002843_1823096 Oryza sativa (japonica cultivar-group) genom...    74   7e-12   
gb:BA000045_742319 Gloeobacter violaceus PCC 7421 DNA, complete ...    74   7e-12   
gb:BA000045_740981 Gloeobacter violaceus PCC 7421 DNA, complete ...    74   7e-12   
pir|AB2410|AB2410 WD-repeat protein [imported] - Nostoc sp. (str...    73   9e-12   Nostoc sp. PCC 7120
gb:CR380959_1654023 Candida glabrata strain CBS138 chromosome M ...    73   1e-11   
pir|G85034|G85034 probable WD-repeat protein [imported] - Arabid...    73   1e-11   Arabidopsis thaliana [mouse-ear cress]
sp|P49695|PKWA_THECU|PKWA_THECU Probable serine/threonine-protein kinase pk...    72   2e-11   Thermomonospora curvata
gb:AF098070_1240741 Drosophila melanogaster Lis1 homolog mRNA, c...    72   2e-11   
gb:AE013599_1132149 Drosophila melanogaster chromosome 2R, compl...    72   2e-11   
gb:AY524043_625304 Micromonospora echinospora ATCC 15835 gentami...    72   3e-11   
gb:MPU575934_149470 Micromonospora purpurea DOS biosynthetic gen...    72   3e-11   
gb:NC9G6_1688870 Neurospora crassa DNA linkage group V Cosmid co...    71   5e-11   
gb:AE017350_1759247 Cryptococcus neoformans var. neoformans JEC2...    70   6e-11   
gb:AY059116_1564480 Arabidopsis thaliana unknown protein (At1g64...    70   6e-11   
sp|Q9BQ87|TBLY_HUMAN|TBLY_HUMAN F-box-like/WD-repeat protein TBL1Y (Transdu...    70   6e-11   Homo sapiens [man]
gb:BC053205_2550597 Danio rerio platelet-activating factor acety...    70   8e-11   
gb:AL603745_2071172 Mouse DNA sequence from clone RP23-392I13 on...    70   8e-11   
gb:AK030547_1162058 Mus musculus adult male pituitary gland cDNA...    70   8e-11   
sp|Q9QXE7|TBLX_MOUSE|TBLX_MOUSE F-box-like/WD-repeat protein TBL1X (Transdu...    70   8e-11   Mus musculus [mouse]
gb:BC052304_1984804 Homo sapiens transducin (beta)-like 1X-linke...    70   1e-10   
gb:BC002884_1968496 Homo sapiens Notchless gene homolog (Drosoph...    70   1e-10   
gb:AX135811_1461885 Sequence 5 from Patent WO0132614.                  70   1e-10   
gb:CR857200_1181447 Pongo pygmaeus mRNA; cDNA DKFZp468I2316 (fro...    70   1e-10   
gb:AK031937_1162655 Mus musculus adult male medulla oblongata cD...    70   1e-10   
pir|AB2202|AB2202 hypothetical protein all3169 [imported] - Nost...    70   1e-10   Nostoc sp. PCC 7120
sp|O60907|TBLX_HUMAN|TBLX_HUMAN F-box-like/WD-repeat protein TBL1X (Transdu...    70   1e-10   Homo sapiens [man]
sp|Q8VEJ4|HUS7_MOUSE|HUS7_MOUSE WD-repeat protein HUSSY-07.>gb:BC018399_209...    70   1e-10   Mus musculus [mouse]
sp|Q9NVX2|HUS7_HUMAN|HUS7_HUMAN WD-repeat protein HUSSY-07.>gb:AX405715_146...    70   1e-10   Homo sapiens [man]
gb:AY087489_1572520 Arabidopsis thaliana clone 35985 mRNA, compl...    69   1e-10   
gb:AY032881_2508795 Xenopus laevis LIS1 mRNA, complete cds.            69   2e-10   
gb:AP005546_1853876 Oryza sativa (japonica cultivar-group) genom...    69   2e-10   
gb:BC051783_2550450 Danio rerio zgc:56312, mRNA (cDNA clone MGC:...    68   3e-10   
gb:BC066132_2554253 Xenopus tropicalis hypothetical protein MGC7...    68   4e-10   
gb:BC044530_2548832 Danio rerio platelet-activating factor acety...    68   4e-10   
gb:AF325901_1786615 Arabidopsis thaliana seh1-like protein mRNA,...    68   4e-10   
pir|AF1890|AF1890 WD-repeat protein [imported] - Nostoc sp. (str...    68   4e-10   Nostoc sp. PCC 7120
gb:AJ719937_2502124 Gallus gallus mRNA for hypothetical protein,...    67   5e-10   
gb:AF268193_1893996 Homo sapiens IRA1 mRNA, complete cds, altern...    67   5e-10   
gb:AK002371_1151155 Mus musculus adult male kidney cDNA, RIKEN f...    67   5e-10   
gb:BC073215_2557068 Xenopus laevis cDNA clone MGC:80502 IMAGE:51...    67   7e-10   
gb:AY225088_2520401 Xenopus laevis nuclear receptor co-repressor...    67   7e-10   
gb:AF268195_2060958 Mus musculus strain BALB/c IRA1 mRNA, comple...    67   7e-10   
gb:AX882446_1478938 Sequence 17351 from Patent EP1074617.>gb:AK0...    67   7e-10   
sp|P74442|Y143_SYNY3|Y143_SYNY3 Hypothetical WD-repeat protein slr0143.>pir...    67   7e-10   Synechocystis sp.
sp|Q8BHJ5|TBLR_MOUSE|TBLR_MOUSE F-box-like/WD-repeat protein TBLR1 (Nuclear...    67   7e-10   Mus musculus [mouse]
sp|Q9BZK7|TBLR_HUMAN|TBLR_HUMAN F-box-like/WD-repeat protein TBLR1 (Nuclear...    67   7e-10   Homo sapiens [man]
gb:AC024818_1204836 Caenorhabditis elegans cosmid Y54H5A, comple...    67   9e-10   
gb:AF164430_1246631 Caenorhabditis elegans LIS-1 (lis-1) mRNA, c...    66   1e-09   
gb:AC114263_1205598 Dictyostelium discoideum chromosome 2 map 21...    66   1e-09   
gb:AP003517_1830286 Oryza sativa (japonica cultivar-group) genom...    66   1e-09   
gb:CEF55B12_1364502 Caenorhabditis elegans cosmid F55B12, comple...    66   1e-09   
gb:AK036064_1164339 Mus musculus 16 days neonate cerebellum cDNA...    66   1e-09   
pir|T22703|T22703 hypothetical protein F55B12.3 - Caenorhabditis...    66   1e-09   Caenorhabditis elegans [roundworm]
sp|Q93794|SE10_CAEEL|SE10_CAEEL F-box/WD-repeat protein sel-10 (Suppressor/...    66   1e-09   Caenorhabditis elegans [roundworm]
gb:CR382132_1665406 Yarrowia lipolytica chromosome F of strain C...    65   2e-09   
gb:CER06A4_1366510 Caenorhabditis elegans cosmid R06A4, complete...    65   2e-09   
gb:BA000045_743736 Gloeobacter violaceus PCC 7421 DNA, complete ...    65   2e-09   
gb:BA000045_740800 Gloeobacter violaceus PCC 7421 DNA, complete ...    65   3e-09   
pir|C84870|C84870 probable splicing factor [imported] - Arabidop...    65   3e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AF113946_2474699 Gallus gallus LIS1 (LIS1) mRNA, complete cds.      65   3e-09   
gb:AF400434_1901097 Homo sapiens platelet-activating factor acet...    65   3e-09   
gb:AF208838_1890046 Homo sapiens isolate 4 Miller-Dieker lissenc...    65   3e-09   
gb:AF208837_1890045 Homo sapiens isolate 3 Miller-Dieker lissenc...    65   3e-09   
gb:BOVPAF45K_1435710 Bovine mRNA for PAF acetylhydrolase 45 kDa ...    65   3e-09   
gb:BA000045_741705 Gloeobacter violaceus PCC 7421 DNA, complete ...    65   3e-09   
pir|S48052|S48052 platelet-activating factor acetylhydrolase 45K...    65   3e-09   Bos taurus [bovine]
pir|S36113|S36113 LIS-1 protein - human                                65   3e-09   Homo sapiens [man]
sp|P43035|LIS1_MOUSE|LIS1_MOUSE Platelet-activating factor acetylhydrolase ...    65   3e-09   Mus musculus [mouse]
sp|P43034|LIS1_HUMAN|LIS1_HUMAN Platelet-activating factor acetylhydrolase ...    65   3e-09   Homo sapiens [man]
sp|P43033|LIS1_BOVIN|LIS1_BOVIN Platelet-activating factor acetylhydrolase ...    65   3e-09   Bos taurus [bovine]
gb:CR382131_1664016 Yarrowia lipolytica chromosome E of strain C...    64   4e-09   
gb:MUSLISB_2128749 Mus musculus LIS mRNA, partial cds.                 64   6e-09   
gb:MMPAFALIS4_2116876 Mus musculus Pafaha/Lis1 exon 4, Pafaha/Li...    64   6e-09   
gb:AY665285_1958590 Pan troglodytes platelet-activating factor a...    64   6e-09   
gb:AB083321_1871858 Macaca fascicularis pafah1b1 mRNA for platel...    64   6e-09   
gb:AE017344_1756215 Cryptococcus neoformans var. neoformans JEC2...    64   7e-09   
gb:AF319658_1418326 Sus scrofa platelet-activating factor acetyl...    64   7e-09   
gb:MMTBL1_2117530 Mus musculus partial Tbl1 gene.                      63   1e-08   
gb:BC058365_2103177 Mus musculus U5 snRNP-specific protein (Prp8...    63   1e-08   
gb:AF083383_1881616 Homo sapiens 38kDa splicing factor mRNA, com...    63   1e-08   
gb:AF323581_1786291 Podospora anserina beta transducin-like prot...    63   1e-08   
gb:PCWO3G5_1699544 Pneumocystis carinii telomeric cosmid, WO3G5.       63   1e-08   
gb:CQ782448_1451984 Sequence 2588 from Patent EP1396543.>gb:AL45...    63   1e-08   
gb:HUMLIS1C_2034077 Homo sapiens (clone 6-1) Miller-Dieker lisse...    63   1e-08   
gb:AY463620_1607709 Arabidopsis thaliana TAF5 (At5g25150) mRNA, ...    63   1e-08   
gb:SPBC713_1720377 S.pombe chromosome II cosmid c713.                  62   2e-08   
gb:PFMAL8P1_1192072 Plasmodium falciparum 3D7 chromosome 8, *** ...    62   2e-08   
gb:AK089463_1175945 Mus musculus B6-derived CD11 +ve dendritic c...    62   2e-08   
sp|Q91WQ5|TA5L_MOUSE|TA5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associ...    62   2e-08   Mus musculus [mouse]
gb:AJ719967_2502154 Gallus gallus mRNA for hypothetical protein,...    62   2e-08   
gb:CR857310_1181554 Pongo pygmaeus mRNA; cDNA DKFZp469N2132 (fro...    62   2e-08   
gb:AE014134_1126890 Drosophila melanogaster chromosome 2L, compl...    62   3e-08   
pir|JC7987|JC7987 receptor for activated C kinase, RACK protein ...    62   3e-08   Plasmodium falciparum
gb:AP005063_1847406 Oryza sativa (japonica cultivar-group) genom...    61   4e-08   
gb:AB006703_1509953 Arabidopsis thaliana genomic DNA, chromosome...    61   4e-08   
gb:CR858112_1182299 Pongo pygmaeus mRNA; cDNA DKFZp469O1927 (fro...    61   4e-08   
pir|T49682|T49682 hypothetical protein B8B20.360 [imported] - Ne...    61   4e-08   Neurospora crassa
gb:BC067651_2554823 Danio rerio cDNA clone IMAGE:6963216, partia...    61   5e-08   
gb:BC055275_2551353 Danio rerio zgc:63538, mRNA (cDNA clone MGC:...    61   5e-08   
gb:AJ721075_2503262 Gallus gallus mRNA for hypothetical protein,...    61   5e-08   
gb:BC034261_2097619 Mus musculus F-box and WD-40 domain protein ...    61   5e-08   
gb:AL669844_2072493 Mouse DNA sequence from clone RP23-395O6 on ...    61   5e-08   
gb:AB093260_2048045 Mus musculus mRNA for mKIAA0696 protein.           61   5e-08   
gb:AF090988_1882483 Homo sapiens U5 snRNP-specific 40 kDa protei...    61   5e-08   
gb:AB033280_1866304 Homo sapiens BTRCP2 mRNA for F-box and WD-re...    61   5e-08   
gb:AB033279_1866303 Homo sapiens BTRCP2 mRNA for F-box and WD-re...    61   5e-08   
gb:AB014596_1864625 Homo sapiens mRNA for KIAA0696 protein, part...    61   5e-08   
gb:AE017348_1758402 Cryptococcus neoformans var. neoformans JEC2...    61   5e-08   
gb:AK041532_1166020 Mus musculus 3 days neonate thymus cDNA, RIK...    61   5e-08   
sp|P41318|YNA6_YEAST|YNA6_YEAST Hypothetical 34.0 kDa Trp-Asp repeats conta...    61   5e-08   Saccharomyces cerevisiae [brewer's yeast]
sp|Q9UKB1|FW1B_HUMAN|FW1B_HUMAN F-box/WD-repeat protein 1B (F-box and WD-re...    61   5e-08   Homo sapiens [man]
gb:CR382128_1660900 Yarrowia lipolytica chromosome B of strain C...    60   6e-08   
gb:AY597210_1617101 Chlamydomonas reinhardtii katanin p80 subuni...    60   6e-08   
gb:CQ783661_1452567 Sequence 3801 from Patent EP1396543.>gb:AK07...    60   6e-08   
pir|T16607|T16607 hypothetical protein K10B2.1 - Caenorhabditis ...    60   6e-08   Caenorhabditis elegans [roundworm]
sp|Q09990|LI23_CAEEL|LI23_CAEEL F-box/WD-repeat protein lin-23.>gb:AF275253...    60   6e-08   Caenorhabditis elegans [roundworm]
gb:AY422998_2532084 Danio rerio TUWD12 (TUWD12) mRNA, complete cds.    60   8e-08   
gb:AC117072_1207632 Dictyostelium discoideum chromosome 2 map 38...    60   8e-08   
gb:BC085436_2564385 Danio rerio zgc:101778, mRNA (cDNA clone MGC...    60   1e-07   
gb:AF197225_1776129 Emericella nidulans TUPA (tupA) gene, comple...    60   1e-07   
gb:AC079736_1732768 Oryza sativa (japonica cultivar-group) chrom...    60   1e-07   
pir|T48933|T48933 WD repeat domain protein - Arabidopsis thalian...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC067546_2554724 Danio rerio retinoblastoma binding protein 4...    59   1e-07   
gb:BC045356_2549198 Danio rerio F-box and WD-40 domain protein 1...    59   1e-07   
gb:AB086191_2047797 Mus musculus mRNA for putative WDC146, compl...    59   1e-07   
gb:AK050653_1169412 Mus musculus 2 days neonate thymus thymic ce...    59   1e-07   
gb:AE014296_1136134 Drosophila melanogaster chromosome 3L, compl...    59   1e-07   
gb:AE010953_267897 Methanosarcina acetivorans str. C2A, section ...    59   1e-07   
pir|T26531|T26531 hypothetical protein Y18D10A.9 - Caenorhabditi...    59   1e-07   Caenorhabditis elegans [roundworm]
sp|Q9C0J8|W146_HUMAN|W146_HUMAN WD-repeat protein WDC146.>gb:AB044749_18671...    59   1e-07   Homo sapiens [man]
gb:BC045034_2548989 Xenopus laevis U5 snRNP-specific 40 kDa prot...    59   2e-07   
gb:BT008213_2151145 Synthetic construct Homo sapiens CDC20 cell ...    59   2e-07   
gb:BC000624_1966890 Homo sapiens CDC20 cell division cycle 20 ho...    59   2e-07   
gb:CR382137_1670331 Debaryomyces hansenii chromosome E of strain...    59   2e-07   
gb:BT002525_1636128 Arabidopsis thaliana Unknown protein mRNA, c...    59   2e-07   
gb:PFMAL8P1_1192110 Plasmodium falciparum 3D7 chromosome 8, *** ...    59   2e-07   
pir|A56021|A56021 probable cell division control protein p55CDC ...    59   2e-07   Homo sapiens [man]
pir|T46032|T46032 WD-40 repeat regulatory protein tup1 homolog -...    59   2e-07   Arabidopsis thaliana [mouse-ear cress]
sp|Q55563|Y163_SYNY3|Y163_SYNY3 Hypothetical WD-repeat protein sll0163.>pir...    59   2e-07   Synechocystis sp.
sp|Q12834|CC20_HUMAN|CC20_HUMAN Cell division cycle protein 20 homolog (p55...    59   2e-07   Homo sapiens [man]
gb:BC054992_2551194 Xenopus laevis hypothetical protein MGC64565...    59   2e-07   
sp|Q23256|YH92_CAEEL|YH92_CAEEL Hypothetical 54.5 kDa Trp-Asp repeats conta...    59   2e-07   Caenorhabditis elegans [roundworm]
sp|Q8IZU2|WD17_HUMAN|WD17_HUMAN WD-repeat protein 17.>gb:AF492460_1905075 H...    59   2e-07   Homo sapiens [man]
sp|Q24572|CAF1_DROME|CAF1_DROME Chromatin assembly factor 1 P55 subunit (CA...    59   2e-07   Drosophila melanogaster
gb:BC056809_2551992 Danio rerio zgc:63728, mRNA (cDNA clone MGC:...    58   3e-07   
gb:BC052110_2550459 Danio rerio retinoblastoma binding protein 4...    58   3e-07   
gb:BC045315_2549159 Danio rerio retinoblastoma binding protein 4...    58   3e-07   
gb:AE016818_1748408 Ashbya gossypii (= Eremothecium gossypii) AT...    58   3e-07   
gb:SCCDC4G_1706655 Yeast cell division cycle gene CDC4.                58   3e-07   
gb:AX135807_1461883 Sequence 1 from Patent WO0132614.                  58   3e-07   
gb:AB192873_1411117 Sus scrofa CDC20 mRNA for cell division cycl...    58   3e-07   
gb:CEY18D10A_1369517 Caenorhabditis elegans YAC Y18D10A, complet...    58   3e-07   
gb:AF339101_1263995 Heterodera glycines beta-transducin repeat-c...    58   3e-07   
sp|P07834|CDC4_YEAST|CDC4_YEAST Cell division control protein 4.>pir|S56245...    58   3e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:AX019507_1456592 Sequence 1 from Patent WO9938969.>gb:AF12953...    58   4e-07   
gb:DDI512336_1376967 Dictyostelium discoideum mRNA for LIS1 prot...    58   4e-07   
gb:CNS07EGE_1373662 chromosome VII of strain GB-M1 of Encephalit...    58   4e-07   
gb:CR857777_1181989 Pongo pygmaeus mRNA; cDNA DKFZp469O1137 (fro...    58   4e-07   
gb:CR749295_1180924 Homo sapiens mRNA; cDNA DKFZp781N011 (from c...    58   4e-07   
gb:AK007246_1153889 Mus musculus adult male testis cDNA, RIKEN f...    58   4e-07   
pir|S19487|S19487 hypothetical protein YCR072c - yeast (Saccharo...    58   4e-07   Saccharomyces cerevisiae [brewer's yeast]
pir|AG2375|AG2375 WD-40 repeat-protein [imported] - Nostoc sp. (...    58   4e-07   Nostoc sp. PCC 7120
pir|T05307|T05307 hypothetical protein F26P21.110 - Arabidopsis ...    58   4e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P25382|YCW2_YEAST|YCW2_YEAST Hypothetical WD-repeat protein YCR072C.>gb:...    58   4e-07   Saccharomyces cerevisiae [brewer's yeast]
sp|P90587|WD66_PHYPO|WD66_PHYPO 66 kDa stress protein (p66).>pir|JE0238|JE0...    58   4e-07   Physarum polycephalum
sp|Q9Y297|FW1A_HUMAN|FW1A_HUMAN F-box/WD-repeat protein 1A (F-box and WD-re...    58   4e-07   Homo sapiens [man]
gb:BC088588_2565718 Xenopus tropicalis hypothetical LOC496866, m...    57   5e-07   
gb:BC077257_2559973 Xenopus laevis retinoblastoma A associated p...    57   5e-07   
gb:BC072311_2556562 Xenopus laevis hypothetical protein MGC82618...    57   5e-07   
gb:AF073787_2471721 Xenopus laevis retinoblastoma A associated p...    57   5e-07   
gb:BC015123_1974962 Homo sapiens, Similar to retinoblastoma-bind...    57   5e-07   
gb:AL929302_1933249 Human DNA sequence from clone RP11-716A19 on...    57   5e-07   
gb:AL929302_1933248 Human DNA sequence from clone RP11-716A19 on...    57   5e-07   
gb:AE016814_1745821 Ashbya gossypii (= Eremothecium gossypii) AT...    57   5e-07   
gb:AC087851_1734183 Oryza sativa chromosome 3 BAC OSJNBb0072E24 ...    57   5e-07   
gb:AK078349_1172282 Mus musculus 10 days neonate cerebellum cDNA...    57   5e-07   
gb:AE013599_1130166 Drosophila melanogaster chromosome 2R, compl...    57   5e-07   
gb:AE010946_267844 Methanosarcina acetivorans str. C2A, section ...    57   5e-07   
pir|T49741|T49741 related to stress protein p66 [imported] - Neu...    57   5e-07   
sp|Q60973|RBB7_MOUSE|RBB7_MOUSE Histone acetyltransferase type B subunit 2 ...    57   5e-07   
sp|Q16576|RBB7_HUMAN|RBB7_HUMAN Histone acetyltransferase type B subunit 2 ...    57   5e-07   
sp|Q09028|RBB4_HUMAN|RBB4_HUMAN Chromatin assembly factor 1 subunit C (CAF-...    57   5e-07   
gb:BC064219_2553772 Xenopus tropicalis hypothetical protein MGC7...    57   7e-07   
gb:BC063984_2553684 Danio rerio retinoblastoma binding protein 4...    57   7e-07   
gb:AY394940_2531683 Danio rerio clone RK046A1D12 retinoblastoma ...    57   7e-07   
gb:AF279275_2484018 Gallus gallus Rbap46 polypeptide mRNA, compl...    57   7e-07   
gb:CR382123_1655844 Kluyveromyces lactis strain NRRL Y-1140 chro...    57   7e-07   
gb:AY608603_1617762 Exophiala dermatitidis Tup1p gene, complete ...    57   7e-07   
gb:AK076030_1171181 Mus musculus 10 days embryo whole body cDNA,...    57   7e-07   
pir|JC7558|JC7558 chromatin assembly factor-1 p48 subunit homolo...    57   7e-07   
gb:BC044710_2548906 Xenopus laevis Notchless gene homolog (Droso...    57   9e-07   
gb:BC042283_2548103 Xenopus laevis retinoblastoma binding protei...    57   9e-07   
gb:AF069737_2471573 Xenopus laevis notchless (nle) mRNA, complet...    57   9e-07   
gb:AP006149_1860959 Oryza sativa (japonica cultivar-group) genom...    57   9e-07   
gb:CR380954_1651215 Candida glabrata strain CBS138 chromosome H ...    57   9e-07   
gb:CR380949_1649444 Candida glabrata strain CBS138 chromosome C ...    57   9e-07   
gb:AB009055_1510732 Arabidopsis thaliana genomic DNA, chromosome...    57   9e-07   
gb:CQ887961_1454885 Sequence 39 from Patent WO2004085644.>gb:AF0...    57   9e-07   
gb:CQ783423_1452458 Sequence 3563 from Patent EP1396543.>gb:AK07...    57   9e-07   
gb:AF079369_1239501 Dictyostelium discoideum transcriptional rep...    57   9e-07   
gb:HSM804229_1187124 Homo sapiens mRNA; cDNA DKFZp762M0115 (from...    57   9e-07   
gb:BA000040_733745 Bradyrhizobium japonicum USDA 110 DNA, comple...    57   9e-07   
gb:AE012949_287446 Chlorobium tepidum TLS section 170 of 194 of ...    57   9e-07   
gb:BC075582_2558678 Xenopus tropicalis TAF5-like RNA polymerase ...    56   1e-06   
gb:BC073699_2557519 Xenopus laevis MGC83609 protein, mRNA (cDNA ...    56   1e-06   
gb:BC045888_2549405 Danio rerio zgc:56055, mRNA (cDNA clone MGC:...    56   1e-06   
gb:AF052695_2052536 Rattus norvegicus cell cycle protein p55CDC ...    56   1e-06   
gb:AB045313_2046010 Mus musculus mmCdc20 mRNA, complete cds.           56   1e-06   
gb:HSIEF9306_2014371 H.sapiens IEF 9306 mRNA.                          56   1e-06   
gb:AE016818_1747879 Ashbya gossypii (= Eremothecium gossypii) AT...    56   1e-06   
gb:BT012225_1641431 Arabidopsis thaliana At5g13480 gene, complet...    56   1e-06   
gb:AY383553_1604108 Pichia angusta Vps4p (VPS4) and Tup1p (TUP1)...    56   1e-06   
gb:CR857269_1181513 Pongo pygmaeus mRNA; cDNA DKFZp469A0122 (fro...    56   1e-06   
gb:AK009247_1155025 Mus musculus adult male tongue cDNA, RIKEN f...    56   1e-06   
gb:AE014296_1134707 Drosophila melanogaster chromosome 3L, compl...    56   1e-06   
pir|S33263|S33263 transcription initiation factor IID-associated...    56   1e-06   
pir|T50168|T50168 probable U4/U6 small nuclear ribonucleoprotein...    56   1e-06   
pir|A84578|A84578 probable WD-40 repeat protein [imported] - Ara...    56   1e-06   
sp|Q8C092|TAF5_MOUSE|TAF5_MOUSE Transcription initiation factor TFIID subun...    56   1e-06   
sp|P49846|TAF5_DROME|TAF5_DROME Transcription initiation factor TFIID subun...    56   1e-06   
sp|Q62623|CC20_RAT|CC20_RAT Cell division cycle protein 20 homolog (p55CD...    56   1e-06   
sp|Q9JJ66|CC20_MOUSE|CC20_MOUSE Cell division cycle protein 20 homolog (p55...    56   1e-06   
gb:BC085125_2109076 Rattus norvegicus beta-transducin repeat con...    56   2e-06   
gb:AF112979_2054942 Mus musculus beta-transducin repeat containi...    56   2e-06   
gb:AF081887_2053835 Mus musculus ubiquitin ligase FWD1 mRNA, com...    56   2e-06   
gb:HSU75309_2025968 Human TBP-associated factor (hTAFII100) mRNA...    56   2e-06   
gb:HSTAFII10_2020620 H.sapiens mRNA for TAFII100 protein.              56   2e-06   
gb:HSA9770_2009927 Homo sapiens mRNA for putative transcription ...    56   2e-06   
gb:BC052268_1984779 Homo sapiens TAF5 RNA polymerase II, TATA bo...    56   2e-06   
gb:AL591408_1930058 Human DNA sequence from clone RP11-792D24 on...    56   2e-06   
gb:AK088953_1175721 Mus musculus 2 days neonate thymus thymic ce...    56   2e-06   
gb:AK032174_1162787 Mus musculus adult male olfactory brain cDNA...    56   2e-06   
pir|AH2024|AH2024 hypothetical protein all1750 [imported] - Nost...    56   2e-06   
sp|Q15542|TAF5_HUMAN|TAF5_HUMAN Transcription initiation factor TFIID subun...    56   2e-06   
sp|O75529|TA5L_HUMAN|TA5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associ...    56   2e-06   
sp|Q60972|RBB4_MOUSE|RBB4_MOUSE Chromatin assembly factor 1 subunit C (CAF-...    56   2e-06   
sp|O14021|PRW1_SCHPO|PRW1_SCHPO RbAp48-related WD40-repeat protein prw1.>pi...    56   2e-06   
sp|Q8VBV4|FBW7_MOUSE|FBW7_MOUSE F-box/WD-repeat protein 7 (F-box and WD-40 ...    56   2e-06   
gb:AF110396_2054867 Mus musculus beta-transducin repeat-containi...    55   2e-06   
gb:BC043494_1983422 Homo sapiens WD repeat domain 5B, mRNA (cDNA...    55   2e-06   
gb:AF383178_1900017 Homo sapiens F-box protein FBX30 mRNA, parti...    55   2e-06   
gb:AP003735_1832638 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:SC6584_1705350 S.cerevisiae chromosome VI lambda clone.             55   2e-06   
gb:AX878269_1477372 Sequence 13174 from Patent EP1074617.>gb:AK0...    55   2e-06   
gb:AX877849_1477188 Sequence 12754 from Patent EP1074617.>gb:AK0...    55   2e-06   
gb:AX722159_1473864 Sequence 17 from Patent WO03024999.>gb:AY008...    55   2e-06   
gb:AX722147_1473863 Sequence 5 from Patent WO03024999.>gb:AF4119...    55   2e-06   
gb:CR857638_1181860 Pongo pygmaeus mRNA; cDNA DKFZp469A0528 (fro...    55   2e-06   
gb:ASPDRUH_582995 Anabaena sp. PCC 7120 DNA downstream region of...    55   2e-06   
sp|O24076|GBLP_MEDSA|GBLP_MEDSA Guanine nucleotide-binding protein beta sub...    55   2e-06   
sp|Q969H0|FBW7_HUMAN|FBW7_HUMAN F-box/WD-repeat protein 7 (F-box and WD-40 ...    55   2e-06   
gb:BC077313_2560027 Xenopus laevis TAF5-like RNA polymerase II, ...    55   3e-06   
gb:BC064215_2553768 Xenopus tropicalis hypothetical protein MGC7...    55   3e-06   
gb:BC037320_1982178 Homo sapiens F-box and WD-40 domain protein ...    55   3e-06   
gb:CR380956_1652130 Candida glabrata strain CBS138 chromosome J ...    55   3e-06   
gb:AC024857_1204991 Caenorhabditis elegans cosmid Y71G12A, compl...    55   3e-06   
pir|AG2400|AG2400 WD-repeat protein [imported] - Nostoc sp. (str...    55   3e-06   
pir|T15282|T15282 hypothetical protein M01D7.3 - Caenorhabditis ...    55   3e-06   
sp|Q91854|TRCB_XENLA|TRCB_XENLA Beta-TrCP (Beta-transducin repeat-containin...    55   3e-06   
gb:BC047817_2549903 Danio rerio PWP2 periodic tryptophan protein...    55   3e-06   
gb:AF427101_2065587 Mus musculus F-box protein (Fbwd6) mRNA, com...    55   3e-06   
gb:AL929302_1933251 Human DNA sequence from clone RP11-716A19 on...    55   3e-06   
gb:AP003565_1830904 Oryza sativa (japonica cultivar-group) genom...    55   3e-06   
gb:CR382127_1659807 Yarrowia lipolytica chromosome A of strain C...    55   3e-06   
gb:CR860672_1184728 Pongo pygmaeus mRNA; cDNA DKFZp459M2115 (fro...    55   3e-06   
pir|T23391|T23391 hypothetical protein K07A1.12 - Caenorhabditis...    55   3e-06   
sp|Q9V3J8|WDS_DROME|WDS_DROME Will die slowly protein.>gb:AE014298_1124067...    55   3e-06   
sp|P90916|RBA2_CAEEL|RBA2_CAEEL Trp-Asp repeats containing protein RBA-2.         55   3e-06   
gb:AF130973_1770830 Arabidopsis thaliana peroxisomal targeting s...    54   4e-06   
gb:A92590_1451234 Sequence 1 from Patent WO9811212.                    54   4e-06   
gb:CR859650_1183756 Pongo pygmaeus mRNA; cDNA DKFZp459C1034 (fro...    54   4e-06   
gb:AK045302_1167348 Mus musculus 9.5 days embryo parthenogenote ...    54   4e-06   
gb:AK016991_1158982 Mus musculus adult male testis cDNA, RIKEN f...    54   4e-06   
gb:SCO939125_179666 Streptomyces coelicolor A3(2) complete genom...    54   4e-06   
pir|B86322|B86322 F6A14.8 protein - Arabidopsis thaliana>gb:AE00...    54   4e-06   
pir|E86245|E86245 hypothetical protein [imported] - Arabidopsis ...    53   6e-06   
gb:CR382124_1656538 Kluyveromyces lactis strain NRRL Y-1140 chro...    54   6e-06   
gb:CR382123_1655797 Kluyveromyces lactis strain NRRL Y-1140 chro...    54   6e-06   
gb:AY654583_1620215 Lolium perenne FY protein (FY) mRNA, partial...    54   6e-06   
gb:AY428810_1605826 Solanum chacoense notchless-like protein mRN...    54   6e-06   
gb:AY128365_1580664 Arabidopsis thaliana putative WD-40 repeat p...    54   6e-06   
gb:AK032797_1163070 Mus musculus 12 days embryo male wolffian du...    54   6e-06   
pir|T33805|T33805 hypothetical protein W07E6.2 - Caenorhabditis ...    54   6e-06   
pir|T00798|T00798 hypothetical protein At2g32700 [imported] - Ar...    54   6e-06   
sp|Q93847|YZLL_CAEEL|YZLL_CAEEL Hypothetical 43.1 kDa Trp-Asp repeats conta...    54   6e-06   
sp|Q99973|TEP1_HUMAN|TEP1_HUMAN Telomerase protein component 1 (Telomerase-...    54   6e-06   
gb:BC056820_2552003 Danio rerio TAF5-like RNA polymerase II, p30...    54   8e-06   
gb:BC008552_2090730 Mus musculus F-box and WD-40 domain protein ...    54   8e-06   
gb:AF490391_2066997 Mus musculus sperm-associated WD repeat prot...    54   8e-06   
gb:AE016818_1747903 Ashbya gossypii (= Eremothecium gossypii) AT...    54   8e-06   
gb:SPBC1711_1719236 S.pombe chromosome II cosmid c1711.                54   8e-06   
gb:CR382131_1664617 Yarrowia lipolytica chromosome E of strain C...    54   8e-06   
gb:CR382129_1662254 Yarrowia lipolytica chromosome C of strain C...    54   8e-06   
gb:CR382125_1657426 Kluyveromyces lactis strain NRRL Y-1140 chro...    54   8e-06   
gb:AY088045_1573069 Arabidopsis thaliana clone 40637 mRNA, compl...    54   8e-06   
gb:AX135809_1461884 Sequence 3 from Patent WO0132614.                  54   8e-06   
gb:DME012588_1378719 Drosophila melanogaster mRNA for Notchless ...    54   8e-06   
gb:CR860642_1184701 Pongo pygmaeus mRNA; cDNA DKFZp459K2224 (fro...    54   8e-06   
gb:AK014865_1158168 Mus musculus adult male testis cDNA, RIKEN f...    54   8e-06   
gb:AE017188_1054024 Takifugu rubripes target 1 genomic scaffold.       54   8e-06   
gb:BA000039_726273 Thermosynechococcus elongatus BP-1 DNA, compl...    54   8e-06   
sp|O22468|MSI2_ARATH|MSI2_ARATH WD-40 repeat protein MSI2.>pir|B84544|B8454...    54   8e-06   
sp|P54313|GBB2_RAT|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/...    54   8e-06   
gb:BC056099_2551681 Xenopus laevis hypothetical protein MGC69111...    53   1e-05   
gb:AF091120_1767420 Filobasidiella neoformans G-protein beta sub...    53   1e-05   
gb:CNS07EG9_1372894 chromosome II of strain GB-M1 of Encephalito...    53   1e-05   
gb:AB076893_1197641 Ciona intestinalis Ci-betaTrCP mRNA for beta...    53   1e-05   
gb:CR857562_1181788 Pongo pygmaeus mRNA; cDNA DKFZp469J1511 (fro...    53   1e-05   
gb:AE014297_1140594 Drosophila melanogaster chromosome 3R, compl...    53   1e-05   
pir|B86415|B86415 peroxisomal targeting signal type 2 receptor, ...    53   1e-05   
sp|Q39336|GBLP_BRANA|GBLP_BRANA Guanine nucleotide-binding protein beta sub...    53   1e-05   
gb:BC064252_2553805 Xenopus tropicalis hypothetical protein MGC7...    53   1e-05   
gb:BC062834_2553423 Danio rerio zgc:77675, mRNA (cDNA clone MGC:...    53   1e-05   
gb:MMU303103_2120562 Mus musculus partial mRNA for WD repeat dom...    53   1e-05   
gb:BC049950_2100274 Mus musculus, clone IMAGE:4021341, mRNA, par...    53   1e-05   
gb:AB049460_2046167 Mus musculus ndrp mRNA for neuronal differen...    53   1e-05   
gb:HSA303102_2003524 Homo sapiens partial mRNA for WD repeat dom...    53   1e-05   
gb:BC015920_1975380 Homo sapiens guanine nucleotide binding prot...    53   1e-05   
gb:AL356776_1924719 Human DNA sequence from clone RP11-477E3 on ...    53   1e-05   
gb:AK057039_1911904 Homo sapiens cDNA FLJ32477 fis, clone SKNMC2...    53   1e-05   
gb:AE016820_1750134 Ashbya gossypii (= Eremothecium gossypii) AT...    53   1e-05   
gb:OSJN00068_1694257 Oryza sativa genomic DNA, chromosome 4, BAC...    53   1e-05   
pir|JC7538|JC7538 neuronal differentiation-related protein - mouse     53   1e-05   
sp|P87053|POF1_SCHPO|POF1_SCHPO F-box/WD-repeat protein pof1 (Skp1-binding ...    53   1e-05   
sp|Q9EPV5|APAF_RAT|APAF_RAT Apoptotic protease activating factor 1 (Apaf-...    53   1e-05   
gb:AJ719544_2501731 Gallus gallus mRNA for hypothetical protein,...    52   2e-05   
gb:BT007777_2150709 Synthetic construct Homo sapiens katanin p80...    52   2e-05   
gb:BC001353_1967515 Homo sapiens katanin p80 (WD repeat containi...    52   2e-05   
gb:AE017344_1756343 Cryptococcus neoformans var. neoformans JEC2...    52   2e-05   
gb:CR382132_1666041 Yarrowia lipolytica chromosome F of strain C...    52   2e-05   
gb:AF100286_1241136 Trypanosoma congolense strain IL1180 activat...    52   2e-05   
gb:AK034103_1163633 Mus musculus adult male diencephalon cDNA, R...    52   2e-05   
gb:AK031630_1162530 Mus musculus 13 days embryo male testis cDNA...    52   2e-05   
gb:AK010364_1155709 Mus musculus ES cells cDNA, RIKEN full-lengt...    52   2e-05   
gb:BC089247_2566129 Xenopus laevis cDNA clone MGC:85213 IMAGE:33...    52   2e-05   
gb:BC068665_2555169 Xenopus laevis hypothetical protein MGC81050...    52   2e-05   
gb:BC052124_2550472 Danio rerio zgc:76895, mRNA (cDNA clone MGC:...    52   2e-05   
gb:AJ719722_2501909 Gallus gallus mRNA for hypothetical protein,...    52   2e-05   
gb:BC082996_2108468 Mus musculus telomerase associated protein 1...    52   2e-05   
gb:BC028268_2096165 Mus musculus WD repeat domain 17, mRNA (cDNA...    52   2e-05   
gb:AF029262_1762405 Arabidopsis thaliana putative cdc20 protein ...    52   2e-05   
gb:NCB7H23_1690170 Neurospora crassa DNA linkage group V BAC con...    52   2e-05   
gb:AY082798_1569212 Penicillium marneffei TupA protein (tupA) ge...    52   2e-05   
gb:AF032878_1234644 Drosophila melanogaster Slimb (slimb) mRNA, ...    52   2e-05   
gb:AK044241_1166883 Mus musculus adult retina cDNA, RIKEN full-l...    52   2e-05   
gb:AE014134_1126817 Drosophila melanogaster chromosome 2L, compl...    52   2e-05   
gb:AF116463_480168 Streptomyces lincolnensis putative oxidoreduc...    52   2e-05   
pir|T05978|T05978 hypothetical protein F17M5.30 - Arabidopsis th...    52   2e-05   
pir|T24399|T24399 hypothetical protein T03F6.5 - Caenorhabditis ...    52   2e-05   
sp|P97499|TEP1_MOUSE|TEP1_MOUSE Telomerase protein component 1 (Telomerase-...    52   2e-05   
sp|P20053|PRP4_YEAST|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4....    52   2e-05   
sp|P93107|PF20_CHLRE|PF20_CHLRE Flagellar WD-repeat protein PF20.>pir|T0818...    52   2e-05   
sp|Q8R537|PEX7_CRIGR|PEX7_CRIGR Peroxisomal targeting signal 2 receptor (PT...    52   2e-05   
sp|P49178|GBB_MAIZE|GBB_MAIZE Guanine nucleotide-binding protein beta subu...    52   2e-05   
sp|P17343|GBB1_CAEEL|GBB1_CAEEL Guanine nucleotide-binding protein beta sub...    52   2e-05   
gb:BC045906_2549422 Danio rerio zgc:56096, mRNA (cDNA clone MGC:...    52   3e-05   
gb:BC044118_2548510 Xenopus laevis glutamate rich WD repeat prot...    52   3e-05   
gb:AB090160_1524945 Triticum aestivum TaGB1 mRNA for G protein b...    52   3e-05   
gb:AX879719_1477953 Sequence 14624 from Patent EP1074617.>gb:AK0...    52   3e-05   
sp|P97865|PEX7_MOUSE|PEX7_MOUSE Peroxisomal targeting signal 2 receptor (PT...    52   3e-05   
sp|Q94775|GBLP_TRYBB|GBLP_TRYBB Guanine nucleotide-binding protein beta sub...    52   3e-05   
gb:BC088650_2565777 Xenopus laevis hypothetical LOC496198, mRNA ...    51   4e-05   
gb:BC059354_2552389 Xenopus laevis hypothetical protein MGC69179...    51   4e-05   
gb:BC047819_2549905 Danio rerio zgc:56071, mRNA (cDNA clone MGC:...    51   4e-05   
gb:AC090119_2467641 Takifugu rubripes clone 242D16, complete seq...    51   4e-05   
gb:BC061006_2104235 Mus musculus coronin 7, mRNA (cDNA clone MGC...    51   4e-05   
gb:AF218388_2059471 Rattus norvegicus apoptotic protease activat...    51   4e-05   
gb:AY497046_1954852 Homo sapiens bromodomain and WD repeat domai...    51   4e-05   
gb:AL590031_1929282 Human DNA sequence from clone RP11-285F11 on...    51   4e-05   
gb:AF310672_1896230 Homo sapiens PF20 variant 1a (PF20) mRNA, co...    51   4e-05   
gb:AF052432_1879229 Homo sapiens katanin p80 subunit mRNA, compl...    51   4e-05   
gb:BNAJ4078_1633446 Brassica napus mRNA with similarity to p55cd...    51   4e-05   
gb:AY675107_1621929 Ostreococcus tauri CDC20 protein (CDC20) gen...    51   4e-05   
gb:AK040408_1165633 Mus musculus 0 day neonate thymus cDNA, RIKE...    51   4e-05   
gb:AE013599_1133653 Drosophila melanogaster chromosome 2R, compl...    51   4e-05   
pir|T05977|T05977 hypothetical protein F17M5.20 - Arabidopsis th...    51   4e-05   
pir|T41148|T41148 trp-asp repeat containing protein - fission ye...    51   4e-05   
sp|Q9D2V7|W70T_MOUSE|W70T_MOUSE 70 kDa WD-repeat tumor rejection antigen ho...    51   4e-05   
sp|Q40687|GBB_ORYSA|GBB_ORYSA Guanine nucleotide-binding protein beta subu...    51   4e-05   
gb:BC083883_2108942 Rattus norvegicus glutamate-rich WD repeat c...    51   5e-05   
gb:BC083143_2108546 Mus musculus glutamate-rich WD repeat contai...    51   5e-05   
gb:BC028896_2096378 Mus musculus glutamate-rich WD repeat contai...    51   5e-05   
gb:BC008121_2090626 Mus musculus glutamate-rich WD repeat contai...    51   5e-05   
gb:AB001539_2043097 Mus musculus mRNA for A301 protein, complete...    51   5e-05   
gb:AF242546_1892559 Homo sapiens YTM1 mRNA, complete cds.              51   5e-05   
gb:AE017344_1756566 Cryptococcus neoformans var. neoformans JEC2...    51   5e-05   
gb:AB020749_1514648 Arabidopsis thaliana genomic DNA, chromosome...    51   5e-05   
gb:AX877440_1477003 Sequence 12345 from Patent EP1074617.>gb:AK0...    51   5e-05   
gb:AK077611_1171950 Mus musculus 8 days embryo whole body cDNA, ...    51   5e-05   
gb:AK038378_1165021 Mus musculus 16 days neonate thymus cDNA, RI...    51   5e-05   
sp|Q39836|GBLP_SOYBN|GBLP_SOYBN Guanine nucleotide-binding protein beta sub...    51   5e-05   


>pir|T00593|T02480 sec13-related protein At2g30050 - Arabidopsis
            thaliana>gb:AC004165_1531519 Arabidopsis thaliana
            chromosome 2 clone T27E13 map m283, complete
            sequence.>gb:AC004680_1532004 Arabidopsis thaliana
            chromosome 2 clone F23F1 map m283, complete
            sequence.>gb:AY124848_1580213 Arabidopsis thaliana
            At2g30050/F23F1.3 mRNA, complete cds.>gb:AF412112_1797365
            Arabidopsis thaliana At2g30050/F23F1.3 mRNA, complete
            cds.
          Length = 302

 Score =  530 bits (1364), Expect = e-149
 Identities = 240/294 (81%), Positives = 266/294 (90%)
 Frame = +3

Query: 174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW 353
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct: 1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQQLATLTGHRGPVW 60

Query: 354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            +V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQ HVF DHKSSVNSI+WAPH++GL L
Sbjct: 61   EVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSL 120

Query: 534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAP+ APGALV SGL DPV KLA
Sbjct: 121  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPATAPGALVSSGLLDPVYKLA 180

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            S GCDNTVKVWKL NG WKMDCFPALQ HT+WVRDVAWAPNLGLPKSTIAS S+DGKV+I
Sbjct: 181  SGGCDNTVKVWKLANGSWKMDCFPALQKHTDWVRDVAWAPNLGLPKSTIASGSQDGKVII 240

Query: 894  WTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            WTV KEG+QWEGKVL DF TPVWRVSWSLTGNLLAV+ G+NNVT+W EAVDGEW
Sbjct: 241  WTVGKEGEQWEGKVLKDFMTPVWRVSWSLTGNLLAVSDGNNNVTVWKEAVDGEW 294



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 29/90 (32%), Positives = 39/90 (43%), Gaps = 4/90 (4%)
 Frame = +3

Query: 201 HSDTVHDVS----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           H+D V DV+    +      +A+ S D  + I  V           L     PVW+VSW+
Sbjct: 209 HTDWVRDVAWAPNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSWS 268

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQ 458
               G+LLA    +  V VWKE    EW Q
Sbjct: 269 LT--GNLLAVSDGNNNVTVWKEAVDGEWEQ 296



>gb:AY087553_1572583 Arabidopsis thaliana clone 36577 mRNA, complete
            sequence.
          Length = 302

 Score =  524 bits (1350), Expect = e-147
 Identities = 239/294 (81%), Positives = 265/294 (90%)
 Frame = +3

Query: 174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW 353
            MP QKIETGH D VHDV MDYYGKR+ATASSD +IKI GVSNN  SQ LATL GH GPVW
Sbjct: 1    MPGQKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQQLATLTGHRGPVW 60

Query: 354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            +V+WAHPK+GS+LASCS+DG+VI+WKEGNQN+WTQ HVF DHKSSVNSI+WAPH++GL L
Sbjct: 61   EVAWAHPKYGSILASCSYDGQVILWKEGNQNQWTQDHVFTDHKSSVNSIAWAPHDIGLSL 120

Query: 534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
            ACGSSDGNISV+TAR+DGGWDT+RIDQAHP+GVT+VSWAP+ APGALV SGL DPV KLA
Sbjct: 121  ACGSSDGNISVFTARADGGWDTSRIDQAHPVGVTSVSWAPATAPGALVSSGLLDPVYKLA 180

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            S GCDNTVKVWKL NG WKMDCFPALQ HT+WVRDVAWAPNLGLPKSTIAS S+DGKV+I
Sbjct: 181  SGGCDNTVKVWKLANGSWKMDCFPALQKHTDWVRDVAWAPNLGLPKSTIASGSQDGKVII 240

Query: 894  WTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            WTV KEG+QWEGKVL DF TPVWRVS SLTGNLLAV+ G+NNVT+W EAVDGEW
Sbjct: 241  WTVGKEGEQWEGKVLKDFMTPVWRVSSSLTGNLLAVSDGNNNVTVWKEAVDGEW 294



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 28/90 (31%), Positives = 38/90 (42%), Gaps = 4/90 (4%)
 Frame = +3

Query: 201 HSDTVHDVS----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           H+D V DV+    +      +A+ S D  + I  V           L     PVW+VS +
Sbjct: 209 HTDWVRDVAWAPNLGLPKSTIASGSQDGKVIIWTVGKEGEQWEGKVLKDFMTPVWRVSSS 268

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQ 458
               G+LLA    +  V VWKE    EW Q
Sbjct: 269 LT--GNLLAVSDGNNNVTVWKEAVDGEWEQ 296



>gb:ATAC010676_1543135 Arabidopsis thaliana chromosome III BAC T22N4
            genomic sequence, complete sequence.>gb:AY063079_1565655
            Arabidopsis thaliana putative transport protein SEC13
            (At3g01340) mRNA, complete cds.>gb:AF370262_1792147
            Arabidopsis thaliana putative transport protein SEC13
            (At3g01340) mRNA, complete cds.
          Length = 302

 Score =  524 bits (1349), Expect = e-147
 Identities = 236/294 (80%), Positives = 264/294 (89%)
 Frame = +3

Query: 174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW 353
            MP QKIETGHSDT+HDV MDYYGKRVATASSD +IKI GVSN+  SQHLATL GH GPVW
Sbjct: 1    MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVW 60

Query: 354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPHELGL L
Sbjct: 61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSL 120

Query: 534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV SG+ DPV KLA
Sbjct: 121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALVSSGMIDPVYKLA 180

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            S GCD+TVKVWK  NG WKMDCFPAL  HT+WVRDVAWAPNLGLPKSTIAS SEDGKV+I
Sbjct: 181  SGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVII 240

Query: 894  WTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            WT+ KEG+QWEG VL DF TPVWRVSWSLTGNLLAV+ G+NNVT+W E+VDGEW
Sbjct: 241  WTIGKEGEQWEGTVLKDFKTPVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEW 294



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 29/93 (31%), Positives = 40/93 (43%), Gaps = 4/93 (4%)
 Frame = +3

Query: 201 HSDTVHDVS----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           H+D V DV+    +      +A+ S D  + I  +           L     PVW+VSW+
Sbjct: 209 HTDWVRDVAWAPNLGLPKSTIASGSEDGKVIIWTIGKEGEQWEGTVLKDFKTPVWRVSWS 268

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV 467
               G+LLA    +  V VWKE    EW Q  V
Sbjct: 269 LT--GNLLAVSDGNNNVTVWKESVDGEWEQVTV 299



>gb:AY087647_1572676 Arabidopsis thaliana clone 37331 mRNA, complete
            sequence.
          Length = 301

 Score =  515 bits (1326), Expect = e-145
 Identities = 234/294 (79%), Positives = 262/294 (89%)
 Frame = +3

Query: 174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW 353
            MP QKIETGHSDT+HDV MDYYGKRVATASSD +IKI GVSN+  SQHLATL GH GPVW
Sbjct: 1    MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVW 60

Query: 354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            QV+WAHPKFGSLLASCS+DG++I+WKEGNQN+WTQAHVF DHK SVNSI+WAPHELGL L
Sbjct: 61   QVAWAHPKFGSLLASCSYDGQIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSL 120

Query: 534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
            ACG+SDGNISV++AR+DGGWDT +IDQAHP+GVT+VSWAP+  PGALV SG+ DPV KLA
Sbjct: 121  ACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAPATEPGALVSSGMIDPVYKLA 180

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            S GCD+TVKVWK  NG WKMDCFPAL  HT+WVRDVAWAPNLGLPKSTIAS SEDGKV+I
Sbjct: 181  SGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVII 240

Query: 894  WTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            WT+ K G+QWEG VL DF TPVWRVSWSLT NLLAV+ G+NNVT+W E+VDGEW
Sbjct: 241  WTIGK-GEQWEGTVLKDFKTPVWRVSWSLTANLLAVSDGNNNVTVWKESVDGEW 293



 Score = 40.0 bits (92), Expect = 0.087
 Identities = 29/93 (31%), Positives = 39/93 (41%), Gaps = 4/93 (4%)
 Frame = +3

Query: 201 HSDTVHDVS----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           H+D V DV+    +      +A+ S D  + II             L     PVW+VSW+
Sbjct: 209 HTDWVRDVAWAPNLGLPKSTIASGSEDGKV-IIWTIGKGEQWEGTVLKDFKTPVWRVSWS 267

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV 467
                +LLA    +  V VWKE    EW Q  V
Sbjct: 268 LT--ANLLAVSDGNNNVTVWKESVDGEWEQVTV 298



>gb:AB055156_1521428 Oryza sativa mRNA for Sec13p, complete
            cds.>gb:AP005474_1852523 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0081C13.
          Length = 305

 Score =  512 bits (1318), Expect = e-144
 Identities = 236/298 (79%), Positives = 267/298 (89%), Gaps = 4/298 (1%)
 Frame = +3

Query: 174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW 353
            MP  KIETGH D VHD++MDYYGKR+ATASSD +IKIIGVS NS  Q LATL+GH GPVW
Sbjct: 1    MPPHKIETGHQDVVHDIAMDYYGKRIATASSDNTIKIIGVSGNS-HQQLATLSGHQGPVW 59

Query: 354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            QV+WAHPK+GSLLASCS+DG+VI+WKEG++ +EW QAH F +HKSSVNSI+WAPHELGLC
Sbjct: 60   QVAWAHPKYGSLLASCSYDGRVIIWKEGSKPDEWAQAHTFIEHKSSVNSIAWAPHELGLC 119

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG---SGLHDPV 701
            LACGSSDGNISV+TARSDGGWDT RIDQAHP+GVT+VSWAP+MAPGAL+    SG  + V
Sbjct: 120  LACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALINTGPSGQFEYV 179

Query: 702  QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDG 881
            QKLAS GCDNTVKVWKLYNG W+MDCFPALQMH +WVRDVAWAPNLGLPKSTIASAS+DG
Sbjct: 180  QKLASGGCDNTVKVWKLYNGSWRMDCFPALQMHRDWVRDVAWAPNLGLPKSTIASASQDG 239

Query: 882  KVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
             VVIWT  KEG+QWEG+VLYDF TPVWR+SWSLTGN+LAV+ G++NVTLW EAVDGEW
Sbjct: 240  TVVIWTAPKEGEQWEGRVLYDFQTPVWRLSWSLTGNILAVSDGNDNVTLWKEAVDGEW 297



 Score = 40.4 bits (93), Expect = 0.067
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 4/90 (4%)
 Frame = +3

Query: 201 HSDTVHDVS----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           H D V DV+    +      +A+AS D ++ I              L     PVW++SW+
Sbjct: 212 HRDWVRDVAWAPNLGLPKSTIASASQDGTVVIWTAPKEGEQWEGRVLYDFQTPVWRLSWS 271

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQ 458
               G++LA    +  V +WKE    EW Q
Sbjct: 272 LT--GNILAVSDGNDNVTLWKEAVDGEWQQ 299



>gb:AP003738_1832698 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1058_C08.>gb:AP006266_1861549 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0003K21.
          Length = 315

 Score =  422 bits (1085), Expect = e-117
 Identities = 193/295 (65%), Positives = 243/295 (82%), Gaps = 1/295 (0%)
 Frame = +3

Query: 174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV 350
            M ++KIE  H D VHD ++DYYGKR+ATASSD+++KI  +   S  SQ LATL+GH+GPV
Sbjct: 1    MSSKKIELDHKDMVHDSAIDYYGKRLATASSDSTVKISSIGGKSAPSQLLATLSGHYGPV 60

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            W+V+WAHPK+G++LASCS+DG+VI+WKEG    W+QAHVF DHKSSVNSI+WAP+E+GLC
Sbjct: 61   WRVAWAHPKYGTILASCSYDGRVIIWKEGAGGHWSQAHVFTDHKSSVNSIAWAPYEVGLC 120

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LACGSSDG ISV T R+DGGWDTARI++AHP+GVTA+SWAP+ A G+L GSG  + V KL
Sbjct: 121  LACGSSDGTISVMTMRADGGWDTARIERAHPVGVTAISWAPATALGSLAGSG--ELVYKL 178

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
             S G D+ VKVW   NG WK++      +HT+ VRDVAWAP LGL K+TIASAS+DGKVV
Sbjct: 179  VSGGFDSVVKVWGFVNGGWKLESALPSDVHTDCVRDVAWAPVLGLAKATIASASQDGKVV 238

Query: 891  IWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            IW+  K GD+WEGKV++DF +PVWRVSWSLTGN+L+VA+G+NN+TLW +A DG+W
Sbjct: 239  IWSRGKVGDKWEGKVMHDFGSPVWRVSWSLTGNILSVAAGENNITLWKQASDGQW 293



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 4/121 (3%)
 Frame = +3

Query: 246 RVATASSDASIKIIGVSNNSTSQHLATLAGHHGP-VWQVSWAHPKFG---SLLASCSFDG 413
           ++ +   D+ +K+ G  N       A  +  H   V  V+WA P  G   + +AS S DG
Sbjct: 177 KLVSGGFDSVVKVWGFVNGGWKLESALPSDVHTDCVRDVAWA-PVLGLAKATIASASQDG 235

Query: 414 KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW 593
           KV++W  G   +  +  V +D  S V  +SW+    G  L+  + + NI+++   SDG W
Sbjct: 236 KVVIWSRGKVGDKWEGKVMHDFGSPVWRVSWSL--TGNILSVAAGENNITLWKQASDGQW 293

Query: 594 D 596
           +
Sbjct: 294 E 294



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 4/90 (4%)
 Frame = +3

Query: 201 HSDTVHDVS----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           H+D V DV+    +      +A+AS D  + I              +     PVW+VSW+
Sbjct: 208 HTDCVRDVAWAPVLGLAKATIASASQDGKVVIWSRGKVGDKWEGKVMHDFGSPVWRVSWS 267

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQ 458
               G++L+  + +  + +WK+ +  +W +
Sbjct: 268 LT--GNILSVAAGENNITLWKQASDGQWEE 295



>gb:AC133339_1741418 Oryza sativa chromosome 3 BAC OSJNBa0078D06
            genomic sequence, complete sequence.>gb:AC133778_1741480
            Oryza sativa chromosome 3 BAC OSJNBb0027B08 genomic
            sequence, complete sequence.
          Length = 301

 Score =  415 bits (1066), Expect = e-114
 Identities = 192/295 (65%), Positives = 236/295 (80%), Gaps = 1/295 (0%)
 Frame = +3

Query: 174  MPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST-SQHLATLAGHHGPV 350
            M + KIE  H D VHD ++DYYGK +ATASSD++++I  +   S  SQ LATL+GH+GPV
Sbjct: 1    MSSNKIELDHKDMVHDSAIDYYGKSLATASSDSTVQISSIGGASAPSQLLATLSGHYGPV 60

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            W+V+WAHPKFGS+LASC +DG+V+VWKEG   +W+QAHVF++HKSS+NSI+WAP+ELGLC
Sbjct: 61   WRVAWAHPKFGSILASCGYDGRVVVWKEGAAGQWSQAHVFDNHKSSLNSIAWAPYELGLC 120

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LACGSSDG+ISV T R DGGWD+  I+QAHP+GV AVSWAP+ A G++VGSG  + VQKL
Sbjct: 121  LACGSSDGSISVMTMRPDGGWDSTTIEQAHPVGVMAVSWAPATALGSIVGSG--ELVQKL 178

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
             S G D  VKVW   NG WK+D      MHT+ VRDV+WAP LGL K TIASASEDGKVV
Sbjct: 179  VSGGFDCVVKVWAFVNGSWKLDSVLPSDMHTDCVRDVSWAPVLGLAKFTIASASEDGKVV 238

Query: 891  IWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            IWT  KEGD+WEGKV++DF  P WRVSWSLTGN+L+VA+G  ++TLW EA DG+W
Sbjct: 239  IWTKGKEGDKWEGKVMHDFEAPAWRVSWSLTGNILSVAAGSGDITLWKEASDGQW 293



 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = +3

Query: 336 HHGPVWQVSWAHPKFGSL---LASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
           H   V  VSWA P  G     +AS S DGKV++W +G + +  +  V +D ++    +SW
Sbjct: 208 HTDCVRDVSWA-PVLGLAKFTIASASEDGKVVIWTKGKEGDKWEGKVMHDFEAPAWRVSW 266

Query: 507 APHELGLCLACGSSDGNISVYTARSDGGWD 596
           +     L +A GS  G+I+++   SDG W+
Sbjct: 267 SLTGNILSVAAGS--GDITLWKEASDGQWE 294



>gb:BC061419_2553193 Xenopus tropicalis hypothetical protein MGC76017,
            mRNA (cDNA clone MGC:76017 IMAGE:5384687), complete cds.
          Length = 320

 Score =  340 bits (873), Expect = 2e-92
 Identities = 160/293 (54%), Positives = 203/293 (69%), Gaps = 4/293 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-IADLRGHEGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+LGL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDLGLVLACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV---GSGLHDPVQKLASA 719
            DG IS+ T   DG W+  +I  AH IG  AVSWAPS+ PG+LV    S   + +++  S 
Sbjct: 126  DGAISILTYTGDGPWEVKKISNAHTIGCNAVSWAPSVVPGSLVDQPSSQKPNYIKRFVSG 185

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
            GCDN VK+W+  +G WK D    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IWT
Sbjct: 186  GCDNLVKIWREEDGQWKED--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWT 243

Query: 900  VAKEGDQ-WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                    W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  SDDAATNCWNPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 296



 Score = 40.0 bits (92), Expect = 0.087
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 5/112 (4%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKIIGVSNNSTS-QHLATLAGHHGP 347
           QK+E  HSD V DV    S+      +A+ S D  + I    + +T+  +   L   +  
Sbjct: 205 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWTSDDAATNCWNPKLLHKFNDV 263

Query: 348 VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
           VW VSW+     ++LA    D KV +WKE    +W      N  + +V++++
Sbjct: 264 VWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSTVT 313



>gb:BC054585_2550996 Danio rerio zgc:63980, mRNA (cDNA clone MGC:63980
            IMAGE:6792353), complete cds.
          Length = 320

 Score =  339 bits (869), Expect = 7e-92
 Identities = 158/293 (53%), Positives = 202/293 (68%), Gaps = 4/293 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQIL-VADLRGHEGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ W P++ GL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWKEENST-WDKMYEYTGHDSSVNSVCWGPYDFGLILACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDP---VQKLASA 719
            DG ISV T   DG WD  +I+ AH IG  AVSWAP++ PG+L+          +++  S 
Sbjct: 126  DGAISVLTCSGDGHWDIKKINNAHTIGCNAVSWAPAVVPGSLIEQPTGQKPNYIKRFVSG 185

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
            GCDN VK+WK  +G WK D    L+ H++WVRDV WAP++GLP STIAS S+DG+V IWT
Sbjct: 186  GCDNLVKLWKEEDGQWKED--QKLEAHSDWVRDVGWAPSIGLPTSTIASCSQDGRVFIWT 243

Query: 900  V-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                 G+ W  K+L+ FN  VW VSWS+TGN+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  CDDPAGNTWTAKLLHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESVDGQW 296



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 5/112 (4%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV 350
           QK+E  HSD V DV    S+      +A+ S D  + I    + + +   A L      V
Sbjct: 205 QKLEA-HSDWVRDVGWAPSIGLPTSTIASCSQDGRVFIWTCDDPAGNTWTAKLLHKFNDV 263

Query: 351 -WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
            W VSW+    G++LA    D KV +WKE    +W      N  + +V+SI+
Sbjct: 264 VWHVSWSIT--GNILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSSIT 313



>gb:BC073381_2557223 Xenopus laevis cDNA clone MGC:80813
            IMAGE:5513833, complete cds.
          Length = 320

 Score =  338 bits (866), Expect = 2e-91
 Identities = 159/293 (54%), Positives = 202/293 (68%), Gaps = 4/293 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGIRLATCSSDRSVKIFDVKNGGQIL-IADLRGHEGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDFGLLLACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV---GSGLHDPVQKLASA 719
            DG IS+ T   DG W+  +I  AH IG  AVSWAPS+ PG+LV    S   + +++  S 
Sbjct: 126  DGAISILTYTGDGPWEVKKISNAHTIGCNAVSWAPSVVPGSLVDQPSSQKPNYIKRFVSG 185

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
            GCDN VK+W+  +G WK D    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IWT
Sbjct: 186  GCDNLVKIWREEDGQWKED--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWT 243

Query: 900  VAKEGDQ-WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                    W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  SDDAATNCWTPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 296



 Score = 40.8 bits (94), Expect = 0.051
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV 350
           QK+E  HSD V DV    S+      +A+ S D  + I    + +T+     L      V
Sbjct: 205 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWTSDDAATNCWTPKLLHKFNDV 263

Query: 351 -WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
            W VSW+     ++LA    D KV +WKE    +W      N  + SV++++
Sbjct: 264 VWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWACISDVNKGQGSVSTVT 313



>gb:BC043755_2548217 Xenopus laevis SEC13-like 1 (S. cerevisiae), mRNA
            (cDNA clone MGC:52900 IMAGE:4889307), complete cds.
          Length = 320

 Score =  337 bits (864), Expect = 3e-91
 Identities = 159/293 (54%), Positives = 202/293 (68%), Gaps = 4/293 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGIRLATCSSDRSVKIFDVKNGGQIL-IADLRGHDGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + + +  H SSVNS+ WAPH+ GL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTYEYTGHDSSVNSVCWAPHDFGLVLACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV---GSGLHDPVQKLASA 719
            DG IS+ T   DG W+  +I  AH IG  AVSWAPS+ PG+LV    S   + +++  S 
Sbjct: 126  DGAISILTFTGDGPWEVKKISNAHTIGCNAVSWAPSVIPGSLVDQPSSQKPNYIKRFVSG 185

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
            GCDN VK+W+  +G WK D    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IWT
Sbjct: 186  GCDNLVKIWREEDGQWKED--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWT 243

Query: 900  VAKEGDQ-WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                    W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  SDDAATNCWTPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 296



 Score = 39.7 bits (91), Expect = 0.11
 Identities = 32/112 (28%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV 350
           QK+E  HSD V DV    S+      +A+ S D  + I    + +T+     L      V
Sbjct: 205 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVYIWTSDDAATNCWTPKLLHKFNDV 263

Query: 351 -WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
            W VSW+     ++LA    D KV +WKE    +W      N  + +V++++
Sbjct: 264 VWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWACISDVNKGQGAVSTVT 313



>gb:BC084705_2109015 Rattus norvegicus SEC13-like 1, mRNA (cDNA clone
            MGC:105923 IMAGE:7301091), complete cds.
          Length = 322

 Score =  334 bits (856), Expect = 2e-90
 Identities = 159/294 (54%), Positives = 207/294 (70%), Gaps = 5/294 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLH-DPVQKLASA 719
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+   SG   + ++K AS 
Sbjct: 126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASG 185

Query: 720  GCDNTVKVWK-LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
            GCDN +K+W+   +G WK +    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IW
Sbjct: 186  GCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIW 243

Query: 897  TV-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            T     G+ W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  TCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 297



 Score = 39.7 bits (91), Expect = 0.11
 Identities = 36/112 (32%), Positives = 50/112 (44%), Gaps = 7/112 (6%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKII---GVSNNSTSQHLATLAGHH 341
           QK+E  HSD V DV    S+      +A+ S D  + I      S N  S  L  L   +
Sbjct: 206 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKL--LHKFN 262

Query: 342 GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
             VW VSW+     ++LA    D KV +WKE    +W      N  + SV++
Sbjct: 263 DVVWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSA 312



>gb:BC002128_2088891 Mus musculus SEC13-like 1 (S. cerevisiae), mRNA
            (cDNA clone MGC:6737 IMAGE:3590767), complete cds.
          Length = 322

 Score =  334 bits (856), Expect = 2e-90
 Identities = 159/294 (54%), Positives = 207/294 (70%), Gaps = 5/294 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLH-DPVQKLASA 719
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+   SG   + ++K AS 
Sbjct: 126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASG 185

Query: 720  GCDNTVKVWK-LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
            GCDN +K+W+   +G WK +    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IW
Sbjct: 186  GCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIW 243

Query: 897  TV-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            T     G+ W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  TCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 297



 Score = 38.9 bits (89), Expect = 0.19
 Identities = 36/112 (32%), Positives = 50/112 (44%), Gaps = 7/112 (6%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKII---GVSNNSTSQHLATLAGHH 341
           QK+E  HSD V DV    S+      +A+ S D  + I      S N  S  L  L   +
Sbjct: 206 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKL--LHKFN 262

Query: 342 GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
             VW VSW+     ++LA    D KV +WKE    +W      N  + SV++
Sbjct: 263 DVVWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWGCISDVNKGQGSVSA 312



>gb:AK003354_1151809 Mus musculus 18-day embryo whole body cDNA, RIKEN
            full-length enriched library, clone:1110003H02
            product:SEC13-RELATED PROTEIN homolog [Homo sapiens],
            full insert sequence.
          Length = 322

 Score =  334 bits (856), Expect = 2e-90
 Identities = 159/294 (54%), Positives = 207/294 (70%), Gaps = 5/294 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLH-DPVQKLASA 719
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+   SG   + ++K AS 
Sbjct: 126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASG 185

Query: 720  GCDNTVKVWK-LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
            GCDN +K+W+   +G WK +    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IW
Sbjct: 186  GCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIW 243

Query: 897  TV-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            T     G+ W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  TCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 297



 Score = 39.7 bits (91), Expect = 0.11
 Identities = 36/112 (32%), Positives = 50/112 (44%), Gaps = 7/112 (6%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKII---GVSNNSTSQHLATLAGHH 341
           QK+E  HSD V DV    S+      +A+ S D  + I      S N  S  L  L   +
Sbjct: 206 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKL--LHKFN 262

Query: 342 GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
             VW VSW+     ++LA    D KV +WKE    +W      N  + SV++
Sbjct: 263 DVVWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSA 312



>gb:AK009755_1155332 Mus musculus adult male tongue cDNA, RIKEN
            full-length enriched library, clone:2310042K15
            product:SEC13-RELATED PROTEIN homolog [Homo sapiens],
            full insert sequence.
          Length = 318

 Score =  333 bits (855), Expect = 3e-90
 Identities = 159/294 (54%), Positives = 207/294 (70%), Gaps = 5/294 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 4    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFHVRNGGQIL-IADLRGHEGPVWQVAWA 62

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+WKE N   W + H  + H SSVNS+ WAPH+ GL LACGSS
Sbjct: 63   HPMYGNILASCSYDRKVIIWKEEN-GTWEKTHEHSGHDSSVNSVCWAPHDYGLILACGSS 121

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLH-DPVQKLASA 719
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+   SG   + ++K AS 
Sbjct: 122  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIKKFASG 181

Query: 720  GCDNTVKVWK-LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
            GCDN +K+W+   +G WK +    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IW
Sbjct: 182  GCDNLIKLWREEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIW 239

Query: 897  TV-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            T     G+ W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 240  TCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 293



 Score = 39.7 bits (91), Expect = 0.11
 Identities = 36/112 (32%), Positives = 50/112 (44%), Gaps = 7/112 (6%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKII---GVSNNSTSQHLATLAGHH 341
           QK+E  HSD V DV    S+      +A+ S D  + I      S N  S  L  L   +
Sbjct: 202 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASGNMWSPKL--LHKFN 258

Query: 342 GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
             VW VSW+     ++LA    D KV +WKE    +W      N  + SV++
Sbjct: 259 DVVWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSA 308



>gb:BC002634_1968276 Homo sapiens SEC13-like 1 (S. cerevisiae),
            transcript variant 1, mRNA (cDNA clone MGC:4272
            IMAGE:3605545), complete cds.
          Length = 325

 Score =  330 bits (845), Expect = 4e-89
 Identities = 160/303 (52%), Positives = 210/303 (69%), Gaps = 7/303 (2%)
 Frame = +3

Query: 168  GKMPA--QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHH 341
            GKM +    ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH 
Sbjct: 2    GKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHE 60

Query: 342  GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHEL 521
            GPVWQV+WAHP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAPH+ 
Sbjct: 61   GPVWQVAWAHPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAPHDY 119

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLH- 692
            GL LACGSSDG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+   SG   
Sbjct: 120  GLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKP 179

Query: 693  DPVQKLASAGCDNTVKVWK-LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASA 869
            + +++ AS GCDN +K+WK   +G WK +    L+ H++WVRDVAWAP++GLP STIAS 
Sbjct: 180  NYIKRFASGGCDNLIKLWKEEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASC 237

Query: 870  SEDGKVVIWTV-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVD 1046
            S+DG+V IWT      + W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VD
Sbjct: 238  SQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVD 297

Query: 1047 GEW 1055
            G+W
Sbjct: 298  GQW 300



 Score = 40.8 bits (94), Expect = 0.051
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 7/112 (6%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKII---GVSNNSTSQHLATLAGHH 341
           QK+E  HSD V DV    S+      +A+ S D  + I      S+N+ S  L  L   +
Sbjct: 209 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKL--LHKFN 265

Query: 342 GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
             VW VSW+     ++LA    D KV +WKE    +W      N  + SV++
Sbjct: 266 DVVWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSA 315



>sp|P55735|SC13_HUMAN SEC13-related protein.
          Length = 322

 Score =  328 bits (840), Expect = 2e-88
 Identities = 156/294 (53%), Positives = 205/294 (69%), Gaps = 5/294 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +  L GH GPVWQV+WA
Sbjct: 8    VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IVDLRGHEGPVWQVAWA 66

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAPH+ GL LACGSS
Sbjct: 67   HPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSS 125

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLH-DPVQKLASA 719
            DG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+   SG   + +++ AS 
Sbjct: 126  DGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASG 185

Query: 720  GCDNTVKVWK-LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
            GCDN +K+WK   +G WK +    L+ H++WVRDVAWAP++GLP STIAS S+DG+V IW
Sbjct: 186  GCDNLIKLWKEEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIW 243

Query: 897  TV-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            T      + W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG+W
Sbjct: 244  TCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQW 297



 Score = 40.8 bits (94), Expect = 0.051
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 7/112 (6%)
 Frame = +3

Query: 183 QKIETGHSDTVHDV----SMDYYGKRVATASSDASIKII---GVSNNSTSQHLATLAGHH 341
           QK+E  HSD V DV    S+      +A+ S D  + I      S+N+ S  L  L   +
Sbjct: 206 QKLEA-HSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKL--LHKFN 262

Query: 342 GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
             VW VSW+     ++LA    D KV +WKE    +W      N  + SV++
Sbjct: 263 DVVWHVSWSIT--ANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSA 312



>gb:AF160909_1246212 Drosophila melanogaster LD03471 full insert cDNA.
          Length = 386

 Score =  313 bits (801), Expect = 5e-84
 Identities = 146/295 (49%), Positives = 200/295 (67%), Gaps = 4/295 (1%)
 Frame = +3

Query: 183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS 362
            Q+I+T H D VH  ++D+YG  +AT SSD S++I     N+ +  LA L GH GPVWQV+
Sbjct: 36   QEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNKA--LAELKGHQGPVWQVA 93

Query: 363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG 542
            WAHPKFG++LASCS+D KVIVWK     +WT+ + +++H SSVNS+ +AP E GL LAC 
Sbjct: 94   WAHPKFGNILASCSYDRKVIVWKSTTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVLACA 153

Query: 543  SSDGNISVYTARSD-GGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHD---PVQKL 710
            SSDG++SV T  ++ G WD  +I  AH IGV A+SW P+ AP       +      V++L
Sbjct: 154  SSDGSVSVLTCNTEYGVWDAKKIPNAHTIGVNAISWCPAQAPDPAFDQRVTSRSAAVKRL 213

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
             S GCDN VK+W+  N  W  +    L+ H++WVRDVAWAP++GLP+S IA+AS+D  V+
Sbjct: 214  VSGGCDNLVKIWREDNDRWVEE--HRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVI 271

Query: 891  IWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            +W+   +  +W   VL+ F+  VW +SWS TGN+LAV  GDNNVTLW E  +G+W
Sbjct: 272  VWSSNADLSEWTSTVLHTFDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQW 326



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 5/110 (4%)
 Frame = +3

Query: 201 HSDTVHDV----SMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSW 365
           HSD V DV    S+     ++ATAS D  + I+  SN   S+  +T L      VW +SW
Sbjct: 241 HSDWVRDVAWAPSIGLPRSQIATASQDRHV-IVWSSNADLSEWTSTVLHTFDDAVWSISW 299

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPH 515
           +    G++LA    D  V +WKE  + +W + +  +         S  PH
Sbjct: 300 STT--GNILAVTGGDNNVTLWKENTEGQWIRINYESGTAIQSKQPSHLPH 347



>gb:AE014297_1140964 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003743_1222957 Drosophila melanogaster
            chromosome 3R, section 81 of 118 of the complete
            sequence.
          Length = 356

 Score =  313 bits (801), Expect = 5e-84
 Identities = 146/295 (49%), Positives = 200/295 (67%), Gaps = 4/295 (1%)
 Frame = +3

Query: 183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS 362
            Q+I+T H D VH  ++D+YG  +AT SSD S++I     N+ +  LA L GH GPVWQV+
Sbjct: 6    QEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNKA--LAELKGHQGPVWQVA 63

Query: 363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG 542
            WAHPKFG++LASCS+D KVIVWK     +WT+ + +++H SSVNS+ +AP E GL LAC 
Sbjct: 64   WAHPKFGNILASCSYDRKVIVWKSTTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVLACA 123

Query: 543  SSDGNISVYTARSD-GGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHD---PVQKL 710
            SSDG++SV T  ++ G WD  +I  AH IGV A+SW P+ AP       +      V++L
Sbjct: 124  SSDGSVSVLTCNTEYGVWDAKKIPNAHTIGVNAISWCPAQAPDPAFDQRVTSRSAAVKRL 183

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
             S GCDN VK+W+  N  W  +    L+ H++WVRDVAWAP++GLP+S IA+AS+D  V+
Sbjct: 184  VSGGCDNLVKIWREDNDRWVEE--HRLEAHSDWVRDVAWAPSIGLPRSQIATASQDRHVI 241

Query: 891  IWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            +W+   +  +W   VL+ F+  VW +SWS TGN+LAV  GDNNVTLW E  +G+W
Sbjct: 242  VWSSNADLSEWTSTVLHTFDDAVWSISWSTTGNILAVTGGDNNVTLWKENTEGQW 296



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 5/110 (4%)
 Frame = +3

Query: 201 HSDTVHDV----SMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSW 365
           HSD V DV    S+     ++ATAS D  + I+  SN   S+  +T L      VW +SW
Sbjct: 211 HSDWVRDVAWAPSIGLPRSQIATASQDRHV-IVWSSNADLSEWTSTVLHTFDDAVWSISW 269

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPH 515
           +    G++LA    D  V +WKE  + +W + +  +         S  PH
Sbjct: 270 STT--GNILAVTGGDNNVTLWKENTEGQWIRINYESGTAIQSKQPSHLPH 317



>pir|T39905|T39905 protein transport protein sec13 homolog, WD domain
            containing - fission yeast (Schizosaccharomyces
            pombe)>gb:SPBC215_1719521 S.pombe chromosome II cosmid
            c215.
          Length = 297

 Score =  281 bits (720), Expect = 1e-74
 Identities = 145/287 (50%), Positives = 186/287 (64%), Gaps = 3/287 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            ++T H D +HD  +DYYGKR+AT SSD +IK+  + NN  +  L TL GH GPVWQ+ WA
Sbjct: 4    VDTQHDDMIHDAILDYYGKRLATCSSDQTIKVFSIENNQQTL-LETLRGHSGPVWQLGWA 62

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HPKFG++LAS S+DG VIVW+E     W++      H++SVN++SWAPHE G  LAC SS
Sbjct: 63   HPKFGTILASASYDGHVIVWRETG-GVWSELMDHTAHQASVNAVSWAPHEYGALLACASS 121

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            DG +SV   + DG  DT RI  AH  G  AV W+P    G++VG       +KLA+AGCD
Sbjct: 122  DGKVSVLEFKDDGSCDT-RIFTAHEPGCNAVCWSPPSLSGSVVGQSPAAGPKKLATAGCD 180

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            N VK+W    GV        L  H +W RDVAWAP++GL K+ +ASAS+D  V IWT  K
Sbjct: 181  NLVKIWAFDAGVNNWILEDTLAGHVDWTRDVAWAPSVGLTKTYLASASQDKNVFIWT--K 238

Query: 909  EGD-QWEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            EGD  W+   L +   P   WRVSWSL+GN+LAV+ GDN V L+ E+
Sbjct: 239  EGDGPWQKTPLTEEKFPDIAWRVSWSLSGNILAVSCGDNKVYLFKES 285



>gb:BC006167_1970075 Homo sapiens, clone IMAGE:3959959, mRNA, partial
            cds.
          Length = 264

 Score =  278 bits (711), Expect = 1e-73
 Identities = 131/242 (54%), Positives = 174/242 (71%), Gaps = 5/242 (2%)
 Frame = +3

Query: 345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG 524
            PVWQV+WAHP +G++LASCS+D KVI+W+E N   W ++H    H SSVNS+ WAPH+ G
Sbjct: 1    PVWQVAWAHPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSVNSVCWAPHDYG 59

Query: 525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLH-D 695
            L LACGSSDG IS+ T   +G W+  +I+ AH IG  AVSWAP++ PG+L+   SG   +
Sbjct: 60   LILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPN 119

Query: 696  PVQKLASAGCDNTVKVWK-LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASAS 872
             +++ AS GCDN +K+WK   +G WK +    L+ H++WVRDVAWAP++GLP STIAS S
Sbjct: 120  YIKRFASGGCDNLIKLWKEEEDGQWKEE--QKLEAHSDWVRDVAWAPSIGLPTSTIASCS 177

Query: 873  EDGKVVIWTV-AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
            +DG+V IWT      + W  K+L+ FN  VW VSWS+T N+LAV+ GDN VTLW E+VDG
Sbjct: 178  QDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDG 237

Query: 1050 EW 1055
            +W
Sbjct: 238  QW 239



>gb:CR382132_1666174 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 298

 Score =  266 bits (681), Expect = 4e-70
 Identities = 141/290 (48%), Positives = 186/290 (64%), Gaps = 5/290 (1%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
            H D +HD  +DYYGKR+AT SSD +IKI  +  ++  + + TL GH GPVWQVSWAHPKF
Sbjct: 8    HDDLIHDAVLDYYGKRLATCSSDKTIKIFEIDGDN-HKLVETLRGHEGPVWQVSWAHPKF 66

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            GS++AS S+DGKV +W+E N   WT     + H +SVNS+ WAP E G  L C SSDGN+
Sbjct: 67   GSIIASASYDGKVFIWREEN-GRWTNI-AQHQHNASVNSVVWAPQEYGPLLLCASSDGNV 124

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG--SGLHDPVQKLASAGCDNT 734
            SV   + +GG   A    AH +G  + SWAP    G+L+   +G      ++ + GCDN 
Sbjct: 125  SVVEFK-EGGNCEATTFAAHDVGANSASWAPPAVSGSLIQPINGKASNNIRIVTGGCDNL 183

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            VK+WK             L  H +WVRDVAW+ ++ L KS IASAS+D  V++WT  +EG
Sbjct: 184  VKIWKYDPSSKTYVIEETLSGHKDWVRDVAWSSSV-LSKSYIASASQDKTVIVWT--QEG 240

Query: 915  DQ-WEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            +Q W+ K+L D   P  VW+VSWSL+GN+LAV+ GDN VTLW E + GEW
Sbjct: 241  NQPWKKKLLQDIPFPDVVWKVSWSLSGNVLAVSGGDNKVTLWKENLTGEW 290



 Score = 41.6 bits (96), Expect = 0.030
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 4/98 (4%)
 Frame = +3

Query: 195 TGHSDTVHDV--SMDYYGKR-VATASSDASIKIIGVSNNST-SQHLATLAGHHGPVWQVS 362
           +GH D V DV  S     K  +A+AS D ++ +     N    + L         VW+VS
Sbjct: 203 SGHKDWVRDVAWSSSVLSKSYIASASQDKTVIVWTQEGNQPWKKKLLQDIPFPDVVWKVS 262

Query: 363 WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND 476
           W+    G++LA    D KV +WKE    EW  A V  +
Sbjct: 263 WSLS--GNVLAVSGGDNKVTLWKENLTGEWESAGVVEE 298



>pir|T10477|T10477 sec13 protein - yeast (Pichia pastoris)
          Length = 288

 Score =  266 bits (679), Expect = 7e-70
 Identities = 137/291 (47%), Positives = 181/291 (62%), Gaps = 2/291 (0%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            I   H D +HD  +DYYG+R+AT SSD +IKI  +   +  + + TL GH GPVWQV+WA
Sbjct: 3    IGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIDGEN-QRLVETLIGHEGPVWQVAWA 61

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HPKFG +LASCS+DGKV++WKE N   W +    + H++SVNS+SWAPHE G  L C SS
Sbjct: 62   HPKFGVILASCSYDGKVLIWKEDN-GVWNKVAEHSVHQASVNSVSWAPHEYGPVLLCASS 120

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            DG IS+   + DGG     + Q H IG  A SWAP   P         D  ++  S GCD
Sbjct: 121  DGKISIVEFK-DGGALEPIVIQGHAIGGNAASWAPISLP---------DNTRRFVSGGCD 170

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            N VK+W+  +         A Q H++WVRDVAW+P+  L KS IA+AS+D  V+IWT   
Sbjct: 171  NLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPS-RLSKSYIATASQDRTVLIWTKDG 229

Query: 909  EGDQWEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            + ++WE + L     P   WR SWSL+GN+LA++ GDN VTL  E + G+W
Sbjct: 230  KSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLSKENIQGKW 280



>sp|P53024|SC13_PICPA Protein transport protein
            SEC13.>gb:PPU52430_1701720 Pichia pastoris Sec13p (SEC13)
            gene, complete cds.
          Length = 289

 Score =  266 bits (679), Expect = 7e-70
 Identities = 137/291 (47%), Positives = 181/291 (62%), Gaps = 2/291 (0%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            I   H D +HD  +DYYG+R+AT SSD +IKI  +   +  + + TL GH GPVWQV+WA
Sbjct: 4    IGNAHDDLIHDAVLDYYGRRLATCSSDKTIKIFEIDGEN-QRLVETLIGHEGPVWQVAWA 62

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HPKFG +LASCS+DGKV++WKE N   W +    + H++SVNS+SWAPHE G  L C SS
Sbjct: 63   HPKFGVILASCSYDGKVLIWKEDN-GVWNKVAEHSVHQASVNSVSWAPHEYGPVLLCASS 121

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            DG IS+   + DGG     + Q H IG  A SWAP   P         D  ++  S GCD
Sbjct: 122  DGKISIVEFK-DGGALEPIVIQGHAIGGNAASWAPISLP---------DNTRRFVSGGCD 171

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            N VK+W+  +         A Q H++WVRDVAW+P+  L KS IA+AS+D  V+IWT   
Sbjct: 172  NLVKIWRYDDAAKTFIEEEAFQGHSDWVRDVAWSPS-RLSKSYIATASQDRTVLIWTKDG 230

Query: 909  EGDQWEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            + ++WE + L     P   WR SWSL+GN+LA++ GDN VTL  E + G+W
Sbjct: 231  KSNKWEKQPLTKEKFPDVCWRASWSLSGNVLAISGGDNKVTLSKENIQGKW 281



>sp|Q04491|SC13_YEAST Protein transport protein
            SEC13.>pir|A45442|A45442 transport versicle formation
            protein SEC13 [validated] - yeast (Saccharomyces
            cerevisiae)>gb:YSCH8167_1729044 Saccharomyces cerevisiae
            chromosome XII cosmid 8167.>gb:YSCSEC13P_1730558
            Saccharomyces cerevisiae Sec13 gene, complete cds.
          Length = 297

 Score =  263 bits (673), Expect = 4e-69
 Identities = 134/291 (46%), Positives = 182/291 (62%), Gaps = 2/291 (0%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            I   H++ +HD  +DYYGKR+AT SSD +IKI  V    T + + TL GH GPVW+V WA
Sbjct: 4    IANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGE-THKLIDTLTGHEGPVWRVDWA 62

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HPKFG++LASCS+DGKV++WKE N   W+Q  V   H +SVNS+ WAPHE G  L   SS
Sbjct: 63   HPKFGTILASCSYDGKVLIWKEEN-GRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASS 121

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            DG +SV   + +G      ID AH IGV + SWAP+        +G  +  +K  + G D
Sbjct: 122  DGKVSVVEFKENGTTSPIIID-AHAIGVNSASWAPATIEEDGEHNGTKES-RKFVTGGAD 179

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            N VK+WK  +          L+ H++WVRDVAW+P + L +S +AS S+D   +IWT   
Sbjct: 180  NLVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTV-LLRSYLASVSQDRTCIIWTQDN 238

Query: 909  EGDQWEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            E   W+  +L +   P  +WR SWSL+GN+LA++ GDN VTLW E ++G+W
Sbjct: 239  EQGPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKW 289



 Score = 37.4 bits (85), Expect = 0.57
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 6/94 (6%)
 Frame = +3

Query: 198 GHSDTVHDVSMD---YYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHH---GPVWQV 359
           GHSD V DV+          +A+ S D +  II   +N       TL         +W+ 
Sbjct: 202 GHSDWVRDVAWSPTVLLRSYLASVSQDRTC-IIWTQDNEQGPWKKTLLKEEKFPDVLWRA 260

Query: 360 SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA 461
           SW+    G++LA    D KV +WKE  + +W  A
Sbjct: 261 SWSLS--GNVLALSGGDNKVTLWKENLEGKWEPA 292



>gb:CR382123_1656207 Kluyveromyces lactis strain NRRL Y-1140
            chromosome C of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 302

 Score =  263 bits (671), Expect = 6e-69
 Identities = 134/295 (45%), Positives = 179/295 (60%), Gaps = 6/295 (2%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            I   HS+ +HD  +DYYGKR+AT SSD ++KI  V    T + + TL GH GPVWQV WA
Sbjct: 4    INNAHSELIHDAVLDYYGKRLATCSSDHTVKIFEVEGE-THKLVDTLQGHEGPVWQVDWA 62

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HPKFG +LASCS+DGKV++WKE N   W+Q      H +SVNSI WAPHE G  L   SS
Sbjct: 63   HPKFGVILASCSYDGKVLIWKEVN-GRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASS 121

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS----MAPGALVGSGLHDPVQKLAS 716
            DG +SV   + +G      ID AH IG     WAP+     +     GS     V++  +
Sbjct: 122  DGKVSVVEFKENGTTSPIIID-AHSIGANTACWAPATLQQQSNQGTSGSASPQQVRRFVT 180

Query: 717  AGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             G DN VK+WK  +          L+ H++WVRDVAW+P + L +S +AS S+D   +IW
Sbjct: 181  GGADNLVKIWKYNSDAATYLLEHTLEGHSDWVRDVAWSPTV-LSRSYLASVSQDRTCIIW 239

Query: 897  TVAKEGDQWEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            T   + D W+  +L +   P  +WR SWSL+GN+LA++ GDN VTLW E ++G+W
Sbjct: 240  TQDSKEDTWKKTLLKEDKFPDVLWRASWSLSGNILALSCGDNTVTLWKENLEGKW 294



>gb:CR380956_1652367 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 298

 Score =  263 bits (671), Expect = 6e-69
 Identities = 135/292 (46%), Positives = 179/292 (61%), Gaps = 2/292 (0%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            +I   H+D +HD  +DYYGK++AT SSD +IKI  V   S  + + TL GH GPVW+V W
Sbjct: 3    EIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVEGES-HKLVDTLVGHEGPVWRVDW 61

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            AHPKFG++LASCS+DGKVI+WKE N + W+Q  V   H +SVNS+ WAPHE G  L   S
Sbjct: 62   AHPKFGTILASCSYDGKVIIWKEEN-DRWSQIAVHAVHTASVNSVQWAPHEYGALLLAAS 120

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            SDG +SV   + + G  T  I  AH IGV A SWAP+   G          V++  + G 
Sbjct: 121  SDGKVSVVEFK-ENGTATPLIFDAHAIGVNAASWAPATVEGGNNPGEAPKEVRRFVTGGA 179

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            DN VK+W+             L+ H++WVRDVAW+P++ L +S IAS S+D    IWT  
Sbjct: 180  DNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWSPSV-LLRSYIASVSQDRTCNIWTQE 238

Query: 906  KEGDQWEGKVL--YDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                 W    L   +F   +WR SWSL+GN+LA++ GDN VTLW E ++G+W
Sbjct: 239  DNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTLWKENLNGKW 290



 Score = 40.0 bits (92), Expect = 0.087
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 5/97 (5%)
 Frame = +3

Query: 198 GHSDTVHDVSMD---YYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP--VWQVS 362
           GHSD V DV+          +A+ S D +  I    +N+       L     P  +W+ S
Sbjct: 203 GHSDWVRDVAWSPSVLLRSYIASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRAS 262

Query: 363 WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFN 473
           W+    G++LA    D KV +WKE    +W  A   N
Sbjct: 263 WSLS--GNILAISGGDNKVTLWKENLNGKWESAGEVN 297



>gb:CR382139_1672363 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 297

 Score =  260 bits (665), Expect = 3e-68
 Identities = 133/292 (45%), Positives = 183/292 (62%), Gaps = 3/292 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            I   H D +HD  +DYYGKR+AT SSD +IK+  V      + + TL GH GPVWQV+WA
Sbjct: 4    IGNAHDDLIHDAVLDYYGKRLATCSSDKTIKLFEVEGTENYKLVETLIGHEGPVWQVAWA 63

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            HPKFGS+LASCS+DGK ++WKE  +  +W+       H++SVNS+SWAPHELG  L C S
Sbjct: 64   HPKFGSILASCSYDGKALIWKEQPETQQWSIIAEHTVHQASVNSVSWAPHELGAILLCTS 123

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            SDG +SV     DG       D AH IGV + SWAP ++     G   +  +++  + G 
Sbjct: 124  SDGKVSVVDFNDDGTTSHIIFD-AHAIGVNSASWAP-LSNNNTKGKDTNS-IRRFVTCGS 180

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            DN  K+WK  +          L+ HT+WVRDV W+P++ L +S IA+AS+D  V+IW+  
Sbjct: 181  DNLAKIWKFDSSKNAYIEEAVLEGHTDWVRDVCWSPSI-LIRSYIATASQDRTVLIWSQD 239

Query: 906  KEGDQWEGKVLYD--FNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
              G +W+ ++L +  F    WR SWSL+GN+LAV+ GDN V+LW E + G+W
Sbjct: 240  NNG-KWQKQLLTEEMFPDVCWRCSWSLSGNILAVSGGDNKVSLWKENLQGKW 290



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 32/92 (34%), Positives = 42/92 (45%), Gaps = 4/92 (4%)
 Frame = +3

Query: 198 GHSDTVHDVSMD---YYGKRVATASSDASIKIIGVSNNSTSQ-HLATLAGHHGPVWQVSW 365
           GH+D V DV           +ATAS D ++ I    NN   Q  L T        W+ SW
Sbjct: 204 GHTDWVRDVCWSPSILIRSYIATASQDRTVLIWSQDNNGKWQKQLLTEEMFPDVCWRCSW 263

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA 461
           +    G++LA    D KV +WKE  Q +W  A
Sbjct: 264 SLS--GNILAVSGGDNKVSLWKENLQGKWESA 293



>gb:AE016816_1746889 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 295

 Score =  259 bits (661), Expect = 9e-68
 Identities = 131/292 (44%), Positives = 180/292 (61%), Gaps = 3/292 (1%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            I   H++ +HD  +DYYGKR+AT SSD +I+I  V  +S  + + +L GH GPVWQV WA
Sbjct: 4    ITNAHTELIHDAVLDYYGKRLATCSSDKTIQIFEVDGDS-HKLVDSLHGHEGPVWQVDWA 62

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
            HPKFG +LASCS+DGKV++WKE N   W+Q   +  H +SVNS+ WAPHE G  L C SS
Sbjct: 63   HPKFGVILASCSYDGKVLIWKEEN-GRWSQIAAYEVHSASVNSVKWAPHEYGPLLLCSSS 121

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDP-VQKLASAGC 725
            DG  SV   + +G      ID AH IGV A  WAP+     +   G     ++++A+ G 
Sbjct: 122  DGKFSVVEFKENGTTSPIIID-AHAIGVNAACWAPA----TIEDDGQQSQHLRRIATGGA 176

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            DN VK+WK             L  H +WVRDVAW+P++ LP++ +A+ S+D   +IWT  
Sbjct: 177  DNLVKIWKYNPEANTYLLEDTLAAHADWVRDVAWSPSV-LPRAYLATVSQDRTCIIWTQE 235

Query: 906  KEGDQWEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                 W   +L +   P  +WR SWSL+GN+LA++ GDN VTLW E ++G+W
Sbjct: 236  NNQGPWTKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKENLEGKW 287



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 5/92 (5%)
 Frame = +3

Query: 201 HSDTVHDVSMD---YYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP--VWQVSW 365
           H+D V DV+          +AT S D +  I    NN        L     P  +W+ SW
Sbjct: 201 HADWVRDVAWSPSVLPRAYLATVSQDRTCIIWTQENNQGPWTKTLLKEDKFPDVLWRASW 260

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA 461
           +    G++LA    D KV +WKE  + +W  A
Sbjct: 261 SLS--GNILALSGGDNKVTLWKENLEGKWESA 290



>gb:AE017349_1758832 Cryptococcus neoformans var. neoformans JEC21
            chromosome 9, complete sequence.
          Length = 339

 Score =  253 bits (645), Expect = 7e-66
 Identities = 136/315 (43%), Positives = 173/315 (54%), Gaps = 26/315 (8%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            +ET H D +HD  +DYYGKR+AT SSD +I+I  V           L GH   VWQVSWA
Sbjct: 18   VETQHEDMIHDAQLDYYGKRLATCSSDRTIRIFNVIKGEAKGEPVILKGHTAAVWQVSWA 77

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNE-----------WTQAHVFNDHKSSVNSISWAPH 515
            HP FGS+LASCS+DG+V +WKE  Q +           W +      H +SVNSI+WAP+
Sbjct: 78   HPSFGSILASCSYDGRVFIWKEVGQGQGKGSGGELQDGWERIKEHTLHTASVNSIAWAPY 137

Query: 516  ELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHD 695
            +LG  LAC SSDG +SV + ++DG  +   I  AH  G  A+SWAPS+       S    
Sbjct: 138  DLGPILACASSDGKVSVLSFQNDGSIE-VNIFPAHGTGANAISWAPSVLSTVSGVSRSQQ 196

Query: 696  PVQKLA------SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
            P   LA      +AG DN +++W       K      ++ H +WVRDVAWAPN+GLP   
Sbjct: 197  PSNSLAPQKRFVTAGSDNLIRIWGFDEEQKKWTEEETIKGHEDWVRDVAWAPNIGLPGMY 256

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLY---------DFNTPVWRVSWSLTGNLLAVASG 1010
            IASAS+D  V+I +       W    L           F   VWRVSWSL GN+LAV+ G
Sbjct: 257  IASASQDRTVLIHSRPSPSSSWTSAPLLPSLPQSQDPHFPDAVWRVSWSLAGNVLAVSCG 316

Query: 1011 DNNVTLWNEAVDGEW 1055
            D  V+LW E V   W
Sbjct: 317  DGKVSLWKEGVGKGW 331



>gb:CR380955_1651661 Candida glabrata strain CBS138 chromosome I
            complete sequence.
          Length = 303

 Score =  222 bits (566), Expect = 1e-56
 Identities = 123/303 (40%), Positives = 171/303 (56%), Gaps = 13/303 (4%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSN-NSTSQHLATLAGHHGPVWQVS 362
            KIE  H   +H  +++YYG R+AT SSD ++KI  +++ N++S  L TL GH GPVW   
Sbjct: 3    KIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNSSSLLETLVGHEGPVWYAD 62

Query: 363  WAHPKFG-SLLASCSFDGKVIVWKE---GNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            W HP  G +LLA+C +DGKV++WKE   G + +    H    H +SVN + WAPHE GL 
Sbjct: 63   WCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAV--HSASVNCVKWAPHEYGLI 120

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            L CGS+DG ISV   +      T  +D AH  GV ++SWAP M   +         V++ 
Sbjct: 121  LLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWAPLMKTDSSDDGDETTAVKQF 180

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
             S G DN VK+WK  +          L+ H + V  V W+P   L +S +AS S D + +
Sbjct: 181  ISGGNDNLVKIWKFDDDQETYVVADTLEGHKDAVTAVDWSPTT-LLQSYVASVSNDKQCL 239

Query: 891  IWTV--AKEGDQW------EGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVD 1046
            +WT   + + + W      EGK    F   +  VSWSL+GNLLAV+  D NVT+W E+ D
Sbjct: 240  VWTQDHSSKKNDWKKISVNEGK----FEQKLGSVSWSLSGNLLAVSDDDKNVTIWKESGD 295

Query: 1047 GEW 1055
            G+W
Sbjct: 296  GKW 298



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 7/125 (5%)
 Frame = +3

Query: 243 KRVATASSDASIKIIGVSNNSTSQHLA-TLAGHHGPVWQVSWAHPKF-GSLLASCSFDGK 416
           K+  +  +D  +KI    ++  +  +A TL GH   V  V W+      S +AS S D +
Sbjct: 178 KQFISGGNDNLVKIWKFDDDQETYVVADTLEGHKDAVTAVDWSPTTLLQSYVASVSNDKQ 237

Query: 417 VIVWKEGN---QNEWTQAHVFNDHK--SSVNSISWAPHELGLCLACGSSDGNISVYTARS 581
            +VW + +   +N+W +  V N+ K    + S+SW+    G  LA    D N++++    
Sbjct: 238 CLVWTQDHSSKKNDWKKISV-NEGKFEQKLGSVSWSLS--GNLLAVSDDDKNVTIWKESG 294

Query: 582 DGGWD 596
           DG W+
Sbjct: 295 DGKWE 299



>gb:AC024214_1204313 Caenorhabditis elegans cosmid Y77E11A, complete
            sequence.
          Length = 313

 Score =  218 bits (556), Expect = 1e-55
 Identities = 114/295 (38%), Positives = 168/295 (56%), Gaps = 4/295 (1%)
 Frame = +3

Query: 183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS 362
            Q+I+T H D +HD  ++ YG R+AT  SD  +KI  V  N  S  +A L GH GPVW+VS
Sbjct: 6    QRIDTQHRDAIHDAQLNIYGSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVS 65

Query: 363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG 542
            WAHPK+G LLAS S+D KVI+W E  Q  W +A+ +  H++S   +++APH+ GL LA  
Sbjct: 66   WAHPKYGGLLASASYDKKVIIWNE-QQGRWQKAYEWAAHEASTTCVAFAPHQYGLMLASA 124

Query: 543  SSDGNISVYT-ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK--LA 713
            S+DG+I +     S   W +++I + H  GV +V WAP  A          DP  K  L 
Sbjct: 125  SADGDIGILRYDNSSNEWISSKIQKCHEQGVNSVCWAPGSA----------DPAAKKRLV 174

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            SAG D  VK+W   +   +      L  HT++VR+ AW P     + TI S   +G +V+
Sbjct: 175  SAGNDKNVKIWAFDDATNEWILEKTLAGHTDFVREAAWCPVTNNGQHTIVSCGMEGNLVL 234

Query: 894  WTVAK-EGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            +  +  E ++W+ K+L      ++  S+S  G+ L+VA  DN +T+W E + G+W
Sbjct: 235  FRTSNIETEEWKAKLLETAPCALYHSSFSPCGSFLSVAGDDNVITIWRENLQGQW 289



>gb:AE014188_968103 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014849_1229495 Plasmodium falciparum 3D7
            chromosome 12, section 6 of 9 of the complete sequence.
          Length = 822

 Score =  200 bits (508), Expect = 5e-50
 Identities = 113/325 (34%), Positives = 170/325 (52%), Gaps = 37/325 (11%)
 Frame = +3

Query: 192  ETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAH 371
            +T H  +++D  +DYY K++AT SSD ++KI  VS +     +A L  H   VW+V W+H
Sbjct: 8    DTYHGRSINDCELDYYSKKLATCSSDNTVKIFDVSLSKEPVCVAELKDHSSAVWKVCWSH 67

Query: 372  PKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSD 551
            PK+GSLLASCSFD  VI++KE N N++   ++ N+H SSVN I W+PHE GL L C SSD
Sbjct: 68   PKYGSLLASCSFDKNVIIYKEVNINKYEMIYINNEHVSSVNYIEWSPHEYGLHLGCASSD 127

Query: 552  GNISVYT-----ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQ---- 704
            G IS+ +       ++G W+   + +AH  GV  +SW        L+   L+D       
Sbjct: 128  GTISILSYYMNKGSNEGYWNKYSM-KAHLNGVACISWEKPYNNILLMNKNLNDNNNNNNN 186

Query: 705  ----------------------KLASAGCDNTVKVW------KLYNGVWKMDCFPALQMH 800
                                  KL S G DN V +W      K +  +++M+  P    H
Sbjct: 187  NNNNNNNNNNNNNNNNDVINSFKLVSGGYDNQVIIWMFDNNTKEFQKIYQMNDKP----H 242

Query: 801  TNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSL 980
             + ++DVAW PNL    + IAS S++  V++W      + W+   +      + ++SWS 
Sbjct: 243  KSSIKDVAWKPNLDNSANIIASCSDEKIVILWIEDVTNNVWKNGQIIKVKYNIHKISWSP 302

Query: 981  TGNLLAVASGDNNVTLWNEAVDGEW 1055
             G +LA+A  D+N  L+ E  +G W
Sbjct: 303  NGTILAIACSDDNAYLYKENAEGIW 327



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +3

Query: 336 HHGPVWQVSWAH--PKFGSLLASCSFDGKVIVWKEG-NQNEWTQAHVFNDHKSSVNSISW 506
           H   +  V+W        +++ASCS +  VI+W E    N W    +    K +++ ISW
Sbjct: 242 HKSSIKDVAWKPNLDNSANIIASCSDEKIVILWIEDVTNNVWKNGQIIKV-KYNIHKISW 300

Query: 507 APHELGLCLACGSSDGNISVYTARSDGGWD 596
           +P+   L +AC  SD N  +Y   ++G W+
Sbjct: 301 SPNGTILAIAC--SDDNAYLYKENAEGIWE 328



>gb:AF206628_1776748 Cucumis melo sec13-like protein mRNA, partial
            cds.
          Length = 143

 Score =  176 bits (446), Expect = 8e-43
 Identities = 79/128 (61%), Positives = 100/128 (78%)
 Frame = +3

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
            LVGS   DPV KLAS G D+TVKVW L +G W+ D   +LQMHT+WVRDVAW+PNLGL K
Sbjct: 17   LVGSSSEDPVWKLASGGFDSTVKVWTLKDGSWRRDSSLSLQMHTDWVRDVAWSPNLGLQK 76

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            STIAS  +DG V+IW+  KEG +W+  ++ DF TP+W+VSWSLTG+LLAV+ G+N++TLW
Sbjct: 77   STIASGXQDGTVIIWS-TKEGGKWDATLMNDFKTPIWKVSWSLTGDLLAVSDGNNHITLW 135

Query: 1032 NEAVDGEW 1055
             EA  G+W
Sbjct: 136  KEAASGKW 143



 Score = 40.4 bits (93), Expect = 0.067
 Identities = 36/131 (27%), Positives = 59/131 (45%), Gaps = 5/131 (3%)
 Frame = +3

Query: 345 PVWQVSWAHPKFGSLLASCSFDGKVIVW--KEGNQNEWTQAHVFNDHKSSVNSISWAPHE 518
           PVW+           LAS  FD  V VW  K+G+    +   +   H   V  ++W+P+ 
Sbjct: 25  PVWK-----------LASGGFDSTVKVWTLKDGSWRRDSSLSL-QMHTDWVRDVAWSPN- 71

Query: 519 LGL---CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGL 689
           LGL    +A G  DG + +++ +  G WD A +       +  VSW+ +    A+     
Sbjct: 72  LGLQKSTIASGXQDGTVIIWSTKEGGKWD-ATLMNDFKTPIWKVSWSLTGDLLAVSDGNN 130

Query: 690 HDPVQKLASAG 722
           H  + K A++G
Sbjct: 131 HITLWKEAASG 141



 Score = 35.0 bits (79), Expect = 2.8
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 4/88 (4%)
 Frame = +3

Query: 201 HSDTVHDVS----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           H+D V DV+    +      +A+   D ++ II  +          +     P+W+VSW+
Sbjct: 59  HTDWVRDVAWSPNLGLQKSTIASGXQDGTV-IIWSTKEGGKWDATLMNDFKTPIWKVSWS 117

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEW 452
               G LLA    +  + +WKE    +W
Sbjct: 118 LT--GDLLAVSDGNNHITLWKEAASGKW 143



>gb:AC024214_1204314 Caenorhabditis elegans cosmid Y77E11A, complete
           sequence.
          Length = 211

 Score =  167 bits (422), Expect = 5e-40
 Identities = 85/193 (44%), Positives = 115/193 (59%), Gaps = 3/193 (1%)
 Frame = +3

Query: 183 QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS 362
           Q+I+T H D +HD  ++ YG R+AT  SD  +KI  V  N  S  +A L GH GPVW+VS
Sbjct: 6   QRIDTQHRDAIHDAQLNIYGSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVS 65

Query: 363 WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG 542
           WAHPK+G LLAS S+D KVI+W E  Q  W +A+ +  H++S   +++APH+ GL LA  
Sbjct: 66  WAHPKYGGLLASASYDKKVIIWNE-QQGRWQKAYEWAAHEASTTCVAFAPHQYGLMLASA 124

Query: 543 SSDGNISVYT-ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK--LA 713
           S+DG+I +     S   W +++I + H  GV +V WAP  A          DP  K  L 
Sbjct: 125 SADGDIGILRYDNSSNEWISSKIQKCHEQGVNSVCWAPGSA----------DPAAKKRLV 174

Query: 714 SAGCDNTVKVWKL 752
           SAG D  VK+W L
Sbjct: 175 SAGNDKNVKIWAL 187



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 30/83 (36%), Positives = 39/83 (46%), Gaps = 2/83 (2%)
 Frame = +3

Query: 813  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTG 986
            RD      L +  S +A+   D  V I+ V   G  +    L   + PVW+VSW+    G
Sbjct: 13   RDAIHDAQLNIYGSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVSWAHPKYG 72

Query: 987  NLLAVASGDNNVTLWNEAVDGEW 1055
             LLA AS D  V +WNE   G W
Sbjct: 73   GLLASASYDKKVIIWNEQ-QGRW 94



 Score = 36.6 bits (83), Expect = 0.97
 Identities = 49/178 (27%), Positives = 64/178 (35%), Gaps = 8/178 (4%)
 Frame = +3

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV 701
            G  LA   SD  + ++  R +G          H   V  VSWA     G L         
Sbjct: 25   GSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVSWAHPKYGGLL--------- 75

Query: 702  QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN-LGLPKSTIASASED 878
               ASA  D  V +W    G W+     A   H      VA+AP+  GL    +ASAS D
Sbjct: 76   ---ASASYDKKVIIWNEQQGRWQKAYEWA--AHEASTTCVAFAPHQYGL---MLASASAD 127

Query: 879  GKVVIWTVAKEGDQW-EGKVLYDFNTPVWRVSWS------LTGNLLAVASGDNNVTLW 1031
            G + I       ++W   K+       V  V W+           L  A  D NV +W
Sbjct: 128  GDIGILRYDNSSNEWISSKIQKCHEQGVNSVCWAPGSADPAAKKRLVSAGNDKNVKIW 185



>gb:BC084902_2564141 Xenopus tropicalis hypothetical LOC496570, mRNA
            (cDNA clone MGC:89468 IMAGE:6991675), complete cds.
          Length = 360

 Score =  159 bits (402), Expect = 1e-37
 Identities = 100/316 (31%), Positives = 157/316 (49%), Gaps = 24/316 (7%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S N      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSENGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAP--SMAPGALV 677
              +GL LA  S+DG + +Y A    +   W + + + +  +  + +SW P  S A   ++
Sbjct: 124  KHMGLMLATCSADGVVRIYEAPDVMNLSQW-SLQHEISCKLSCSCISWNPSSSRAHSPMI 182

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
              G  D     +S      V++++      K      L   ++ V D+A+APNLG     
Sbjct: 183  AVGSDD-----SSPNIMGKVQIYEYNENTRKYAKAETLMSVSDPVHDIAFAPNLGRSFHI 237

Query: 858  IASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSLTGNLLAVAS 1007
            +A A++D ++  +  + KE     G   ++          N+ VWRVSW++TG +LA + 
Sbjct: 238  LAVATKDVRIFTMKPLRKELSSSGGVTKFEIHTVAQFDNHNSQVWRVSWNITGTVLASSG 297

Query: 1008 GDNNVTLWNEAVDGEW 1055
             D  V LW       W
Sbjct: 298  DDGTVRLWKANYMDNW 313



>gb:BC073561_2557390 Xenopus laevis MGC82845 protein, mRNA (cDNA clone
            MGC:82845 IMAGE:5506962), complete cds.
          Length = 360

 Score =  158 bits (400), Expect = 2e-37
 Identities = 100/316 (31%), Positives = 157/316 (49%), Gaps = 24/316 (7%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S N      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSENVNWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAP--SMAPGALV 677
              +GL LA  S+DG + +Y A    +   W + + + +  +  + +SW P  S A   ++
Sbjct: 124  KHMGLMLATCSADGVVRIYEAPDVMNLSQW-SLQHEISCKLSCSCISWNPSSSRAHSPMI 182

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
              G  D     +S      V++++      K      L   ++ V D+A+APNLG     
Sbjct: 183  AVGSDD-----SSPNIMGKVQIYEYNENTRKYAKAETLMSVSDPVHDIAFAPNLGRSFHI 237

Query: 858  IASASEDGKV-VIWTVAKEGDQWEGKVLYD---------FNTPVWRVSWSLTGNLLAVAS 1007
            +A A++D ++  +  + KE     G   ++          N+ VWRVSW++TG +LA + 
Sbjct: 238  LAVATKDVRIFTMKPLRKELSSSGGVTKFENHTVAQFDNHNSQVWRVSWNITGTVLASSG 297

Query: 1008 GDNNVTLWNEAVDGEW 1055
             D  V LW       W
Sbjct: 298  DDGTVRLWKANYMDNW 313



>gb:AF255625_1893156 Homo sapiens putative nucleoporin protein SEH1A
            (SEH1) mRNA, complete cds.>gb:AF514996_1905634 Homo
            sapiens nucleoporin Seh1 mRNA, complete
            cds.>gb:BC012430_1973608 Homo sapiens SEH1-like (S.
            cerevisiae), mRNA (cDNA clone MGC:21489 IMAGE:3865994),
            complete cds.
          Length = 360

 Score =  158 bits (400), Expect = 2e-37
 Identities = 101/316 (31%), Positives = 157/316 (49%), Gaps = 24/316 (7%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S +      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAP--SMAPGALV 677
              +GL LA  S+DG + +Y A    +   W + + + +  +  + +SW P  S A   ++
Sbjct: 124  KHMGLMLATCSADGIVRIYEAPDVMNLSQW-SLQHEISCKLSCSCISWNPSSSRAHSPMI 182

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
              G  D     +S      V++++      K      L   T+ V D+A+APNLG     
Sbjct: 183  AVGSDD-----SSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHI 237

Query: 858  IASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSLTGNLLAVAS 1007
            +A A++D ++  +  V KE     G   ++          N+ VWRVSW++TG +LA + 
Sbjct: 238  LAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSG 297

Query: 1008 GDNNVTLWNEAVDGEW 1055
             D  V LW       W
Sbjct: 298  DDGCVRLWKANYMDNW 313



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 271 VAQFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 328

Query: 498 IS 503
            S
Sbjct: 329 SS 330



>gb:AF136976_1885786 Homo sapiens sec13-like protein mRNA, complete
            cds.
          Length = 360

 Score =  158 bits (400), Expect = 2e-37
 Identities = 101/316 (31%), Positives = 157/316 (49%), Gaps = 24/316 (7%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S +      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAP--SMAPGALV 677
              +GL LA  S+DG + +Y A    +   W + + + +  +  + +SW P  S A   ++
Sbjct: 124  KHMGLMLATCSADGIVRIYEAPDVMNLSQW-SLQHEISCKLSCSCISWNPSSSRAHSPMI 182

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
              G  D     +S      V++++      K      L   T+ V D+A+APNLG     
Sbjct: 183  AVGSDD-----SSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHI 237

Query: 858  IASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSLTGNLLAVAS 1007
            +A A++D ++  +  V KE     G   ++          N+ VWRVSW++TG +LA + 
Sbjct: 238  LAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSG 297

Query: 1008 GDNNVTLWNEAVDGEW 1055
             D  V LW       W
Sbjct: 298  DDGCVRLWKANYMDNW 313



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 271 VAQFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 328

Query: 498 IS 503
            S
Sbjct: 329 SS 330



>gb:CR858979_1183119 Pongo pygmaeus mRNA; cDNA DKFZp469H1823 (from
            clone DKFZp469H1823).
          Length = 360

 Score =  158 bits (400), Expect = 2e-37
 Identities = 101/316 (31%), Positives = 157/316 (49%), Gaps = 24/316 (7%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S +      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAP--SMAPGALV 677
              +GL LA  S+DG + +Y A    +   W + + + +  +  + +SW P  S A   ++
Sbjct: 124  KHMGLMLATCSADGIVRIYEAPDVMNLSQW-SLQHEISCKLSCSCISWNPSSSRAHSPMI 182

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
              G  D     +S      V++++      K      L   T+ V D+A+APNLG     
Sbjct: 183  AVGSDD-----SSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHI 237

Query: 858  IASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSLTGNLLAVAS 1007
            +A A++D ++  +  V KE     G   ++          N+ VWRVSW++TG +LA + 
Sbjct: 238  LAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAHFDNHNSQVWRVSWNITGTVLASSG 297

Query: 1008 GDNNVTLWNEAVDGEW 1055
             D  V LW       W
Sbjct: 298  DDGCVRLWKANYMDNW 313



 Score = 38.1 bits (87), Expect = 0.33
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 271 VAHFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 328

Query: 498 IS 503
            S
Sbjct: 329 SS 330



>sp|Q96EE3|SEH1_HUMAN Nucleoporin SEH1 (SEC13-like
            protein).>gb:AF431970_1902028 Homo sapiens putative
            nucleoporin protein SEH1B (SEH1) mRNA, complete cds.
          Length = 421

 Score =  158 bits (400), Expect = 2e-37
 Identities = 101/316 (31%), Positives = 157/316 (49%), Gaps = 24/316 (7%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S +      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAP--SMAPGALV 677
              +GL LA  S+DG + +Y A    +   W + + + +  +  + +SW P  S A   ++
Sbjct: 124  KHMGLMLATCSADGIVRIYEAPDVMNLSQW-SLQHEISCKLSCSCISWNPSSSRAHSPMI 182

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
              G  D     +S      V++++      K      L   T+ V D+A+APNLG     
Sbjct: 183  AVGSDD-----SSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHI 237

Query: 858  IASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSLTGNLLAVAS 1007
            +A A++D ++  +  V KE     G   ++          N+ VWRVSW++TG +LA + 
Sbjct: 238  LAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSG 297

Query: 1008 GDNNVTLWNEAVDGEW 1055
             D  V LW       W
Sbjct: 298  DDGCVRLWKANYMDNW 313



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 271 VAQFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 328

Query: 498 IS 503
            S
Sbjct: 329 SS 330



>gb:AK088835_1175654 Mus musculus 2 days neonate thymus thymic cells
            cDNA, RIKEN full-length enriched library,
            clone:E430027N06 product:SEC13-LIKE PROTEIN homolog [Homo
            sapiens], full insert sequence.>gb:BC027244_2095851 Mus
            musculus SEH1-like (S. cerevisiae, mRNA (cDNA clone
            MGC:27929 IMAGE:3584697), complete cds.
          Length = 360

 Score =  157 bits (396), Expect = 5e-37
 Identities = 104/325 (32%), Positives = 157/325 (48%), Gaps = 33/325 (10%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S +      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQ---AHPIG----VTAVSWAPSMAPGA 671
              +GL LA  S+DG + VY A      D   + Q    H +      + +SW PS     
Sbjct: 124  KHMGLMLATCSADGIVRVYEAP-----DVMNLSQWSLQHEVSCKLCCSCISWNPS----- 173

Query: 672  LVGSGLHDPVQKLASAGCDNT-------VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWA 830
               S  H P   + + G D++       V++++      K      L   T+ V D+A+A
Sbjct: 174  --SSRAHPP---MIAVGSDDSSPNSMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFA 228

Query: 831  PNLGLPKSTIASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSL 980
            PNLG     +A A++D ++  +  + KE     G   ++          N+ VWRVSW++
Sbjct: 229  PNLGRSFHILAVATKDVRIFTLKPLRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNI 288

Query: 981  TGNLLAVASGDNNVTLWNEAVDGEW 1055
            TG +LA +  D  V LW       W
Sbjct: 289  TGTVLASSGDDGCVRLWKANYMDNW 313



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 271 VAQFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 328

Query: 498 IS 503
            S
Sbjct: 329 SS 330



>gb:AK011330_1156335 Mus musculus 10 days embryo whole body cDNA,
            RIKEN full-length enriched library, clone:2610007A16
            product:SEC13-LIKE PROTEIN homolog [Homo sapiens], full
            insert sequence.
          Length = 357

 Score =  157 bits (396), Expect = 5e-37
 Identities = 104/325 (32%), Positives = 157/325 (48%), Gaps = 33/325 (10%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S +      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQ---AHPIG----VTAVSWAPSMAPGA 671
              +GL LA  S+DG + VY A      D   + Q    H +      + +SW PS     
Sbjct: 124  KHMGLMLATCSADGIVRVYEAP-----DVMNLSQWSLQHEVSCKLCCSCISWNPS----- 173

Query: 672  LVGSGLHDPVQKLASAGCDNT-------VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWA 830
               S  H P   + + G D++       V++++      K      L   T+ V D+A+A
Sbjct: 174  --SSRAHPP---MIAVGSDDSSPNSMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFA 228

Query: 831  PNLGLPKSTIASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSL 980
            PNLG     +A A++D ++  +  + KE     G   ++          N+ VWRVSW++
Sbjct: 229  PNLGRSFHILAVATKDVRIFTLKPLRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNI 288

Query: 981  TGNLLAVASGDNNVTLWNEAVDGEW 1055
            TG +LA +  D  V LW       W
Sbjct: 289  TGTVLASSGDDGCVRLWKANYMDNW 313



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 271 VAQFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 328

Query: 498 IS 503
            S
Sbjct: 329 SS 330



>gb:AK056940_1911868 Homo sapiens cDNA FLJ32378 fis, clone
            SKMUS1000022, weakly similar to NUCLEAR PORE PROTEIN SEH1
            HOMOLOG.
          Length = 421

 Score =  156 bits (395), Expect = 6e-37
 Identities = 100/316 (31%), Positives = 156/316 (49%), Gaps = 24/316 (7%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+   S +      A+   H G VW+V
Sbjct: 4    ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASC FD    VW+E           Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCPFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAP--SMAPGALV 677
              +GL LA  S+DG + +Y A    +   W + + + +  +  + +SW P  S A   ++
Sbjct: 124  KHMGLMLATCSADGIVRIYEAPDVMNLSQW-SLQHEISCKLSCSCISWNPSSSRAHSPMI 182

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
              G  D     +S      V++++      K      L   T+ V D+A+APNLG     
Sbjct: 183  AVGSDD-----SSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHI 237

Query: 858  IASASEDGKV-VIWTVAKEGDQWEGKVLYDF---------NTPVWRVSWSLTGNLLAVAS 1007
            +A A++D ++  +  V KE     G   ++          N+ VWRVSW++TG +LA + 
Sbjct: 238  LAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSG 297

Query: 1008 GDNNVTLWNEAVDGEW 1055
             D  V LW       W
Sbjct: 298  DDGCVRLWKANYMDNW 313



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 271 VAQFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 328

Query: 498 IS 503
            S
Sbjct: 329 SS 330



>gb:AY398414_2531944 Danio rerio clone RK075A4E03 sec13-like protein
            (SEC13L) mRNA, complete cds.
          Length = 364

 Score =  153 bits (387), Expect = 5e-36
 Identities = 101/320 (31%), Positives = 160/320 (50%), Gaps = 28/320 (8%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A+ I   H D +HDVS D++G+R+AT SSD S+K+    ++      A+   H G VW+V
Sbjct: 4    AKSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKGDDGEWHCTASWKTHSGSVWRV 63

Query: 360  SWAHPKFGSLLASCSFDGKVIVW---------KEGNQNEWTQAHVFNDHKSSVNSISWAP 512
            +WAHP+FG +LASCSFD    VW         K+  Q+ W +     D ++SV  + +AP
Sbjct: 64   TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKQRGQSHWIKRTTLVDSRTSVTDVKFAP 123

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGS 683
              +GL L   S+DG + +Y A    +   W + + + +  +  + +SW PS        S
Sbjct: 124  KHMGLMLTTCSADGVVRIYEAPDVMNLSQW-SLQHEISCKLACSCISWNPS-------SS 175

Query: 684  GLHDPVQKLASAGCDNT------VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
              H P+  +A  G D+       V++ +      K      L   T+ V D+A+APNLG 
Sbjct: 176  RAHPPM--IAVGGDDSNGAYSGKVQIHEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGR 233

Query: 846  PKSTIASASEDGKVV-IWTVAKEG------DQWEGKVLYDF---NTPVWRVSWSLTGNLL 995
                +A A++D ++  +  + +E        ++E +V+  F   N+ VWRVSW++T  LL
Sbjct: 234  SFHVLAIATKDVRIFKLLPLRRESANSSGPTKFEVQVMAQFDSHNSQVWRVSWNITSTLL 293

Query: 996  AVASGDNNVTLWNEAVDGEW 1055
            A +  D  V LW       W
Sbjct: 294  ASSGDDGCVRLWKANYMDNW 313



 Score = 38.9 bits (89), Expect = 0.19
 Identities = 33/114 (28%), Positives = 49/114 (42%), Gaps = 14/114 (12%)
 Frame = +3

Query: 204 SDTVHDVSMDYYGKR----VATASSDASI-KIIGVSNNSTS---------QHLATLAGHH 341
           +D VHD++      R    +A A+ D  I K++ +   S +         Q +A    H+
Sbjct: 219 TDPVHDIAFAPNLGRSFHVLAIATKDVRIFKLLPLRRESANSSGPTKFEVQVMAQFDSHN 278

Query: 342 GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
             VW+VSW      +LLAS   DG V +WK    + W    +     S VN  S
Sbjct: 279 SQVWRVSWNITS--TLLASSGDDGCVRLWKANYMDNWKCTGILRGDGSPVNGSS 330



>gb:CR382128_1661031 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 319

 Score =  139 bits (350), Expect = 1e-31
 Identities = 87/303 (28%), Positives = 150/303 (49%), Gaps = 16/303 (5%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA-TLAGHHGPVWQVSWAH 371
            TGH + VHDV+ D+YG+R+AT SSD ++K+   ++++    ++ +   H   + +V WA+
Sbjct: 6    TGHEELVHDVAYDFYGRRIATCSSDTTVKVFDRNDSTGEWDISDSWKAHDASIIKVCWAN 65

Query: 372  PKFGSLLASCSFDGKVIVW------KEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            P+FG +LA+CS D  + +W      K+ +   W +     DHK  +  ++++P   GL L
Sbjct: 66   PEFGKVLATCSHDSTIKIWEENIREKQNSGKRWKRVATITDHKGPIYDLAFSPSHCGLKL 125

Query: 534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS---MAPGALVGSGLHDPVQ 704
            A  S+DG   ++ A        A     +      +S APS    +   L         +
Sbjct: 126  ASISTDGQFKIHEALD----PNAISSWTNIFETNTLSSAPSRQLQSSFCLSWGKSRFSKE 181

Query: 705  KLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
             + +   + +    +  NG  K      L  H + +RD++WAP++G     IA+A +DG 
Sbjct: 182  YVVACALEQSYIYQRQENG--KYTQTGQLPAHGSIIRDISWAPSIGRGYQLIATACKDGL 239

Query: 885  VVIWTVAK---EGDQWEGKVLYDFNT---PVWRVSWSLTGNLLAVASGDNNVTLWNEAVD 1046
            V I+ + +   E  Q +  ++  F+     VWRVSW+LTG +L+ A  D  V LW    +
Sbjct: 240  VRIFKIEEPLTESGQLQVSLINQFDDHKGDVWRVSWNLTGTILSSAGDDGRVRLWKSTYN 299

Query: 1047 GEW 1055
             E+
Sbjct: 300  KEF 302



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 29/116 (25%), Positives = 48/116 (41%), Gaps = 10/116 (8%)
 Frame = +3

Query: 135 DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKR----VATASSDASIKIIGVSNN 302
           + ++I    + GK         H   + D+S      R    +ATA  D  ++I  +   
Sbjct: 189 EQSYIYQRQENGKYTQTGQLPAHGSIIRDISWAPSIGRGYQLIATACKDGLVRIFKIEEP 248

Query: 303 STSQHLATLA------GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEW 452
            T      ++       H G VW+VSW     G++L+S   DG+V +WK     E+
Sbjct: 249 LTESGQLQVSLINQFDDHKGDVWRVSWNLT--GTILSSAGDDGRVRLWKSTYNKEF 302



>gb:AE013599_1130561 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE013599_1130562 Drosophila melanogaster
            chromosome 2R, complete sequence.>gb:AE013599_1130563
            Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003839_1227191 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AE003839_1227192 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AE003839_1227193 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AY060480_1292392 Drosophila melanogaster
            SD07614 full length cDNA.
          Length = 354

 Score =  135 bits (340), Expect = 2e-30
 Identities = 97/315 (30%), Positives = 148/315 (46%), Gaps = 24/315 (7%)
 Frame = +3

Query: 183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS 362
            + I   H D +HDV  DYYG+R+AT SSD ++KI            ++   H G +W+VS
Sbjct: 5    EPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVS 64

Query: 363  WAHPKFGSLLASCSFDGKVIVWKE--GNQ--------NEWTQAHVFNDHKSSVNSISWAP 512
            WAHP+FG ++A+CSFD    VW+E  G +          W +     D ++SV  + +AP
Sbjct: 65   WAHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAP 124

Query: 513  HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGS 683
              LGL LA  S+DG I +Y A    +   W     + ++ + ++ +SW  S         
Sbjct: 125  KYLGLLLATASADGIIRIYEAPDIMNLSQWPVQH-EISNKLPLSCLSWNTSTY------- 176

Query: 684  GLHDPVQKLASAGCDN----TVKVWKLYNGVWKMDC--FPALQMHTNWVRDVAWAPNLGL 845
                 V +L +AG D     T KV+          C     +   T+ V DVA+APN G 
Sbjct: 177  ----MVTQLLAAGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGR 232

Query: 846  PKSTIASASEDGKVVIW---TVAKEGDQWEGKVL--YDFNTPVWRVSWSLTGNLLAVASG 1010
                +A AS+D  +V     T A +  + + + +   + N PVWRV W++   +L     
Sbjct: 233  TFHMLAVASKDLYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGD 292

Query: 1011 DNNVTLWNEAVDGEW 1055
            D  V LW    + +W
Sbjct: 293  DGCVRLWRMNYNRQW 307



>gb:AE016819_1748798 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 330

 Score =  128 bits (322), Expect = 2e-28
 Identities = 91/326 (27%), Positives = 141/326 (43%), Gaps = 39/326 (11%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA-TLAGHHGPVWQVSWAH 371
            TGH D VHD+  D+YG+ VAT SSD  IK+  +  ++    L+ +  GH   V  + WA 
Sbjct: 6    TGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNEWTLSDSWKGHDSSVVALDWAS 65

Query: 372  PKFGSLLASCSFDGKVIVWK------EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            P++G +LAS S++  + VW+      EG+   WT+    ND    + S+ +AP  LGL L
Sbjct: 66   PEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLCTLNDATGPLYSVKFAPGHLGLRL 125

Query: 534  ACGSSDGNISVYTARSDG---GWD-------TARIDQAHPIGVTAVSWAPSMAPGALVGS 683
                +DG + +Y A        W         A    +H     ++ W PS         
Sbjct: 126  GAIGNDGVLRIYDALEPSDLRSWTLTSEVKVLATPPASHLQSDFSLDWCPS--------- 176

Query: 684  GLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIA 863
                  ++L     D      +  N   K+     L  H   +R V+WAP+ G     IA
Sbjct: 177  --RFSAERLVVCALDQAFVYER--NKAGKLFQAARLPGHQGLIRSVSWAPSFGRWHQLIA 232

Query: 864  SASEDGKVVIWTVAKEGDQWEGKVLYDFNT----------------------PVWRVSWS 977
            + S+DG+V I+ + ++ D  +     D +T                       VW VSW+
Sbjct: 233  TGSKDGRVRIFQLTEKLDATDDASTDDASTDDAGPAPHISVQLLSEHADHKGEVWSVSWN 292

Query: 978  LTGNLLAVASGDNNVTLWNEAVDGEW 1055
            LTG +L+ +  D  V LW  +   E+
Sbjct: 293  LTGTILSSSGDDGKVRLWKSSFSNEF 318



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 34/105 (32%), Positives = 49/105 (46%)
 Frame = +3

Query: 138 HTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH 317
           H  I +  K+G++   ++ T   D   D S D           DAS    G + + + Q 
Sbjct: 228 HQLIATGSKDGRVRIFQL-TEKLDATDDASTD-----------DASTDDAGPAPHISVQL 275

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEW 452
           L+  A H G VW VSW     G++L+S   DGKV +WK    NE+
Sbjct: 276 LSEHADHKGEVWSVSW--NLTGTILSSSGDDGKVRLWKSSFSNEF 318



>sp|P53011|SEH1_YEAST Nuclear pore protein SEH1.>pir|S62137|S62137
            SEC13 protein homolog YGL100w - yeast (Saccharomyces
            cerevisiae)>gb:AY558497_1614724 Saccharomyces cerevisiae
            clone FLH002719.01X YGL100W gene, complete
            cds.>gb:SCDNASEH1_1707797 S.cerevisiae seh1
            gene.>gb:SCYGL100W_1712022 S.cerevisiae chromosome VII
            reading frame ORF YGL100w.
          Length = 349

 Score =  128 bits (322), Expect = 2e-28
 Identities = 94/352 (26%), Positives = 146/352 (41%), Gaps = 61/352 (17%)
 Frame = +3

Query: 183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA-TLAGHHGPVWQV 359
            Q  ++GH D VHDV  D+YG+ VAT SSD  IK+  +  ++++  L+ +   H   +  +
Sbjct: 2    QPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAI 61

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNE------WTQAHVFNDHKSSVNSISWAPHEL 521
             WA P++G ++AS S+D  V +W+E    E      W +    ND K S+ S+ +AP  L
Sbjct: 62   DWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHL 121

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQA----------HPIGVTAVSWAPS-MAPG 668
            GL LAC  +DG + +Y A       +  +             H      +SW PS  +P 
Sbjct: 122  GLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPE 181

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
             L  S L   +  +   G D             K+     L  H + +R ++WAP++G  
Sbjct: 182  KLAVSALEQAI--IYQRGKDG------------KLHVAAKLPGHKSLIRSISWAPSIGRW 227

Query: 849  KSTIASASEDGKVVIWTV------------------------------AKEGDQWEGKVL 938
               IA+  +DG++ I+ +                               +     E K  
Sbjct: 228  YQLIATGCKDGRIRIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAE 287

Query: 939  Y-------------DFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                          D N  VW VSW+LTG +L+ A  D  V LW      E+
Sbjct: 288  LQSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEF 339



>gb:AC116977_1207008 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 467

 Score =  126 bits (316), Expect = 9e-28
 Identities = 66/182 (36%), Positives = 97/182 (53%), Gaps = 7/182 (3%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           ++ T H D +HDVS D+YGKR+AT SSD  IK+   ++N   +  A    H G VW+++W
Sbjct: 6   RLSTAHDDLIHDVSYDFYGKRLATCSSDQKIKVWDQNDNQKWELSAEWKAHSGSVWKLAW 65

Query: 366 AHPKFGSLLASCSFDGKVIVWKEG----NQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
           AHP++G ++ASCSFD  V +W+E      Q +W       D + SV  I +AP   GL L
Sbjct: 66  AHPEYGQVIASCSFDRTVCIWEESEDEKGQKKWQLKAHLVDSRDSVTDIKFAPKSFGLRL 125

Query: 534 ACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQ 704
           A  SSDG I +Y A    +   W      ++       +SW PS     ++  G ++P  
Sbjct: 126 ATCSSDGYIRIYEAMDIMNLSQWTIVEEFESQKGTSNCISWNPSSYDKPMIAVGSNEPYI 185

Query: 705 KL 710
           K+
Sbjct: 186 KI 187



 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 82/354 (23%), Positives = 142/354 (40%), Gaps = 56/354 (15%)
 Frame = +3

Query: 162  KEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKI---IGVSNNSTSQHLATLA 332
            K+ ++ A  +++  S T    +   +G R+AT SSD  I+I   + + N S    +    
Sbjct: 96   KKWQLKAHLVDSRDSVTDIKFAPKSFGLRLATCSSDGYIRIYEAMDIMNLSQWTIVEEFE 155

Query: 333  GHHGPVWQVSWAHPKFGS-LLASCSFDGKVIVWKEGNQ-NEWTQAHVFNDH-------KS 485
               G    +SW    +   ++A  S +  + +W+      +W Q      +        S
Sbjct: 156  SQKGTSNCISWNPSSYDKPMIAVGSNEPYIKIWEYSETARKWLQIDTLTAYPIGSTISSS 215

Query: 486  SVNSISWAPHELGLCLA---------CGSSDGNISVYTARSDGGWDTARIDQAHPIGVTA 638
            ++NS       +G  +           G S G +S     S G   +   +  +   +  
Sbjct: 216  NLNSGGGIGGGIGSGIGGGIGGGIGGAGGSIGGVSGVNNSSMGNLGSGIGNNINNSNINN 275

Query: 639  VSWAPSMAPGALVGSGLHDPVQK-LASA------------------------------GC 725
            +S       G  VGSG+   +   L SA                              G 
Sbjct: 276  ISVGVGSGVGGGVGSGVGGSLNNGLNSAQGNSIGNGNIGSLNNISGNSGGLNSNSLMSGA 335

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMH-TNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
            ++++ V    N ++  + F +     +  + DV WAPN+G     IA+AS+D KV IW +
Sbjct: 336  NSSINVSSGNNSIYSNNNFDSSSDGGSRAIHDVCWAPNMGRSYHLIATASKDHKVRIWKL 395

Query: 903  AKEGDQWEGKVLY---DFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            + +  + E K +    D  + VWRV W++TG +LA +  D NV LW   ++GEW
Sbjct: 396  SSDKSKMELKEVMRKDDHKSEVWRVEWNITGTILASSGDDGNVCLWKCNMNGEW 449



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 7/104 (6%)
 Frame = +3

Query: 198 GHSDTVHDV----SMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLA---GHHGPVWQ 356
           G S  +HDV    +M      +ATAS D  ++I  +S++ +   L  +     H   VW+
Sbjct: 360 GGSRAIHDVCWAPNMGRSYHLIATASKDHKVRIWKLSSDKSKMELKEVMRKDDHKSEVWR 419

Query: 357 VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSS 488
           V W     G++LAS   DG V +WK     EW    + +  +S+
Sbjct: 420 VEWNIT--GTILASSGDDGNVCLWKCNMNGEWKLFSLISGEEST 461



>gb:CR382126_1658650 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 344

 Score =  124 bits (311), Expect = 4e-27
 Identities = 92/342 (26%), Positives = 144/342 (42%), Gaps = 55/342 (16%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA-TLAGHHGPVWQVSWAH 371
            TGHSD VHD+S D+YG+RVAT SSD  IK+  +   +    L+ +   H   +  + WA 
Sbjct: 6    TGHSDLVHDISYDFYGRRVATCSSDQHIKVFKLDKETNEWELSESWKAHDSSIVSLDWAA 65

Query: 372  PKFGSLLASCSFDGKVIVWKEG------NQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            P+FG ++AS S+D  + +W+E       +   W +    ND    + S+ +AP  LGL L
Sbjct: 66   PEFGRIIASVSYDKTIKLWEEDPDALELSGKRWQKLCTLNDATGPLFSVKFAPSHLGLRL 125

Query: 534  ACGSSDGNISVYTARSDG---GWD-TARI------DQAHPIGVTAVSWAPSMAPGALVGS 683
            A   +DG + +Y A        W  T+ I        +H      +SW PS         
Sbjct: 126  AALGNDGKLRLYDALESSDLRSWTLTSEITVLNTPPASHLQSDFCLSWCPS--------- 176

Query: 684  GLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIA 863
                  ++L  +  D      +   G  K+     L+ HT  +R +AWAP++G     IA
Sbjct: 177  --RFSTERLVISAMDQATIYQRNKQG--KLVPAGHLKGHTGLIRSIAWAPSVGRWYQLIA 232

Query: 864  SASEDGKVVIWTVA---------------------KEGDQWEGKVL-------------- 938
            +  +DGK+ I+ V                      ++G   +   +              
Sbjct: 233  TGCKDGKLRIFKVTESRNNGTNIINEENDNNANIERDGPPIDSSAIDADGSVANLHVELI 292

Query: 939  ---YDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                D    VW VSW+LTG +L+    D  + LW  +   E+
Sbjct: 293  SEHSDHQGEVWSVSWNLTGTILSSTGDDGKIRLWKASYSNEF 334



 Score = 41.2 bits (95), Expect = 0.039
 Identities = 27/113 (23%), Positives = 53/113 (46%), Gaps = 8/113 (7%)
 Frame = +3

Query: 138 HTFIRSSDKEGKMPAQKIETGHSDTVH--------DVSMDYYGKRVATASSDASIKIIGV 293
           +  I +  K+GK+   K+    ++  +        + +++  G  + +++ DA   +  +
Sbjct: 228 YQLIATGCKDGKLRIFKVTESRNNGTNIINEENDNNANIERDGPPIDSSAIDADGSVANL 287

Query: 294 SNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEW 452
                S+H    + H G VW VSW     G++L+S   DGK+ +WK    NE+
Sbjct: 288 HVELISEH----SDHQGEVWSVSWNLT--GTILSSTGDDGKIRLWKASYSNEF 334



>gb:CR382135_1668187 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 364

 Score =  123 bits (309), Expect = 6e-27
 Identities = 97/337 (28%), Positives = 149/337 (44%), Gaps = 50/337 (14%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATL-AGHHGPVWQVSWAH 371
            TGH + +HD+  D+YGK +AT SSD  IK+  + +++++  L  L   H   + ++SWAH
Sbjct: 6    TGHEELIHDIKYDFYGKHIATCSSDQHIKVFDLDSSTSTWVLNDLWKAHDSLIVKLSWAH 65

Query: 372  PKFGS--LLASCSFDGKVIVWKE------GNQNEWTQ-AHVFNDHKSSVNSISWAPHELG 524
            P F S  +LASCS+D  V +W+E      G+   W + A +  +    +  + +AP+ LG
Sbjct: 66   PGFSSSKILASCSYDRTVKIWQEQPEELHGSGRRWIKLATLAIESYGPIYDVVFAPNHLG 125

Query: 525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPI-----------GVTAVSWAP------ 653
            L L C   DG   +Y +          +    PI               + W P      
Sbjct: 126  LKLGCVGLDGIFRIYESLDPSDLTNWVLTTEIPILSDLLPAKSLQSSFGIEWCPAKFTKT 185

Query: 654  ------SMAPGALVGSG----LHD--------PVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                  ++  G + G+     L+D             +S G  +  KV KL +       
Sbjct: 186  EKFIIVALDQGFIYGTAPSNQLYDEDVLGDFGSDADQSSIGSHSNSKVIKLCD------- 238

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKV-----LYD 944
               L  H   +R V+WAP++G     IA+  +DG V I+  A E    E K+     L D
Sbjct: 239  ---LPEHNGLIRSVSWAPSMGRNYHLIATGCKDGYVRIFK-AVESATGELKIETLAKLND 294

Query: 945  FNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                VWRV+W+LTG +L+ A  D  + LW      EW
Sbjct: 295  HKLEVWRVNWNLTGTILSSAGDDGKIRLWKCNYLNEW 331



>gb:CR380956_1652438 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 338

 Score =  123 bits (309), Expect = 6e-27
 Identities = 93/334 (27%), Positives = 147/334 (44%), Gaps = 43/334 (12%)
 Frame = +3

Query: 183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHGPVWQV 359
            Q   TGH D VHDV+ D+YG+ +AT SSD  IK+  +  ++T   +  +   H   +  +
Sbjct: 2    QPFNTGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSL 61

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEG-NQNE-----WTQAHVFNDHKSSVNSISWAPHEL 521
             WA P++G ++AS S+D  + +W+E  NQ E     WT+    ND K S+  + +AP  L
Sbjct: 62   DWASPEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLCTLNDSKGSLYCVKFAPSHL 121

Query: 522  GLCLACGSSDGNISVYTARSDG---GWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG-- 686
            GL +A   +DG + +Y A        W      +  P+       AP+    +  G    
Sbjct: 122  GLRIASIGNDGIMRMYDALDPSNLRSWTMTAEVKVLPV-------APANNLQSAFGLSWC 174

Query: 687  -LHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIA 863
                  +K+A    D      +  +G +       L  HT+ +R ++WAP +G P   IA
Sbjct: 175  FTRFSPEKIAVCALDQAYIYQRGKDGHFYQ--AGKLPGHTSLIRSISWAPLIGRPYHLIA 232

Query: 864  SASEDGKVVIWTV-----------AKEGDQW----------------EGKVLY---DFNT 953
            +  +DG+V I+ V             + D +                E ++L    D   
Sbjct: 233  TGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQGIKQRQNNTDLEVELLSEHDDHKG 292

Query: 954  PVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
             VW VSW+LTG +L+    D  V LW      E+
Sbjct: 293  EVWSVSWNLTGTILSSTGEDGKVRLWKSTYSNEY 326



>gb:AY325252_1177921 Rattus norvegicus Da1-6 mRNA, complete cds.
          Length = 2377

 Score =  121 bits (303), Expect = 3e-26
 Identities = 90/300 (30%), Positives = 136/300 (45%), Gaps = 33/300 (11%)
 Frame = +3

Query: 255  TASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKE 434
            T S +  + +   S +      A+   H G VW+V+WAHP+FG +LASCSFD    VW+E
Sbjct: 541  TYSCECCVCVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEE 600

Query: 435  ---------GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDG 587
                       Q+ W +     D ++SV  + +AP  +GL LA  S+DG + VY A    
Sbjct: 601  IVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRVYEAP--- 657

Query: 588  GWDTARIDQ---AHPIG----VTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT---- 734
              D   + Q    H I      + +SW PS        S  H P   + + G D++    
Sbjct: 658  --DVMNLSQWSLQHEISCKLCCSCISWNPS-------SSRAHPP---MIAVGSDDSSPNS 705

Query: 735  ---VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV-VIWTV 902
               V++++      K      L   T+ V D+A+APNLG     +A A++D ++  +  V
Sbjct: 706  MAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPV 765

Query: 903  AKEGDQWEGKVLYDF---------NTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
             KE     G   ++          N+ VWRVSW++TG +LA +  D  V LW       W
Sbjct: 766  RKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNW 825



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 18/34 (52%), Positives = 25/34 (73%)
 Frame = +3

Query: 180 AQKIETGHSDTVHDVSMDYYGKRVATASSDASIK 281
           A+ I   H D +HDVS D++G+R+AT SSD S+K
Sbjct: 388 ARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVK 421



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNS 497
           +A    H+  VW+VSW     G++LAS   DG V +WK    + W    +   + S VN 
Sbjct: 783 VAQFDNHNSQVWRVSWNIT--GTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNG 840

Query: 498 IS 503
            S
Sbjct: 841 SS 842



>sp|Q10099|SEH1_SCHPO Nuclear pore protein SEH1
            homolog.>pir|T37727|T37727 probable nuclear pore protein
            - fission yeast  (Schizosaccharomyces
            pombe)>gb:SPAC15F9_1716583 S.pombe chromosome I cosmid
            c15F9.
          Length = 339

 Score =  119 bits (298), Expect = 1e-25
 Identities = 92/326 (28%), Positives = 144/326 (44%), Gaps = 42/326 (12%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHG--PVW 353
            A  I+T H D V+DV+ D+YG+R+ + S+D  +K+    N+ T     T     G   + 
Sbjct: 6    ATTIQTNHQDLVNDVTYDFYGRRMVSCSADQRVKVYDF-NDDTETWAITSEWRAGDASLM 64

Query: 354  QVSWAHPKFGSLLASCSFDGKVIVWKEGNQN----EWTQAHVFNDHKSSVNSISWAPHEL 521
            +V+WAHP FG +LA CS D  V +++E  +N     W +     D +S+V  IS+ P + 
Sbjct: 65   RVAWAHPSFGQVLAVCSLDRGVRIYEEQKKNFESKTWVEVAKLMDARSAVLDISFCPFQH 124

Query: 522  GLCLACGSSDGNISVYTARSDGG---WDTARIDQAHPIGVT-------AVSWAPSMAPGA 671
            G  LA  S+D  + +Y A   G    W         P   +        V+W PS     
Sbjct: 125  GCKLAAVSADATLRIYEAMEPGNLTYWTLMNEIALMPSPPSRNEQPAFCVNWCPSRWR-- 182

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKL-YNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
                      ++  + GC N   ++K   +G WK      L  HT+ +RD+ WAP++G  
Sbjct: 183  ----------EQYIAVGCMNDAYIYKQNSHGKWKK--VAELPGHTDLIRDICWAPSMGSS 230

Query: 849  KSTIASASEDGKVVIWTVA-------KEGDQWEGKVLYDFN------------------T 953
               IA+A +DG V I+ V        +E +     +  D N                   
Sbjct: 231  YYLIATACKDGNVRIFKVETLCEEVFQEEEDAGNSMTEDSNFNLNSLKVELIGEYDNHKC 290

Query: 954  PVWRVSWSLTGNLLAVASGDNNVTLW 1031
             VWR  +++TG +L+ +  D  V LW
Sbjct: 291  QVWRCRFNVTGTILSSSGDDGCVRLW 316



>gb:AX885787_1481240 Sequence 1650 from Patent EP1033401.
          Length = 106

 Score =  118 bits (296), Expect = 2e-25
 Identities = 54/101 (53%), Positives = 69/101 (68%)
 Frame = +3

Query: 189 IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           ++T H D +HD  MDYYG R+AT SSD S+KI  V N      +A L GH GPVWQV+WA
Sbjct: 8   VDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQIL-IADLRGHEGPVWQVAWA 66

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
           HP +G++LASCS+D KVI+W+E N   W ++H    H SSV
Sbjct: 67  HPMYGNILASCSYDRKVIIWREEN-GTWEKSHEHAGHDSSV 106



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +3

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS--LTGNLLAVASGDNNVTLW 1031
            +A+ S D  V I+ V + G Q     L     PVW+V+W+  + GN+LA  S D  V +W
Sbjct: 28   LATCSSDRSVKIFDV-RNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIW 86

Query: 1032 NEAVDGEW 1055
             E  +G W
Sbjct: 87   REE-NGTW 93



>gb:BC051159_2550412 Danio rerio SEH1-like (S. cerevisiae), mRNA
           (cDNA clone MGC:55977 IMAGE:3819590), complete cds.
          Length = 186

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/176 (34%), Positives = 95/176 (53%), Gaps = 12/176 (6%)
 Frame = +3

Query: 180 AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
           A+ I   H D +HDVS D++G+R+AT SSD S+K+    ++      A+   H G VW+V
Sbjct: 4   AKSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKGDDGEWHCTASWKTHSGSVWRV 63

Query: 360 SWAHPKFGSLLASCSFDGKVIVW---------KEGNQNEWTQAHVFNDHKSSVNSISWAP 512
           +WAHP+FG +LASCSFD    VW         K+  Q+ W +     D ++SV  + +AP
Sbjct: 64  TWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKQRGQSHWIKRTTLVDSRTSVTDVKFAP 123

Query: 513 HELGLCLACGSSDGNISVYTA---RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
             +GL L   S+DG + +Y A    +   W + + + +  +  + +SW P    G+
Sbjct: 124 KHMGLMLTTCSADGVVRIYEAPDVMNLSQW-SLQHEISCKLACSCISWEPLQFSGS 178



>pir|T26842|T26842 hypothetical protein Y43F4B.4 - Caenorhabditis
            elegans>gb:CEY43F4B_1369995 Caenorhabditis elegans YAC
            Y43F4B, complete sequence.
          Length = 363

 Score =  107 bits (268), Expect = 3e-22
 Identities = 80/314 (25%), Positives = 142/314 (45%), Gaps = 29/314 (9%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
            H D +H VS D +G+R+AT +SD ++ I     +   +  A    H G VW+V WAHP+F
Sbjct: 16   HRDLIHCVSFDPHGRRMATCASDMTMAIWDRKPDGNWRRSAHWKCHGGAVWRVIWAHPEF 75

Query: 381  GSLLASCSFDGKVIVWKE----------GNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            G ++A+CS+D  +++W+E            +++W +  + +D++S V  I ++P  LGL 
Sbjct: 76   GQIVATCSYDRTIVIWEEQIVRSEKDLKQKESQWIRRTIISDNRSDVTDICFSPRHLGLM 135

Query: 531  LACGSSDGNISVYTAR---SDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV 701
            +A  +  G + +Y A        W+     QA       V+W+ S     L+  G  +  
Sbjct: 136  MASCNVLGTVRIYEAPDIVDASRWNLIHELQAFHTRCGCVTWSLSRMHRPLIAVGSDE-- 193

Query: 702  QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNW-VRDVAWAPNLGLPKSTIASASED 878
                 A     V +++  +G+ K     +L       + D+ ++P   +    +A AS D
Sbjct: 194  ---KKAENKKRVVIYENIDGLRKWQRINSLVFDLPCPITDLKFSPISMVDSHQLAVASGD 250

Query: 879  GKVVIWTVAK----EGDQWEGKV-LYDFN----------TPVWRVSWSLTGNLLAVASGD 1013
              V    VA+    E D  E  + L D+N             WR+ ++L G++++  S D
Sbjct: 251  VHVYNIKVARSAILEEDGVENPIQLADYNLIKVALLGDHRKAWRLRYNLMGSVISSTSLD 310

Query: 1014 NNVTLWNEAVDGEW 1055
              +  W      +W
Sbjct: 311  GTLRSWKSLFVNQW 324



>gb:BA000045_742896 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1193

 Score =  106 bits (264), Expect = 1e-21
 Identities = 83/289 (28%), Positives = 141/289 (48%)
 Frame = +3

Query: 183  QKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVS 362
            +K   G++  ++ V+    G+ +A+AS+D ++++   +     Q   TL GHH  V+ V+
Sbjct: 854  RKTIQGYTSGIYSVAFSPDGRTLASASTDHTVRLWDTATGECRQ---TLEGHHSWVFAVA 910

Query: 363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG 542
            ++    G  LAS S D  V++W+           +   H S V S+ ++P   G  +A G
Sbjct: 911  FSPD--GQTLASGSVDHTVLLWETVTGR---CRKILEGHHSWVWSVVFSPD--GTTIATG 963

Query: 543  SSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAG 722
            S+D  + ++ A +      + + QAH   V+AV+++   A G +           LASA 
Sbjct: 964  SADRTVRIWNAATGR---LSTVLQAHTGWVSAVAFS---ADGRI-----------LASAS 1006

Query: 723  CDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
             D TV++W + NG+    C   L  H+NWV  V ++P+     S +AS S DG V +W +
Sbjct: 1007 ADGTVRLWNVSNGL----CVALLAEHSNWVHSVVFSPD----GSLLASGSADGTVRLWDL 1058

Query: 903  AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
                     +V+    +PVW V++S  G LLA A  D  + +W  +  G
Sbjct: 1059 QSNRCT---RVIEGHTSPVWSVAFSADGTLLASAGEDRIIRIWRTSTGG 1104



 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 73/285 (25%), Positives = 133/285 (46%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            +I  GH+D +H V     G+ +A+  +D ++++      +T +   +  GH   +W V++
Sbjct: 729  RILRGHTDWIHSVVFSPDGRSIASGGADRTVRL---WEAATGECRKSFPGHSSLIWSVAF 785

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            +    G  LAS   D  + +W            +   H + V +++++P   G  LA GS
Sbjct: 786  SPD--GQSLASGGQDALIKLWDVATAQ---CRRILQGHTNLVYAVAFSPD--GQTLASGS 838

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            +D  + ++  ++D G    +  Q +  G+ +V+++P                + LASA  
Sbjct: 839  ADQAVRLW--KTDTG-QCRKTIQGYTSGIYSVAFSPD--------------GRTLASAST 881

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            D+TV++W    G    +C   L+ H +WV  VA++P+      T+AS S D  V++W   
Sbjct: 882  DHTVRLWDTATG----ECRQTLEGHHSWVFAVAFSPD----GQTLASGSVDHTVLLWETV 933

Query: 906  KEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                +   K+L   ++ VW V +S  G  +A  S D  V +WN A
Sbjct: 934  TGRCR---KILEGHHSWVWSVVFSPDGTTIATGSADRTVRIWNAA 975



 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 91/341 (26%), Positives = 146/341 (42%), Gaps = 36/341 (10%)
 Frame = +3

Query: 126  FQGDHTFIRSSDKEGKMPAQKIE--------TGHSDTVHDVSMDYYGKRVATASSDASIK 281
            F  +   + + D +GK+   ++          GH+  V  V     G  VA+ SSD +++
Sbjct: 575  FSPNRNVLATGDADGKVCLWQLPHGIQINICEGHTAWVWSVGFSPDGSIVASGSSDQTVR 634

Query: 282  IIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA 461
            +      +T Q L  L GH   +W V ++    GS++AS S D  V +W+          
Sbjct: 635  LW---ETTTGQCLRILQGHANSIWSVGFSPD--GSIMASGSSDQTVRLWE---TTTGQCL 686

Query: 462  HVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAV 641
             +   H   V S++++P   G  +A GSSD  + ++   +       RI + H   + +V
Sbjct: 687  RILQGHGGWVLSLAFSPD--GSIVASGSSDQTVRLWETTTG---QCLRILRGHTDWIHSV 741

Query: 642  SWAP---SMAPG------------------------ALVGSGLHDP-VQKLASAGCDNTV 737
             ++P   S+A G                        +L+ S    P  Q LAS G D  +
Sbjct: 742  VFSPDGRSIASGGADRTVRLWEAATGECRKSFPGHSSLIWSVAFSPDGQSLASGGQDALI 801

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W     V    C   LQ HTN V  VA++P+      T+AS S D  V +W   K   
Sbjct: 802  KLW----DVATAQCRRILQGHTNLVYAVAFSPD----GQTLASGSADQAVRLW---KTDT 850

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                K +  + + ++ V++S  G  LA AS D+ V LW+ A
Sbjct: 851  GQCRKTIQGYTSGIYSVAFSPDGRTLASASTDHTVRLWDTA 891



>gb:AF323584_1786294 Podospora anserina beta transducin-like protein
            HET-E2C*40 (het-e) gene, het-e2C*40 allele, complete cds.
          Length = 1356

 Score =  102 bits (254), Expect = 1e-20
 Identities = 89/303 (29%), Positives = 138/303 (45%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            GD T I+  D       Q +E GH ++V  V+    G+RVA+ S D +IKI   ++ + +
Sbjct: 987  GDKT-IKIWDTASGTCTQTLE-GHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCT 1044

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
            Q   TL GH G VW V+++    G  +AS S DG + +W   +    T       H   V
Sbjct: 1045 Q---TLEGHGGWVWSVAFSPD--GQRVASGSIDGTIKIWDAAS---GTCTQTLEGHGDWV 1096

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
             S++++P   G  +A GS D  I ++ A S     T    + H   V +V+++P      
Sbjct: 1097 QSVAFSPD--GQRVASGSDDHTIKIWDAASGTCTQTL---EGHGDSVWSVAFSPD----- 1146

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
                      Q++AS   D T+K+W   +G     C   L+ H  WV  VA++P+     
Sbjct: 1147 ---------GQRVASGSIDGTIKIWDAASGT----CTQTLEGHGGWVHSVAFSPD----G 1189

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              +AS S DG + IW  A        + L      V  V++S  G  +A  S DN + +W
Sbjct: 1190 QRVASGSIDGTIKIWDAASGTCT---QTLEGHGGWVHSVAFSPDGQRVASGSSDNTIKIW 1246

Query: 1032 NEA 1040
            + A
Sbjct: 1247 DTA 1249



 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 82/281 (29%), Positives = 129/281 (45%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q   TL GH G VW V+++   
Sbjct: 839  GHGSSVLSVAFSPDGQRVASGSDDKTIKIWDAASGTGTQ---TLEGHGGSVWSVAFSPD- 894

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS S D  + +W   +    T       H SSV S++++P   G  +A GS D  
Sbjct: 895  -GQRVASGSDDKTIKIWDAAS---GTCTQTLEGHGSSVLSVAFSPD--GQRVASGSGDKT 948

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++   S  G  T    + H   V +V+++P                Q++AS   D T+
Sbjct: 949  IKIWDTASGTGTQTL---EGHGGSVWSVAFSPD--------------GQRVASGSGDKTI 991

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W   +G     C   L+ H N V  VA++P+       +AS S+D  + IW  A    
Sbjct: 992  KIWDTASGT----CTQTLEGHGNSVWSVAFSPD----GQRVASGSDDKTIKIWDTASGTC 1043

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                + L      VW V++S  G  +A  S D  + +W+ A
Sbjct: 1044 T---QTLEGHGGWVWSVAFSPDGQRVASGSIDGTIKIWDAA 1081



 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 90/338 (26%), Positives = 141/338 (41%), Gaps = 36/338 (10%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
            D   I+  D       Q +E GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q
Sbjct: 861  DDKTIKIWDAASGTGTQTLE-GHGGSVWSVAFSPDGQRVASGSDDKTIKIWDAASGTCTQ 919

Query: 315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
               TL GH   V  V+++    G  +AS S D  + +W   +    T       H  SV 
Sbjct: 920  ---TLEGHGSSVLSVAFSPD--GQRVASGSGDKTIKIWDTAS---GTGTQTLEGHGGSVW 971

Query: 495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSM 659
            S++++P   G  +A GS D  I +        WDTA     +  + H   V +V+++P  
Sbjct: 972  SVAFSPD--GQRVASGSGDKTIKI--------WDTASGTCTQTLEGHGNSVWSVAFSPD- 1020

Query: 660  APGALVGSGLHDPV-------------------------------QKLASAGCDNTVKVW 746
              G  V SG  D                                 Q++AS   D T+K+W
Sbjct: 1021 --GQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFSPDGQRVASGSIDGTIKIW 1078

Query: 747  KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWE 926
               +G     C   L+ H +WV+ VA++P+       +AS S+D  + IW  A       
Sbjct: 1079 DAASGT----CTQTLEGHGDWVQSVAFSPD----GQRVASGSDDHTIKIWDAASGTCT-- 1128

Query: 927  GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             + L      VW V++S  G  +A  S D  + +W+ A
Sbjct: 1129 -QTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAA 1165



 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 57/188 (30%), Positives = 90/188 (47%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D V  V+    G+RVA+ S D +IKI   ++ + +Q   TL GH   VW V+++   
Sbjct: 1091 GHGDWVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQ---TLEGHGDSVWSVAFSPD- 1146

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS S DG + +W   +    T       H   V+S++++P   G  +A GS DG 
Sbjct: 1147 -GQRVASGSIDGTIKIWDAAS---GTCTQTLEGHGGWVHSVAFSPD--GQRVASGSIDGT 1200

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++ A S     T    + H   V +V+++P                Q++AS   DNT+
Sbjct: 1201 IKIWDAASGTCTQTL---EGHGGWVHSVAFSPD--------------GQRVASGSSDNTI 1243

Query: 738  KVWKLYNG 761
            K+W   +G
Sbjct: 1244 KIWDTASG 1251



 Score = 33.5 bits (75), Expect = 8.2
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL 320
            GH   VH V+    G+RVA+ SSD +IKI   ++ + +Q L
Sbjct: 1217 GHGGWVHSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTL 1257



>gb:AF323582_1786292 Podospora anserina beta transducin-like protein
            HET-E2C (het-e) gene, het-e2C allele, complete cds.
          Length = 1356

 Score =  102 bits (254), Expect = 1e-20
 Identities = 89/303 (29%), Positives = 138/303 (45%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            GD T I+  D       Q +E GH ++V  V+    G+RVA+ S D +IKI   ++ + +
Sbjct: 987  GDKT-IKIWDTASGTCTQTLE-GHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCT 1044

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
            Q   TL GH G VW V+++    G  +AS S DG + +W   +    T       H   V
Sbjct: 1045 Q---TLEGHGGWVWSVAFSPD--GQRVASGSIDGTIKIWDAAS---GTCTQTLEGHGDWV 1096

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
             S++++P   G  +A GS D  I ++ A S     T    + H   V +V+++P      
Sbjct: 1097 QSVAFSPD--GQRVASGSDDHTIKIWDAASGTCTQTL---EGHGDSVWSVAFSPD----- 1146

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
                      Q++AS   D T+K+W   +G     C   L+ H  WV  VA++P+     
Sbjct: 1147 ---------GQRVASGSIDGTIKIWDAASGT----CTQTLEGHGGWVHSVAFSPD----G 1189

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              +AS S DG + IW  A        + L      V  V++S  G  +A  S DN + +W
Sbjct: 1190 QRVASGSIDGTIKIWDAASGTCT---QTLEGHGGWVHSVAFSPDGQRVASGSSDNTIKIW 1246

Query: 1032 NEA 1040
            + A
Sbjct: 1247 DTA 1249



 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 82/281 (29%), Positives = 129/281 (45%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q   TL GH G VW V+++   
Sbjct: 839  GHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQ---TLEGHGGSVWSVAFSPD- 894

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS S D  + +W   +    T       H SSV S++++P   G  +A GS D  
Sbjct: 895  -GQRVASGSDDKTIKIWDAAS---GTCTQTLEGHGSSVLSVAFSPD--GQRVASGSGDKT 948

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++   S  G  T    + H   V +V+++P                Q++AS   D T+
Sbjct: 949  IKIWDTASGTGTQTL---EGHGGSVWSVAFSPD--------------GQRVASGSGDKTI 991

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W   +G     C   L+ H N V  VA++P+       +AS S+D  + IW  A    
Sbjct: 992  KIWDTASGT----CTQTLEGHGNSVWSVAFSPD----GQRVASGSDDKTIKIWDTASGTC 1043

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                + L      VW V++S  G  +A  S D  + +W+ A
Sbjct: 1044 T---QTLEGHGGWVWSVAFSPDGQRVASGSIDGTIKIWDAA 1081



 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 90/338 (26%), Positives = 141/338 (41%), Gaps = 36/338 (10%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
            D   I+  D       Q +E GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q
Sbjct: 861  DDKTIKIWDTASGTGTQTLE-GHGGSVWSVAFSPDGQRVASGSDDKTIKIWDAASGTCTQ 919

Query: 315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
               TL GH   V  V+++    G  +AS S D  + +W   +    T       H  SV 
Sbjct: 920  ---TLEGHGSSVLSVAFSPD--GQRVASGSGDKTIKIWDTAS---GTGTQTLEGHGGSVW 971

Query: 495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSM 659
            S++++P   G  +A GS D  I +        WDTA     +  + H   V +V+++P  
Sbjct: 972  SVAFSPD--GQRVASGSGDKTIKI--------WDTASGTCTQTLEGHGNSVWSVAFSPD- 1020

Query: 660  APGALVGSGLHDPV-------------------------------QKLASAGCDNTVKVW 746
              G  V SG  D                                 Q++AS   D T+K+W
Sbjct: 1021 --GQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFSPDGQRVASGSIDGTIKIW 1078

Query: 747  KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWE 926
               +G     C   L+ H +WV+ VA++P+       +AS S+D  + IW  A       
Sbjct: 1079 DAASGT----CTQTLEGHGDWVQSVAFSPD----GQRVASGSDDHTIKIWDAASGTCT-- 1128

Query: 927  GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             + L      VW V++S  G  +A  S D  + +W+ A
Sbjct: 1129 -QTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAA 1165



 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 57/188 (30%), Positives = 90/188 (47%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D V  V+    G+RVA+ S D +IKI   ++ + +Q   TL GH   VW V+++   
Sbjct: 1091 GHGDWVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQ---TLEGHGDSVWSVAFSPD- 1146

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS S DG + +W   +    T       H   V+S++++P   G  +A GS DG 
Sbjct: 1147 -GQRVASGSIDGTIKIWDAAS---GTCTQTLEGHGGWVHSVAFSPD--GQRVASGSIDGT 1200

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++ A S     T    + H   V +V+++P                Q++AS   DNT+
Sbjct: 1201 IKIWDAASGTCTQTL---EGHGGWVHSVAFSPD--------------GQRVASGSSDNTI 1243

Query: 738  KVWKLYNG 761
            K+W   +G
Sbjct: 1244 KIWDTASG 1251



 Score = 33.5 bits (75), Expect = 8.2
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL 320
            GH   VH V+    G+RVA+ SSD +IKI   ++ + +Q L
Sbjct: 1217 GHGGWVHSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTL 1257



>gb:AF323583_1786293 Podospora anserina beta transducin-like protein
            HET-E2C*4 (het-e) gene, het-e2C*4 allele, complete cds.
          Length = 1356

 Score =  100 bits (248), Expect = 7e-20
 Identities = 87/312 (27%), Positives = 135/312 (43%), Gaps = 31/312 (9%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q   TL GH G VW V+++   
Sbjct: 839  GHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQ---TLEGHGGSVWSVAFSPD- 894

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS S D  + +W   +    T       H SSV S++++P   G  +A GS D  
Sbjct: 895  -GQRVASGSDDKTIKIWDAAS---GTCTQTLEGHGSSVLSVAFSPD--GQRVASGSGDKT 948

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV------------ 701
            I ++   S  G  T    + H   V +V+++P    G  V SG  D              
Sbjct: 949  IKIWDTASGTGTQTL---EGHGGSVWSVAFSPD---GQRVASGSGDKTIKIWDTASGTCT 1002

Query: 702  -------------------QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
                               Q++AS   D T+K+W   +G     C   L+ H  WV+ VA
Sbjct: 1003 QTLEGHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGT----CTQTLEGHGGWVQSVA 1058

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVA 1004
            ++P+       +AS S D  + IW  A        + L      VW V++S  G  +A  
Sbjct: 1059 FSPD----GQRVASGSNDHTIKIWDAASGTCT---QTLEGHGDSVWSVAFSPDGQRVASG 1111

Query: 1005 SGDNNVTLWNEA 1040
            S D+ + +W+ A
Sbjct: 1112 SDDHTIKIWDAA 1123



 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 89/303 (29%), Positives = 135/303 (44%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            GD T I+  D       Q +E GH ++V  V+    G+RVA+ S D +IKI   ++ + +
Sbjct: 987  GDKT-IKIWDTASGTCTQTLE-GHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCT 1044

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
            Q   TL GH G  W  S A    G  +AS S D  + +W   +    T       H  SV
Sbjct: 1045 Q---TLEGHGG--WVQSVAFSPDGQRVASGSNDHTIKIWDAAS---GTCTQTLEGHGDSV 1096

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
             S++++P   G  +A GS D  I ++ A S     T    + H   V +V+++P      
Sbjct: 1097 WSVAFSPD--GQRVASGSDDHTIKIWDAASGTCTQTL---EGHGDSVWSVAFSPD----- 1146

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
                      Q++AS   D T+K+W   +G     C   L+ H  WV  VA++P+     
Sbjct: 1147 ---------GQRVASGSIDGTIKIWDAASGT----CTQTLEGHGGWVHSVAFSPD----G 1189

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              +AS S DG + IW  A        + L      V  V++S  G  +A  S DN + +W
Sbjct: 1190 QRVASGSIDGTIKIWDAASGTCT---QTLEGHGGWVHSVAFSPDGQRVASGSSDNTIKIW 1246

Query: 1032 NEA 1040
            + A
Sbjct: 1247 DTA 1249



 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 64/209 (30%), Positives = 100/209 (47%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
            DHT I+  D       Q +E GH D+V  V+    G+RVA+ S D +IKI   ++ + +Q
Sbjct: 1072 DHT-IKIWDAASGTCTQTLE-GHGDSVWSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQ 1129

Query: 315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
               TL GH   VW V+++    G  +AS S DG + +W   +    T       H   V+
Sbjct: 1130 ---TLEGHGDSVWSVAFSPD--GQRVASGSIDGTIKIWDAAS---GTCTQTLEGHGGWVH 1181

Query: 495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL 674
            S++++P   G  +A GS DG I ++ A S     T    + H   V +V+++P       
Sbjct: 1182 SVAFSPD--GQRVASGSIDGTIKIWDAASGTCTQTL---EGHGGWVHSVAFSPD------ 1230

Query: 675  VGSGLHDPVQKLASAGCDNTVKVWKLYNG 761
                     Q++AS   DNT+K+W   +G
Sbjct: 1231 --------GQRVASGSSDNTIKIWDTASG 1251



 Score = 33.5 bits (75), Expect = 8.2
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL 320
            GH   VH V+    G+RVA+ SSD +IKI   ++ + +Q L
Sbjct: 1217 GHGGWVHSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTL 1257



>gb:BA000045_744431 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1188

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 89/285 (31%), Positives = 134/285 (47%), Gaps = 3/285 (1%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGHS  V  VS    G+ +A+ S D +++I   +   T Q L TL G+ G +W V++A  
Sbjct: 818  TGHSGQVWSVSFAPDGQTLASGSLDQTVRIWDAA---TGQCLRTLQGNAGWIWSVAFAPD 874

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G  LAS S D  V +W   +            H S V S++++P   G  LA GS D 
Sbjct: 875  --GQTLASGSLDRTVRIWDVPSGR---CVRTLTGHGSWVWSVAFSPD--GRTLASGSFDQ 927

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
             I ++ A +       R    H   V +V+++P    G  + SG HD            T
Sbjct: 928  TIKLWDAATG---QCLRTLSGHNNWVRSVAFSPD---GRTLASGSHD-----------QT 970

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            VK+W++ +G     C   L  H++WV  VA++P+      T+AS S D  V +W  A   
Sbjct: 971  VKLWEVSSG----QCLRTLTGHSSWVWSVAFSPD----GRTVASGSFDQTVRVWNAAT-- 1020

Query: 915  DQWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                G+ L+     ++ VW V++S  G +LA  SG+  V LW+ A
Sbjct: 1021 ----GECLHTLKVDSSQVWSVAFSPDGRILAGGSGNYAVWLWDTA 1061



 Score = 96.7 bits (239), Expect = 8e-19
 Identities = 82/282 (29%), Positives = 124/282 (43%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGH+  +  +S    G+ +A++S D ++K+   +   T + L T  GH G VW VS+A  
Sbjct: 776  TGHTGRIRAISFSPDGEWLASSSLDCTVKLWDAA---TGECLRTFTGHSGQVWSVSFAPD 832

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G  LAS S D  V +W                +   + S+++AP   G  LA GS D 
Sbjct: 833  --GQTLASGSLDQTVRIWDAATGQ---CLRTLQGNAGWIWSVAFAPD--GQTLASGSLDR 885

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
             + ++   S       R    H   V +V+++P                + LAS   D T
Sbjct: 886  TVRIWDVPSG---RCVRTLTGHGSWVWSVAFSPD--------------GRTLASGSFDQT 928

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            +K+W    G     C   L  H NWVR VA++P+      T+AS S D  V +W V+   
Sbjct: 929  IKLWDAATG----QCLRTLSGHNNWVRSVAFSPD----GRTLASGSHDQTVKLWEVSSGQ 980

Query: 915  DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                 + L   ++ VW V++S  G  +A  S D  V +WN A
Sbjct: 981  CL---RTLTGHSSWVWSVAFSPDGRTVASGSFDQTVRVWNAA 1019



 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 77/284 (27%), Positives = 128/284 (45%), Gaps = 3/284 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D +  ++    G  +A+ S D +IK+    + +T Q L TL GH G  W  S A   
Sbjct: 608  GHTDWISALAFSPDGSVLASGSEDQTIKLW---DTATGQCLRTLTGHGG--WVYSVAFSP 662

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+L+AS S   + +   +    + T+   F      + S++++P   G  LA  S D  
Sbjct: 663  DGTLIASSSPSNETVRLWDAAGGQCTRT--FKSRTGRMWSVAFSPD--GHTLAAASLDRT 718

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            + ++  R+     T      H   V +V+++P    G ++ SG HD            T+
Sbjct: 719  VKLWDVRTGERLGTLT---GHTDQVLSVAFSPD---GGVLASGSHD-----------QTL 761

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W++  G     C   L  HT  +R ++++P+       +AS+S D  V +W  A    
Sbjct: 762  KLWEVTTGT----CLTTLTGHTGRIRAISFSPD----GEWLASSSLDCTVKLWDAA---- 809

Query: 918  QWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
               G+ L  F   +  VW VS++  G  LA  S D  V +W+ A
Sbjct: 810  --TGECLRTFTGHSGQVWSVSFAPDGQTLASGSLDQTVRIWDAA 851



 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 76/280 (27%), Positives = 121/280 (43%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGH   V  V+    G+ +A+ S D +IK+   +   T Q L TL+GH+   W  S A  
Sbjct: 902  TGHGSWVWSVAFSPDGRTLASGSFDQTIKLWDAA---TGQCLRTLSGHNN--WVRSVAFS 956

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G  LAS S D  V +W+  +            H S V S++++P   G  +A GS D 
Sbjct: 957  PDGRTLASGSHDQTVKLWEVSSGQ---CLRTLTGHSSWVWSVAFSPD--GRTVASGSFDQ 1011

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
             + V+ A +     T ++D +         W+ + +P   +          LA    +  
Sbjct: 1012 TVRVWNAATGECLHTLKVDSSQV-------WSVAFSPDGRI----------LAGGSGNYA 1054

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            V +W    G    +C   L  HT+ V  VA++P+      T+ S+S D  V +W  A  G
Sbjct: 1055 VWLWDTATG----ECLRTLTGHTSQVWSVAFSPD----SRTVVSSSHDQTVRLWDAAT-G 1105

Query: 915  DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +    + L    + VW V++S  G  +   S D  + LW+
Sbjct: 1106 ECL--RTLTGHTSQVWSVAFSPDGRTVISGSQDETIRLWD 1143



 Score = 50.4 bits (119), Expect = 6e-05
 Identities = 52/191 (27%), Positives = 85/191 (44%), Gaps = 1/191 (0%)
 Frame = +3

Query: 465  VFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVS 644
            VF      +  ++++P   G  LA G   G + ++  R DG    +   + H   ++A++
Sbjct: 563  VFAQTFGGILFVAYSPK--GELLAIGDDSGEVRLWRVR-DGQQQLSF--RGHTDWISALA 617

Query: 645  WAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
            ++P    G+++ SG  D            T+K+W    G     C   L  H  WV  VA
Sbjct: 618  FSPD---GSVLASGSED-----------QTIKLWDTATG----QCLRTLTGHGGWVYSVA 659

Query: 825  WAPNLGLPKSTIASASEDGKVV-IWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAV 1001
            ++P+  L    IAS+S   + V +W  A  G Q   +        +W V++S  G+ LA 
Sbjct: 660  FSPDGTL----IASSSPSNETVRLWDAA--GGQCT-RTFKSRTGRMWSVAFSPDGHTLAA 712

Query: 1002 ASGDNNVTLWN 1034
            AS D  V LW+
Sbjct: 713  ASLDRTVKLWD 723



>gb:CNS07EGH_1374321 chromosome XI of strain GB-M1 of Encephalitozoon
            cuniculi (Microspora).
          Length = 272

 Score = 96.7 bits (239), Expect = 8e-19
 Identities = 81/278 (29%), Positives = 126/278 (45%), Gaps = 6/278 (2%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL---ATLAGHHGPVWQVSWAH 371
            H DT+H +  D+  K++ TA SD  +++    ++     L     L G  GP  +  + +
Sbjct: 4    HKDTIHSIETDFSQKKIVTACSDGMVRVFAKGSSVPPYELNLELELDGDSGPATKAIFLN 63

Query: 372  PKFGSLLASCSFDGKVIVWKE--GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
               G  +AS  F GKVI+WK   G  N+ ++  + +    SVN IS   +     L C  
Sbjct: 64   Q--GEFIASSYFSGKVIIWKYEGGRFNKKSERQILS---GSVNDISGRWNGSSFTLFCAC 118

Query: 546  SDGNISVYTARSDGGWDTARIDQ-AHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAG 722
            SDG + +     D  ++T   +   H  GV++VS   S                   S G
Sbjct: 119  SDGTVRILDI--DSSFNTTESEVFCHRFGVSSVSATES----------------GFVSGG 160

Query: 723  CDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
             D +V VW   +G  +   F   + H  +VRDVA  P        +AS SEDG VVI+T 
Sbjct: 161  MDYSVAVW---DGTSEAARF---RDHKGFVRDVAACPANSFKLFCMASCSEDGTVVIYT- 213

Query: 903  AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDN 1016
             K G+++E + +     P + +SWS +G  L+V  G +
Sbjct: 214  -KRGEEYESQKI-TLEEPCYSLSWSFSGFSLSVGYGSS 249



>sp|Q8YRI1|YY46_ANASP Hypothetical WD-repeat protein
            alr3466.>pir|AC2239|AC2239 WD-40 repeat protein
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_684455 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1526

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 85/282 (30%), Positives = 130/282 (46%), Gaps = 3/282 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V+ V  +  G  +A+ SSD ++++  +++   S+ L T  GH    W  S     
Sbjct: 1198 GHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINS---SKCLCTFQGHTS--WVNSVVFNP 1252

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             GS+LAS S D  V +W   +       H F  H + VNS+++ P   G  LA GS D  
Sbjct: 1253 DGSMLASGSSDKTVRLWDISSSK---CLHTFQGHTNWVNSVAFNPD--GSMLASGSGDQT 1307

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            + ++   S     T    Q H   V++V+++P    G +           LAS   D TV
Sbjct: 1308 VRLWEISSSKCLHTF---QGHTSWVSSVTFSPD---GTM-----------LASGSDDQTV 1350

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            ++W + +G    +C      HTNWV  V ++P+  +    +AS S D  V +W+++    
Sbjct: 1351 RLWSISSG----ECLYTFLGHTNWVGSVIFSPDGAI----LASGSGDQTVRLWSISS--- 1399

Query: 918  QWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               GK LY     N  V  + +S  G LLA  S D  V LWN
Sbjct: 1400 ---GKCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWN 1438



 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 82/282 (29%), Positives = 128/282 (45%), Gaps = 3/282 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V  V        +A+ SSD ++++  +   S+ + L    GH G  W  S A   
Sbjct: 946  GHTSRVRSVVFSPNSLMLASGSSDQTVRLWDI---SSGECLYIFQGHTG--WVYSVAFNL 1000

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             GS+LA+ S D  V +W   +   +   ++F  H S V S+ ++    G  LA GS D  
Sbjct: 1001 DGSMLATGSGDQTVRLWDISSSQCF---YIFQGHTSCVRSVVFSSD--GAMLASGSDDQT 1055

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            + ++   S     T    Q H   V +V ++P    GA+           LAS G D  V
Sbjct: 1056 VRLWDISSGNCLYTL---QGHTSCVRSVVFSPD---GAM-----------LASGGDDQIV 1098

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            ++W + +G    +C   LQ +T+WVR + ++PN      T+A+ S D  V +W ++ +  
Sbjct: 1099 RLWDISSG----NCLYTLQGYTSWVRFLVFSPN----GVTLANGSSDQIVRLWDISSK-- 1148

Query: 918  QWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                K LY        V  V++S  G  LA  SGD  V LW+
Sbjct: 1149 ----KCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWD 1186



 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 83/282 (29%), Positives = 121/282 (42%), Gaps = 3/282 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            G++  V  +     G  +A  SSD  +++  +S+      L TL GH    W  + A   
Sbjct: 1114 GYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISSKKC---LYTLQGHTN--WVNAVAFSP 1168

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+ LAS S D  V +W   +       ++   H S VNS+ + P   G  LA GSSD  
Sbjct: 1169 DGATLASGSGDQTVRLWDISSSK---CLYILQGHTSWVNSVVFNPD--GSTLASGSSDQT 1223

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            + ++   S     T    Q H   V +V + P        GS        LAS   D TV
Sbjct: 1224 VRLWEINSSKCLCTF---QGHTSWVNSVVFNPD-------GS-------MLASGSSDKTV 1266

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            ++W + +      C    Q HTNWV  VA+ P+     S +AS S D  V +W ++    
Sbjct: 1267 RLWDISSS----KCLHTFQGHTNWVNSVAFNPD----GSMLASGSGDQTVRLWEIS---- 1314

Query: 918  QWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                K L+ F    + V  V++S  G +LA  S D  V LW+
Sbjct: 1315 --SSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWS 1354



 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 74/266 (27%), Positives = 118/266 (44%), Gaps = 31/266 (11%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V+ V  +  G  +A+ SSD ++++  +S+   S+ L T  GH    W  S A   
Sbjct: 1240 GHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISS---SKCLHTFQGHTN--WVNSVAFNP 1294

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             GS+LAS S D  V +W+  +       H F  H S V+S++++P   G  LA GS D  
Sbjct: 1295 DGSMLASGSGDQTVRLWEISSSK---CLHTFQGHTSWVSSVTFSPD--GTMLASGSDDQT 1349

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL--------- 710
            + +++  S    +       H   V +V ++P    GA++ SG  D   +L         
Sbjct: 1350 VRLWSISSG---ECLYTFLGHTNWVGSVIFSPD---GAILASGSGDQTVRLWSISSGKCL 1403

Query: 711  ----------------------ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
                                  AS   D TV++W + +G    +C   L  H N VR VA
Sbjct: 1404 YTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWNISSG----ECLYTLHGHINSVRSVA 1459

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTV 902
            ++ + GL    +AS S+D  + +W V
Sbjct: 1460 FSSD-GL---ILASGSDDETIKLWDV 1481



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 54/193 (27%), Positives = 85/193 (44%), Gaps = 3/193 (1%)
 Frame = +3

Query: 465  VFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVS 644
            VF     SV +++++P   G   A G S G +  + A +     T +            S
Sbjct: 859  VFTKILGSVLTVAFSPD--GKLFATGDSGGIVRFWEAATGKELLTCKGHN---------S 907

Query: 645  WAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
            W  S+        G     + LAS   D TV++W + +G     C    + HT+ VR V 
Sbjct: 908  WVNSV--------GFSQDGKMLASGSDDQTVRLWDISSG----QCLKTFKGHTSRVRSVV 955

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTP---VWRVSWSLTGNLL 995
            ++PN       +AS S D  V +W ++       G+ LY F      V+ V+++L G++L
Sbjct: 956  FSPN----SLMLASGSSDQTVRLWDISS------GECLYIFQGHTGWVYSVAFNLDGSML 1005

Query: 996  AVASGDNNVTLWN 1034
            A  SGD  V LW+
Sbjct: 1006 ATGSGDQTVRLWD 1018



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 54/219 (24%), Positives = 90/219 (41%), Gaps = 31/219 (14%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH++ V+ V+ +  G  +A+ S D ++++  +S+   S+ L T  GH    W  S     
Sbjct: 1282 GHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISS---SKCLHTFQGHTS--WVSSVTFSP 1336

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G++LAS S D  V +W   +       + F  H + V S+ ++P   G  LA GS D  
Sbjct: 1337 DGTMLASGSDDQTVRLWSISSGE---CLYTFLGHTNWVGSVIFSPD--GAILASGSGDQT 1391

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL--------- 710
            + +++  S     T    Q H   V ++ ++P    G L+ SG  D   +L         
Sbjct: 1392 VRLWSISSGKCLYTL---QGHNNWVGSIVFSPD---GTLLASGSDDQTVRLWNISSGECL 1445

Query: 711  ----------------------ASAGCDNTVKVWKLYNG 761
                                  AS   D T+K+W +  G
Sbjct: 1446 YTLHGHINSVRSVAFSSDGLILASGSDDETIKLWDVKTG 1484



>pir|AG1889|AG1889 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681656 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 934

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 92/311 (29%), Positives = 140/311 (45%), Gaps = 8/311 (2%)
 Frame = +3

Query: 126  FQGDHTFIRSS--DKEGKM-----PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKI 284
            F  D T I ++  DK  K+     P   I  GH D V D+     GK +ATAS D + K+
Sbjct: 581  FSPDGTSIATAGNDKTAKIWKLNSPNSIIVRGHEDEVFDLVFSPNGKYIATASWDKTAKL 640

Query: 285  IGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAH 464
              +  +   Q L T  GH G V ++S++    G  +A+ S+D    +W      + T   
Sbjct: 641  WSIVGDKL-QELRTFNGHQGRVNKLSFSPD--GKYIATTSWDKTAKLWNL----DGTLQK 693

Query: 465  VFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVS 644
                HK +V S++++P   G  +A  S D  + ++    +                  + 
Sbjct: 694  TLTGHKDTVWSVNFSPD--GQLIATASEDKTVKLWNRDGE-----------------LLK 734

Query: 645  WAPSMAPGALVGSGLHDPVQKL-ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDV 821
              P  +  ++V S +  P  KL A+AG D TVK+W +   + K      L  HT+ +  V
Sbjct: 735  TLPRQS--SVVNSAVFSPDGKLIATAGWDKTVKIWSIDGRLQK-----TLTGHTSGINSV 787

Query: 822  AWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAV 1001
             ++P+  L    IASAS D  V IW +    D  E + L      V  V++S  G L+A 
Sbjct: 788  TFSPDGKL----IASASWDNTVKIWNL----DGKELRTLRGHKNVVHNVTFSPDGKLIAT 839

Query: 1002 ASGDNNVTLWN 1034
            ASGDN V +WN
Sbjct: 840  ASGDNTVKIWN 850



 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 87/342 (25%), Positives = 146/342 (42%), Gaps = 24/342 (7%)
 Frame = +3

Query: 99   SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASI 278
            S D +L +    D+T ++   +EGK+    +E GH D V+ ++    G+ +AT   D ++
Sbjct: 418  SPDSQLLATASWDNT-VKLWSREGKL-LHTLE-GHKDKVNSITFSPDGQLIATVGWDNTM 474

Query: 279  KIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ 458
            K+     N   + L T  GH   +W VS++    G  +A+ S D  V +W    +    +
Sbjct: 475  KLW----NLDGKELRTFRGHQDMIWSVSFSPD--GKQIATASGDRTVKLWSLDGK----E 524

Query: 459  AHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSD------GGWDTARIDQAH 620
                  H++ VNS++++P   G  +A  S D  + ++ ++        G  D        
Sbjct: 525  LQTLRGHQNGVNSVTFSPD--GKLIATASGDRTVKLWNSKGQELETLYGHTDAVNSVAFS 582

Query: 621  PIGV---------TAVSWAPSMAPGALVGSGLHDPV---------QKLASAGCDNTVKVW 746
            P G          TA  W  + +P +++  G  D V         + +A+A  D T K+W
Sbjct: 583  PDGTSIATAGNDKTAKIWKLN-SPNSIIVRGHEDEVFDLVFSPNGKYIATASWDKTAKLW 641

Query: 747  KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWE 926
             +     K+        H   V  ++++P+       IA+ S D    +W +    D   
Sbjct: 642  SIVGD--KLQELRTFNGHQGRVNKLSFSPD----GKYIATTSWDKTAKLWNL----DGTL 691

Query: 927  GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
             K L      VW V++S  G L+A AS D  V LWN   DGE
Sbjct: 692  QKTLTGHKDTVWSVNFSPDGQLIATASEDKTVKLWNR--DGE 731



 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 72/278 (25%), Positives = 118/278 (42%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
            H   +  VS     K +ATAS D ++KI  +      + L  L    G  +  S A    
Sbjct: 324  HDGMLESVSFSPDSKFIATASRDKTVKIWSLDG---KKQLVVLREEKGEGFN-SVAFSPD 379

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            G+L+A+ S+D    +W      E  + H  + HK +V  ++++P      LA  S D  +
Sbjct: 380  GTLMATGSWDNTAKIW----SREGKRLHTLDGHKEAVLEVAFSPD--SQLLATASWDNTV 433

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVK 740
             +++             + H   V +++++P                Q +A+ G DNT+K
Sbjct: 434  KLWSREG----KLLHTLEGHKDKVNSITFSPD--------------GQLIATVGWDNTMK 475

Query: 741  VWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQ 920
            +W L     ++  F   Q       D+ W+ +       IA+AS D  V +W++    D 
Sbjct: 476  LWNLDGK--ELRTFRGHQ-------DMIWSVSFSPDGKQIATASGDRTVKLWSL----DG 522

Query: 921  WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             E + L      V  V++S  G L+A ASGD  V LWN
Sbjct: 523  KELQTLRGHQNGVNSVTFSPDGKLIATASGDRTVKLWN 560



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 70/261 (26%), Positives = 112/261 (42%), Gaps = 6/261 (2%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKM-----PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVS 296
            G +    S DK  K+       QK  TGH DTV  V+    G+ +ATAS D ++K+    
Sbjct: 670  GKYIATTSWDKTAKLWNLDGTLQKTLTGHKDTVWSVNFSPDGQLIATASEDKTVKLW--- 726

Query: 297  NNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND 476
             N   + L TL      V    ++    G L+A+  +D  V +W    + + T       
Sbjct: 727  -NRDGELLKTLPRQSSVVNSAVFSPD--GKLIATAGWDKTVKIWSIDGRLQKT----LTG 779

Query: 477  HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS 656
            H S +NS++++P   G  +A  S D  + ++    DG     R  + H   V  V+++P 
Sbjct: 780  HTSGINSVTFSPD--GKLIASASWDNTVKIWNL--DG--KELRTLRGHKNVVHNVTFSPD 833

Query: 657  MAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHT-NWVRDVAWAP 833
               G L+           A+A  DNTVK+W + NG          ++ T    +D  W+ 
Sbjct: 834  ---GKLI-----------ATASGDNTVKIWNI-NG---------QELRTLRGYKDAVWSL 869

Query: 834  NLGLPKSTIASASEDGKVVIW 896
               L   T+A+ S    +V+W
Sbjct: 870  RFSLDGKTLATGSR-YDIVVW 889



>sp|Q00808|HET1_PODAN Vegetatible incompatibility protein
            HET-E-1.>pir|T18521|T18521 beta transducin-like protein -
            Podospora anserina>gb:FLABTLP_1679076 Podospora anserina
            beta transducin-like protein (het-e) gene, het-e-e1
            allele, complete cds.
          Length = 1356

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 87/302 (28%), Positives = 134/302 (44%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
            DHT I+  D       Q +E GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q
Sbjct: 946  DHT-IKIWDAASGTCTQTLE-GHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQ 1003

Query: 315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
               TL GH G VW V+++    G  +AS S D  + +W   +    T       H   V 
Sbjct: 1004 ---TLEGHGGSVWSVAFSPD--GQRVASGSDDKTIKIWDTAS---GTCTQTLEGHGGWVQ 1055

Query: 495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL 674
            S+ ++P   G  +A GS D  I ++ A S     T    + H   V +V+++P       
Sbjct: 1056 SVVFSPD--GQRVASGSDDHTIKIWDAVSGTCTQTL---EGHGDSVWSVAFSPD------ 1104

Query: 675  VGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKS 854
                     Q++AS   D T+K+W   +G     C   L+ H  WV  VA++P+      
Sbjct: 1105 --------GQRVASGSIDGTIKIWDAASGT----CTQTLEGHGGWVHSVAFSPD----GQ 1148

Query: 855  TIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +AS S DG + IW  A        + L      V  V++S  G  +A  S D  + +W+
Sbjct: 1149 RVASGSIDGTIKIWDAASGTCT---QTLEGHGGWVQSVAFSPDGQRVASGSSDKTIKIWD 1205

Query: 1035 EA 1040
             A
Sbjct: 1206 TA 1207



 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 88/303 (29%), Positives = 134/303 (44%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            GD T I+  D       Q +E GH  +V  V+    G+RVA+ S D +IKI   ++ + +
Sbjct: 987  GDKT-IKIWDTASGTCTQTLE-GHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCT 1044

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
            Q   TL GH G  W  S      G  +AS S D  + +W   +    T       H  SV
Sbjct: 1045 Q---TLEGHGG--WVQSVVFSPDGQRVASGSDDHTIKIW---DAVSGTCTQTLEGHGDSV 1096

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
             S++++P   G  +A GS DG I ++ A S     T    + H   V +V+++P      
Sbjct: 1097 WSVAFSPD--GQRVASGSIDGTIKIWDAASGTCTQTL---EGHGGWVHSVAFSPD----- 1146

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
                      Q++AS   D T+K+W   +G     C   L+ H  WV+ VA++P+     
Sbjct: 1147 ---------GQRVASGSIDGTIKIWDAASGT----CTQTLEGHGGWVQSVAFSPD----G 1189

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              +AS S D  + IW  A        + L      V  V++S  G  +A  S DN + +W
Sbjct: 1190 QRVASGSSDKTIKIWDTASGTCT---QTLEGHGGWVQSVAFSPDGQRVASGSSDNTIKIW 1246

Query: 1032 NEA 1040
            + A
Sbjct: 1247 DTA 1249



 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 82/312 (26%), Positives = 131/312 (41%), Gaps = 31/312 (9%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q   TL GH G VW V+++  +
Sbjct: 839  GHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQ---TLEGHGGSVWSVAFSPDR 895

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
                +AS S D  + +W   +    T       H   V S++++P   G  +A GS D  
Sbjct: 896  --ERVASGSDDKTIKIWDAAS---GTCTQTLEGHGGRVQSVAFSPD--GQRVASGSDDHT 948

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV------------ 701
            I ++ A S     T    + H   V +V+++P    G  V SG  D              
Sbjct: 949  IKIWDAASGTCTQTL---EGHGSSVLSVAFSPD---GQRVASGSGDKTIKIWDTASGTCT 1002

Query: 702  -------------------QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
                               Q++AS   D T+K+W   +G     C   L+ H  WV+ V 
Sbjct: 1003 QTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGT----CTQTLEGHGGWVQSVV 1058

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVA 1004
            ++P+       +AS S+D  + IW           + L      VW V++S  G  +A  
Sbjct: 1059 FSPD----GQRVASGSDDHTIKIWDAVSGTCT---QTLEGHGDSVWSVAFSPDGQRVASG 1111

Query: 1005 SGDNNVTLWNEA 1040
            S D  + +W+ A
Sbjct: 1112 SIDGTIKIWDAA 1123



 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 66/214 (30%), Positives = 98/214 (45%), Gaps = 5/214 (2%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
            DHT I+  D       Q +E GH D+V  V+    G+RVA+ S D +IKI   ++ + +Q
Sbjct: 1072 DHT-IKIWDAVSGTCTQTLE-GHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQ 1129

Query: 315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
               TL GH G  W  S A    G  +AS S DG + +W   +    T       H   V 
Sbjct: 1130 ---TLEGHGG--WVHSVAFSPDGQRVASGSIDGTIKIWDAAS---GTCTQTLEGHGGWVQ 1181

Query: 495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSM 659
            S++++P   G  +A GSSD  I +        WDTA     +  + H   V +V+++P  
Sbjct: 1182 SVAFSPD--GQRVASGSSDKTIKI--------WDTASGTCTQTLEGHGGWVQSVAFSPD- 1230

Query: 660  APGALVGSGLHDPVQKLASAGCDNTVKVWKLYNG 761
                          Q++AS   DNT+K+W   +G
Sbjct: 1231 -------------GQRVASGSSDNTIKIWDTASG 1251



>sp|Q8YV57|YL24_ANASP Hypothetical WD-repeat protein
            all2124.>pir|AF2071|AF2071 WD-40 repeat protein
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_683113 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1683

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 80/279 (28%), Positives = 127/279 (45%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D V  +S+   G+ +A+ S D +IK+     +   +   TL GH   V+ VS++   
Sbjct: 1070 GHKDGVISISISRDGQTIASGSLDKTIKLW----SRDGRLFRTLNGHEDAVYSVSFSPD- 1124

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS   D  + +W+    ++ T       H+ +VN++ ++P   G  LA  SSD +
Sbjct: 1125 -GQTIASGGSDKTIKLWQT---SDGTLLKTITGHEQTVNNVYFSPD--GKNLASASSDHS 1178

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++   S     T      H  GV  V ++P                Q +A+   D TV
Sbjct: 1179 IKLWDTTSGQLLMTLT---GHSAGVITVRFSPDG--------------QTIAAGSEDKTV 1221

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W   +G         L  H +WV  ++++P+      T+ASAS D  + +W +A   D
Sbjct: 1222 KLWHRQDG----KLLKTLNGHQDWVNSLSFSPD----GKTLASASADKTIKLWRIA---D 1270

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                K L   N  VW V++S  G  +A AS DN + LWN
Sbjct: 1271 GKLVKTLKGHNDSVWDVNFSSDGKAIASASRDNTIKLWN 1309



 Score = 80.1 bits (196), Expect = 8e-14
 Identities = 84/298 (28%), Positives = 134/298 (44%)
 Frame = +3

Query: 162  KEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHH 341
            ++GK+   K   GH D V+ +S    GK +A+AS+D +IK+  +++      + TL GH+
Sbjct: 1227 QDGKL--LKTLNGHQDWVNSLSFSPDGKTLASASADKTIKLWRIADGKL---VKTLKGHN 1281

Query: 342  GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHEL 521
              VW V+++    G  +AS S D  + +W         +   F  H   V ++++ P   
Sbjct: 1282 DSVWDVNFSSD--GKAIASASRDNTIKLWNRHG----IELETFTGHSGGVYAVNFLPDSN 1335

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV 701
               +A  S D  I +        W    I    P+ V A +       G    S LHD  
Sbjct: 1336 --IIASASLDNTIRL--------WQRPLIS---PLEVLAGN------SGVYAVSFLHDG- 1375

Query: 702  QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDG 881
              +A+AG D  +++W   +G   +   P  +     +  +++ P   L    IASA+ D 
Sbjct: 1376 SIIATAGADGNIQLWHSQDGSL-LKTLPGNKA----IYGISFTPQGDL----IASANADK 1426

Query: 882  KVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
             V IW V    D    K L   +  V +V++S  G  LA AS DN V LWN + DG++
Sbjct: 1427 TVKIWRVR---DGKALKTLIGHDNEVNKVNFSPDGKTLASASRDNTVKLWNVS-DGKF 1480



 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 87/312 (27%), Positives = 137/312 (43%), Gaps = 34/312 (10%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V DV+    GK +A+AS D +IK+     N     L T  GH G V+ V++    
Sbjct: 1279 GHNDSVWDVNFSSDGKAIASASRDNTIKLW----NRHGIELETFTGHSGGVYAVNFLPDS 1334

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
              +++AS S D  + +W    Q             S V ++S+  H+ G  +A   +DGN
Sbjct: 1335 --NIIASASLDNTIRLW----QRPLISPLEVLAGNSGVYAVSFL-HD-GSIIATAGADGN 1386

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK---------- 707
            I ++ ++      T   ++A    +  +S+ P    G L+ S   D   K          
Sbjct: 1387 IQLWHSQDGSLLKTLPGNKA----IYGISFTPQ---GDLIASANADKTVKIWRVRDGKAL 1439

Query: 708  ---------------------LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
                                 LASA  DNTVK+W + +G +K      L+ HT+ V  V+
Sbjct: 1440 KTLIGHDNEVNKVNFSPDGKTLASASRDNTVKLWNVSDGKFK----KTLKGHTDEVFWVS 1495

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG---KVLYDFNTPVWRVSWSLTGNLL 995
            ++P+       IASAS D  + +W      D + G   K L   N  V+ V+++  G++L
Sbjct: 1496 FSPD----GKIIASASADKTIRLW------DSFSGNLIKSLPAHNDLVYSVNFNPDGSML 1545

Query: 996  AVASGDNNVTLW 1031
            A  S D  V LW
Sbjct: 1546 ASTSADKTVKLW 1557



 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 81/283 (28%), Positives = 135/283 (47%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            K  TGH  TV++V     GK +A+ASSD SIK+    + ++ Q L TL GH   V  V +
Sbjct: 1149 KTITGHEQTVNNVYFSPDGKNLASASSDHSIKL---WDTTSGQLLMTLTGHSAGVITVRF 1205

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            +    G  +A+ S D  V +W   ++ +       N H+  VNS+S++P   G  LA  S
Sbjct: 1206 SPD--GQTIAAGSEDKTVKLW---HRQDGKLLKTLNGHQDWVNSLSFSPD--GKTLASAS 1258

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            +D  I ++   +DG     +  + H   V  V+++                 + +ASA  
Sbjct: 1259 ADKTIKLWRI-ADG--KLVKTLKGHNDSVWDVNFS--------------SDGKAIASASR 1301

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            DNT+K+W  + G+ +++ F     H+  V  V + P+     + IASAS D  + +W   
Sbjct: 1302 DNTIKLWNRH-GI-ELETFTG---HSGGVYAVNFLPD----SNIIASASLDNTIRLW--- 1349

Query: 906  KEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +        +   N+ V+ VS+   G+++A A  D N+ LW+
Sbjct: 1350 -QRPLISPLEVLAGNSGVYAVSFLHDGSIIATAGADGNIQLWH 1391



 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 73/273 (26%), Positives = 115/273 (42%)
 Frame = +3

Query: 213  VHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLL 392
            ++ +S    G  +A+A++D ++KI  V +      L TL GH   V +V+++    G  L
Sbjct: 1407 IYGISFTPQGDLIASANADKTVKIWRVRDGKA---LKTLIGHDNEVNKVNFSPD--GKTL 1461

Query: 393  ASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYT 572
            AS S D  V +W   N ++         H   V  +S++P   G  +A  S+D  I ++ 
Sbjct: 1462 ASASRDNTVKLW---NVSDGKFKKTLKGHTDEVFWVSFSPD--GKIIASASADKTIRLWD 1516

Query: 573  ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
            + S    +  +   AH   V +V++ P        GS        LAS   D TVK+W+ 
Sbjct: 1517 SFSG---NLIKSLPAHNDLVYSVNFNPD-------GS-------MLASTSADKTVKLWRS 1559

Query: 753  YNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGK 932
            ++G            H+N V   +++P+       IASASED  V IW +    D     
Sbjct: 1560 HDG----HLLHTFSGHSNVVYSSSFSPD----GRYIASASEDKTVKIWQI----DGHLLT 1607

Query: 933  VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
             L      V    +S  G  L   S D    +W
Sbjct: 1608 TLPQHQAGVMSAIFSPDGKTLISGSLDTTTKIW 1640



 Score = 35.0 bits (79), Expect = 2.8
 Identities = 25/87 (28%), Positives = 40/87 (45%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GHS+ V+  S    G+ +A+AS D ++KI  +  +     L TL  H   V    ++  
Sbjct: 1569 SGHSNVVYSSSFSPDGRYIASASEDKTVKIWQIDGHL----LTTLPQHQAGVMSAIFSPD 1624

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWT 455
              G  L S S D    +W+  +Q   T
Sbjct: 1625 --GKTLISGSLDTTTKIWRFDSQQAKT 1649



>gb:AE013599_1131923 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003813_1225804 Drosophila melanogaster
            chromosome 2R, section 37 of 74 of the complete
            sequence.>gb:AY061388_1293191 Drosophila melanogaster
            LD31217 full length cDNA.
          Length = 335

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 2/238 (0%)
 Frame = +3

Query: 324  TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND-HKSSVNSI 500
            TL GH G +W V+W HPK G++ ASC  D  + +W     N W+   + +D HK ++  I
Sbjct: 9    TLQGHKGRIWGVAW-HPK-GNVFASCGEDKAIRIWSLTG-NTWSTKTILSDGHKRTIREI 65

Query: 501  SWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG 680
             W+P   G  LA  S D   +++ ++S G ++     + H   V +VSW+ S   G L  
Sbjct: 66   RWSP--CGQYLASASFDATTAIW-SKSSGEFECNATLEGHENEVKSVSWSRS---GGL-- 117

Query: 681  SGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTI 860
                     LA+   D +V +W++  G  + +C   L  HT  V+ V W P     K  +
Sbjct: 118  ---------LATCSRDKSVWIWEV-AGDDEFECAAVLNPHTQDVKRVVWHPT----KDIL 163

Query: 861  ASASEDGKVVIWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            ASAS D  + ++      + W+    L    + VW + +   G  L   S D  + +W
Sbjct: 164  ASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGIDFDADGERLVSCSDDTTIKIW 221



 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 81/305 (26%), Positives = 122/305 (40%), Gaps = 24/305 (7%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            +  GH  T+ ++     G+ +A+AS DA+  I   S+     + ATL GH   V  VSW+
Sbjct: 54   LSDGHKRTIREIRWSPCGQYLASASFDATTAIWSKSSGEFECN-ATLEGHENEVKSVSWS 112

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
              + G LLA+CS D  V +W+    +E+  A V N H   V  + W  H     LA  S 
Sbjct: 113  --RSGGLLATCSRDKSVWIWEVAGDDEFECAAVLNPHTQDVKRVVW--HPTKDILASASY 168

Query: 549  DGNISVYTARS-DGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I ++     D  WD      +H    T+  W          G       ++L S   
Sbjct: 169  DNTIKMFAEEPIDNDWDCTATLTSH----TSTVW----------GIDFDADGERLVSCSD 214

Query: 726  DNTVKVWKLYN-------------GVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS 866
            D T+K+W+ Y+              VWK  C  + Q H+  + DV+W    GL    IA+
Sbjct: 215  DTTIKIWRAYHPGNTAGVATPDQQTVWKCVCTVSGQ-HSRAIYDVSWCKLTGL----IAT 269

Query: 867  ASEDGKVVIWTVAKEG----------DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDN 1016
            A  D  + I+  + +              EG    D N+  W     +    L   S D 
Sbjct: 270  ACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQWN---PVVAGQLISCSDDG 326

Query: 1017 NVTLW 1031
             + +W
Sbjct: 327  TIKIW 331



 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 77/312 (24%), Positives = 127/312 (40%), Gaps = 17/312 (5%)
 Frame = +3

Query: 168  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP 347
            G++  +    GH   +  V+    G   A+   D +I+I  ++ N+ S       GH   
Sbjct: 2    GRLILEHTLQGHKGRIWGVAWHPKGNVFASCGEDKAIRIWSLTGNTWSTKTILSDGHKRT 61

Query: 348  VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGL 527
            + ++ W+    G  LAS SFD    +W + +  E+        H++ V S+SW+    G 
Sbjct: 62   IREIRWS--PCGQYLASASFDATTAIWSK-SSGEFECNATLEGHENEVKSVSWS--RSGG 116

Query: 528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK 707
             LA  S D ++ ++    D  ++ A +   H   V  V W P+                 
Sbjct: 117  LLATCSRDKSVWIWEVAGDDEFECAAVLNPHTQDVKRVVWHPTK--------------DI 162

Query: 708  LASAGCDNTVKVW--KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDG 881
            LASA  DNT+K++  +  +  W  DC   L  HT+ V    W  +       + S S+D 
Sbjct: 163  LASASYDNTIKMFAEEPIDNDW--DCTATLTSHTSTV----WGIDFDADGERLVSCSDDT 216

Query: 882  KVVIWTVAKEGDQWEGKVLYDFNTPVWR---------------VSWSLTGNLLAVASGDN 1016
             + IW     G+   G    D  T VW+               VSW     L+A A GD+
Sbjct: 217  TIKIWRAYHPGNT-AGVATPDQQT-VWKCVCTVSGQHSRAIYDVSWCKLTGLIATACGDD 274

Query: 1017 NVTLWNEAVDGE 1052
             + ++ E+ D +
Sbjct: 275  GIRIFKESSDSK 286



 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 57/200 (28%), Positives = 87/200 (43%), Gaps = 2/200 (1%)
 Frame = +3

Query: 462  HVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARI-DQAHPIGVTA 638
            H    HK  +  ++W  H  G   A    D  I +++   +  W T  I    H   +  
Sbjct: 8    HTLQGHKGRIWGVAW--HPKGNVFASCGEDKAIRIWSLTGNT-WSTKTILSDGHKRTIRE 64

Query: 639  VSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRD 818
            + W+P                Q LASA  D T  +W   +G  + +C   L+ H N V+ 
Sbjct: 65   IRWSPCG--------------QYLASASFDATTAIWSKSSG--EFECNATLEGHENEVKS 108

Query: 819  VAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLA 998
            V+W+ + GL    +A+ S D  V IW VA + +     VL      V RV W  T ++LA
Sbjct: 109  VSWSRSGGL----LATCSRDKSVWIWEVAGDDEFECAAVLNPHTQDVKRVVWHPTKDILA 164

Query: 999  VASGDNNVTLW-NEAVDGEW 1055
             AS DN + ++  E +D +W
Sbjct: 165  SASYDNTIKMFAEEPIDNDW 184



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 50/188 (26%), Positives = 74/188 (39%), Gaps = 20/188 (10%)
 Frame = +3

Query: 249 VATASSDASIKIIGVSN-NSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIV 425
           +A+AS D +IK+      ++     ATL  H   VW + +     G  L SCS D  + +
Sbjct: 163 LASASYDNTIKMFAEEPIDNDWDCTATLTSHTSTVWGIDFDAD--GERLVSCSDDTTIKI 220

Query: 426 WKE---GN---------QNEWT-QAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV 566
           W+    GN         Q  W     V   H  ++  +SW      +  ACG  D  I +
Sbjct: 221 WRAYHPGNTAGVATPDQQTVWKCVCTVSGQHSRAIYDVSWCKLTGLIATACG--DDGIRI 278

Query: 567 YTARSDGGWDTARIDQ------AHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
           +   SD   D    +Q      AH   V +V W P +A              +L S   D
Sbjct: 279 FKESSDSKPDEPTFEQITAEEGAHDQDVNSVQWNPVVAG-------------QLISCSDD 325

Query: 729 NTVKVWKL 752
            T+K+WK+
Sbjct: 326 GTIKIWKV 333



 Score = 39.7 bits (91), Expect = 0.11
 Identities = 28/83 (33%), Positives = 37/83 (44%), Gaps = 6/83 (7%)
 Frame = +3

Query: 201 HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST------SQHLATLAGHHGPVWQVS 362
           HS  ++DVS       +ATA  D  I+I   S++S        Q  A    H   V  V 
Sbjct: 251 HSRAIYDVSWCKLTGLIATACGDDGIRIFKESSDSKPDEPTFEQITAEEGAHDQDVNSVQ 310

Query: 363 WAHPKFGSLLASCSFDGKVIVWK 431
           W +P     L SCS DG + +WK
Sbjct: 311 W-NPVVAGQLISCSDDGTIKIWK 332



>gb:BC044534_2548836 Danio rerio zgc:55911, mRNA (cDNA clone MGC:55911
            IMAGE:3818952), complete cds.
          Length = 330

 Score = 93.6 bits (231), Expect = 7e-18
 Identities = 71/237 (29%), Positives = 117/237 (49%), Gaps = 3/237 (1%)
 Frame = +3

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVW-KEGNQNEWTQAHVFND-HKSSVNSISWAPHELG 524
            W V+W +P  G+ LA+C  D  + +W KEG+   W    V +D H+ +V  ++W+P   G
Sbjct: 20   WYVAW-NPA-GTTLATCGGDRAIRIWGKEGDS--WECKCVLSDGHQRTVRKVAWSP--CG 73

Query: 525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQ 704
              LA  S D    ++  ++D  ++   + + H   V  V+WAPS   G+L          
Sbjct: 74   KYLASASFDATTCIW-KKTDEDFECLTVLEGHENEVKCVAWAPS---GSL---------- 119

Query: 705  KLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
             LA+   D +V +W++ +   + +C   +  HT  V+ V W P     +  +ASAS D K
Sbjct: 120  -LATCSRDKSVWIWEV-DEEDEYECLSVVNSHTQDVKHVVWHPT----QELLASASYDNK 173

Query: 885  VVIWTVAKEGDQWEGK-VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            + I+   +EGD WE +  L    + VW +++   G  LA  S D  V +W E+  G+
Sbjct: 174  ICIY--KEEGDDWECRATLEGHESTVWSLTFDPEGRRLASCSDDRTVKIWKESTTGD 228



 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 77/303 (25%), Positives = 127/303 (41%), Gaps = 20/303 (6%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYY------GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV 350
            +E  H  + H  S  +Y      G  +AT   D +I+I G   +S         GH   V
Sbjct: 5    LELQHRVSAHPDSRCWYVAWNPAGTTLATCGGDRAIRIWGKEGDSWECKCVLSDGHQRTV 64

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
             +V+W+    G  LAS SFD    +WK+ ++ ++    V   H++ V  ++WAP   G  
Sbjct: 65   RKVAWS--PCGKYLASASFDATTCIWKKTDE-DFECLTVLEGHENEVKCVAWAPS--GSL 119

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LA  S D ++ ++    +  ++   +  +H   V  V W P+               + L
Sbjct: 120  LATCSRDKSVWIWEVDEEDEYECLSVVNSHTQDVKHVVWHPTQ--------------ELL 165

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
            ASA  DN + ++K     W  +C   L+ H + V    W+         +AS S+D  V 
Sbjct: 166  ASASYDNKICIYKEEGDDW--ECRATLEGHESTV----WSLTFDPEGRRLASCSDDRTVK 219

Query: 891  IWTVAKEGD-----QWE---------GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTL 1028
            IW  +  GD      W+         G+ +YD       ++W      LA A GD+ V +
Sbjct: 220  IWKESTTGDGSSDESWKCICTLSGFHGRTIYD-------IAWCRLTGALATACGDDGVRV 272

Query: 1029 WNE 1037
            ++E
Sbjct: 273  FSE 275



 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 88/316 (27%), Positives = 127/316 (40%), Gaps = 16/316 (5%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQK--IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNS 305
            G    IR   KEG     K  +  GH  TV  V+    GK +A+AS DA+   I    + 
Sbjct: 35   GGDRAIRIWGKEGDSWECKCVLSDGHQRTVRKVAWSPCGKYLASASFDATT-CIWKKTDE 93

Query: 306  TSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKS 485
              + L  L GH   V  V+WA    GSLLA+CS D  V +W+   ++E+    V N H  
Sbjct: 94   DFECLTVLEGHENEVKCVAWAPS--GSLLATCSRDKSVWIWEVDEEDEYECLSVVNSHTQ 151

Query: 486  SVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAP 665
             V  + W P +    LA  S D  I +Y    D  W+     + H   V ++++ P    
Sbjct: 152  DVKHVVWHPTQ--ELLASASYDNKICIYKEEGD-DWECRATLEGHESTVWSLTFDPE--- 205

Query: 666  GALVGSGLHDPVQKLASAGCDNTVKVWK-------LYNGVWKMDCFPALQMHTNWVRDVA 824
                        ++LAS   D TVK+WK         +  WK  C      H   + D+A
Sbjct: 206  -----------GRRLASCSDDRTVKIWKESTTGDGSSDESWKCIC-TLSGFHGRTIYDIA 253

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTP------VWRVSWS-LT 983
            W    G     +A+A  D  V +++     D  +       + P      V  VSW+   
Sbjct: 254  WCRLTG----ALATACGDDGVRVFSEDPTADPEQPIFALSAHMPKAHNQDVNCVSWNPKE 309

Query: 984  GNLLAVASGDNNVTLW 1031
              LLA  S +    +W
Sbjct: 310  AGLLATCSDNGEFAIW 325



 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 55/186 (29%), Positives = 78/186 (41%)
 Frame = +3

Query: 498  ISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV 677
            ++W P   G  LA    D  I ++    D       +   H   V  V+W+P        
Sbjct: 22   VAWNP--AGTTLATCGGDRAIRIWGKEGDSWECKCVLSDGHQRTVRKVAWSPCG------ 73

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
                    + LASA  D T  +WK  +     +C   L+ H N V+ VAWAP+     S 
Sbjct: 74   --------KYLASASFDATTCIWKKTDE--DFECLTVLEGHENEVKCVAWAPS----GSL 119

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
            +A+ S D  V IW V +E +     V+      V  V W  T  LLA AS DN + ++ E
Sbjct: 120  LATCSRDKSVWIWEVDEEDEYECLSVVNSHTQDVKHVVWHPTQELLASASYDNKICIYKE 179

Query: 1038 AVDGEW 1055
              D +W
Sbjct: 180  EGD-DW 184



 Score = 37.4 bits (85), Expect = 0.57
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 6/116 (5%)
 Frame = +3

Query: 102 ADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIK 281
           +D R   +++   T   SSD+  K     +   H  T++D++       +ATA  D  ++
Sbjct: 213 SDDRTVKIWKESTTGDGSSDESWKCICT-LSGFHGRTIYDIAWCRLTGALATACGDDGVR 271

Query: 282 IIGVSNNSTSQHLATLAGHHGP------VWQVSWAHPKFGSLLASCSFDGKVIVWK 431
           +      +  +        H P      V  VSW +PK   LLA+CS +G+  +WK
Sbjct: 272 VFSEDPTADPEQPIFALSAHMPKAHNQDVNCVSW-NPKEAGLLATCSDNGEFAIWK 326



>gb:BC088474_2110592 Rattus norvegicus WD40 protein Ciao1 (predicted),
            mRNA (cDNA clone MGC:95143 IMAGE:7129030), complete cds.
          Length = 339

 Score = 93.2 bits (230), Expect = 9e-18
 Identities = 83/295 (28%), Positives = 120/295 (40%), Gaps = 13/295 (4%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            +  GH  TV  V+    G  +A+AS DA+   I   N    + + TL GH   V  V+WA
Sbjct: 56   LSEGHQRTVRKVAWSPCGNYLASASFDATT-CIWKKNQDDFECVTTLEGHENEVKSVAWA 114

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
                G+LLA+CS D  V VW+   ++E+    V N H   V  + W P +    LA  S 
Sbjct: 115  PS--GNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQ--ELLASASY 170

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            D  + +Y    D  W      + H   V ++++ PS               Q+LAS   D
Sbjct: 171  DDTVKLYQEEGD-DWVCCATLEGHESTVWSIAFDPS--------------GQRLASCSDD 215

Query: 729  NTVKVWKLY-----NGV--------WKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASA 869
             TV++W+ Y      GV        WK  C      HT  + DVAW    G     +A+A
Sbjct: 216  RTVRIWRQYLPGNEQGVACSGSDPSWKCVC-TLSGFHTRTIYDVAWCQLTG----ALATA 270

Query: 870  SEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              D  + ++      D  +              ++SLT +L    S D N   WN
Sbjct: 271  CGDDAIRVFEEDPGSDPQQ-------------PTFSLTAHLRQAHSQDVNCVAWN 312



 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 78/279 (27%), Positives = 123/279 (44%), Gaps = 13/279 (4%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A+   D  I+I G   +S         GH   V +V+W+    G+ LAS SFD   
Sbjct: 28   GTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS--PCGNYLASASFDATT 85

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +WK+ NQ+++        H++ V S++WAP   G  LA  S D ++ V+    +  ++ 
Sbjct: 86   CIWKK-NQDDFECVTTLEGHENEVKSVAWAPS--GNLLATCSRDKSVWVWEVDEEDEYEC 142

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
              +  +H   V  V W PS               + LASA  D+TVK+++     W   C
Sbjct: 143  VSVLNSHTQDVKHVVWHPSQ--------------ELLASASYDDTVKLYQEEGDDWV--C 186

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT---------VAKEGDQWEGK 932
               L+ H + V  +A+ P+       +AS S+D  V IW          VA  G     K
Sbjct: 187  CATLEGHESTVWSIAFDPS----GQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWK 242

Query: 933  ---VLYDFNT-PVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
                L  F+T  ++ V+W      LA A GD+ + ++ E
Sbjct: 243  CVCTLSGFHTRTIYDVAWCQLTGALATACGDDAIRVFEE 281



 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 66/234 (28%), Positives = 110/234 (47%), Gaps = 1/234 (0%)
 Frame = +3

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            W ++W +P  G+LLASC  D K+ +W     +   ++ +   H+ +V  ++W+P   G  
Sbjct: 20   WFLAW-NPT-GTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSP--CGNY 75

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LA  S D    ++    D  ++     + H   V +V+WAPS   G L           L
Sbjct: 76   LASASFDATTCIWKKNQD-DFECVTTLEGHENEVKSVAWAPS---GNL-----------L 120

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
            A+   D +V VW++ +   + +C   L  HT  V+ V W P+    +  +ASAS D  V 
Sbjct: 121  ATCSRDKSVWVWEV-DEEDEYECVSVLNSHTQDVKHVVWHPS----QELLASASYDDTVK 175

Query: 891  IWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
            ++   +EGD W     L    + VW +++  +G  LA  S D  V +W + + G
Sbjct: 176  LY--QEEGDDWVCCATLEGHESTVWSIAFDPSGQRLASCSDDRTVRIWRQYLPG 227



 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 55/186 (29%), Positives = 78/186 (41%)
 Frame = +3

Query: 498  ISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV 677
            ++W P   G  LA    D  I ++    D     + + + H   V  V+W+P        
Sbjct: 22   LAWNP--TGTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCG------ 73

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
                      LASA  D T  +WK        +C   L+ H N V+ VAWAP+  L    
Sbjct: 74   --------NYLASASFDATTCIWKKNQD--DFECVTTLEGHENEVKSVAWAPSGNL---- 119

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
            +A+ S D  V +W V +E +     VL      V  V W  +  LLA AS D+ V L+ E
Sbjct: 120  LATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYQE 179

Query: 1038 AVDGEW 1055
              D +W
Sbjct: 180  EGD-DW 184



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 59/220 (26%), Positives = 85/220 (38%), Gaps = 21/220 (9%)
 Frame = +3

Query: 159 DKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGH 338
           D+E +     +   H+  V  V      + +A+AS D ++K+     +      ATL GH
Sbjct: 135 DEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYQEEGDDWVC-CATLEGH 193

Query: 339 HGPVWQVSWAHPKFGSLLASCSFDGKVIVWKE------------GNQNEWTQAHVFND-H 479
              VW +  A    G  LASCS D  V +W++            G+   W      +  H
Sbjct: 194 ESTVWSI--AFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCVCTLSGFH 251

Query: 480 KSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWD--------TARIDQAHPIGVT 635
             ++  ++W      L  ACG  D  I V+    D G D        TA + QAH   V 
Sbjct: 252 TRTIYDVAWCQLTGALATACG--DDAIRVF--EEDPGSDPQQPTFSLTAHLRQAHSQDVN 307

Query: 636 AVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLY 755
            V+W P  A       GL      LAS   D  V  W+ +
Sbjct: 308 CVAWNPKEA-------GL------LASCSDDGEVAFWEYH 334



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 19/150 (12%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKI-----------IGVSNNSTS-QHLATLAGHH 341
           GH  TV  ++ D  G+R+A+ S D +++I           +  S +  S + + TL+G H
Sbjct: 192 GHESTVWSIAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCVCTLSGFH 251

Query: 342 G-PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ------AHVFNDHKSSVNSI 500
              ++ V+W     G+L  +C  D  + V++E   ++  Q      AH+   H   VN +
Sbjct: 252 TRTIYDVAWCQLT-GALATACG-DDAIRVFEEDPGSDPQQPTFSLTAHLRQAHSQDVNCV 309

Query: 501 SWAPHELGLCLACGSSDGNISVYTARSDGG 590
           +W P E GL  +C S DG ++ +      G
Sbjct: 310 AWNPKEAGLLASC-SDDGEVAFWEYHQPAG 338



>gb:AE017342_1754685 Cryptococcus neoformans var. neoformans JEC21
            chromosome 2, complete sequence.
          Length = 399

 Score = 93.2 bits (230), Expect = 9e-18
 Identities = 86/371 (23%), Positives = 145/371 (39%), Gaps = 86/371 (23%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
            H+D V  ++ DYYG+R+AT S+D  IK+     +      A    H  P+  +S++HP  
Sbjct: 11   HADLVTHLTYDYYGERLATCSADQRIKVFRKDEHGKWAEDANWKAHDAPILHLSFSHPIH 70

Query: 381  GSLLASCSFDGKVIVWKE------------GNQNEWTQAHVFNDHKSSVNSISWAPHEL- 521
            GSLLASCS D  + +W+E                 W +  +      ++ S+ + P +  
Sbjct: 71   GSLLASCSHDRTIRIWEEPSFSTSATAPAASTSRAWLERGILTGPTGAIRSVQFGPPDPA 130

Query: 522  -GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS------MAPGALVG 680
             GL +A  ++DG + V+T+      D + + + H   +   S APS       A  +  G
Sbjct: 131  HGLRVASIATDGYLRVHTSLDPSLNDWSEVVRIHVPSLPGPSSAPSDDGGTGTASSSAAG 190

Query: 681  SGLHDPVQKLASA----GCDNTVKVWKLYNGVWKMD----------------CFPALQM- 797
            +GL   +   ++A    G  +     +L  G W +                   P+L++ 
Sbjct: 191  TGLTGTLAMASAAGDSGGTSHHPHTSELATGGWGLSWCKERWWGPLIAVFAGTSPSLKLV 250

Query: 798  ------------------------HTNW--VRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
                                     T +  +  +AWAPN G     +A+ + DG + IW 
Sbjct: 251  SLSPTPSCVLLLTPSSTPSTTSSGPTQYAPLTCLAWAPNCGRNYHLLATGARDGTIRIWR 310

Query: 900  VAKEGDQWEGKVLYDFNTPV---WR----------------VSWSLTGNLLAVASGDNNV 1022
            V   G++  G+V YD    V   WR                V W+ TG +L+    +  V
Sbjct: 311  VEPPGER--GRVDYDTGGEVVKEWRGQCTGEFGKGGARIGTVDWNATGTMLSTTDDEGIV 368

Query: 1023 TLWNEAVDGEW 1055
             ++       W
Sbjct: 369  RIYKPTYARSW 379



>sp|O76071|CIA1_HUMAN WD-repeat containing protein Ciao
            1.>gb:BC001395_1967553 Homo sapiens WD repeat domain 39,
            mRNA (cDNA clone MGC:1983 IMAGE:3050587), complete
            cds.>gb:BC032812_1980693 Homo sapiens WD repeat domain
            39, mRNA (cDNA clone MGC:45274 IMAGE:5219740), complete
            cds.>gb:CR456802_1993009 Homo sapiens full open reading
            frame cDNA clone RZPDo834A1118D for gene CIAO1, WD40
            protein Ciao1; complete cds, incl.
            stopcodon.>gb:HSU63810_2025395 Homo sapiens WD40 protein
            Ciao 1 mRNA, complete cds.>gb:HUAC004020_2028698 Homo
            sapiens Chromosome 16 BAC clone CIT987SK-A-319E8,
            complete sequence.
          Length = 339

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 83/300 (27%), Positives = 123/300 (41%), Gaps = 13/300 (4%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            +  GH  TV  V+    G  +A+AS DA+   I   N    + + TL GH   V  V+WA
Sbjct: 56   LSEGHQRTVRKVAWSPCGNYLASASFDATT-CIWKKNQDDFECVTTLEGHENEVKSVAWA 114

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
                G+LLA+CS D  V VW+   ++E+    V N H   V  + W P +    LA  S 
Sbjct: 115  PS--GNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQ--ELLASASY 170

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            D  + +Y    D  W      + H   V ++++ PS               Q+LAS   D
Sbjct: 171  DDTVKLYREEED-DWVCCATLEGHESTVWSLAFDPS--------------GQRLASCSDD 215

Query: 729  NTVKVWKLY-----NGV--------WKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASA 869
             TV++W+ Y      GV        WK  C      H+  + D+AW    G     +A+A
Sbjct: 216  RTVRIWRQYLPGNEQGVACSGSDPSWKCIC-TLSGFHSRTIYDIAWCQLTG----ALATA 270

Query: 870  SEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
              D  + ++               D N+   + ++SLT +L    S D N   WN    G
Sbjct: 271  CGDDAIRVFQ-------------EDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPG 317



 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 75/281 (26%), Positives = 121/281 (43%), Gaps = 15/281 (5%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A+   D  I+I G   +S         GH   V +V+W+    G+ LAS SFD   
Sbjct: 28   GTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS--PCGNYLASASFDATT 85

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +WK+ NQ+++        H++ V S++WAP   G  LA  S D ++ V+    +  ++ 
Sbjct: 86   CIWKK-NQDDFECVTTLEGHENEVKSVAWAPS--GNLLATCSRDKSVWVWEVDEEDEYEC 142

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
              +  +H   V  V W PS               + LASA  D+TVK+++     W   C
Sbjct: 143  VSVLNSHTQDVKHVVWHPSQ--------------ELLASASYDDTVKLYREEEDDWV--C 186

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPV 959
               L+ H + V  +A+ P+       +AS S+D  V IW     G+  E  V    + P 
Sbjct: 187  CATLEGHESTVWSLAFDPS----GQRLASCSDDRTVRIWRQYLPGN--EQGVACSGSDPS 240

Query: 960  WR---------------VSWSLTGNLLAVASGDNNVTLWNE 1037
            W+               ++W      LA A GD+ + ++ E
Sbjct: 241  WKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQE 281



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 64/234 (27%), Positives = 109/234 (46%), Gaps = 1/234 (0%)
 Frame = +3

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            W ++W +P  G+LLASC  D ++ +W     +   ++ +   H+ +V  ++W+P   G  
Sbjct: 20   WFLAW-NPA-GTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSP--CGNY 75

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LA  S D    ++    D  ++     + H   V +V+WAPS   G L           L
Sbjct: 76   LASASFDATTCIWKKNQD-DFECVTTLEGHENEVKSVAWAPS---GNL-----------L 120

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
            A+   D +V VW++ +   + +C   L  HT  V+ V W P+    +  +ASAS D  V 
Sbjct: 121  ATCSRDKSVWVWEV-DEEDEYECVSVLNSHTQDVKHVVWHPS----QELLASASYDDTVK 175

Query: 891  IWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
            ++   +E D W     L    + VW +++  +G  LA  S D  V +W + + G
Sbjct: 176  LY--REEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPG 227



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 19/143 (13%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKI-----------IGVSNNSTS-QHLATLAGHH 341
           GH  TV  ++ D  G+R+A+ S D +++I           +  S +  S + + TL+G H
Sbjct: 192 GHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFH 251

Query: 342 G-PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ------AHVFNDHKSSVNSI 500
              ++ ++W     G+L  +C  D  + V++E   ++  Q      AH+   H   VN +
Sbjct: 252 SRTIYDIAWCQLT-GALATACG-DDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCV 309

Query: 501 SWAPHELGLCLACGSSDGNISVY 569
           +W P E GL  +C S DG ++ +
Sbjct: 310 AWNPKEPGLLASC-SDDGEVAFW 331



 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 2/118 (1%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPAL-QMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
            LAS G D  +++W      W   C   L + H   VR VAW+P      + +ASAS D  
Sbjct: 31   LASCGGDRRIRIWGTEGDSWI--CKSVLSEGHQRTVRKVAWSPC----GNYLASASFDAT 84

Query: 885  VVIWTVAKEGDQWEG-KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
              IW   K  D +E    L      V  V+W+ +GNLLA  S D +V +W    + E+
Sbjct: 85   TCIWK--KNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY 140



 Score = 43.1 bits (100), Expect = 0.010
 Identities = 31/85 (36%), Positives = 42/85 (49%), Gaps = 8/85 (9%)
 Frame = +3

Query: 201 HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ--------HLATLAGHHGPVWQ 356
           HS T++D++       +ATA  D +I++     NS  Q        HL     H   V  
Sbjct: 251 HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ--AHSQDVNC 308

Query: 357 VSWAHPKFGSLLASCSFDGKVIVWK 431
           V+W +PK   LLASCS DG+V  WK
Sbjct: 309 VAW-NPKEPGLLASCSDDGEVAFWK 332



>gb:AK028376_1160958 Mus musculus 18 days pregnant adult female
            placenta and extra embryonic tissue cDNA, RIKEN
            full-length enriched library, clone:3830430M13
            product:WD40 protein Ciao1, full insert
            sequence.>gb:BC004089_2089595 Mus musculus WD repeat
            domain 39, mRNA (cDNA clone MGC:8301 IMAGE:3593736),
            complete cds.
          Length = 339

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 83/300 (27%), Positives = 121/300 (40%), Gaps = 13/300 (4%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            +  GH  TV  V+    G  +A+AS DA+   I   N    + + TL GH   V  V+WA
Sbjct: 56   LSEGHQRTVRKVAWSPCGNYLASASFDATT-CIWKKNQDDFECVTTLEGHENEVKSVAWA 114

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
                G+LLA+CS D  V VW+   ++E+    V + H   V  + W P +    LA  S 
Sbjct: 115  PS--GNLLATCSRDKSVWVWEVDEEDEYECVSVLSSHTQDVKHVVWHPSQ--ELLASASY 170

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            D  + +Y    D  W      + H   V ++++ PS               Q+LAS   D
Sbjct: 171  DDTVKLYQEEGD-DWVCCATLEGHESTVWSIAFDPS--------------GQRLASCSDD 215

Query: 729  NTVKVWKLY-----NGV--------WKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASA 869
             TV++W+ Y      GV        WK  C      HT  + DVAW    G     +A+A
Sbjct: 216  RTVRIWRQYLPGNEQGVACSGSDPSWKCIC-TLSGFHTRTIYDVAWCQLTG----ALATA 270

Query: 870  SEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
              D  + ++      D  +              ++SLT +L    S D N   WN    G
Sbjct: 271  CGDDAIRVFEEDPGSDPQQ-------------PTFSLTAHLRQAHSQDVNCVAWNPKEPG 317



 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 78/279 (27%), Positives = 123/279 (44%), Gaps = 13/279 (4%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A+   D  I+I G   +S         GH   V +V+W+    G+ LAS SFD   
Sbjct: 28   GTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS--PCGNYLASASFDATT 85

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +WK+ NQ+++        H++ V S++WAP   G  LA  S D ++ V+    +  ++ 
Sbjct: 86   CIWKK-NQDDFECVTTLEGHENEVKSVAWAPS--GNLLATCSRDKSVWVWEVDEEDEYEC 142

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
              +  +H   V  V W PS               + LASA  D+TVK+++     W   C
Sbjct: 143  VSVLSSHTQDVKHVVWHPSQ--------------ELLASASYDDTVKLYQEEGDDWV--C 186

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT---------VAKEGDQWEGK 932
               L+ H + V  +A+ P+       +AS S+D  V IW          VA  G     K
Sbjct: 187  CATLEGHESTVWSIAFDPS----GQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWK 242

Query: 933  ---VLYDFNT-PVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
                L  F+T  ++ V+W      LA A GD+ + ++ E
Sbjct: 243  CICTLSGFHTRTIYDVAWCQLTGALATACGDDAIRVFEE 281



 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 66/234 (28%), Positives = 110/234 (47%), Gaps = 1/234 (0%)
 Frame = +3

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            W ++W +P  G+LLASC  D K+ +W     +   ++ +   H+ +V  ++W+P   G  
Sbjct: 20   WFLAW-NPS-GTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSP--CGNY 75

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LA  S D    ++    D  ++     + H   V +V+WAPS   G L           L
Sbjct: 76   LASASFDATTCIWKKNQD-DFECVTTLEGHENEVKSVAWAPS---GNL-----------L 120

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
            A+   D +V VW++ +   + +C   L  HT  V+ V W P+    +  +ASAS D  V 
Sbjct: 121  ATCSRDKSVWVWEV-DEEDEYECVSVLSSHTQDVKHVVWHPS----QELLASASYDDTVK 175

Query: 891  IWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
            ++   +EGD W     L    + VW +++  +G  LA  S D  V +W + + G
Sbjct: 176  LY--QEEGDDWVCCATLEGHESTVWSIAFDPSGQRLASCSDDRTVRIWRQYLPG 227



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 19/150 (12%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKI-----------IGVSNNSTS-QHLATLAGHH 341
           GH  TV  ++ D  G+R+A+ S D +++I           +  S +  S + + TL+G H
Sbjct: 192 GHESTVWSIAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFH 251

Query: 342 G-PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ------AHVFNDHKSSVNSI 500
              ++ V+W     G+L  +C  D  + V++E   ++  Q      AH+   H   VN +
Sbjct: 252 TRTIYDVAWCQLT-GALATACG-DDAIRVFEEDPGSDPQQPTFSLTAHLRQAHSQDVNCV 309

Query: 501 SWAPHELGLCLACGSSDGNISVYTARSDGG 590
           +W P E GL  +C S DG ++ +      G
Sbjct: 310 AWNPKEPGLLASC-SDDGEVAFWEYHQPAG 338



 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 2/118 (1%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPAL-QMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
            LAS G D  +++W      W   C   L + H   VR VAW+P      + +ASAS D  
Sbjct: 31   LASCGGDRKIRIWGTEGDSWI--CKSVLSEGHQRTVRKVAWSPC----GNYLASASFDAT 84

Query: 885  VVIWTVAKEGDQWEG-KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
              IW   K  D +E    L      V  V+W+ +GNLLA  S D +V +W    + E+
Sbjct: 85   TCIWK--KNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY 140



>gb:BC065658_2554103 Danio rerio zgc:55911, mRNA (cDNA clone MGC:77394
            IMAGE:6969540), complete cds.
          Length = 330

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 70/237 (29%), Positives = 116/237 (48%), Gaps = 3/237 (1%)
 Frame = +3

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVW-KEGNQNEWTQAHVFND-HKSSVNSISWAPHELG 524
            W V+W +P  G+ LA+C  D  + +W KEG+   W    V +D H+ +V  ++W+P   G
Sbjct: 20   WYVAW-NPA-GTTLATCGGDRAIRIWGKEGDS--WECKCVLSDGHQRTVRKVAWSP--CG 73

Query: 525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQ 704
              LA  S D    ++  ++D  ++   + + H   V  V+WAPS   G+L          
Sbjct: 74   KYLASASFDATTCIW-KKTDEDFECLTVLEGHENEVKCVAWAPS---GSL---------- 119

Query: 705  KLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
             LA+   D +V +W++ +   + +C   +  HT  V+ V W P     +  +ASAS D K
Sbjct: 120  -LATCSRDKSVWIWEV-DEEDEYECLSVVNSHTQDVKHVVWHPT----QELLASASYDNK 173

Query: 885  VVIWTVAKEGDQWEGK-VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            + I+   +E D WE +  L    + VW +++   G  LA  S D  V +W E+  G+
Sbjct: 174  ICIY--KEEDDDWECRATLEGHESTVWSLTFDPEGRRLASCSDDRTVKIWKESTTGD 228



 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 77/303 (25%), Positives = 128/303 (42%), Gaps = 20/303 (6%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYY------GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPV 350
            +E  H  + H  S  +Y      G  +AT   D +I+I G   +S         GH   V
Sbjct: 5    LELQHRVSAHPDSRCWYVAWNPAGTTLATCGGDRAIRIWGKEGDSWECKCVLSDGHQRTV 64

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
             +V+W+    G  LAS SFD    +WK+ ++ ++    V   H++ V  ++WAP   G  
Sbjct: 65   RKVAWS--PCGKYLASASFDATTCIWKKTDE-DFECLTVLEGHENEVKCVAWAPS--GSL 119

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LA  S D ++ ++    +  ++   +  +H   V  V W P+               + L
Sbjct: 120  LATCSRDKSVWIWEVDEEDEYECLSVVNSHTQDVKHVVWHPTQ--------------ELL 165

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
            ASA  DN + ++K  +  W  +C   L+ H + V    W+         +AS S+D  V 
Sbjct: 166  ASASYDNKICIYKEEDDDW--ECRATLEGHESTV----WSLTFDPEGRRLASCSDDRTVK 219

Query: 891  IWTVAKEGD-----QWE---------GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTL 1028
            IW  +  GD      W+         G+ +YD       ++W      LA A GD+ V +
Sbjct: 220  IWKESTTGDGSSDESWKCICTLSGFHGRTIYD-------IAWCRLTGALATACGDDGVRV 272

Query: 1029 WNE 1037
            ++E
Sbjct: 273  FSE 275



 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 89/316 (28%), Positives = 127/316 (40%), Gaps = 16/316 (5%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQK--IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNS 305
            G    IR   KEG     K  +  GH  TV  V+    GK +A+AS DA+   I    + 
Sbjct: 35   GGDRAIRIWGKEGDSWECKCVLSDGHQRTVRKVAWSPCGKYLASASFDATT-CIWKKTDE 93

Query: 306  TSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKS 485
              + L  L GH   V  V+WA    GSLLA+CS D  V +W+   ++E+    V N H  
Sbjct: 94   DFECLTVLEGHENEVKCVAWAPS--GSLLATCSRDKSVWIWEVDEEDEYECLSVVNSHTQ 151

Query: 486  SVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAP 665
             V  + W P +    LA  S D  I +Y    D  W+     + H   V ++++ P    
Sbjct: 152  DVKHVVWHPTQ--ELLASASYDNKICIY-KEEDDDWECRATLEGHESTVWSLTFDPE--- 205

Query: 666  GALVGSGLHDPVQKLASAGCDNTVKVWK-------LYNGVWKMDCFPALQMHTNWVRDVA 824
                        ++LAS   D TVK+WK         +  WK  C      H   + D+A
Sbjct: 206  -----------GRRLASCSDDRTVKIWKESTTGDGSSDESWKCIC-TLSGFHGRTIYDIA 253

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWE------GKVLYDFNTPVWRVSWS-LT 983
            W    G     +A+A  D  V +++     D  +        V    N  V  VSW+   
Sbjct: 254  WCRLTG----ALATACGDDGVRVFSEDPTADPEQPIFALSAHVPKAHNQDVNCVSWNPKE 309

Query: 984  GNLLAVASGDNNVTLW 1031
              LLA  S +    +W
Sbjct: 310  AGLLATCSDNGEFAIW 325



 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 55/186 (29%), Positives = 78/186 (41%)
 Frame = +3

Query: 498  ISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALV 677
            ++W P   G  LA    D  I ++    D       +   H   V  V+W+P        
Sbjct: 22   VAWNP--AGTTLATCGGDRAIRIWGKEGDSWECKCVLSDGHQRTVRKVAWSPCG------ 73

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
                    + LASA  D T  +WK  +     +C   L+ H N V+ VAWAP+     S 
Sbjct: 74   --------KYLASASFDATTCIWKKTDE--DFECLTVLEGHENEVKCVAWAPS----GSL 119

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
            +A+ S D  V IW V +E +     V+      V  V W  T  LLA AS DN + ++ E
Sbjct: 120  LATCSRDKSVWIWEVDEEDEYECLSVVNSHTQDVKHVVWHPTQELLASASYDNKICIYKE 179

Query: 1038 AVDGEW 1055
              D +W
Sbjct: 180  E-DDDW 184



 Score = 37.4 bits (85), Expect = 0.57
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 6/116 (5%)
 Frame = +3

Query: 102 ADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIK 281
           +D R   +++   T   SSD+  K     +   H  T++D++       +ATA  D  ++
Sbjct: 213 SDDRTVKIWKESTTGDGSSDESWKCICT-LSGFHGRTIYDIAWCRLTGALATACGDDGVR 271

Query: 282 IIGVSNNSTSQHLATLAGHHGP------VWQVSWAHPKFGSLLASCSFDGKVIVWK 431
           +      +  +        H P      V  VSW +PK   LLA+CS +G+  +WK
Sbjct: 272 VFSEDPTADPEQPIFALSAHVPKAHNQDVNCVSW-NPKEAGLLATCSDNGEFAIWK 326



>gb:AK002314_1151117 Mus musculus adult male kidney cDNA, RIKEN
            full-length enriched library, clone:0610008B13
            product:WD40 protein Ciao1, full insert sequence.
          Length = 339

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 83/300 (27%), Positives = 121/300 (40%), Gaps = 13/300 (4%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            +  GH  TV  V+    G  +A+AS DA+   I   N    + + TL GH   V  V+WA
Sbjct: 56   LSEGHQRTVMKVAWSPCGNYLASASFDATT-CIWKKNQDDFECVTTLEGHENEVKSVAWA 114

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
                G+LLA+CS D  V VW+   ++E+    V + H   V  + W P +    LA  S 
Sbjct: 115  PS--GNLLATCSRDKSVWVWEVDEEDEYECVSVLSSHTQDVKHVVWHPSQ--ELLASASY 170

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            D  + +Y    D  W      + H   V ++++ PS               Q+LAS   D
Sbjct: 171  DDTVKLYQEEGD-DWVCCATLEGHESTVWSIAFDPS--------------GQRLASCNDD 215

Query: 729  NTVKVWKLY-----NGV--------WKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASA 869
             TV++W+ Y      GV        WK  C      HT  + DVAW    G     +A+A
Sbjct: 216  RTVRIWRQYLPGNEQGVACSGSDPSWKCIC-TLSGFHTRTIYDVAWCQLTG----ALATA 270

Query: 870  SEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
              D  + ++      D  +              ++SLT +L    S D N   WN    G
Sbjct: 271  CGDDAIRVFEEDPGSDPQQ-------------PTFSLTAHLRQAHSQDVNCVAWNPKEPG 317



 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 77/279 (27%), Positives = 123/279 (44%), Gaps = 13/279 (4%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A+   D  I+I G   +S         GH   V +V+W+    G+ LAS SFD   
Sbjct: 28   GTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVMKVAWS--PCGNYLASASFDATT 85

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +WK+ NQ+++        H++ V S++WAP   G  LA  S D ++ V+    +  ++ 
Sbjct: 86   CIWKK-NQDDFECVTTLEGHENEVKSVAWAPS--GNLLATCSRDKSVWVWEVDEEDEYEC 142

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
              +  +H   V  V W PS               + LASA  D+TVK+++     W   C
Sbjct: 143  VSVLSSHTQDVKHVVWHPSQ--------------ELLASASYDDTVKLYQEEGDDWV--C 186

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT---------VAKEGDQWEGK 932
               L+ H + V  +A+ P+       +AS ++D  V IW          VA  G     K
Sbjct: 187  CATLEGHESTVWSIAFDPS----GQRLASCNDDRTVRIWRQYLPGNEQGVACSGSDPSWK 242

Query: 933  ---VLYDFNT-PVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
                L  F+T  ++ V+W      LA A GD+ + ++ E
Sbjct: 243  CICTLSGFHTRTIYDVAWCQLTGALATACGDDAIRVFEE 281



 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 65/234 (27%), Positives = 110/234 (47%), Gaps = 1/234 (0%)
 Frame = +3

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
            W ++W +P  G+LLASC  D K+ +W     +   ++ +   H+ +V  ++W+P   G  
Sbjct: 20   WFLAW-NPS-GTLLASCGGDRKIRIWGTEGDSWICKSVLSEGHQRTVMKVAWSP--CGNY 75

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
            LA  S D    ++    D  ++     + H   V +V+WAPS   G L           L
Sbjct: 76   LASASFDATTCIWKKNQD-DFECVTTLEGHENEVKSVAWAPS---GNL-----------L 120

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
            A+   D +V VW++ +   + +C   L  HT  V+ V W P+    +  +ASAS D  V 
Sbjct: 121  ATCSRDKSVWVWEV-DEEDEYECVSVLSSHTQDVKHVVWHPS----QELLASASYDDTVK 175

Query: 891  IWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
            ++   +EGD W     L    + VW +++  +G  LA  + D  V +W + + G
Sbjct: 176  LY--QEEGDDWVCCATLEGHESTVWSIAFDPSGQRLASCNDDRTVRIWRQYLPG 227



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 40/150 (26%), Positives = 71/150 (47%), Gaps = 19/150 (12%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKI-----------IGVSNNSTS-QHLATLAGHH 341
           GH  TV  ++ D  G+R+A+ + D +++I           +  S +  S + + TL+G H
Sbjct: 192 GHESTVWSIAFDPSGQRLASCNDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFH 251

Query: 342 G-PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ------AHVFNDHKSSVNSI 500
              ++ V+W     G+L  +C  D  + V++E   ++  Q      AH+   H   VN +
Sbjct: 252 TRTIYDVAWCQLT-GALATACG-DDAIRVFEEDPGSDPQQPTFSLTAHLRQAHSQDVNCV 309

Query: 501 SWAPHELGLCLACGSSDGNISVYTARSDGG 590
           +W P E GL  +C S DG ++ +      G
Sbjct: 310 AWNPKEPGLLASC-SDDGEVAFWEYHQPAG 338



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 39/118 (33%), Positives = 54/118 (45%), Gaps = 2/118 (1%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPAL-QMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
            LAS G D  +++W      W   C   L + H   V  VAW+P      + +ASAS D  
Sbjct: 31   LASCGGDRKIRIWGTEGDSWI--CKSVLSEGHQRTVMKVAWSPC----GNYLASASFDAT 84

Query: 885  VVIWTVAKEGDQWEG-KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
              IW   K  D +E    L      V  V+W+ +GNLLA  S D +V +W    + E+
Sbjct: 85   TCIWK--KNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY 140



>pir|T39094|T39094 WD domain, G-beta repeat protein - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC806_1718347 S.pombe
            chromosome I cosmid c806.
          Length = 608

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 78/281 (27%), Positives = 121/281 (43%), Gaps = 2/281 (0%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            T  S+ VH  S     K+ +  +++   ++ G     T   + T++GH G +W V+ AHP
Sbjct: 245  TPDSNIVHLYSKTEMSKKFSFITNEFLNQLYGPRKLDT---ITTISGHTGRLWSVA-AHP 300

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND-HKSSVNSISWAPHELGLCLACGSSD 551
                L A+ S D  V ++   N N +   HV +  H  S+  ++W P E  + LA  S D
Sbjct: 301  ML-PLFATSSQDKSVRIY---NSNTYNLVHVIDGFHTRSIRRVAWRPIERPV-LAVASFD 355

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
              +S+   + D  W+     + H   V  ++W+ +                 LA+   D 
Sbjct: 356  SVVSI-NEKIDDDWECTAALEGHENEVKCIAWSCNG--------------NYLATCSRDK 400

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
            +V +W+      + DC   LQ HT  V+ V W P   L    + S S D  +  W    +
Sbjct: 401  SVWIWEATEDD-EFDCLAVLQEHTQDVKVVTWHPTEDL----LVSGSYDNSICFWR--DD 453

Query: 912  GDQWEGKV-LYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            GD W     L      VW +++S  GN LA A  D NV LW
Sbjct: 454  GDDWALTCQLQGHTNTVWALAFSPNGNTLASADNDGNVFLW 494



 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 74/283 (26%), Positives = 113/283 (39%), Gaps = 28/283 (9%)
 Frame = +3

Query: 189  IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
            I+  H+ ++  V+     + V   +S  S+  I    +   +  A L GH   V  ++W+
Sbjct: 328  IDGFHTRSIRRVAWRPIERPVLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWS 387

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
                G+ LA+CS D  V +W+    +E+    V  +H   V  ++W P E    L  GS 
Sbjct: 388  CN--GNYLATCSRDKSVWIWEATEDDEFDCLAVLQEHTQDVKVVTWHPTE--DLLVSGSY 443

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            D +I  +    D G D A   Q    G T   WA + +P              LASA  D
Sbjct: 444  DNSICFW---RDDGDDWALTCQLQ--GHTNTVWALAFSPNG----------NTLASADND 488

Query: 729  NTVKVW---KLYNGVWKMDCF----PALQ-----------MHTNWVRDVAWAPNLGLPKS 854
              V +W        V  +D      PALQ           +H   V  ++W     +  +
Sbjct: 489  GNVFLWIKISSNEDVATIDSTNILRPALQEEWKQQTSLPHIHKGAVYTISW-----MNDA 543

Query: 855  TIASASEDGKVVI----------WTVAKEGDQWEGKVLYDFNT 953
            T+ SA  DGK+V+          W VA E D   G  +Y+ N+
Sbjct: 544  TLCSAGGDGKIVVYQREKHDEALWHVAYEQDHAHG--VYEINS 584



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 42/133 (31%), Positives = 59/133 (44%), Gaps = 3/133 (2%)
 Frame = +3

Query: 666  GALVGSGLHDPVQKLASAGCDNTVKVWK--LYNGVWKMDCFPALQMHTNWVRDVAWAPNL 839
            G L     H  +   A++  D +V+++    YN V  +D F     HT  +R VAW P  
Sbjct: 291  GRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNLVHVIDGF-----HTRSIRRVAWRP-- 343

Query: 840  GLPKSTIASASEDGKVVIWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDN 1016
             + +  +A AS D  V I    K  D WE    L      V  ++WS  GN LA  S D 
Sbjct: 344  -IERPVLAVASFDSVVSI--NEKIDDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDK 400

Query: 1017 NVTLWNEAVDGEW 1055
            +V +W    D E+
Sbjct: 401  SVWIWEATEDDEF 413



>gb:AP005824_1858512 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0669H03.
          Length = 353

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 72/252 (28%), Positives = 117/252 (46%), Gaps = 12/252 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGS----LLASCSFDGKVIVWKEGNQNEWTQAHVFND-HKSSV 491
            L GH   VW ++W +P  G+    +LASC  D  V +WK      W  + V  D H  +V
Sbjct: 17   LTGHTDRVWSLAW-NPSPGAGAGPVLASCGGDKAVRIWKRAADGAWQCSDVLEDTHNRTV 75

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
             S +W+P   G  LA  S D   +++   S G ++     + H   V +VSW+   A G+
Sbjct: 76   RSCAWSPD--GKLLATASFDSTTAIW-EYSGGDFECVATLEGHENEVKSVSWS---ASGS 129

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
            L           LA+   D +V +W++  G  + +C    Q HT  V+ V W P L    
Sbjct: 130  L-----------LATCSRDKSVWIWEMQPGN-EYECVSVQQGHTQDVKMVQWHPIL---- 173

Query: 852  STIASASEDGKVVIWTVAKEG-DQWE-GKVLYDFN-----TPVWRVSWSLTGNLLAVASG 1010
              + S S D  + +W  A +G D+W   + L + N     + VW +S++  G+ +   S 
Sbjct: 174  DVLVSVSYDNSIRVW--ADDGDDEWHCVQTLTEANNCGHSSTVWALSFNQKGDRMVTCSD 231

Query: 1011 DNNVTLWNEAVD 1046
            D+ + +W+ + D
Sbjct: 232  DHTLKIWDTSAD 243



 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 55/187 (29%), Positives = 85/187 (45%), Gaps = 1/187 (0%)
 Frame = +3

Query: 189 IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           +E  H+ TV   +    GK +ATAS D++  I   S     + +ATL GH   V  VSW+
Sbjct: 67  LEDTHNRTVRSCAWSPDGKLLATASFDSTTAIWEYSGGDF-ECVATLEGHENEVKSVSWS 125

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
               GSLLA+CS D  V +W+    NE+    V   H   V  + W  H +   L   S 
Sbjct: 126 AS--GSLLATCSRDKSVWIWEMQPGNEYECVSVQQGHTQDVKMVQW--HPILDVLVSVSY 181

Query: 549 DGNISVYTARSDGGWDTAR-IDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
           D +I V+    D  W   + + +A+  G ++  WA S           +    ++ +   
Sbjct: 182 DNSIRVWADDGDDEWHCVQTLTEANNCGHSSTVWALS----------FNQKGDRMVTCSD 231

Query: 726 DNTVKVW 746
           D+T+K+W
Sbjct: 232 DHTLKIW 238



 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 55/205 (26%), Positives = 93/205 (45%), Gaps = 5/205 (2%)
 Frame = +3

Query: 456  QAHVFNDHKSSVNSISWAPHE---LGLCLACGSSDGNISVYTARSDGGWDTARI-DQAHP 623
            +AH    H   V S++W P      G  LA    D  + ++   +DG W  + + +  H 
Sbjct: 13   EAHRLTGHTDRVWSLAWNPSPGAGAGPVLASCGGDKAVRIWKRAADGAWQCSDVLEDTHN 72

Query: 624  IGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHT 803
              V + +W+P    G L           LA+A  D+T  +W+   G    +C   L+ H 
Sbjct: 73   RTVRSCAWSPD---GKL-----------LATASFDSTTAIWEYSGG--DFECVATLEGHE 116

Query: 804  NWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTP-VWRVSWSL 980
            N V+ V+W+ +     S +A+ S D  V IW + + G+++E   +   +T  V  V W  
Sbjct: 117  NEVKSVSWSAS----GSLLATCSRDKSVWIWEM-QPGNEYECVSVQQGHTQDVKMVQWHP 171

Query: 981  TGNLLAVASGDNNVTLWNEAVDGEW 1055
              ++L   S DN++ +W +  D EW
Sbjct: 172  ILDVLVSVSYDNSIRVWADDGDDEW 196



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 60/249 (24%), Positives = 99/249 (39%), Gaps = 16/249 (6%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH + V  VS    G  +AT S D S+ I  +   +  + ++   GH   V  V W HP 
Sbjct: 114 GHENEVKSVSWSASGSLLATCSRDKSVWIWEMQPGNEYECVSVQQGHTQDVKMVQW-HPI 172

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND-----HKSSVNSISWAPHELGLCLACG 542
              +L S S+D  + VW +   +EW       +     H S+V ++S+  ++ G  +   
Sbjct: 173 L-DVLVSVSYDNSIRVWADDGDDEWHCVQTLTEANNCGHSSTVWALSF--NQKGDRMVTC 229

Query: 543 SSDGNISVYTARSDGGWDTARIDQA-----------HPIGVTAVSWAPSMAPGALVGSGL 689
           S D  + ++   +D        +Q            H   + +  W+       ++ SG 
Sbjct: 230 SDDHTLKIWDTSADLSQPKTSDNQESWRHLSTLTGYHNRTIFSAHWSSE----DIIASGA 285

Query: 690 HDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASA 869
            D    L +    + V+    Y  + K +   A  M  N VR   W P        +ASA
Sbjct: 286 GDDAICLFAEDKSSMVE-GPSYRLILKKE--KAHDMDINCVR---WCPQ---DPRMLASA 336

Query: 870 SEDGKVVIW 896
           S+DG V +W
Sbjct: 337 SDDGTVKLW 345



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 47/210 (22%), Positives = 80/210 (38%), Gaps = 22/210 (10%)
 Frame = +3

Query: 189 IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLA-----GHHGPVW 353
           ++ GH+  V  V        + + S D SI++     +     + TL      GH   VW
Sbjct: 156 VQQGHTQDVKMVQWHPILDVLVSVSYDNSIRVWADDGDDEWHCVQTLTEANNCGHSSTVW 215

Query: 354 QVSWAHPKFGSLLASCSFDGKVIVWKEG----------NQNEWTQAHVFND-HKSSVNSI 500
            +S+     G  + +CS D  + +W             NQ  W         H  ++ S 
Sbjct: 216 ALSFNQK--GDRMVTCSDDHTLKIWDTSADLSQPKTSDNQESWRHLSTLTGYHNRTIFSA 273

Query: 501 SWAPHELGLCLACGSSDGNISVYTARSDGGWD------TARIDQAHPIGVTAVSWAPSMA 662
            W+  ++   +A G+ D  I ++        +        + ++AH + +  V W P   
Sbjct: 274 HWSSEDI---IASGAGDDAICLFAEDKSSMVEGPSYRLILKKEKAHDMDINCVRWCPQ-- 328

Query: 663 PGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
                     DP + LASA  D TVK+W+L
Sbjct: 329 ----------DP-RMLASASDDGTVKLWEL 347



>gb:AE016816_1746781 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 328

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 89/348 (25%), Positives = 147/348 (42%), Gaps = 20/348 (5%)
 Frame = +3

Query: 48   GSDCFSLSCSQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVS 227
            G  C+S+  S+    T SAD ++  +   +   +   D          +T H   V  V+
Sbjct: 14   GDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELD----------DTAHKKAVRSVA 63

Query: 228  MDYYGKRVATASSDASIKIIGVSNNSTS---QHLATLAGHHGPVWQVSWAHPKFGSLLAS 398
               +   +A  S D ++ I G  ++  S   + LA + GH   V  V+W+H   G+ LA+
Sbjct: 64   WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHD--GAYLAT 121

Query: 399  CSFDGKVIVWKEGNQNEWTQAH-VFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTA 575
            CS D  V +W+    +E  + + V  +H   V  I W  H   L LA  S D  + ++ A
Sbjct: 122  CSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHIVW--HASRLLLASSSYDDTVRIW-A 178

Query: 576  RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWK-- 749
              D  W+ A +   H  G T   W           +G+     +L S   D TV++W+  
Sbjct: 179  EQDDDWECAAVLSGH--GGTV--WCSDFERAE---TGI-----RLCSGSDDTTVRIWRCL 226

Query: 750  -----LYNGVWKMD-CFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
                 +++  W  +   PA  +HT  V  V+W+ +       IAS   DG + ++   + 
Sbjct: 227  TDDADVFDKEWIQETVLPA--VHTRAVYSVSWSAD-----GLIASVGSDGVLAVYKEVQA 279

Query: 912  GDQWE-------GKVLYDFNTPVWRVSWSLTGNLLAVASGDNN-VTLW 1031
            G +WE          +Y+ N   W    +L G +L V  GD+  V +W
Sbjct: 280  G-RWEVVARVDCAHTVYEINVVKW---LALDGRVLLVTGGDDGCVNVW 323



 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 58/207 (28%), Positives = 89/207 (42%), Gaps = 14/207 (6%)
 Frame = +3

Query: 477  HKSSVNSISWAPHELGLC--LACGSSDGNISVYTARSD---GGWDTARIDQAHPIGVTAV 641
            HK +V S++W PH    C  LA GS D  +S++    D   G  +   + + H   V +V
Sbjct: 55   HKKAVRSVAWRPH----CNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV 110

Query: 642  SWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDV 821
            +W+             HD    LA+   D +V +W+      + +C   LQ H+  V+ +
Sbjct: 111  AWS-------------HDGAY-LATCSRDKSVWIWEADELSEEFECNSVLQEHSQDVKHI 156

Query: 822  AWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWE-GKVLYDFNTPVWRVSW--SLTGNL 992
             W  +    +  +AS+S D  V IW  A++ D WE   VL      VW   +  + TG  
Sbjct: 157  VWHAS----RLLLASSSYDDTVRIW--AEQDDDWECAAVLSGHGGTVWCSDFERAETGIR 210

Query: 993  LAVASGDNNVTLWN------EAVDGEW 1055
            L   S D  V +W       +  D EW
Sbjct: 211  LCSGSDDTTVRIWRCLTDDADVFDKEW 237



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 57/193 (29%), Positives = 85/193 (44%), Gaps = 9/193 (4%)
 Frame = +3

Query: 201 HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
           HS  V  +        +A++S D +++I    ++   +  A L+GH G VW   +   + 
Sbjct: 149 HSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDW-ECAAVLSGHGGTVWCSDFERAET 207

Query: 381 GSLLASCSFDGKVIVWK------EGNQNEWTQAHVFND-HKSSVNSISWAPHELGLCLAC 539
           G  L S S D  V +W+      +    EW Q  V    H  +V S+SW+   L   +A 
Sbjct: 208 GIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGL---IAS 264

Query: 540 GSSDGNISVYTARSDGGWD-TARIDQAHPI-GVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
             SDG ++VY     G W+  AR+D AH +  +  V W       AL G  L      L 
Sbjct: 265 VGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWL------ALDGRVL------LV 312

Query: 714 SAGCDNTVKVWKL 752
           + G D  V VW+L
Sbjct: 313 TGGDDGCVNVWEL 325



 Score = 42.0 bits (97), Expect = 0.023
 Identities = 38/141 (26%), Positives = 58/141 (41%), Gaps = 11/141 (7%)
 Frame = +3

Query: 195 TGHSDTV--HDVSMDYYGKRVATASSDASIKI-------IGVSNNSTSQHLATLAGHHGP 347
           +GH  TV   D      G R+ + S D +++I         V +    Q     A H   
Sbjct: 191 SGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTDDADVFDKEWIQETVLPAVHTRA 250

Query: 348 VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEW-TQAHVFNDHKS-SVNSISWAPHEL 521
           V+ VSW+      L+AS   DG + V+KE     W   A V   H    +N + W   + 
Sbjct: 251 VYSVSWSAD---GLIASVGSDGVLAVYKEVQAGRWEVVARVDCAHTVYEINVVKWLALDG 307

Query: 522 GLCLACGSSDGNISVYTARSD 584
            + L  G  DG ++V+  R +
Sbjct: 308 RVLLVTGGDDGCVNVWELREE 328



>gb:BA000045_742040 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1197

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 80/285 (28%), Positives = 124/285 (43%), Gaps = 2/285 (0%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            ++  GH   +  V+    GK +A+ S D S+++   S   T Q + +L  H    W  + 
Sbjct: 855  RVLQGHGSGIWSVAFRGDGKTLASGSIDHSVRLWDFS---TRQPMRSLQAHTS--WVRTV 909

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            A    G+LLAS   D  + +W   + +          H   VNS++++P+  G  LA  S
Sbjct: 910  AFSPDGTLLASSGQDRTIKLW---DPDSGRCLKTLRGHTGWVNSLAFSPN--GALLASSS 964

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
             D ++ ++   +        + Q H       SW  S+A         H   + LASA  
Sbjct: 965  VDHSLRIWNVETG---QCLGMLQGH------TSWVRSVA--------FHPDGRVLASASQ 1007

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV- 902
            D T ++W +  G     C   LQ HT+WVR VA+ P+      T+AS S+DG V +W V 
Sbjct: 1008 DKTARLWDIETG----RCLWTLQGHTSWVRSVAFHPD----GHTLASGSDDGTVKLWDVQ 1059

Query: 903  -AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +  D   G       + VW V ++  G  LA    D  V LW+
Sbjct: 1060 TGRLADSLSGH-----GSGVWSVVFAADGKRLASGGDDKTVRLWD 1099



 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 85/312 (27%), Positives = 137/312 (43%)
 Frame = +3

Query: 99   SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASI 278
            SAD R  +    D T +R  D +  +   ++  GHS+ +  V     G+ + + S D S+
Sbjct: 786  SADGRTLASGSDDQT-VRLWDADSGL-CFRVMHGHSNWISSVVFSPDGRLLTSGSVDHSV 843

Query: 279  KIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ 458
            +I  +S+      L  L GH   +W V++     G  LAS S D  V +W    +     
Sbjct: 844  RIWEISSGHC---LRVLQGHGSGIWSVAFRGD--GKTLASGSIDHSVRLWDFSTRQPMRS 898

Query: 459  AHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTA 638
                  H S V +++++P   G  LA    D  I ++   S     T R    H   V +
Sbjct: 899  LQA---HTSWVRTVAFSPD--GTLLASSGQDRTIKLWDPDSGRCLKTLR---GHTGWVNS 950

Query: 639  VSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRD 818
            ++++P+   GAL           LAS+  D+++++W +  G     C   LQ HT+WVR 
Sbjct: 951  LAFSPN---GAL-----------LASSSVDHSLRIWNVETG----QCLGMLQGHTSWVRS 992

Query: 819  VAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLA 998
            VA+ P+       +ASAS+D    +W +      W    L    + V  V++   G+ LA
Sbjct: 993  VAFHPD----GRVLASASQDKTARLWDIETGRCLW---TLQGHTSWVRSVAFHPDGHTLA 1045

Query: 999  VASGDNNVTLWN 1034
              S D  V LW+
Sbjct: 1046 SGSDDGTVKLWD 1057



 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 80/285 (28%), Positives = 127/285 (44%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            +Q I T    TV  V+    G+ +AT+  + +I++   ++   +Q LA   GH   VW +
Sbjct: 559  SQSIFTEALSTVSSVAFSPDGQLLATSEINGTIRLWQAAD---AQQLAYCRGHTSWVWSI 615

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC 539
            +++    G +LAS S D  V +W   +        VF  H+  V S+++ P   G  LA 
Sbjct: 616  AFSPD--GRVLASGSADRTVRLW---DYRTGQCLKVFQGHEGWVRSVAFHPG--GGILAS 668

Query: 540  GSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASA 719
            GS D  + ++   S     T R    H   + AV ++P+               Q LAS+
Sbjct: 669  GSEDAAVRLWEVDSGRCLLTLR---GHSGWIHAVRFSPNG--------------QWLASS 711

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D  +++W   +G    +   A+Q HT WVR +A+AP+      T+ S S+D  + +W 
Sbjct: 712  SQDGKIQLWHPESG----EPLQAMQGHTGWVRSIAFAPD----GQTLISGSDDQTLRLWD 763

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            V +       K L      V  V +S  G  LA  S D  V LW+
Sbjct: 764  VQR---GLLLKCLQGHTGWVRSVDFSADGRTLASGSDDQTVRLWD 805



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 61/220 (27%), Positives = 91/220 (41%), Gaps = 32/220 (14%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V+ ++    G  +A++S D S++I  V    T Q L  L GH   V  V++ HP 
Sbjct: 943  GHTGWVNSLAFSPNGALLASSSVDHSLRIWNVE---TGQCLGMLQGHTSWVRSVAF-HPD 998

Query: 378  FGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
             G +LAS S D    +W  E  +  WT       H S V S+++ P   G  LA GS DG
Sbjct: 999  -GRVLASASQDKTARLWDIETGRCLWT----LQGHTSWVRSVAFHPD--GHTLASGSDDG 1051

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL-------- 710
             + ++  ++    D+      H  GV +V +A   A G  + SG  D   +L        
Sbjct: 1052 TVKLWDVQTGRLADSL---SGHGSGVWSVVFA---ADGKRLASGGDDKTVRLWDTTSMQC 1105

Query: 711  -----------------------ASAGCDNTVKVWKLYNG 761
                                   AS+  D T+ +W L  G
Sbjct: 1106 THVLNRHASGVLCVAIEADSRILASSSADETITLWDLQGG 1145



>pir|AE1810|AE1810 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681021 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1227

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 82/318 (25%), Positives = 137/318 (43%), Gaps = 9/318 (2%)
 Frame = +3

Query: 114  LHSL-FQGDHTFIRSSDKEGKMPAQKIETG--------HSDTVHDVSMDYYGKRVATASS 266
            +HS+ F  D   + SS ++  +    ++TG        HS  V+ V     G+ +A+   
Sbjct: 777  VHSVSFSPDGQTLASSGEDSTVRLWDVKTGQCWQIFEGHSKKVYSVRFSPDGQTLASCGE 836

Query: 267  DASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQN 446
            D SIK+  +        + TL GH   VW ++++    G  L SCS D    +W     N
Sbjct: 837  DRSIKLWDIQRGEC---VNTLWGHSSQVWAIAFSPD--GRTLISCSDDQTARLWDVITGN 891

Query: 447  EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI 626
                 ++   +   V S++++P      LA G  D  I ++  ++          + HP+
Sbjct: 892  S---LNILRGYTRDVYSVAFSPDSQ--ILASGRDDYTIGLWNLKTG---------ECHPL 937

Query: 627  GVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTN 806
                         G +     H   + LAS   DNT+K+W + +          L  HTN
Sbjct: 938  ---------RGHQGRIRSVAFHPDGKILASGSADNTIKLWDI-SDTNHSKYIRTLTGHTN 987

Query: 807  WVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTG 986
            WV  V ++P+    K T+AS+SED  + +W     GD  +   L   +  VW V++S  G
Sbjct: 988  WVWTVVFSPD----KHTLASSSEDRTIRLWD-KDTGDCLQK--LKGHSHWVWTVAFSPDG 1040

Query: 987  NLLAVASGDNNVTLWNEA 1040
             +LA  S D+ + +W+ A
Sbjct: 1041 RILASGSADSEIKIWDVA 1058



 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 78/280 (27%), Positives = 125/280 (44%), Gaps = 1/280 (0%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   +  V+    GK +A+ S+D +IK+  +S+ + S+++ TL GH   VW V ++  K
Sbjct: 939  GHQGRIRSVAFHPDGKILASGSADNTIKLWDISDTNHSKYIRTLTGHTNWVWTVVFSPDK 998

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
                LAS S D  + +W   +++          H   V +++++P   G  LA GS+D  
Sbjct: 999  --HTLASSSEDRTIRLW---DKDTGDCLQKLKGHSHWVWTVAFSPD--GRILASGSADSE 1051

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMA-PGALVGSGLHDPVQKLASAGCDNT 734
            I ++   S     T    Q        + W+ + +  G L           LASA  D T
Sbjct: 1052 IKIWDVASGKCLQTLTDPQ-------GMIWSVAFSLDGTL-----------LASASEDQT 1093

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            VK+W L  G    +C   L+ H   V  VA++PN        AS SED  V +W ++   
Sbjct: 1094 VKLWNLKTG----ECVHTLKGHEKQVYSVAFSPN----GQIAASGSEDTTVKLWDIST-- 1143

Query: 915  DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  + +     +  V++S  G LLA  S D  + LW+
Sbjct: 1144 GSCVDTLKHGHTAAIRSVAFSPDGRLLASGSEDEKIQLWD 1183



 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 73/281 (25%), Positives = 121/281 (43%), Gaps = 1/281 (0%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  VH VS    G+ +A++  D+++++  V    T Q      GH   V+ V ++   
Sbjct: 772  GHTREVHSVSFSPDGQTLASSGEDSTVRLWDVK---TGQCWQIFEGHSKKVYSVRFSPD- 827

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  LASC  D  + +W   +       +    H S V +I+++P   G  L   S D  
Sbjct: 828  -GQTLASCGEDRSIKLW---DIQRGECVNTLWGHSSQVWAIAFSPD--GRTLISCSDD-- 879

Query: 558  ISVYTARSDGGWDTARIDQAHPI-GVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
                TAR    WD    +  + + G T   ++ + +P +          Q LAS   D T
Sbjct: 880  ---QTARL---WDVITGNSLNILRGYTRDVYSVAFSPDS----------QILASGRDDYT 923

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            + +W L  G    +C P L+ H   +R VA+ P+       +AS S D  + +W ++   
Sbjct: 924  IGLWNLKTG----ECHP-LRGHQGRIRSVAFHPD----GKILASGSADNTIKLWDISDTN 974

Query: 915  DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
                 + L      VW V +S   + LA +S D  + LW++
Sbjct: 975  HSKYIRTLTGHTNWVWTVVFSPDKHTLASSSEDRTIRLWDK 1015



 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 55/225 (24%), Positives = 96/225 (42%)
 Frame = +3

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            G   A+   +G++ +W+  +     Q  ++  H + V + +++P      LA GS+D  I
Sbjct: 614  GKYFATGLMNGEIRLWQTSDNK---QLRIYKGHTAWVWAFAFSPDSR--MLASGSADSTI 668

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVK 740
             ++   +    +  +    +   V +V+++P    G +           LASA  D T+K
Sbjct: 669  KLWDVHTG---ECLKTLSKNTNKVYSVAFSPD---GRI-----------LASASQDQTIK 711

Query: 741  VWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQ 920
            +W +  G    +C   L  H +WV  V ++P        +AS+S D  + +W VA     
Sbjct: 712  LWDIATG----NCQQTLIGHDDWVWSVTFSPVTDDRPLLLASSSADQHIKLWDVATGKCL 767

Query: 921  WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
               K L      V  VS+S  G  LA +  D+ V LW+      W
Sbjct: 768  ---KTLKGHTREVHSVSFSPDGQTLASSGEDSTVRLWDVKTGQCW 809



>pir|AH2154|AH2154 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120)>gb:BA000019_683780 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1189

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 79/279 (28%), Positives = 127/279 (45%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHSDT+  +     G+ +ATAS D ++K+     N   +  ATL GH   V   +++   
Sbjct: 909  GHSDTLRSLQFSPDGQIIATASRDKTVKLW----NLNGKERATLHGHQADVRSATFSPDS 964

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
                +AS S+D  V +W    +   T       H++ V ++S++P +    +A  S DG 
Sbjct: 965  --KTIASASWDTTVKLWNLNGREIMT----LRGHQAGVRNVSFSPDDQ--IIATASEDGT 1016

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
              ++  +   G +   + + H  G+ AVS++P                Q +A+A  D TV
Sbjct: 1017 AKLWNRQ---GQELVTL-KGHQAGIQAVSFSPDS--------------QVIATASKDKTV 1058

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W              L  H   V  V+++PN    + TIA+ASED  V +W +  +G 
Sbjct: 1059 KLWNRQGKE-----LLTLLGHRGEVNAVSFSPN----RETIATASEDMTVKLWNL--KGG 1107

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            Q +   L   +  V  VS+S  G +LA +     VTLWN
Sbjct: 1108 QMQ--TLSGLDAGVKSVSFSPDGKVLASSDSLGKVTLWN 1144



 Score = 83.2 bits (204), Expect = 9e-15
 Identities = 101/336 (30%), Positives = 141/336 (41%), Gaps = 35/336 (10%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGK---MPAQKIET--GHSDTVHDVSMDYYGKRVATASSDASIKIIGVS 296
            G +    S DK  K   +  +++ T  GHSDTV        G+ +ATASSD ++++    
Sbjct: 754  GKNLVTASRDKTAKIWDLQGKELATLRGHSDTVASAVFSRDGQTIATASSDKTVRLW--- 810

Query: 297  NNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFN 473
             N   + L    GH   VW V+ +  K G LL S   DG V +W  E  +    Q+  FN
Sbjct: 811  -NRKGEELQVFWGHTDAVWGVNLS--KDGKLLVSSGEDGTVRLWNMENGEAGKFQSLSFN 867

Query: 474  DHKSSVNSISWAPHELGLCLACGSSDGNISVYTARS------------DGGWDTARIDQA 617
              +++  +IS++P         G   G    YT               +G  DT R  Q 
Sbjct: 868  LGEAAAGTISFSPD--------GKILGTTGRYTMAKLWNHQGQELVTLNGHSDTLRSLQF 919

Query: 618  HPIG---------VTAVSW-------APSMAPGALVGSGLHDPVQK-LASAGCDNTVKVW 746
             P G          T   W       A      A V S    P  K +ASA  D TVK+W
Sbjct: 920  SPDGQIIATASRDKTVKLWNLNGKERATLHGHQADVRSATFSPDSKTIASASWDTTVKLW 979

Query: 747  KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWE 926
             L NG   M     L+ H   VR+V+++P+       IA+ASEDG   +W   ++G   E
Sbjct: 980  NL-NGREIM----TLRGHQAGVRNVSFSPD----DQIIATASEDGTAKLWN--RQGQ--E 1026

Query: 927  GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               L      +  VS+S    ++A AS D  V LWN
Sbjct: 1027 LVTLKGHQAGIQAVSFSPDSQVIATASKDKTVKLWN 1062



 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 77/305 (25%), Positives = 122/305 (40%), Gaps = 26/305 (8%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D V  V     G+++A+AS D ++KI         + L TL GH   VW V+++   
Sbjct: 576  GHGDVVTRVKFSPDGEKLASASWDKTVKIW----QRDGKLLHTLRGHTDAVWSVNFSPD- 630

Query: 378  FGSLLASCSFDGKVIVWKEGNQNE--------WTQAHVFNDHKSSVNSISW--------- 506
             G +L S S D  V VW+  +  E        W     F+    +V S+ W         
Sbjct: 631  -GKMLVSASRDKTVKVWRVEDGQEIATLTHQNWVACIGFSPDSKTVASMEWNGTMRLWNL 689

Query: 507  --------APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTA-VSWAPSM 659
                      H+  +     S  GN+ + TA  DG      +D    + +    +W    
Sbjct: 690  QGQELKSFPTHKAPVVAVHFSPKGNM-IATASRDGTAKVWSLDGKELLSLGGHKNW---- 744

Query: 660  APGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNL 839
                ++     +  + L +A  D T K+W L            L+ H++ V    ++ + 
Sbjct: 745  ----VMYVNFSEDGKNLVTASRDKTAKIWDLQGKE-----LATLRGHSDTVASAVFSRD- 794

Query: 840  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNN 1019
                 TIA+AS D  V +W   ++G+  E +V +     VW V+ S  G LL  +  D  
Sbjct: 795  ---GQTIATASSDKTVRLWN--RKGE--ELQVFWGHTDAVWGVNLSKDGKLLVSSGEDGT 847

Query: 1020 VTLWN 1034
            V LWN
Sbjct: 848  VRLWN 852



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 39/159 (24%), Positives = 58/159 (36%), Gaps = 12/159 (7%)
 Frame = +3

Query: 591  WDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWK 770
            W TA+  Q   + +  +      +  A       D + +   AG       WK  +   +
Sbjct: 497  WQTAQ--QKRQVSLGEIKALALSSETAFESHNNFDALLESLKAGIKLNQIGWKNADTELQ 554

Query: 771  MDCFPALQMHTNWVR---------DVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQW 923
            +     L+    WVR         DV            +ASAS D  V IW       Q 
Sbjct: 555  VQVEKNLRQSLYWVRERNRLVGHGDVVTRVKFSPDGEKLASASWDKTVKIW-------QR 607

Query: 924  EGKVLYDFN---TPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            +GK+L+        VW V++S  G +L  AS D  V +W
Sbjct: 608  DGKLLHTLRGHTDAVWSVNFSPDGKMLVSASRDKTVKVW 646



>gb:BA000045_744426 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1184

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 86/306 (28%), Positives = 133/306 (43%), Gaps = 28/306 (9%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D V  V+    G+ +AT S D ++++       T Q L TL  H   V+ +++ HP+
Sbjct: 773  GHGDWVSAVAFAPDGRSLATGSLDRTVRLW---ETITGQCLKTLQEHTDQVFSIAF-HPQ 828

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  LAS S    V +W   +               +V +++++PH  G  L  GS D  
Sbjct: 829  -GHTLASGSPTQTVKLW---DTESGQCLRTLQGKTVTVLAVAFSPH--GQTLVSGSDDRL 882

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV------------ 701
            + ++  R+    +  R+ + H  GVT V+ AP     A  G+ L   +            
Sbjct: 883  VRLWDVRTG---ECTRVLRGHLRGVTTVAVAPDGRTLASAGADLSVKIWDALSGQCLRTL 939

Query: 702  ----------------QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                            + LAS   D T K+W    G     C   L+ HT+W+R VA+AP
Sbjct: 940  REHTGSIRSVAFAPDGRLLASGSQDGTAKLWDPGTG----RCVATLRGHTSWIRSVAFAP 995

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            + GL    +AS S+DG   IW   + G+  +  +L      +  V++SL G LLA  S D
Sbjct: 996  DGGL----LASGSQDGTARIWD-TRTGECLQ--ILAGHTYLICSVAFSLDGQLLASGSQD 1048

Query: 1014 NNVTLW 1031
              + LW
Sbjct: 1049 QTIRLW 1054



 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 80/285 (28%), Positives = 128/285 (44%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            ++  GH   V  V++   G+ +A+A +D S+KI    +    Q L TL  H G +  V++
Sbjct: 895  RVLRGHLRGVTTVAVAPDGRTLASAGADLSVKIWDALSG---QCLRTLREHTGSIRSVAF 951

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            A    G LLAS S DG   +W  G             H S + S+++AP   G  LA GS
Sbjct: 952  APD--GRLLASGSQDGTAKLWDPGTGR---CVATLRGHTSWIRSVAFAPD--GGLLASGS 1004

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
             DG   ++  R+    +  +I   H   + +V+++       L G       Q LAS   
Sbjct: 1005 QDGTARIWDTRTG---ECLQILAGHTYLICSVAFS-------LDG-------QLLASGSQ 1047

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            D T+++W++  G     C   L   T  V  +A++P+       +AS S D  V +W V 
Sbjct: 1048 DQTIRLWEVQTGA----CLRTLTEKTGMVFSLAFSPD----GQILASGSNDMTVKLWQV- 1098

Query: 906  KEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
              G     K L    + V  ++++  G+ LA AS D  + L++ A
Sbjct: 1099 --GTGRCVKTLGPHTSLVVSIAYAPDGSTLASASLDETIRLFDPA 1141



 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 77/260 (29%), Positives = 116/260 (44%), Gaps = 5/260 (1%)
 Frame = +3

Query: 276  IKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK--EGNQNE 449
            + + GV+ + T       A + G V+ V+++    G  +A    + ++ +W+  +G Q  
Sbjct: 544  VNLYGVNFSHTDLARCVFAQNFGGVFSVAFSPD--GEQIAVGDDNSEIRLWRAADGQQQL 601

Query: 450  WTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIG 629
              Q H        V ++++AP+  G   A  S DG + ++ AR      T R    H   
Sbjct: 602  SCQGHT-----DWVCAVAFAPN--GQTFASASQDGTVKLWDARIGQCLATLR---GHIGW 651

Query: 630  VTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNW 809
            V + ++AP    G+L           LASAG D+TVK+W    G     C   LQ HT  
Sbjct: 652  VRSAAFAPD---GSL-----------LASAGQDSTVKLWDAATG----RCLATLQGHTGV 693

Query: 810  VRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGK---VLYDFNTPVWRVSWSL 980
            V  VA+AP+     S +ASA +D  V +W  A       G+    L     P+  V +S 
Sbjct: 694  VHSVAFAPD----GSLLASAGQDSTVKLWDAA------TGRCLATLQGHTEPIRSVVFSP 743

Query: 981  TGNLLAVASGDNNVTLWNEA 1040
             G+ LA AS D  V LWN A
Sbjct: 744  DGHRLASASHDRTVKLWNPA 763



>gb:CR382125_1658200 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 333

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 77/300 (25%), Positives = 128/300 (42%), Gaps = 20/300 (6%)
 Frame = +3

Query: 192  ETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVS-------NNSTSQHLATLAGHHGPV 350
            +T H  TV  V+   +   +A  S D+++ I G         N+  ++ LA + GH   +
Sbjct: 53   DTAHKKTVRSVAWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEI 112

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA-HVFNDHKSSVNSISWAPHELGL 527
              V+W+H   G LLA+CS D  V +W+     E  +   V  +H   V  + W  H+   
Sbjct: 113  KCVAWSHD--GELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIW--HQSLP 168

Query: 528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK 707
             LA  S D  + ++    D  W+   +   H   V +  +  S +              +
Sbjct: 169  LLASSSYDDTVRIWKD-CDDDWECCAVLNGHEGTVWSSDFEKSNSN------------VR 215

Query: 708  LASAGCDNTVKVWKLY--NGVWKMDCFPAL---QMHTNWVRDVAWAPNLGLPKSTIASAS 872
            L S   D TV++W L   NG ++ +        + HT  V  V W+P     K  IAS  
Sbjct: 216  LCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSP-----KGYIASTG 270

Query: 873  EDGKVVIWTVAKEGDQWEGKVLYDFNTPVWR---VSWSLTGN----LLAVASGDNNVTLW 1031
             DG++VI+  +++G  W  + +++    V+    V W   G+    LL  A  D +V +W
Sbjct: 271  SDGRLVIYKESEDG--WIVECIHELTHGVYETNMVKWVEYGSKDVILLITAGDDGHVNVW 328



 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 65/264 (24%), Positives = 106/264 (40%), Gaps = 14/264 (5%)
 Frame = +3

Query: 147 IRSSDKEGKMPAQKIET-------GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNS 305
           I   D +G      +ET       GH + +  V+  + G+ +AT S D S+ I       
Sbjct: 83  IWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMG 142

Query: 306 TS-QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHK 482
              + ++ L  H   V  V W H     LLAS S+D  V +WK+ + ++W    V N H+
Sbjct: 143 EEFECISVLQEHSQDVKHVIW-HQSL-PLLASSSYDDTVRIWKDCD-DDWECCAVLNGHE 199

Query: 483 SSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG-----W-DTARIDQAHPIGVTAVS 644
            +V S  +      + L  GS DG + ++    D G     W   + + +AH   V +V+
Sbjct: 200 GTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVN 259

Query: 645 WAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
           W+P                  +AS G D  + ++K     W ++C   L         V 
Sbjct: 260 WSPK---------------GYIASTGSDGRLVIYKESEDGWIVECIHELTHGVYETNMVK 304

Query: 825 WAPNLGLPKSTIASASEDGKVVIW 896
           W          + +A +DG V +W
Sbjct: 305 WVEYGSKDVILLITAGDDGHVNVW 328



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 52/185 (28%), Positives = 84/185 (45%), Gaps = 7/185 (3%)
 Frame = +3

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV 701
            G  +A GS+D  I +   RS    +    D AH   V +V+W P            H  +
Sbjct: 25   GGIMATGSTDRKIKLVDIRSFQIIEELD-DTAHKKTVRSVAWRP------------HSNI 71

Query: 702  QKLASAGCDNTVKVWKL----YNGV--WKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIA 863
              LA+   D+TV +W      YN     + +    ++ H N ++ VAW+ +  L    +A
Sbjct: 72   --LAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGEL----LA 125

Query: 864  SASEDGKVVIWTVAKEGDQWEG-KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            + S D  V IW   + G+++E   VL + +  V  V W  +  LLA +S D+ V +W + 
Sbjct: 126  TCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC 185

Query: 1041 VDGEW 1055
             D +W
Sbjct: 186  -DDDW 189



>gb:AY123095_1579963 Griffithsia japonica protein stansport protein
           mRNA, partial cds.
          Length = 110

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 35/66 (53%), Positives = 47/66 (71%)
 Frame = +3

Query: 177 PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ 356
           P   I+T H+D +HD  +D+YG+R+AT SSD +IKI  V  N + +  +TL GH GPVWQ
Sbjct: 38  PKNVIDTAHADMIHDAQLDFYGRRLATCSSDRTIKIFQVDRNGSHRLESTLEGHEGPVWQ 97

Query: 357 VSWAHP 374
           VSW+HP
Sbjct: 98  VSWSHP 103



>gb:BA000045_741250 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1183

 Score = 83.2 bits (204), Expect = 9e-15
 Identities = 86/336 (25%), Positives = 137/336 (40%), Gaps = 38/336 (11%)
 Frame = +3

Query: 147  IRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT 326
            +R  D  G    Q + +GH D V  V+    G+R+A+ S DA++++     N+  +  + 
Sbjct: 758  LRMWDTHGGTCKQAL-SGHQDKVRTVAWSLDGQRLASGSWDATVRVW----NADGRCQSI 812

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
            L GH G +  V++A    G LLA+ S D  V +W   +       + F  H   V +++ 
Sbjct: 813  LRGHSGIIRSVAFAPD--GGLLATGSIDQTVKLW---DLQSGQCVYSFKGHSGGVAAVAV 867

Query: 507  APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG 686
              H     LA G +D  + +++   DG          HPI      W+ + APG      
Sbjct: 868  GGHGT---LASGDADHRVRIWSTE-DGRCTRVLSGHTHPI------WSVAFAPGGAT--- 914

Query: 687  LHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS 866
                   LASA  D+ V++W   +G     C   LQ HT+WV  VA++P+       +AS
Sbjct: 915  -------LASASADHAVRLWDGASG----RCTHILQGHTSWVWSVAFSPD----GRRLAS 959

Query: 867  ASEDGKVVIW----------------------------TVAKEGDQ----WEG------K 932
               D  V +W                            T+A   DQ    W+       +
Sbjct: 960  GGADRTVRLWDTATGQCLRTSTEADHRVLAVAFMPDGLTLAGSVDQTVRLWDAATGRCLR 1019

Query: 933  VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             L    + +W ++ S  G L+A  S D +V +W  A
Sbjct: 1020 TLAGHTSWIWSLAASADGRLMATGSADRSVRIWEVA 1055



 Score = 83.2 bits (204), Expect = 9e-15
 Identities = 84/285 (29%), Positives = 132/285 (46%), Gaps = 3/285 (1%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKI---IGVSNNSTSQHLATLAGHHGPVWQVSW 365
            TGH + V  V     G+ +A+ S+D ++K    +G       + L TL GH   VW V++
Sbjct: 689  TGHRNVVASVVWSPDGQYLASGSNDGTVKFWRPVG------GRCLRTLRGHTDEVWSVAF 742

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
              P   +LL+  S DG + +W   + +  T     + H+  V +++W+    G  LA GS
Sbjct: 743  G-PDSRTLLSGSS-DGTLRMW---DTHGGTCKQALSGHQDKVRTVAWSLD--GQRLASGS 795

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
             D  + V+ A  DG   +  I + H   + +V++AP          GL      LA+   
Sbjct: 796  WDATVRVWNA--DGRCQS--ILRGHSGIIRSVAFAPD--------GGL------LATGSI 837

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            D TVK+W L +G     C  + + H+  V  VA   +      T+AS   D +V IW+  
Sbjct: 838  DQTVKLWDLQSG----QCVYSFKGHSGGVAAVAVGGH-----GTLASGDADHRVRIWSTE 888

Query: 906  KEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
               D    +VL     P+W V+++  G  LA AS D+ V LW+ A
Sbjct: 889  ---DGRCTRVLSGHTHPIWSVAFAPGGATLASASADHAVRLWDGA 930



 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 77/265 (29%), Positives = 111/265 (41%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G+ +A A +   +++  V +    +     AGH G  W    A      +LAS   DG +
Sbjct: 578  GRWLAMADTRGEVRLCLVQSR---EQRFVCAGHSG--WVEGLAFSPDSEILASAGLDGTI 632

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +W+  +     QA     H   V S+++AP   G  +A GS DG I ++ A+S     T
Sbjct: 633  RLWQVVSGQ--LQA-TLTGHNKGVRSVAFAPD--GHLIASGSLDGTIKLWDAQSGQCRLT 687

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                  H   V +V W+P                Q LAS   D TVK W+   G     C
Sbjct: 688  L---TGHRNVVASVVWSPD--------------GQYLASGSNDGTVKFWRPVGG----RC 726

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPV 959
               L+ HT+ V  VA+ P+      T+ S S DG + +W     G   + + L      V
Sbjct: 727  LRTLRGHTDEVWSVAFGPD----SRTLLSGSSDGTLRMWDT--HGGTCK-QALSGHQDKV 779

Query: 960  WRVSWSLTGNLLAVASGDNNVTLWN 1034
              V+WSL G  LA  S D  V +WN
Sbjct: 780  RTVAWSLDGQRLASGSWDATVRVWN 804



 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 81/284 (28%), Positives = 121/284 (42%), Gaps = 5/284 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHS  V  V++  +G  +A+  +D  ++I    +   ++    L+GH  P+W V++A   
Sbjct: 857  GHSGGVAAVAVGGHGT-LASGDADHRVRIWSTEDGRCTR---VLSGHTHPIWSVAFAPG- 911

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+ LAS S D  V +W +G     T  H+   H S V S++++P   G  LA G +D  
Sbjct: 912  -GATLASASADHAVRLW-DGASGRCT--HILQGHTSWVWSVAFSPD--GRRLASGGADRT 965

Query: 558  ISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAG 722
            + +        WDTA     R        V AV++ P      L GS             
Sbjct: 966  VRL--------WDTATGQCLRTSTEADHRVLAVAFMPDGL--TLAGS------------- 1002

Query: 723  CDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
             D TV++W    G     C   L  HT+W+    W+         +A+ S D  V IW V
Sbjct: 1003 VDQTVRLWDAATG----RCLRTLAGHTSWI----WSLAASADGRLMATGSADRSVRIWEV 1054

Query: 903  AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            A        K L +    VW V++S     LAV S D  + LW+
Sbjct: 1055 ATGRCL---KHLEEHGGWVWSVAFSPDERRLAVGSMDGTIRLWS 1095



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 52/191 (27%), Positives = 80/191 (41%), Gaps = 3/191 (1%)
 Frame = +3

Query: 468  FNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSW 647
            F DH   V +++++P   G  LA   + G + +   +S    +   +   H   V  +++
Sbjct: 562  FADHFCGVLALAFSPD--GRWLAMADTRGEVRLCLVQSR---EQRFVCAGHSGWVEGLAF 616

Query: 648  APSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAW 827
            +P                + LASAG D T+++W++ +G  +      L  H   VR VA+
Sbjct: 617  SPDS--------------EILASAGLDGTIRLWQVVSGQLQ----ATLTGHNKGVRSVAF 658

Query: 828  APNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGK---VLYDFNTPVWRVSWSLTGNLLA 998
            AP+  L    IAS S DG + +W      D   G+    L      V  V WS  G  LA
Sbjct: 659  APDGHL----IASGSLDGTIKLW------DAQSGQCRLTLTGHRNVVASVVWSPDGQYLA 708

Query: 999  VASGDNNVTLW 1031
              S D  V  W
Sbjct: 709  SGSNDGTVKFW 719



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 11/174 (6%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  +  ++    G+ +AT S+D S++I  V+     +HL     H G VW V+++  +
Sbjct: 1023 GHTSWIWSLAASADGRLMATGSADRSVRIWEVATGRCLKHLEE---HGGWVWSVAFSPDE 1079

Query: 378  FGSLLASCSFDGKVIVWK--EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSD 551
                LA  S DG + +W   EG              +S+V SI++  H  G  L  G  D
Sbjct: 1080 --RRLAVGSMDGTIRLWSFPEGELLRSMAC------ESAVRSIAFESH--GQVLIAGCED 1129

Query: 552  GNISVYTA---------RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG 686
            G I  ++          R+ G    A +D +  +G++    A  +A GA+   G
Sbjct: 1130 GTIRFWSVACGECLRVLRAPG--PHAGMDISGAVGLSEAQRASLIALGAVEHGG 1181



>pir|AG1837|AG1837 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681239 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 304

 Score = 83.2 bits (204), Expect = 9e-15
 Identities = 79/288 (27%), Positives = 131/288 (45%), Gaps = 10/288 (3%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ---VSWA 368
            GHSD V  V     G+R+A+ S+D ++++  ++N  T      L GH    W     S A
Sbjct: 12   GHSDKVMSVMFSPDGQRLASGSADKTVRVWNLANEET----LILKGHGKSSWSGGVNSIA 67

Query: 369  HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
                G  LAS S D  + +W   + N   +   F  H+ +V S+S++P   G  L  GS 
Sbjct: 68   FSPNGKTLASASDDKTIKLW---DVNTGAEIIAFTGHEEAVYSVSFSPD--GKTLVSGSK 122

Query: 549  DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            D ++ +++  +  G +   + + H   V +V+++P    G +V SG          AG D
Sbjct: 123  DKSVKLWSLAT--GRELYSL-KGHLDDVLSVAFSPD---GQVVASG---------GAGND 167

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNW---VRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
             T+K+W L            +  H+ W   +  +A++P+     + +AS S D  + +W 
Sbjct: 168  KTIKIWHL-----AKQKVQTITGHSEWFGGINSLAFSPD----GNILASGSWDKNIKLW- 217

Query: 900  VAKEGDQWEGK----VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                  QW+       L   +  V  VS+S  GN+LA AS D ++ LW
Sbjct: 218  ------QWQNSEEICTLTGHSDHVCCVSFSPNGNILASASKDKSIKLW 259



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 61/230 (26%), Positives = 105/230 (45%), Gaps = 2/230 (0%)
 Frame = +3

Query: 195 TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
           TGH + V+ VS    GK + + S D S+K+  +   +T + L +L GH   V  V+++  
Sbjct: 99  TGHEEAVYSVSFSPDGKTLVSGSKDKSVKLWSL---ATGRELYSLKGHLDDVLSVAFSPD 155

Query: 375 KFGSLLAS--CSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
             G ++AS     D  + +W    Q   T     ++    +NS++++P   G  LA GS 
Sbjct: 156 --GQVVASGGAGNDKTIKIWHLAKQKVQTITG-HSEWFGGINSLAFSPD--GNILASGSW 210

Query: 549 DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
           D NI ++  ++     T      H   V  VS++P+   G +           LASA  D
Sbjct: 211 DKNIKLWQWQNSEEICTL---TGHSDHVCCVSFSPN---GNI-----------LASASKD 253

Query: 729 NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASED 878
            ++K+W+    V       +  +H   V  +A++P+      T+AS+S D
Sbjct: 254 KSIKLWQ----VDTRSIISSFIVHEESVYSLAFSPD----GQTLASSSGD 295



>sp|Q8YTC2|YS00_ANASP Hypothetical WD-repeat protein
            alr2800.>pir|AI2155|AI2155 WD-repeat protein [imported] -
            Nostoc sp. (strain PCC 7120)>gb:BA000019_683789 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 1258

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 86/330 (26%), Positives = 135/330 (40%), Gaps = 30/330 (9%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
            DHT       +GK    +    H+  V  V+    G+ +A+ S D +IKI    N  T +
Sbjct: 789  DHTIKLWDVSQGK--CLRTLKSHTGWVRSVAFSADGQTLASGSGDRTIKIW---NYHTGE 843

Query: 315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV----FNDHK 482
             L T  GH   V+ ++++      +L S S D  + +W         Q H+     + H 
Sbjct: 844  CLKTYIGHTNSVYSIAYSPDS--KILVSGSGDRTIKLWD-------CQTHICIKTLHGHT 894

Query: 483  SSVNSISWAPHELGLCLACGSSDGNISVYTARSDG---GWDTARIDQAHPIG-------- 629
            + V S++++P   G  LAC S D ++ ++  R+      W     D A P+         
Sbjct: 895  NEVCSVAFSPD--GQTLACVSLDQSVRLWNCRTGQCLKAW-YGNTDWALPVAFSPDRQIL 951

Query: 630  --------VTAVSWAPSMAPGALVGS-------GLHDPVQKLASAGCDNTVKVWKLYNGV 764
                    V    W       +L G              Q LASA  D++V++W +  G 
Sbjct: 952  ASGSNDKTVKLWDWQTGKYISSLEGHTDFIYGIAFSPDSQTLASASTDSSVRLWNISTG- 1010

Query: 765  WKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
                CF  L  HT+WV  V + P        IA+ S D  V +W ++        K L +
Sbjct: 1011 ---QCFQILLEHTDWVYAVVFHPQ----GKIIATGSADCTVKLWNISTGQCL---KTLSE 1060

Query: 945  FNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +  +  ++WS  G LLA AS D +V LW+
Sbjct: 1061 HSDKILGMAWSPDGQLLASASADQSVRLWD 1090



 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 78/285 (27%), Positives = 131/285 (45%), Gaps = 6/285 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D ++ ++     + +A+AS+D+S+++  +S   T Q    L  H   V+ V + HP+
Sbjct: 976  GHTDFIYGIAFSPDSQTLASASTDSSVRLWNIS---TGQCFQILLEHTDWVYAVVF-HPQ 1031

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G ++A+ S D  V +W   N +        ++H   +  ++W+P   G  LA  S+D +
Sbjct: 1032 -GKIIATGSADCTVKLW---NISTGQCLKTLSEHSDKILGMAWSPD--GQLLASASADQS 1085

Query: 558  ISVY---TARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            + ++   T R  G      I + H   V +  ++P+   G ++           A+   D
Sbjct: 1086 VRLWDCCTGRCVG------ILRGHSNRVYSAIFSPN---GEII-----------ATCSTD 1125

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
             TVK+W    G     C   L  HTNWV D+A++P+       +ASAS D  V IW V  
Sbjct: 1126 QTVKIWDWQQG----KCLKTLTGHTNWVFDIAFSPD----GKILASASHDQTVRIWDVN- 1176

Query: 909  EGDQWEGK---VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  GK   +       V  V++S  G ++A  S D  V +WN
Sbjct: 1177 -----TGKCHHICIGHTHLVSSVAFSPDGEVVASGSQDQTVRIWN 1216



 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 62/221 (28%), Positives = 98/221 (44%), Gaps = 3/221 (1%)
 Frame = +3

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            G LLA+C  D  V VW+  +        +   H + V  + ++P   G  LA   +D N+
Sbjct: 654  GQLLATCDTDCHVRVWEVKSGKLLL---ICRGHSNWVRFVVFSPD--GEILASCGADENV 708

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVK 740
             +++ R DG          H +   A                 H   + LASA  D T+K
Sbjct: 709  KLWSVR-DGVCIKTLTGHEHEVFSVA----------------FHPDGETLASASGDKTIK 751

Query: 741  VWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQ 920
            +W + +G     C   L  HT+WVR VA++P+     +T+AS++ D  + +W V+     
Sbjct: 752  LWDIQDGT----CLQTLTGHTDWVRCVAFSPD----GNTLASSAADHTIKLWDVS----- 798

Query: 921  WEGKVLYDFNTP---VWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +GK L    +    V  V++S  G  LA  SGD  + +WN
Sbjct: 799  -QGKCLRTLKSHTGWVRSVAFSADGQTLASGSGDRTIKIWN 838



>pir|AE1866|AE1866 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681470 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1708

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 81/303 (26%), Positives = 132/303 (43%), Gaps = 6/303 (1%)
 Frame = +3

Query: 147  IRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT 326
            I+  +++GK+   K   GH D +  V+    G+ +ATAS D +IK+     N     L T
Sbjct: 1253 IKLWNRDGKL--LKTWQGHDDAILGVAWSPKGETIATASFDQTIKLWNRQGNL----LKT 1306

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
            L+GH   V  V+++    G  + S S D  + +W      +         H S VNS+S+
Sbjct: 1307 LSGHTAGVTAVTFSPN--GETIGSASIDATLKLWSP----QGLLLGTLKGHNSWVNSVSF 1360

Query: 507  APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIG---VTAVSWAPSMAPGALV 677
            +P   G   A GS D  ++++       WD   +      G   VT++S++         
Sbjct: 1361 SPD--GRIFASGSRDKTVTLWR------WDEVLLRNPKGDGNDWVTSISFSSDG------ 1406

Query: 678  GSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
                    + LA+A  D TVK+   +  +         + HT  +  VAW+PN    +  
Sbjct: 1407 --------ETLAAASRDQTVKILSRHGKLLN-----TFKGHTGSIWGVAWSPN----RQM 1449

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLLAVASGDNNVTL 1028
            IASAS+D  V +W         +GK+L+        V  V+WS    ++A A  D  V +
Sbjct: 1450 IASASKDQTVKLW-------HQDGKILHTLQGHQDAVLAVAWSSDSQVIASAGKDKIVKI 1502

Query: 1029 WNE 1037
            W++
Sbjct: 1503 WSQ 1505



 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 77/318 (24%), Positives = 131/318 (41%), Gaps = 38/318 (11%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D V++ S    G  +A+ SSD ++K+     +   + L TL+GH+  V  ++W    
Sbjct: 1186 GHGDVVNNASFSPDGSLIASGSSDKTVKLW----SREGKLLNTLSGHNDAVLGIAWTPD- 1240

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  LAS   D  + +W    +   T    +  H  ++  ++W+P   G  +A  S D  
Sbjct: 1241 -GQTLASVGADKNIKLWNRDGKLLKT----WQGHDDAILGVAWSPK--GETIATASFDQT 1293

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++  + +      +    H  GVTAV+++P+   G  +GS           A  D T+
Sbjct: 1294 IKLWNRQGN----LLKTLSGHTAGVTAVTFSPN---GETIGS-----------ASIDATL 1335

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK--- 908
            K+W     +        L+ H +WV  V+++P+  +     AS S D  V +W   +   
Sbjct: 1336 KLWSPQGLL-----LGTLKGHNSWVNSVSFSPDGRI----FASGSRDKTVTLWRWDEVLL 1386

Query: 909  -----EGDQW---------------------------EGKVLYDFNT---PVWRVSWSLT 983
                 +G+ W                            GK+L  F      +W V+WS  
Sbjct: 1387 RNPKGDGNDWVTSISFSSDGETLAAASRDQTVKILSRHGKLLNTFKGHTGSIWGVAWSPN 1446

Query: 984  GNLLAVASGDNNVTLWNE 1037
              ++A AS D  V LW++
Sbjct: 1447 RQMIASASKDQTVKLWHQ 1464



 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 84/321 (26%), Positives = 134/321 (41%), Gaps = 38/321 (11%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            K  +GH+  V  V+    G+ + +AS DA++K+     +     L TL GH+  V  VS+
Sbjct: 1305 KTLSGHTAGVTAVTFSPNGETIGSASIDATLKLW----SPQGLLLGTLKGHNSWVNSVSF 1360

Query: 366  AHPKFGSLLASCSFDGKVIVWK---------EGNQNEWTQA------------------- 461
            +    G + AS S D  V +W+         +G+ N+W  +                   
Sbjct: 1361 SPD--GRIFASGSRDKTVTLWRWDEVLLRNPKGDGNDWVTSISFSSDGETLAAASRDQTV 1418

Query: 462  ----------HVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARID 611
                      + F  H  S+  ++W+P+     +A  S D  + ++    DG        
Sbjct: 1419 KILSRHGKLLNTFKGHTGSIWGVAWSPNRQ--MIASASKDQTVKLW--HQDG--KILHTL 1472

Query: 612  QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPAL 791
            Q H   V AV+W+                 Q +ASAG D  VK+W     +        L
Sbjct: 1473 QGHQDAVLAVAWSSDS--------------QVIASAGKDKIVKIWSQGGQL-----LHTL 1513

Query: 792  QMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVS 971
            Q HT+ V  V+++P+  L    +AS S+D  V +W+  ++G       L + +  V  V+
Sbjct: 1514 QGHTDAVNWVSFSPDGKL----LASVSDDTTVKLWS--RDGQLLH--TLKEHSRRVNGVA 1565

Query: 972  WSLTGNLLAVASGDNNVTLWN 1034
            WS  G +LA AS D  V LWN
Sbjct: 1566 WSPDGQILASASIDGTVKLWN 1586



 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 59/223 (26%), Positives = 94/223 (42%), Gaps = 5/223 (2%)
 Frame = +3

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            GSL+AS S D  + +W+    ++ +  +  + H + VNS++++P    L +A  S D  +
Sbjct: 1118 GSLIASASADNTINLWR----SDGSLINTLSKHTNVVNSVNFSPD--ALLIASASQDKTV 1171

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVK 740
             ++              Q H   V   S++P    G+L+ SG             D TVK
Sbjct: 1172 KLWNRVG----QLVTTLQGHGDVVNNASFSPD---GSLIASG-----------SSDKTVK 1213

Query: 741  VW----KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT-VA 905
            +W    KL N          L  H + V  +AW P+      T+AS   D  + +W    
Sbjct: 1214 LWSREGKLLN---------TLSGHNDAVLGIAWTPD----GQTLASVGADKNIKLWNRDG 1260

Query: 906  KEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            K    W+G      +  +  V+WS  G  +A AS D  + LWN
Sbjct: 1261 KLLKTWQG-----HDDAILGVAWSPKGETIATASFDQTIKLWN 1298



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 48/178 (26%), Positives = 69/178 (38%), Gaps = 37/178 (20%)
 Frame = +3

Query: 612  QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPAL 791
            + H  GV +  ++P    G+L+           ASA  DNT+ +W+    +        L
Sbjct: 1103 EGHTAGVNSAVFSPD---GSLI-----------ASASADNTINLWRSDGSL-----INTL 1143

Query: 792  QMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW--------TVAKEGD---------- 917
              HTN V  V ++P+  L    IASAS+D  V +W        T+   GD          
Sbjct: 1144 SKHTNVVNSVNFSPDALL----IASASQDKTVKLWNRVGQLVTTLQGHGDVVNNASFSPD 1199

Query: 918  --------------QW--EGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                           W  EGK+L      N  V  ++W+  G  LA    D N+ LWN
Sbjct: 1200 GSLIASGSSDKTVKLWSREGKLLNTLSGHNDAVLGIAWTPDGQTLASVGADKNIKLWN 1257



>gb:BA000045_742963 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1081

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 87/300 (29%), Positives = 132/300 (44%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            G+   +R++D  G+  A+   TGH+D +  ++    G  +A+ S D S+K+    +    
Sbjct: 486  GEIRLLRAAD--GQQQARC--TGHTDALCAMAFHPEGNLLASGSEDLSVKLWAAGSG--- 538

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
            Q LATL GH G V+ V++A    G  LAS S DG V +W  G         +  +     
Sbjct: 539  QCLATLTGHTGWVYAVAFAPD--GRTLASGSVDGTVRLWDVGTG---LCLKILCEPGGQF 593

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
             S+++AP   G  LA       I ++   S      A   + H   V +V+++P      
Sbjct: 594  WSVAFAPD--GQTLATAGHGHAIKLWQVSSGA---CALSLEGHTAQVRSVAFSPDG---- 644

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
                      + LASAG D TV++W +  G     C   L+ HT+ VR VA++P   L  
Sbjct: 645  ----------RTLASAGVDGTVRLWDVPLGA----CLMVLEGHTSRVRTVAFSPGGHL-- 688

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              +AS   D  V +W V         +VL      VW +++   G  LA  S D  V LW
Sbjct: 689  --LASGGHDQTVRLWEVRSGRCL---RVLPGHTGQVWSLAFHPNGRTLASGSMDQTVRLW 743



 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 80/285 (28%), Positives = 120/285 (42%), Gaps = 4/285 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V  V+    G  +A+   D ++++  V +      L  L GH G VW +++ HP 
Sbjct: 672  GHTSRVRTVAFSPGGHLLASGGHDQTVRLWEVRSGRC---LRVLPGHTGQVWSLAF-HPN 727

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  LAS S D  V +W+  +         F  +   + S+++ P   G  LA GS D  
Sbjct: 728  -GRTLASGSMDQTVRLWEVDSGRS---LKTFQGNSGWIWSVAFHPG--GHLLASGSMDRL 781

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            + +        WDT R  Q          W  S+A         H   + LAS   D TV
Sbjct: 782  VRL--------WDT-RTGQCLKTLAGHGCWVWSLA--------FHPGGEILASGSFDQTV 824

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W++  G     C  +L  HTNW+R VA++P+     + IASA  D  + +W       
Sbjct: 825  KLWEVDTG----RCIQSLAGHTNWIRAVAFSPD----GAQIASAGVDQTIRLWA------ 870

Query: 918  QWEG----KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             W       VL      V  V++   G  LA  S D  + +W+ A
Sbjct: 871  -WPAGNCTAVLTGHTGWVRCVAFGPDGRQLASGSLDRTIKIWDAA 914



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 89/325 (27%), Positives = 128/325 (39%), Gaps = 44/325 (13%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            G+S  +  V+    G  +A+ S D   +++ + +  T Q L TLAGH   VW +++ HP 
Sbjct: 756  GNSGWIWSVAFHPGGHLLASGSMD---RLVRLWDTRTGQCLKTLAGHGCWVWSLAF-HPG 811

Query: 378  FGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFND------------------ 476
             G +LAS SFD  V +W+               W +A  F+                   
Sbjct: 812  -GEILASGSFDQTVKLWEVDTGRCIQSLAGHTNWIRAVAFSPDGAQIASAGVDQTIRLWA 870

Query: 477  ------------HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAH 620
                        H   V  +++ P   G  LA GS D  I +        WD A  +   
Sbjct: 871  WPAGNCTAVLTGHTGWVRCVAFGPD--GRQLASGSLDRTIKI--------WDAATGECVA 920

Query: 621  PIG-----VTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFP 785
             +G     + AV+++P    G+L           LASA  D+ VK+W L  G    +C  
Sbjct: 921  TLGGHRGQICAVAFSPD---GSL-----------LASAAEDHLVKLWNLATG----ECVA 962

Query: 786  ALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWR 965
             L  H   V  VA+AP+ GL    +AS   D  V  W     G       L   +  VW 
Sbjct: 963  TLAGHCGPVWSVAFAPD-GLH---LASCGHDQVVRFWDA---GSGALTATLRGHSDQVWS 1015

Query: 966  VSWSLTGNLLAVASGDNNVTLWNEA 1040
            V++   G  LA  S D  + LWN A
Sbjct: 1016 VAYDPRGETLASGSQDKTIRLWNPA 1040



 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 57/189 (30%), Positives = 78/189 (41%)
 Frame = +3

Query: 465  VFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVS 644
            VF    + +  +++ P   G  LA G   G I +  A +DG        QA   G T   
Sbjct: 459  VFGQTFAGILLVAFNPE--GTVLAIGDDSGEIRLLRA-ADGQ------QQARCTGHT--- 506

Query: 645  WAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
                    AL     H     LAS   D +VK+W   +G     C   L  HT WV  VA
Sbjct: 507  -------DALCAMAFHPEGNLLASGSEDLSVKLWAAGSG----QCLATLTGHTGWVYAVA 555

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVA 1004
            +AP+      T+AS S DG V +W V   G     K+L +     W V+++  G  LA A
Sbjct: 556  FAPD----GRTLASGSVDGTVRLWDV---GTGLCLKILCEPGGQFWSVAFAPDGQTLATA 608

Query: 1005 SGDNNVTLW 1031
               + + LW
Sbjct: 609  GHGHAIKLW 617



>pir|S70127|S70127 hypothetical protein YDR267c - yeast (Saccharomyces
            cerevisiae)>gb:YSCD9954_1728771 Saccharomyces cerevisiae
            chromosome IV cosmid 9954.
          Length = 330

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 82/291 (28%), Positives = 128/291 (43%), Gaps = 14/291 (4%)
 Frame = +3

Query: 225  SMDYYGKRVATASSDASIKIIGVS-NNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASC 401
            S D+    +AT S+D  IK++ V  ++ T   +     H   +  V+W      SLLA+ 
Sbjct: 19   SFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAWR--PHTSLLAAG 76

Query: 402  SFDGKVIVW-KEGNQN---EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVY 569
            SFD  V +W KE + +   E     +   H++ V  ++W+    G  LA  S D ++ ++
Sbjct: 77   SFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSND--GYYLATCSRDKSVWIW 134

Query: 570  -TARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVW 746
             T  S   ++   + Q H   V  V W PS A               LAS+  D+TV++W
Sbjct: 135  ETDESGEEYECISVLQEHSQDVKHVIWHPSEA--------------LLASSSYDDTVRIW 180

Query: 747  KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST--IASASEDGKVVIWTVA--KEG 914
            K Y+  W  +C   L  H   V    W+ +    +    + S S+D  V +W      E 
Sbjct: 181  KDYDDDW--ECVAVLNGHEGTV----WSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDED 234

Query: 915  DQWEG---KVLYDFNT-PVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            DQ E     +L D +   V+ V+W   G + +V  G + V    E VDGEW
Sbjct: 235  DQQEWVCEAILPDVHKRQVYNVAWGFNGLIASV--GADGVLAVYEEVDGEW 283



 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 72/259 (27%), Positives = 110/259 (42%), Gaps = 7/259 (2%)
 Frame = +3

Query: 153 SSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATL 329
           S+D+  +M    I  GH + V  V+    G  +AT S D S+ I     +      ++ L
Sbjct: 90  SADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSVWIWETDESGEEYECISVL 149

Query: 330 AGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWA 509
             H   V  V W HP   +LLAS S+D  V +WK+ + ++W    V N H+ +V S  + 
Sbjct: 150 QEHSQDVKHVIW-HPS-EALLASSSYDDTVRIWKDYD-DDWECVAVLNGHEGTVWSSDFD 206

Query: 510 PHELGLCLACGSSDGNISVYTARSDGGWDT------ARIDQAHPIGVTAVSWAPSMAPGA 671
             E    L  GS D  + V+    D   D       A +   H   V  V+W        
Sbjct: 207 KTEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILPDVHKRQVYNVAWG------- 259

Query: 672 LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
              +GL      +AS G D  + V++  +G WK+    AL      +  V W    G  K
Sbjct: 260 --FNGL------IASVGADGVLAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNG--K 309

Query: 852 STIASASEDGKVVIWTVAK 908
           + +A+  +DG V  W++ K
Sbjct: 310 TILATGGDDGIVNFWSLEK 328



 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 62/239 (25%), Positives = 101/239 (42%), Gaps = 9/239 (3%)
 Frame = +3

Query: 363  WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND--HKSSVNSISWAPHELGLCLA 536
            W+      +LA+ S D K+ +      +++T   V ++  HK ++ S++W PH     LA
Sbjct: 18   WSFDFSQGILATGSTDRKIKLVSV-KYDDFTLIDVLDETAHKKAIRSVAWRPHTS--LLA 74

Query: 537  CGSSDGNISVYTARSDGG----WDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQ 704
             GS D  +S++            D   I + H   V  V+W+           G +    
Sbjct: 75   AGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWS---------NDGYY---- 121

Query: 705  KLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
             LA+   D +V +W+      + +C   LQ H+  V+ V W P+    ++ +AS+S D  
Sbjct: 122  -LATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPS----EALLASSSYDDT 176

Query: 885  VVIWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASG--DNNVTLWNEAVDGE 1052
            V IW      D WE   VL      VW   +  T  +  + SG  D+ V +W    D E
Sbjct: 177  VRIW--KDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVWKYMGDDE 233



>pir|AD1842|AD1842 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681276 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1711

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 81/280 (28%), Positives = 126/280 (45%), Gaps = 2/280 (0%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
            H+  V  VS    G+ +A+ S D +I +         + L TL GH+  V  VS++    
Sbjct: 1105 HNAWVTSVSYSPDGEVIASGSVDNTIHLW----RRDGKLLTTLTGHNDGVNSVSFSPD-- 1158

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            G +LAS S D  + +W+   Q   T       H   V S+S++P+  G  +A GSSD  I
Sbjct: 1159 GEILASASADSTIKLWQRNGQLITT----LKGHDQGVKSVSFSPN--GEIIASGSSDHTI 1212

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVK 740
            +++   S  G     ++  H  GV ++ ++P                  +ASA  D T++
Sbjct: 1213 NLW---SRAGKLLLSLN-GHSQGVNSIKFSPEG--------------DTIASASDDGTIR 1254

Query: 741  VWKLYNGVWKMDCFPALQM--HTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            +W L       D  P + +  HT  V  V ++P+      TI SA  D  V +W+  + G
Sbjct: 1255 LWSL-------DGRPLITIPSHTKQVLAVTFSPD----GQTIVSAGADNTVKLWS--RNG 1301

Query: 915  DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                   L   N  VW+V +S  G L+A AS D  +TLW+
Sbjct: 1302 TLLT--TLEGHNEAVWQVIFSPDGRLIATASADKTITLWS 1339



 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 84/316 (26%), Positives = 126/316 (39%), Gaps = 37/316 (11%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH++ V  V     G+ +ATAS+D +I +     N     L T AGH+  V  +S++   
Sbjct: 1309 GHNEAVWQVIFSPDGRLIATASADKTITLWSRDGNI----LGTFAGHNHEVNSLSFSPD- 1363

Query: 378  FGSLLASCSFDGKVIVWKE---------GNQNEWTQAHVFNDHKS--------------- 485
             G++LAS S D  V +W           G++   +     ND K                
Sbjct: 1364 -GNILASGSDDNTVRLWTVNRTLPKTFYGHKGSVSYVRFSNDGKKITSLSTDSTMKTWSL 1422

Query: 486  -------------SVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI 626
                          V SIS+ P    + LA  S D  I +Y  +  GG    R    H  
Sbjct: 1423 DGKLLQTLSSPLPDVTSISFTPDNKIVALA--SPDHTIHLYNRQ--GG--LLRSLPGHNH 1476

Query: 627  GVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTN 806
             +T++S++P+               Q LAS   D T+K+W +   + K      L  H  
Sbjct: 1477 WITSLSFSPNK--------------QILASGSADKTIKLWSVNGRLLK-----TLLGHNG 1517

Query: 807  WVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTG 986
            WV D+ ++ +       I SAS D  + IW++    D    + L   +  VW V+ S  G
Sbjct: 1518 WVTDIKFSAD----GKNIVSASADKTIKIWSL----DGRLIRTLQGHSASVWSVNLSPDG 1569

Query: 987  NLLAVASGDNNVTLWN 1034
              LA  S D  + LWN
Sbjct: 1570 QTLASTSQDETIKLWN 1585



 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 55/185 (29%), Positives = 83/185 (44%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V D+     GK + +AS+D +IKI  +        + TL GH   VW V+ +   
Sbjct: 1514 GHNGWVTDIKFSADGKNIVSASADKTIKIWSLDGRL----IRTLQGHSASVWSVNLSPD- 1568

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  LAS S D  + +W    +  +T       H   V ++S++P   G  +A  S DG 
Sbjct: 1569 -GQTLASTSQDETIKLWNLNGELIYT----LRGHSDVVYNLSFSPD--GKTIASASDDGT 1621

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++   +       +  Q H  GV +VS++P    G ++ SG HD            TV
Sbjct: 1622 IKLWNVPNG---TLLKTFQGHRGGVRSVSFSPD---GKILASGGHD-----------TTV 1664

Query: 738  KVWKL 752
            KVW L
Sbjct: 1665 KVWNL 1669



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 77/277 (27%), Positives = 120/277 (43%), Gaps = 3/277 (1%)
 Frame = +3

Query: 213  VHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLL 392
            V  +S     K VA AS D +I +     N     L +L GH+  +  +S++  K   +L
Sbjct: 1437 VTSISFTPDNKIVALASPDHTIHLY----NRQGGLLRSLPGHNHWITSLSFSPNK--QIL 1490

Query: 393  ASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYT 572
            AS S D  + +W    +   T       H   V  I ++    G  +   S+D  I +++
Sbjct: 1491 ASGSADKTIKLWSVNGRLLKTLL----GHNGWVTDIKFSAD--GKNIVSASADKTIKIWS 1544

Query: 573  ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
               DG     R  Q H   V    W+ +++P            Q LAS   D T+K+W L
Sbjct: 1545 L--DGR--LIRTLQGHSASV----WSVNLSPDG----------QTLASTSQDETIKLWNL 1586

Query: 753  YNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGK 932
             NG    +    L+ H++ V +++++P+      TIASAS+DG + +W V        G 
Sbjct: 1587 -NG----ELIYTLRGHSDVVYNLSFSPD----GKTIASASDDGTIKLWNVP------NGT 1631

Query: 933  VLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +L  F      V  VS+S  G +LA    D  V +WN
Sbjct: 1632 LLKTFQGHRGGVRSVSFSPDGKILASGGHDTTVKVWN 1668



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 62/285 (21%), Positives = 115/285 (40%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   V  VS    G+ +A+ SSD +I +     +   + L +L GH   V  + ++   
Sbjct: 1186 GHDQGVKSVSFSPNGEIIASGSSDHTINLW----SRAGKLLLSLNGHSQGVNSIKFSPE- 1240

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS S DG + +W    +   T       H   V +++++P   G  +    +D  
Sbjct: 1241 -GDTIASASDDGTIRLWSLDGRPLIT----IPSHTKQVLAVTFSPD--GQTIVSAGADNT 1293

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            + +++             + H   V  V ++P    G L+           A+A  D T+
Sbjct: 1294 VKLWSRNG----TLLTTLEGHNEAVWQVIFSPD---GRLI-----------ATASADKTI 1335

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
             +W     +           H + V  ++++P+     + +AS S+D  V +WTV    +
Sbjct: 1336 TLWSRDGNI-----LGTFAGHNHEVNSLSFSPD----GNILASGSDDNTVRLWTV----N 1382

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            +   K  Y     V  V +S  G  +   S D+ +  W  ++DG+
Sbjct: 1383 RTLPKTFYGHKGSVSYVRFSNDGKKITSLSTDSTMKTW--SLDGK 1425



>gb:CR382129_1662049 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 332

 Score = 80.5 bits (197), Expect = 6e-14
 Identities = 62/205 (30%), Positives = 88/205 (42%), Gaps = 1/205 (0%)
 Frame = +3

Query: 312 QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND-HKSS 488
           Q +  L GH    W  S  HP    LLA+CS D  V ++   N N W       + H  S
Sbjct: 2   QLIKALKGHTDRAWAAS-VHPNL-PLLATCSGDKTVRIY---NTNNWELVTTITEGHNRS 56

Query: 489 VNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPG 668
           V S++W P      LA GS D  +S++  + D  W      + H   V  VSW+      
Sbjct: 57  VRSVAWKPSGSSPSLALGSFDSTVSIW-GKEDDEWQFLAAIEGHENEVKGVSWSCDG--- 112

Query: 669 ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
                      Q LA+   D ++ VW+  +   + +C   LQ HT  V+ VAW P+    
Sbjct: 113 -----------QLLATCSRDKSIWVWEADDMNDEFECISVLQDHTQDVKHVAWHPS---- 157

Query: 849 KSTIASASEDGKVVIWTVAKEGDQW 923
           +   ASAS D  V +W   ++ D W
Sbjct: 158 EMVFASASYDDTVRLW--REDDDDW 180



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/177 (28%), Positives = 79/177 (44%), Gaps = 2/177 (1%)
 Frame = +3

Query: 531  LACGSSDGNISVYTARSDGGWD-TARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK 707
            LA  S D  + +Y   +   W+    I + H   V +V+W PS       GS        
Sbjct: 26   LATCSGDKTVRIYNTNN---WELVTTITEGHNRSVRSVAWKPS-------GSS-----PS 70

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
            LA    D+TV +W   +  W+     A++ H N V+ V+W+ +  L    +A+ S D  +
Sbjct: 71   LALGSFDSTVSIWGKEDDEWQF--LAAIEGHENEVKGVSWSCDGQL----LATCSRDKSI 124

Query: 888  VIWTVAKEGDQWEG-KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
             +W      D++E   VL D    V  V+W  +  + A AS D+ V LW E  D +W
Sbjct: 125  WVWEADDMNDEFECISVLQDHTQDVKHVAWHPSEMVFASASYDDTVRLWRED-DDDW 180



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 1/118 (0%)
 Frame = +3

Query: 681  SGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTI 860
            + +H  +  LA+   D TV+++   N  W++      + H   VR VAW P+   P  ++
Sbjct: 17   ASVHPNLPLLATCSGDKTVRIYNTNN--WEL-VTTITEGHNRSVRSVAWKPSGSSP--SL 71

Query: 861  ASASEDGKVVIWTVAKEGDQWEGKVLYD-FNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            A  S D  V IW   KE D+W+     +     V  VSWS  G LLA  S D ++ +W
Sbjct: 72   ALGSFDSTVSIW--GKEDDEWQFLAAIEGHENEVKGVSWSCDGQLLATCSRDKSIWVW 127



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 44/170 (25%), Positives = 66/170 (38%), Gaps = 25/170 (14%)
 Frame = +3

Query: 318 LATLAGHHGPVWQVSWAHPKFGS--LLASCSFDGKVIVWKEGNQ---------------- 443
           +A L GH   VW  ++  P  GS   L SCS D   IVWK+  Q                
Sbjct: 183 VADLGGHESTVWGCAF-EPSEGSDLRLVSCSDDKTCIVWKKEGQVGGTGDHSGIRPAFRA 241

Query: 444 ----NEW-TQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT-AR 605
                EW  QA +   H  ++ S++W  +     +A   +DG + VY     G W   + 
Sbjct: 242 DPLSEEWIQQATLPEAHTRAIYSVAWNKNGR---IASTGADGKLVVYKENGPGQWVVESE 298

Query: 606 IDQAHPI-GVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
           ++ AH +  V  V W                   KL ++G D  V +W++
Sbjct: 299 VENAHGVYEVNDVVWLD----------------DKLVTSGDDGVVNIWEV 332



>gb:SCO939118_177541 Streptomyces coelicolor A3(2) complete genome;
            segment 15/29.
          Length = 1676

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 77/282 (27%), Positives = 124/282 (43%), Gaps = 3/282 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSWAHP 374
            GH+  V+  S    G+ +ATAS D ++++  VS+    Q L   L GH    W  +    
Sbjct: 1022 GHTGAVYLTSFSPDGRILATASYDRTVRLWDVSDPGRPQQLGKPLTGHTS--WVSTAVFS 1079

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHV-FNDHKSSVNSISWAPHELGLCLACGSSD 551
              G  LAS S DG + +W   +           + H  +V  ++++P   G  LA    D
Sbjct: 1080 PDGRTLASASDDGTIRLWDVTDPGRPRPLGAPLDGHGGTVYLLAFSPD--GRTLASAHDD 1137

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
              + +        W+ A  D+  P  +  ++ +     GA+           LAS G D+
Sbjct: 1138 HAVRL--------WNVA--DRRAPEALDTLTGST----GAVRSVAFSPDGDTLASGGDDD 1183

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             V++W + +          L  H+  V  VA++P+      T+AS S D  V +W V   
Sbjct: 1184 KVRLWDVSDPRRPEPAGAPLAGHSGLVHSVAFSPD----GHTLASGSADDTVQLWDVTDP 1239

Query: 912  -GDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             G +  G  L   + PVW V++S  G +LAV+S D+  +LWN
Sbjct: 1240 AGAKPVGAPLTGHSGPVWAVAFSPDGAMLAVSSADSTASLWN 1281



 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 73/283 (25%), Positives = 123/283 (43%), Gaps = 3/283 (1%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHGPVWQVSWAH 371
            TGH+  V        G+ +A+AS D +I++  V++    + L A L GH G V+ ++++ 
Sbjct: 1067 TGHTSWVSTAVFSPDGRTLASASDDGTIRLWDVTDPGRPRPLGAPLDGHGGTVYLLAFSP 1126

Query: 372  PKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSD 551
               G  LAS   D  V +W   ++              +V S++++P   G  LA G  D
Sbjct: 1127 D--GRTLASAHDDHAVRLWNVADRRAPEALDTLTGSTGAVRSVAFSPD--GDTLASGGDD 1182

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV-QKLASAGCD 728
              + +        WD +   +  P G      AP      LV S    P    LAS   D
Sbjct: 1183 DKVRL--------WDVSDPRRPEPAG------APLAGHSGLVHSVAFSPDGHTLASGSAD 1228

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            +TV++W + +          L  H+  V  VA++P+  +    +A +S D    +W V+ 
Sbjct: 1229 DTVQLWDVTDPAGAKPVGAPLTGHSGPVWAVAFSPDGAM----LAVSSADSTASLWNVSD 1284

Query: 909  EGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                 + G  L   +  ++ + +S  G+ LA  SGD+ V LW+
Sbjct: 1285 PAYPSQVGVPLAGGSGEMYALGFSPDGHTLATGSGDSKVRLWS 1327



 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 85/372 (22%), Positives = 143/372 (38%), Gaps = 73/372 (19%)
 Frame = +3

Query: 156  SDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLA 332
            SD     PA     GHS  VH V+    G  +A+ S+D ++++  V++ + ++ + A L 
Sbjct: 1191 SDPRRPEPAGAPLAGHSGLVHSVAFSPDGHTLASGSADDTVQLWDVTDPAGAKPVGAPLT 1250

Query: 333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV-FNDHKSSVNSISWA 509
            GH GPVW V+++    G++LA  S D    +W   +    +Q  V        + ++ ++
Sbjct: 1251 GHSGPVWAVAFSPD--GAMLAVSSADSTASLWNVSDPAYPSQVGVPLAGGSGEMYALGFS 1308

Query: 510  PHELGLCLACGSSDGNISVY----------------------TARSDGG---WDTARIDQ 614
            P   G  LA GS D  + ++                      TA  DG    WD    D 
Sbjct: 1309 PD--GHTLATGSGDSKVRLWSLPTSEMIGRIGAFRPDGHVLATAARDGRVRLWDVT--DP 1364

Query: 615  AHPIGVTA-----------VSWAPSMAPGALVGSG-------LHDPV------------- 701
              P+ ++A           + ++P     A++  G       + DP              
Sbjct: 1365 GRPVSLSAPFEPGDGDIRSLVFSPDGGTLAVLVGGRALQLWDVTDPAGPTAHGPPVALST 1424

Query: 702  --------------QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNL 839
                          + LA+A  D T+++W   +          L  H+ +V  +A++P+ 
Sbjct: 1425 RYAGPDTLAFSPDGRTLATAHDDRTIQLWNADDPSRPRRLGKPLAGHSGYVNTLAFSPD- 1483

Query: 840  GLPKSTIASASEDGKVVIWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDN 1016
                 T+AS   D  V +W V         G        PV  +++S  G+ LA  S D 
Sbjct: 1484 ---GRTLASGGADDAVRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPDGHTLASGSDDG 1540

Query: 1017 NVTLWNEAVDGE 1052
             V LW+    GE
Sbjct: 1541 TVRLWDVTEPGE 1552



 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 69/315 (21%), Positives = 124/315 (39%), Gaps = 36/315 (11%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH  TV+ ++    G+ +A+A  D ++++  V++    + L TL G  G V  V+++   
Sbjct: 1114 GHGGTVYLLAFSPDGRTLASAHDDHAVRLWNVADRRAPEALDTLTGSTGAVRSVAFSPD- 1172

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHV-FNDHKSSVNSISWAPHELGLCLACGSSDG 554
             G  LAS   D KV +W   +      A      H   V+S++++P   G  LA GS+D 
Sbjct: 1173 -GDTLASGGDDDKVRLWDVSDPRRPEPAGAPLAGHSGLVHSVAFSPD--GHTLASGSADD 1229

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVS-----WAPSMAPGALVGSGLHDPVQKLASA 719
             + +        WD      A P+G          WA + +P   +          LA +
Sbjct: 1230 TVQL--------WDVTDPAGAKPVGAPLTGHSGPVWAVAFSPDGAM----------LAVS 1271

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN---------------LGLPKS 854
              D+T  +W + +  +       L   +  +  + ++P+                 LP S
Sbjct: 1272 SADSTASLWNVSDPAYPSQVGVPLAGGSGEMYALGFSPDGHTLATGSGDSKVRLWSLPTS 1331

Query: 855  --------------TIASASEDGKVVIWTVAKEGDQWEGKVLYD-FNTPVWRVSWSLTGN 989
                           +A+A+ DG+V +W V   G        ++  +  +  + +S  G 
Sbjct: 1332 EMIGRIGAFRPDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPGDGDIRSLVFSPDGG 1391

Query: 990  LLAVASGDNNVTLWN 1034
             LAV  G   + LW+
Sbjct: 1392 TLAVLVGGRALQLWD 1406



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 1/110 (0%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
            LAS G D+ V++W + +         A   H   V  +A++P+      T+AS S+DG V
Sbjct: 1487 LASGGADDAVRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPD----GHTLASGSDDGTV 1542

Query: 888  VIWTVAKEGD-QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +W V + G+    G  L      V  +++S  G+ LA  + DN V LW+
Sbjct: 1543 RLWDVTEPGEGSGGGTTLAGHTDSVVSLTFSQDGDTLASGANDNTVRLWS 1592



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 47/173 (27%), Positives = 72/173 (41%), Gaps = 2/173 (1%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSWAHPKFGSLLASCSFDGK 416
            G+ +ATA  D +I++    + S  + L   LAGH G V  ++++    G  LAS   D  
Sbjct: 1438 GRTLATAHDDRTIQLWNADDPSRPRRLGKPLAGHSGYVNTLAFSPD--GRTLASGGADDA 1495

Query: 417  VIVWKEGNQNEWTQAHVFND-HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW 593
            V +W   +    T+       H   VN ++++P   G  LA GS DG + +        W
Sbjct: 1496 VRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPD--GHTLASGSDDGTVRL--------W 1545

Query: 594  DTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
            D     +    G T      S+        G       LAS   DNTV++W +
Sbjct: 1546 DVTEPGEGSGGGTTLAGHTDSVVSLTFSQDG-----DTLASGANDNTVRLWSV 1593



>pir|T42045|T42045 beta transducin-like protein homolog - Streptomyces
            coelicolor>gb:SCO131817_173255 Streptomyces coelicolor
            wdpA gene.
          Length = 1049

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 77/282 (27%), Positives = 124/282 (43%), Gaps = 3/282 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSWAHP 374
            GH+  V+  S    G+ +ATAS D ++++  VS+    Q L   L GH    W  +    
Sbjct: 395  GHTGAVYLTSFSPDGRILATASYDRTVRLWDVSDPGRPQQLGKPLTGHTS--WVSTAVFS 452

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHV-FNDHKSSVNSISWAPHELGLCLACGSSD 551
              G  LAS S DG + +W   +           + H  +V  ++++P   G  LA    D
Sbjct: 453  PDGRTLASASDDGTIRLWDVTDPGRPRPLGAPLDGHGGTVYLLAFSPD--GRTLASAHDD 510

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
              + +        W+ A  D+  P  +  ++ +     GA+           LAS G D+
Sbjct: 511  HAVRL--------WNVA--DRRAPEALDTLTGST----GAVRSVAFSPDGDTLASGGDDD 556

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             V++W + +          L  H+  V  VA++P+      T+AS S D  V +W V   
Sbjct: 557  KVRLWDVSDPRRPEPAGAPLAGHSGLVHSVAFSPD----GHTLASGSADDTVQLWDVTDP 612

Query: 912  -GDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             G +  G  L   + PVW V++S  G +LAV+S D+  +LWN
Sbjct: 613  AGAKPVGAPLTGHSGPVWAVAFSPDGAMLAVSSADSTASLWN 654



 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 73/283 (25%), Positives = 123/283 (43%), Gaps = 3/283 (1%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHGPVWQVSWAH 371
            TGH+  V        G+ +A+AS D +I++  V++    + L A L GH G V+ ++++ 
Sbjct: 440  TGHTSWVSTAVFSPDGRTLASASDDGTIRLWDVTDPGRPRPLGAPLDGHGGTVYLLAFSP 499

Query: 372  PKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSD 551
               G  LAS   D  V +W   ++              +V S++++P   G  LA G  D
Sbjct: 500  D--GRTLASAHDDHAVRLWNVADRRAPEALDTLTGSTGAVRSVAFSPD--GDTLASGGDD 555

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV-QKLASAGCD 728
              + +        WD +   +  P G      AP      LV S    P    LAS   D
Sbjct: 556  DKVRL--------WDVSDPRRPEPAG------APLAGHSGLVHSVAFSPDGHTLASGSAD 601

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            +TV++W + +          L  H+  V  VA++P+  +    +A +S D    +W V+ 
Sbjct: 602  DTVQLWDVTDPAGAKPVGAPLTGHSGPVWAVAFSPDGAM----LAVSSADSTASLWNVSD 657

Query: 909  EGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                 + G  L   +  ++ + +S  G+ LA  SGD+ V LW+
Sbjct: 658  PAYPSQVGVPLAGGSGEMYALGFSPDGHTLATGSGDSKVRLWS 700



 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 85/372 (22%), Positives = 143/372 (38%), Gaps = 73/372 (19%)
 Frame = +3

Query: 156  SDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLA 332
            SD     PA     GHS  VH V+    G  +A+ S+D ++++  V++ + ++ + A L 
Sbjct: 564  SDPRRPEPAGAPLAGHSGLVHSVAFSPDGHTLASGSADDTVQLWDVTDPAGAKPVGAPLT 623

Query: 333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV-FNDHKSSVNSISWA 509
            GH GPVW V+++    G++LA  S D    +W   +    +Q  V        + ++ ++
Sbjct: 624  GHSGPVWAVAFSPD--GAMLAVSSADSTASLWNVSDPAYPSQVGVPLAGGSGEMYALGFS 681

Query: 510  PHELGLCLACGSSDGNISVY----------------------TARSDGG---WDTARIDQ 614
            P   G  LA GS D  + ++                      TA  DG    WD    D 
Sbjct: 682  PD--GHTLATGSGDSKVRLWSLPTSDMIGRIGAFRPDGHVLATAARDGRVRLWDVT--DP 737

Query: 615  AHPIGVTA-----------VSWAPSMAPGALVGSG-------LHDPV------------- 701
              P+ ++A           + ++P     A++  G       + DP              
Sbjct: 738  GRPVSLSAPFEPGDGDIRSLVFSPDGGTLAVLVGGRALQLWDVTDPAGPTAHGPPVALST 797

Query: 702  --------------QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNL 839
                          + LA+A  D T+++W   +          L  H+ +V  +A++P+ 
Sbjct: 798  RYAGPDTLAFSPDGRTLATAHDDRTIQLWNADDPSRPRRLGKPLAGHSGYVNTLAFSPD- 856

Query: 840  GLPKSTIASASEDGKVVIWTVAKEGDQWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGDN 1016
                 T+AS   D  V +W V         G        PV  +++S  G+ LA  S D 
Sbjct: 857  ---GRTLASGGADDAVRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPDGHTLASGSDDG 913

Query: 1017 NVTLWNEAVDGE 1052
             V LW+    GE
Sbjct: 914  TVRLWDVTEPGE 925



 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 69/315 (21%), Positives = 124/315 (39%), Gaps = 36/315 (11%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH  TV+ ++    G+ +A+A  D ++++  V++    + L TL G  G V  V+++   
Sbjct: 487  GHGGTVYLLAFSPDGRTLASAHDDHAVRLWNVADRRAPEALDTLTGSTGAVRSVAFSPD- 545

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHV-FNDHKSSVNSISWAPHELGLCLACGSSDG 554
             G  LAS   D KV +W   +      A      H   V+S++++P   G  LA GS+D 
Sbjct: 546  -GDTLASGGDDDKVRLWDVSDPRRPEPAGAPLAGHSGLVHSVAFSPD--GHTLASGSADD 602

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVS-----WAPSMAPGALVGSGLHDPVQKLASA 719
             + +        WD      A P+G          WA + +P   +          LA +
Sbjct: 603  TVQL--------WDVTDPAGAKPVGAPLTGHSGPVWAVAFSPDGAM----------LAVS 644

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN---------------LGLPKS 854
              D+T  +W + +  +       L   +  +  + ++P+                 LP S
Sbjct: 645  SADSTASLWNVSDPAYPSQVGVPLAGGSGEMYALGFSPDGHTLATGSGDSKVRLWSLPTS 704

Query: 855  --------------TIASASEDGKVVIWTVAKEGDQWEGKVLYD-FNTPVWRVSWSLTGN 989
                           +A+A+ DG+V +W V   G        ++  +  +  + +S  G 
Sbjct: 705  DMIGRIGAFRPDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPGDGDIRSLVFSPDGG 764

Query: 990  LLAVASGDNNVTLWN 1034
             LAV  G   + LW+
Sbjct: 765  TLAVLVGGRALQLWD 779



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 1/110 (0%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
            LAS G D+ V++W + +         A   H   V  +A++P+      T+AS S+DG V
Sbjct: 860  LASGGADDAVRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPD----GHTLASGSDDGTV 915

Query: 888  VIWTVAKEGD-QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +W V + G+    G  L      V  +++S  G+ LA  + DN V LW+
Sbjct: 916  RLWDVTEPGEGSGGGTTLAGHTDSVVSLTFSQDGDTLASGANDNTVRLWS 965



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 47/173 (27%), Positives = 72/173 (41%), Gaps = 2/173 (1%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLAT-LAGHHGPVWQVSWAHPKFGSLLASCSFDGK 416
            G+ +ATA  D +I++    + S  + L   LAGH G V  ++++    G  LAS   D  
Sbjct: 811  GRTLATAHDDRTIQLWNADDPSRPRRLGKPLAGHSGYVNTLAFSPD--GRTLASGGADDA 868

Query: 417  VIVWKEGNQNEWTQAHVFND-HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW 593
            V +W   +    T+       H   VN ++++P   G  LA GS DG + +        W
Sbjct: 869  VRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPD--GHTLASGSDDGTVRL--------W 918

Query: 594  DTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
            D     +    G T      S+        G       LAS   DNTV++W +
Sbjct: 919  DVTEPGEGSGGGTTLAGHTDSVVSLTFSQDG-----DTLASGANDNTVRLWSV 966



>gb:AX765828_1474603 Sequence 37 from Patent
            WO03008440.>gb:AC004747_1532138 Arabidopsis thaliana
            chromosome 2 clone T19L18 map B68, complete
            sequence.>gb:AY085277_1570349 Arabidopsis thaliana clone
            142426 mRNA, complete sequence.>gb:AY093154_1575108
            Arabidopsis thaliana unknown protein (At2g26060) mRNA,
            complete cds.>gb:BT003394_1636817 Arabidopsis thaliana
            unknown protein (At2g26060) mRNA, complete cds.
          Length = 352

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 66/247 (26%), Positives = 108/247 (43%), Gaps = 12/247 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSW----AHPKFGS-LLASCSFDGKVIVWKEGN-QNEWTQAHVFND-HKS 485
            L GH   VW V+W    +H    S +LASCS D  V +W++ +    WT   V  + H  
Sbjct: 16   LEGHTDRVWSVAWNPVSSHADGVSPILASCSGDNTVRIWEQSSLSRSWTCKTVLEETHTR 75

Query: 486  SVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAP 665
            +V S +W+P   G  LA  S DG   ++       ++     + H   V +VSW  S   
Sbjct: 76   TVRSCAWSPS--GQLLATASFDGTTGIW-KNYGSEFECISTLEGHENEVKSVSWNAS--- 129

Query: 666  GALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
                GS        LA+   D +V +W++  G  + DC   L  HT  V+ V W P +  
Sbjct: 130  ----GS-------CLATCSRDKSVWIWEVLEGN-EYDCAAVLTGHTQDVKMVQWHPTM-- 175

Query: 846  PKSTIASASEDGKVVIWTVAKEGDQWE-----GKVLYDFNTPVWRVSWSLTGNLLAVASG 1010
                + S S D  + +W    +  +++     G+     ++ VW +S++  G+ +   S 
Sbjct: 176  --DVLFSCSYDNTIKVWWSEDDDGEYQCVQTLGESNNGHSSTVWSISFNAAGDKMVTCSD 233

Query: 1011 DNNVTLW 1031
            D  + +W
Sbjct: 234  DLTLKIW 240



 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 78/295 (26%), Positives = 114/295 (38%), Gaps = 56/295 (18%)
 Frame = +3

Query: 189 IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH--LATLAGHHGPVWQVS 362
           +E  H+ TV   +    G+ +ATAS D +    G+  N  S+   ++TL GH   V  VS
Sbjct: 69  LEETHTRTVRSCAWSPSGQLLATASFDGTT---GIWKNYGSEFECISTLEGHENEVKSVS 125

Query: 363 WAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACG 542
           W     GS LA+CS D  V +W+    NE+  A V   H   V  + W P  + +  +C 
Sbjct: 126 WNAS--GSCLATCSRDKSVWIWEVLEGNEYDCAAVLTGHTQDVKMVQWHP-TMDVLFSC- 181

Query: 543 SSDGNISVYTARSDGG-----WDTARIDQAHPIGVTAVS-------------------WA 650
           S D  I V+ +  D G           +  H   V ++S                   W 
Sbjct: 182 SYDNTIKVWWSEDDDGEYQCVQTLGESNNGHSSTVWSISFNAAGDKMVTCSDDLTLKIWG 241

Query: 651 PSMAP-----------GALVGSGLHDPV---------QKLASAGCDNTVKVW-------- 746
             +A                 SG HD             +AS   DN ++++        
Sbjct: 242 TDIAKMQSGEEYAPWIHLCTLSGYHDRTIYSAHWSRDDIIASGAGDNAIRLFVDSKHDSV 301

Query: 747 --KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
               YN + K +     + H N V  V W+P  G     +ASAS+DG V IW +A
Sbjct: 302 DGPSYNLLLKKN-----KAHENDVNSVQWSPGEG--NRLLASASDDGMVKIWQLA 349



 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 48/148 (32%), Positives = 69/148 (46%), Gaps = 2/148 (1%)
 Frame = +3

Query: 612  QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPAL 791
            + H   V +V+W P       V S        LAS   DNTV++W+  +      C   L
Sbjct: 17   EGHTDRVWSVAWNP-------VSSHADGVSPILASCSGDNTVRIWEQSSLSRSWTCKTVL 69

Query: 792  Q-MHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG-KVLYDFNTPVWR 965
            +  HT  VR  AW+P+  L    +A+AS DG   IW     G ++E    L      V  
Sbjct: 70   EETHTRTVRSCAWSPSGQL----LATASFDGTTGIWK--NYGSEFECISTLEGHENEVKS 123

Query: 966  VSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
            VSW+ +G+ LA  S D +V +W E ++G
Sbjct: 124  VSWNASGSCLATCSRDKSVWIW-EVLEG 150



>pir|AH2195|AH2195 hypothetical protein alr3119 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_684108 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 676

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 74/280 (26%), Positives = 121/280 (43%), Gaps = 1/280 (0%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V+ V+    G+ +A+ S D +IK+  + N    Q + TL GH G VW ++++   
Sbjct: 389  GHASDVNSVAFSPNGEFLASGSDDKTIKVWNLKNK---QKIHTLPGHSGWVWAIAFSPD- 444

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  LAS   D  + +W   N     +      H   V S++++P   G  LA GS D  
Sbjct: 445  -GKTLASTGADKTIKLW---NLATGKEIRHLKGHSQGVASVAFSPD--GKTLASGSLDKT 498

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++   +       R  Q H  GV  V+++P                + LAS   D T+
Sbjct: 499  IKLWNPATG---KEIRTLQEHSSGVANVAFSPD--------------GKTLASGSWDKTI 541

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W L            L+ H++ V  VA+  +      T+AS S+D  + +W ++    
Sbjct: 542  KLWNLTTS----KVIHTLKGHSDLVMSVAFNSD----SQTLASGSKDKTIKLWNLSTGKT 593

Query: 918  QWEGKVLYDFNTPVWRVSW-SLTGNLLAVASGDNNVTLWN 1034
                + L   +  V  V++      +LA  S DN + LWN
Sbjct: 594  I---RTLRGHSDKVNSVAYVPRDSTVLASGSNDNTIKLWN 630



 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 58/236 (24%), Positives = 101/236 (42%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHS  V  V+    GK +A+ S D +IK+    N +T + + TL  H   V  V+++   
Sbjct: 473  GHSQGVASVAFSPDGKTLASGSLDKTIKLW---NPATGKEIRTLQEHSSGVANVAFSPD- 528

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  LAS S+D  + +W   N       H    H   V S+++  +     LA GS D  
Sbjct: 529  -GKTLASGSWDKTIKLW---NLTTSKVIHTLKGHSDLVMSVAF--NSDSQTLASGSKDKT 582

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++   +     T R  + H   V +V++ P  +               LAS   DNT+
Sbjct: 583  IKLWNLSTG---KTIRTLRGHSDKVNSVAYVPRDST-------------VLASGSNDNTI 626

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            K+W L  G    +    L+  + ++  +  +P+    ++  +  S +  + IW ++
Sbjct: 627  KLWNLTTG----EIIRTLKRDSGYIYSIVISPD---GRNLASGGSAENIIKIWPMS 675



 Score = 38.1 bits (87), Expect = 0.33
 Identities = 25/88 (28%), Positives = 42/88 (47%)
 Frame = +3

Query: 789  LQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRV 968
            L+ H + V  VA++PN       +AS S+D  + +W +    ++ +   L   +  VW +
Sbjct: 387  LKGHASDVNSVAFSPN----GEFLASGSDDKTIKVWNLK---NKQKIHTLPGHSGWVWAI 439

Query: 969  SWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            ++S  G  LA    D  + LWN A   E
Sbjct: 440  AFSPDGKTLASTGADKTIKLWNLATGKE 467



>gb:AB007645_1510148 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K8K14.>gb:AY057698_1564110 Arabidopsis thaliana
            AT5g67320/K8K14_4 mRNA, complete cds.>gb:AY143932_1583389
            Arabidopsis thaliana At5g67320/K8K14_4 mRNA, complete
            cds.
          Length = 613

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 74/273 (27%), Positives = 117/273 (42%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I  ++     + ++TL+ H GP++ + W   K G  L + S D   
Sbjct: 336  GTLLATGSCDGQARIWTLNG----ELISTLSKHKGPIFSLKWN--KKGDYLLTGSVDRTA 389

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            +VW +    EW Q   F  H      + W  +   +  A  S+D  I +      G    
Sbjct: 390  VVW-DVKAEEWKQQFEF--HSGPTLDVDWRNN---VSFATSSTDSMIYLCKI---GETRP 440

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
            A+    H   V  V W P+   G+L           LAS   D+T K+W +    +  D 
Sbjct: 441  AKTFTGHQGEVNCVKWDPT---GSL-----------LASCSDDSTAKIWNIKQSTFVHD- 485

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               L+ HT  +  + W+P     N    + T+ASAS D  V +W      D   GK+L  
Sbjct: 486  ---LREHTKEIYTIRWSPTGPGTNNPNKQLTLASASFDSTVKLW------DAELGKMLCS 536

Query: 945  FN---TPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            FN    PV+ +++S  G  +A  S D ++ +W+
Sbjct: 537  FNGHREPVYSLAFSPNGEYIASGSLDKSIHIWS 569



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 38/161 (23%), Positives = 62/161 (38%), Gaps = 10/161 (6%)
 Frame = +3

Query: 603  RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKM--- 773
            RI + H   V A +W+PS +               LAS   D T ++W +  G +K    
Sbjct: 259  RILEGHTSEVCACAWSPSAS--------------LLASGSGDATARIWSIPEGSFKAVHT 304

Query: 774  --DCFPALQMHTNWV-----RDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGK 932
              +    +  H         +DV      G   + +A+ S DG+  IWT+  E       
Sbjct: 305  GRNINALILKHAKGKSNEKSKDVTTLDWNG-EGTLLATGSCDGQARIWTLNGELIS---- 359

Query: 933  VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
             L     P++ + W+  G+ L   S D    +W+   + EW
Sbjct: 360  TLSKHKGPIFSLKWNKKGDYLLTGSVDRTAVVWDVKAE-EW 399



>gb:AF323585_1786295 Podospora anserina beta transducin-like protein
            HET-D2Y (het-d) gene, het-d2Y allele, complete cds.
          Length = 1376

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 75/281 (26%), Positives = 117/281 (41%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   V+ V+     K VA+ S D +IKI   +  S +Q   TL GH G  W  S A   
Sbjct: 1039 GHGGPVNSVTFSPDSKWVASGSDDHTIKIWEAATGSCTQ---TLEGHGG--WVYSVAFSP 1093

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
                + S S D  + +W E      TQ      H  SVNS++++P      +A GS+D  
Sbjct: 1094 DSKWVVSGSADSTIKIW-EAATGSCTQ--TLEGHGGSVNSVAFSPD--SKWVASGSTDRT 1148

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++ A +     T         G    +W+ + +P +          + +AS   D+T+
Sbjct: 1149 IKIWEAATGSCTQTLE-------GHGGWAWSVAFSPDS----------KWVASGSADSTI 1191

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W+   G     C   L+ H   V  VA++P+       +AS S+D  + IW  A    
Sbjct: 1192 KIWEAATG----SCTQTLEGHGGPVNSVAFSPD----SKWVASGSDDHTIKIWEAATGSC 1243

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                + L      V  V++S     +A  S D  + +W  A
Sbjct: 1244 T---QTLEGHGRSVKSVAFSPDSKWVASGSTDRTIKIWEAA 1281



 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 75/281 (26%), Positives = 121/281 (43%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHS +V+ V+     K VA+   D++IKI   +  S +Q   TL GH G  W +S A   
Sbjct: 829  GHSGSVNSVTFSPDSKWVASGLDDSTIKIWEAATGSCTQ---TLEGHGG--WVLSVAFSP 883

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
                +AS S D  + +W E      TQ      H   V S++++P      +  GS+D  
Sbjct: 884  DSKWVASGSADSTIKIW-EAATGSCTQ--TLEGHGGWVYSVAFSPD--SKWVVSGSADST 938

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++ A +     T    + H   V +V+++P                + +AS   D+T+
Sbjct: 939  IKIWEAATGSCTQTL---EGHGGWVWSVAFSPDS--------------KWVASGSADSTI 981

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W+   G     C   L+ H   V  VA++P+       +AS S+D  + IW  A    
Sbjct: 982  KIWEAATG----SCTQTLEGHGGPVNSVAFSPD----SKWVASGSDDHTIKIWEAATGSC 1033

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                + L     PV  V++S     +A  S D+ + +W  A
Sbjct: 1034 T---QTLEGHGGPVNSVTFSPDSKWVASGSDDHTIKIWEAA 1071



 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 82/310 (26%), Positives = 132/310 (42%)
 Frame = +3

Query: 90   LT*SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSD 269
            +T S D +  +    DHT I+  +       Q +E GH   V+ V+     K V + S+D
Sbjct: 1047 VTFSPDSKWVASGSDDHT-IKIWEAATGSCTQTLE-GHGGWVYSVAFSPDSKWVVSGSAD 1104

Query: 270  ASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNE 449
            ++IKI   +  S +Q   TL GH G V  V+++       +AS S D  + +W E     
Sbjct: 1105 STIKIWEAATGSCTQ---TLEGHGGSVNSVAFSPD--SKWVASGSTDRTIKIW-EAATGS 1158

Query: 450  WTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIG 629
             TQ      H     S++++P      +A GS+D  I ++ A +     T    + H   
Sbjct: 1159 CTQ--TLEGHGGWAWSVAFSPD--SKWVASGSADSTIKIWEAATGSCTQTL---EGHGGP 1211

Query: 630  VTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNW 809
            V +V+++P                + +AS   D+T+K+W+   G     C   L+ H   
Sbjct: 1212 VNSVAFSPDS--------------KWVASGSDDHTIKIWEAATG----SCTQTLEGHGRS 1253

Query: 810  VRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGN 989
            V+ VA++P+       +AS S D  + IW  A        + L      V  V+ SL   
Sbjct: 1254 VKSVAFSPD----SKWVASGSTDRTIKIWEAATGSCT---QTLEGHGGSVKSVASSLDSK 1306

Query: 990  LLAVASGDNN 1019
            L+A  S D N
Sbjct: 1307 LIASGSNDTN 1316



>gb:AE017347_1757920 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 435

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 72/243 (29%), Positives = 103/243 (42%), Gaps = 27/243 (11%)
 Frame = +3

Query: 249 VATASSDASI---KIIGVSNNSTS-QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGK 416
           + +AS D +I    I G S    S Q L    GH   V  V W HPK  ++  S S DG+
Sbjct: 206 ILSASEDTTIGHWDIQGYSKQDPSLQPLRLYTGHSAYVADVEW-HPKNENMFGSVSDDGQ 264

Query: 417 VIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWD 596
           +++W   + N    +     H + +N IS+AP    L L  GSSD  I++        WD
Sbjct: 265 IMIWDTRSDNTAKASSQVQGHNAEINCISFAPSSEYLFLT-GSSDNTIAL--------WD 315

Query: 597 TARID------QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYN 758
             ++       +AH   V  +SW+P+        S +H      ASA  D  V +W L  
Sbjct: 316 LRKLSTKHHSFEAHTNDVLQLSWSPT--------SPVH-----FASASADRRVHIWDL-- 360

Query: 759 GVWKMDCFPALQM-----------------HTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
                D   A Q                  HT+ V D++W+P+      TIASASED  +
Sbjct: 361 -----DAIGAEQTPDDAEDGPPELLFVHGGHTSKVCDISWSPS---SPWTIASASEDNIL 412

Query: 888 VIW 896
            +W
Sbjct: 413 QVW 415



 Score = 43.1 bits (100), Expect = 0.010
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 7/116 (6%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQM------HTNWVRDVAWAPNLGLPKSTIASA 869
            + SA  D T+  W +  G  K D  P+LQ       H+ +V DV W P     ++   S 
Sbjct: 206  ILSASEDTTIGHWDI-QGYSKQD--PSLQPLRLYTGHSAYVADVEWHPK---NENMFGSV 259

Query: 870  SEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGN-LLAVASGDNNVTLWN 1034
            S+DG+++IW    +        +   N  +  +S++ +   L    S DN + LW+
Sbjct: 260  SDDGQIMIWDTRSDNTAKASSQVQGHNAEINCISFAPSSEYLFLTGSSDNTIALWD 315



>pir|T02617|T02617 hypothetical protein At2g26060 [imported] -
            Arabidopsis thaliana
          Length = 323

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 65/246 (26%), Positives = 107/246 (43%), Gaps = 11/246 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSW----AHPKFGS-LLASCSFDGKVIVWKEGN-QNEWTQAHVFNDHKSS 488
            L GH   VW V+W    +H    S +LASCS D  V +W++ +    WT       H  +
Sbjct: 13   LEGHTDRVWSVAWNPVSSHADGVSPILASCSGDNTVRIWEQSSLSRSWT----CKTHTRT 68

Query: 489  VNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPG 668
            V S +W+P   G  LA  S DG   ++       ++     + H   V +VSW  S    
Sbjct: 69   VRSCAWSPS--GQLLATASFDGTTGIWK-NYGSEFECISTLEGHENEVKSVSWNAS---- 121

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
               GS L       A+   D +V +W++  G  + DC   L  HT  V+ V W P + + 
Sbjct: 122  ---GSCL-------ATCSRDKSVWIWEVLEGN-EYDCAAVLTGHTQDVKMVQWHPTMDV- 169

Query: 849  KSTIASASEDGKVVIWTVAKEGDQWE-----GKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
               + S S D  + +W    +  +++     G+     ++ VW +S++  G+ +   S D
Sbjct: 170  ---LFSCSYDNTIKVWWSEDDDGEYQCVQTLGESNNGHSSTVWSISFNAAGDKMVTCSDD 226

Query: 1014 NNVTLW 1031
              + +W
Sbjct: 227  LTLKIW 232



 Score = 70.9 bits (172), Expect = 5e-11
 Identities = 75/270 (27%), Positives = 113/270 (41%), Gaps = 35/270 (12%)
 Frame = +3

Query: 201 HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH--LATLAGHHGPVWQVSWAHP 374
           H+ TV   +    G+ +ATAS D +    G+  N  S+   ++TL GH   V  VSW   
Sbjct: 65  HTRTVRSCAWSPSGQLLATASFDGTT---GIWKNYGSEFECISTLEGHENEVKSVSWNAS 121

Query: 375 KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
             GS LA+CS D  V +W+    NE+  A V   H   V  + W P  + +  +C S D 
Sbjct: 122 --GSCLATCSRDKSVWIWEVLEGNEYDCAAVLTGHTQDVKMVQWHP-TMDVLFSC-SYDN 177

Query: 555 NISVYTARSDGG-WDTARIDQAHPIGVTAVSWAPSM-APGALVGSGLHDPVQK------- 707
            I V+ +  D G +   +       G ++  W+ S  A G  + +   D   K       
Sbjct: 178 TIKVWWSEDDDGEYQCVQTLGESNNGHSSTVWSISFNAAGDKMVTCSDDLTLKIWGTDIA 237

Query: 708 --------------LASAGCDNTVKVW----------KLYNGVWKMDCFPALQMHTNWVR 815
                         +AS   DN ++++            YN + K +     + H N V 
Sbjct: 238 KMQSGEEYAPWDDIIASGAGDNAIRLFVDSKHDSVDGPSYNLLLKKN-----KAHENDVN 292

Query: 816 DVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            V W+P  G     +ASAS+DG V IW +A
Sbjct: 293 SVQWSPGEG--NRLLASASDDGMVKIWQLA 320



 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 60/211 (28%), Positives = 91/211 (43%), Gaps = 8/211 (3%)
 Frame = +3

Query: 447  EWTQAHVFNDHKSSVNSISWAP---HELGLC--LACGSSDGNISVYTARS-DGGWDTARI 608
            E  +      H   V S++W P   H  G+   LA  S D  + ++   S    W     
Sbjct: 6    ELVEIQKLEGHTDRVWSVAWNPVSSHADGVSPILASCSGDNTVRIWEQSSLSRSWTC--- 62

Query: 609  DQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPA 788
             + H   V + +W+PS               Q LA+A  D T  +WK Y    + +C   
Sbjct: 63   -KTHTRTVRSCAWSPSG--------------QLLATASFDGTTGIWKNYGS--EFECIST 105

Query: 789  LQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWE-GKVLYDFNTPVWR 965
            L+ H N V+ V+W  +     S +A+ S D  V IW V  EG++++   VL      V  
Sbjct: 106  LEGHENEVKSVSWNAS----GSCLATCSRDKSVWIWEVL-EGNEYDCAAVLTGHTQDVKM 160

Query: 966  VSWSLTGNLLAVASGDNNVTL-WNEAVDGEW 1055
            V W  T ++L   S DN + + W+E  DGE+
Sbjct: 161  VQWHPTMDVLFSCSYDNTIKVWWSEDDDGEY 191



>pir|AC1842|AC1842 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681275 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1747

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 79/297 (26%), Positives = 129/297 (43%), Gaps = 3/297 (1%)
 Frame = +3

Query: 153  SSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLA 332
            SSDK  ++     +      V+ VS +  GK  A+A  D +I I      + S  L+T+ 
Sbjct: 1415 SSDKTVRIRQLNYQKSQKSNVNSVSFNPDGKTFASAGWDGNITIWQRETLAHSS-LSTIQ 1473

Query: 333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP 512
             +   +  VS++    G  +A+ S D  + +W    Q           HK  + ++S+ P
Sbjct: 1474 KNQNIITTVSYSPD--GKTIATASADNTIKLWDSQTQQ---LIKTLTGHKDRITTLSFHP 1528

Query: 513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLH 692
                  +A GS+D  I ++   +DG     R    H   VT+V+++P             
Sbjct: 1529 DNQ--TIASGSADKTIKIWRV-NDG--QLLRTLTGHNDEVTSVNFSPDG----------- 1572

Query: 693  DPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASAS 872
               Q LAS   DNTVK+W+    + K      +  H   +  V ++P+      T+ASAS
Sbjct: 1573 ---QFLASGSTDNTVKIWQTDGRLIKN-----ITGHGLAIASVKFSPD----SHTLASAS 1620

Query: 873  EDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             D  + +W V       +GK++ + N     V  +S+S  G +LA  S DN + LWN
Sbjct: 1621 WDNTIKLWQVT------DGKLINNLNGHIDGVTSLSFSPDGEILASGSADNTIKLWN 1671



 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 66/239 (27%), Positives = 105/239 (43%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            K  TGH D +  +S     + +A+ S+D +IKI  V++    Q L TL GH+  V  V++
Sbjct: 1512 KTLTGHKDRITTLSFHPDNQTIASGSADKTIKIWRVNDG---QLLRTLTGHNDEVTSVNF 1568

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            +    G  LAS S D  V +W    Q +         H  ++ S+ ++P      LA  S
Sbjct: 1569 SPD--GQFLASGSTDNTVKIW----QTDGRLIKNITGHGLAIASVKFSPDSH--TLASAS 1620

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
             D  I ++   +DG          H  GVT++S++P                + LAS   
Sbjct: 1621 WDNTIKLWQV-TDG--KLINNLNGHIDGVTSLSFSPDG--------------EILASGSA 1663

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
            DNT+K+W L N          L  H   +  +A++P+      T+ S  ED  V++W +
Sbjct: 1664 DNTIKLWNLPNAT----LLKTLLGHPGKINTLAFSPD----GKTLLSGGEDAGVMVWNL 1714



 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 72/278 (25%), Positives = 120/278 (43%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D V DV      K + ++S D +IK+  +  +  +    T   H+G V  +S++   
Sbjct: 1229 GHTDIVTDVVFSPDSKTIVSSSLDKTIKLWRIDGSIIN----TWNAHNGWVNSISFSPD- 1283

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G ++AS   D  V +W+  N +          HK  + S+ ++P   G  LA  S D  
Sbjct: 1284 -GKMIASGGEDNLVKLWQATNGH---LIKTLTGHKERITSVKFSPD--GKILASASGDKT 1337

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I  +   +DG +   +   AH   V +++++                 + L SAG D+T+
Sbjct: 1338 IKFWN--TDGKF--LKTIAAHNQQVNSINFSSDS--------------KTLVSAGADSTM 1379

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            KVWK+   + K      +      +RDV ++P+       IASAS D  V I  +  +  
Sbjct: 1380 KVWKIDGTLIK-----TISGRGEQIRDVTFSPD----NKVIASASSDKTVRIRQLNYQKS 1430

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            Q          + V  VS++  G   A A  D N+T+W
Sbjct: 1431 Q---------KSNVNSVSFNPDGKTFASAGWDGNITIW 1459



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 67/274 (24%), Positives = 110/274 (40%), Gaps = 3/274 (1%)
 Frame = +3

Query: 243  KRVATASSDASIKIIGVSNNS--TSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGK 416
            K+V     D  I  +     +   +Q +  L GH   V  VS++    G +LAS S D  
Sbjct: 1103 KQVFAPERDIQIATVATFQQAIANTQEINRLQGHAQQVNAVSFSPD--GKVLASASDDRT 1160

Query: 417  VIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWD 596
            V +W    Q   T        +  V +I+++ +  G  LA  ++D  I +Y   +     
Sbjct: 1161 VKLWDIHGQLITT----ITASQKRVTAIAFSHN--GKYLATANADYTIKLYALDT----- 1209

Query: 597  TARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK-LASAGCDNTVKVWKLYNGVWKM 773
            +  I       +  +   P      +V   +  P  K + S+  D T+K+W++   +   
Sbjct: 1210 SCLIVNNLQKCIQLIKTFPGHTD--IVTDVVFSPDSKTIVSSSLDKTIKLWRIDGSI--- 1264

Query: 774  DCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNT 953
                    H  WV  ++++P+       IAS  ED  V +W  A  G     K L     
Sbjct: 1265 --INTWNAHNGWVNSISFSPD----GKMIASGGEDNLVKLWQ-ATNGHLI--KTLTGHKE 1315

Query: 954  PVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
             +  V +S  G +LA ASGD  +  WN   DG++
Sbjct: 1316 RITSVKFSPDGKILASASGDKTIKFWN--TDGKF 1347



>gb:BA000045_742730 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1193

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 87/358 (24%), Positives = 141/358 (39%), Gaps = 47/358 (13%)
 Frame = +3

Query: 108  PRLHSLFQGDHTFIRSSDKEGKMPAQKIETG--------HSDTVHDVSMDYYGKRVATAS 263
            P L  LF  D T + S   +  +    + TG        H + V  +++   G R+A+ S
Sbjct: 792  PTLSVLFIDDTT-VASGSTDRSIRFWDVATGRCTRLIAAHDNNVMALALSPCGTRLASGS 850

Query: 264  SDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ 443
             D +I++  VS   T + L T+ G     W  S      G  +A+      V++W     
Sbjct: 851  DDQAIRLWEVS---TGRLLRTICGRIN--WLTSGTFSPDGRFVAAGGEYDLVLLWDRIAD 905

Query: 444  NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHP 623
             +W        H  +V ++ ++P    L  A  S+DG I +++  S        I + H 
Sbjct: 906  RQWRLV----GHTGAVGAVVFSPDREHL--ASASADGTIRLWSLTSHR---QVAIFEGHT 956

Query: 624  IGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNG-------------- 761
              +  ++++P    GAL           L S G D+ V+VW++  G              
Sbjct: 957  AAIRGLAFSPD---GAL-----------LVSCGYDSGVRVWQVSTGHLLRSGGEQLVDSV 1002

Query: 762  -------------------VWKMDCFPALQM---HTNWVRDVAWAPNLGLPKSTIASASE 875
                               +W ++ F  LQ+   H  W   VA++P+  +    +AS S 
Sbjct: 1003 AVASDGKRLAVGLIDDRAEIWDLETFEKLQIFPGHREWAWQVAFSPDGRI----LASGSH 1058

Query: 876  DGKVVIWTVAKEGDQWEGKVLYDFNTP---VWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            DG V +W      D  EGK+L+        VWRV++S  G  LA A  D    +W  A
Sbjct: 1059 DGTVRLW------DSAEGKLLHTLEAHRGWVWRVAFSPDGQFLASAGTDAKAAVWEVA 1110



 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 57/251 (22%), Positives = 99/251 (39%), Gaps = 38/251 (15%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V  V      + +A+AS+D +I++  ++++   + +A   GH   +  ++++   
Sbjct: 912  GHTGAVGAVVFSPDREHLASASADGTIRLWSLTSH---RQVAIFEGHTAAIRGLAFSPD- 967

Query: 378  FGSLLASCSFDGKVIVWKE---------GNQ----------------------------N 446
             G+LL SC +D  V VW+          G Q                             
Sbjct: 968  -GALLVSCGYDSGVRVWQVSTGHLLRSGGEQLVDSVAVASDGKRLAVGLIDDRAEIWDLE 1026

Query: 447  EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI 626
             + +  +F  H+     ++++P   G  LA GS DG + +        WD+A     H +
Sbjct: 1027 TFEKLQIFPGHREWAWQVAFSPD--GRILASGSHDGTVRL--------WDSAEGKLLHTL 1076

Query: 627  GV-TAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHT 803
                   W  + +P            Q LASAG D    VW++  G        A Q H 
Sbjct: 1077 EAHRGWVWRVAFSPDG----------QFLASAGTDAKAAVWEVATG----RRLRAWQAHN 1122

Query: 804  NWVRDVAWAPN 836
            +WV  VA++P+
Sbjct: 1123 SWVISVAFSPD 1133



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 46/173 (26%), Positives = 79/173 (45%)
 Frame = +3

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV 701
            G  LA G +DG I ++  R+DG  ++  +     +G++   +  + +P            
Sbjct: 675  GEYLASGGADGQIHLWR-RADGYGNSCVL-----VGLSRTIYGLAFSPDG---------- 718

Query: 702  QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDG 881
            + L SAG D  ++VW + + V    C   L  HT+W++ VA++P+  L    +ASA  D 
Sbjct: 719  RWLVSAGADCLLRVWDVESSV----CLRVLGGHTDWIKSVAFSPSGHL----VASAGIDR 770

Query: 882  KVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             V +W  A  G +    VL     P   V + +    +A  S D ++  W+ A
Sbjct: 771  TVRLWDPA--GGECVA-VLEGHTGPTLSVLF-IDDTTVASGSTDRSIRFWDVA 819



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 79/363 (21%), Positives = 127/363 (34%), Gaps = 47/363 (12%)
 Frame = +3

Query: 108  PRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKII 287
            PR H L  GD T        GK+   + + G      +   +     V T   D  +   
Sbjct: 586  PRGHLLACGDST--------GKIYLWQTDNGRQVACFEAQPEAVWGLVFTPKGDTLVSAA 637

Query: 288  GVSNNSTSQHLATLAG--------HHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ 443
            G   ++  Q     +G        H G +   + A    G  LAS   DG++ +W+  + 
Sbjct: 638  GRGVDAAIQFWDVESGRCLRSHKVHTGTI--PTLAISADGEYLASGGADGQIHLWRRADG 695

Query: 444  NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHP 623
              +  + V      ++  ++++P   G  L    +D  + V+   S       R+   H 
Sbjct: 696  --YGNSCVLVGLSRTIYGLAFSPD--GRWLVSAGADCLLRVWDVESSV---CLRVLGGHT 748

Query: 624  IGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHT 803
              + +V+++PS   G LV           ASAG D TV++W    G    +C   L+ HT
Sbjct: 749  DWIKSVAFSPS---GHLV-----------ASAGIDRTVRLWDPAGG----ECVAVLEGHT 790

Query: 804  NWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK------------------------- 908
                 V     L +  +T+AS S D  +  W VA                          
Sbjct: 791  GPTLSV-----LFIDDTTVASGSTDRSIRFWDVATGRCTRLIAAHDNNVMALALSPCGTR 845

Query: 909  ----EGDQ----WEGKVLYDFNTPVWRVSWSLTGNL-----LAVASGDNN-VTLWNEAVD 1046
                  DQ    WE        T   R++W  +G          A G+ + V LW+   D
Sbjct: 846  LASGSDDQAIRLWEVSTGRLLRTICGRINWLTSGTFSPDGRFVAAGGEYDLVLLWDRIAD 905

Query: 1047 GEW 1055
             +W
Sbjct: 906  RQW 908



>gb:AP004312_555846 Synechocystis sp. PCC 6803 plasmid pSYSG DNA,
            complete genome.
          Length = 1237

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 75/285 (26%), Positives = 118/285 (41%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A +   GH +TV  +  +  G  +A++S DA++++  V    T +    L  H   VW  
Sbjct: 802  APRYLNGHPETVWSLDWNPDGAWLASSSHDATVRLWDVV---TGRCRRILRSHQNWVWYA 858

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC 539
             W HP    +++    DG + +W  G             H +++ +I+ AP   G  LA 
Sbjct: 859  RW-HPHQPRIISG-GHDGTLKLWDTGTGQCLKS---LTGHMANIRAIAPAPD--GQTLAL 911

Query: 540  GSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASA 719
            G  D  + +  A S   +  A     H   ++ + W P+               + LASA
Sbjct: 912  GCDDTIVRLCGADSPPSFIHAF---GHSHLISDLCWNPTG--------------ENLASA 954

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D  ++VW+       + C   L+ HTNWV  V W P   L    +AS S D  + +W 
Sbjct: 955  SHDCNLRVWQRS----PLRCTQVLKGHTNWVWSVDWHPTQDL----LASGSVDSTIRLWY 1006

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +       K L    + +  V W  TG  LA A+GD  + LWN
Sbjct: 1007 PTQSTPV---KTLMAQTSWILSVRWHPTGRWLASAAGDFTIGLWN 1048



 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 62/233 (26%), Positives = 102/233 (43%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHS  + D+  +  G+ +A+AS D ++++   S    +Q    L GH   VW V W HP 
Sbjct: 934  GHSHLISDLCWNPTGENLASASHDCNLRVWQRSPLRCTQ---VLKGHTNWVWSVDW-HPT 989

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
               LLAS S D  + +W      + T         S + S+ W  H  G  LA  + D  
Sbjct: 990  -QDLLASGSVDSTIRLWYP---TQSTPVKTLMAQTSWILSVRW--HPTGRWLASAAGDFT 1043

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++ +++   W+   +   H   +  ++W+P+               Q LAS G DNTV
Sbjct: 1044 IGLWNSKT---WECTHLLTGHTHWIWCLAWSPNG--------------QYLASGGYDNTV 1086

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             +WK+   V  +        H   +  +AW P+  L    +A++  DG + +W
Sbjct: 1087 FIWKVEKEVTSLRTLE----HPTILSAIAWHPDGEL----LATSCHDGNIRLW 1131



 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 78/309 (25%), Positives = 121/309 (39%)
 Frame = +3

Query: 108  PRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKII 287
            P    +  G H         G     K  TGH   +  ++    G+ +A    D  +++ 
Sbjct: 862  PHQPRIISGGHDGTLKLWDTGTGQCLKSLTGHMANIRAIAPAPDGQTLALGCDDTIVRLC 921

Query: 288  GVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV 467
            G  +  +  H     GH   +  + W +P  G  LAS S D  + VW+   ++      V
Sbjct: 922  GADSPPSFIHAF---GHSHLISDLCW-NPT-GENLASASHDCNLRVWQ---RSPLRCTQV 973

Query: 468  FNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSW 647
               H + V S+ W P +    LA GS D  I ++         T     A    + +V W
Sbjct: 974  LKGHTNWVWSVDWHPTQD--LLASGSVDSTIRLWYPTQSTPVKTL---MAQTSWILSVRW 1028

Query: 648  APSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAW 827
             P+               + LASA  D T+ +W   +  W  +C   L  HT+W+  +AW
Sbjct: 1029 HPTG--------------RWLASAAGDFTIGLWN--SKTW--ECTHLLTGHTHWIWCLAW 1070

Query: 828  APNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVAS 1007
            +PN       +AS   D  V IW V KE          +  T +  ++W   G LLA + 
Sbjct: 1071 SPN----GQYLASGGYDNTVFIWKVEKEVTSLR---TLEHPTILSAIAWHPDGELLATSC 1123

Query: 1008 GDNNVTLWN 1034
             D N+ LW+
Sbjct: 1124 HDGNIRLWH 1132



 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 80/327 (24%), Positives = 121/327 (37%), Gaps = 43/327 (13%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            A  + T H+D V+ +S D     +A++SSD+++K+  V      +          PV   
Sbjct: 719  APVLVTAHTDIVNSLSWDANSNLLASSSSDSTVKLWDVETGICHRIWREAV----PVRWA 774

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC 539
            +W+    G  LA    DG +++W   N +        N H  +V S+ W P   G  LA 
Sbjct: 775  TWSPD--GHTLAISREDGGIVLW---NPHSDQAPRYLNGHPETVWSLDWNPD--GAWLAS 827

Query: 540  GSSDGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQ 704
             S D  + +        WD       RI ++H   V    W P            H P  
Sbjct: 828  SSHDATVRL--------WDVVTGRCRRILRSHQNWVWYARWHP------------HQP-- 865

Query: 705  KLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN-----LGLPKSTI--- 860
            ++ S G D T+K+W    G     C  +L  H   +R +A AP+     LG   + +   
Sbjct: 866  RIISGGHDGTLKLWDTGTG----QCLKSLTGHMANIRAIAPAPDGQTLALGCDDTIVRLC 921

Query: 861  ------------------------------ASASEDGKVVIWTVAKEGDQWEGKVLYDFN 950
                                          ASAS D  + +W   +       +VL    
Sbjct: 922  GADSPPSFIHAFGHSHLISDLCWNPTGENLASASHDCNLRVW---QRSPLRCTQVLKGHT 978

Query: 951  TPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              VW V W  T +LLA  S D+ + LW
Sbjct: 979  NWVWSVDWHPTQDLLASGSVDSTIRLW 1005



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 34/116 (29%), Positives = 50/116 (43%), Gaps = 3/116 (2%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPAL-QMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
            LA  G D  +++W  +      +  P L   HT+ V  ++W  N  L    +AS+S D  
Sbjct: 700  LAIGGIDGHIRLWYPFT-----EQAPVLVTAHTDIVNSLSWDANSNL----LASSSSDST 750

Query: 885  VVIWTVAKEGDQ--WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVD 1046
            V +W V        W   V      PV   +WS  G+ LA++  D  + LWN   D
Sbjct: 751  VKLWDVETGICHRIWREAV------PVRWATWSPDGHTLAISREDGGIVLWNPHSD 800



>sp|Q95RJ9|EBI_DROME F-box-like/WD-repeat protein
            ebi.>gb:AE014134_1126862 Drosophila melanogaster
            chromosome 2L, complete sequence.>gb:AE003589_1216743
            Drosophila melanogaster chromosome 2L, section 2 of 83 of
            the complete sequence.>gb:AF146345_1244815 Drosophila
            melanogaster Ebi mRNA, complete cds.
          Length = 700

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 72/278 (25%), Positives = 116/278 (41%), Gaps = 4/278 (1%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
            H   +  +  +  G  + +A  D +  I   S    +Q  A    H  P   V W   + 
Sbjct: 450  HKGPIFALKWNKCGNYILSAGVDKTTIIWDASTGQCTQQFAF---HSAPALDVDW---QT 503

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
                ASCS D ++ V + G  NE      F  H + VN+I W P   G  LA  S D  +
Sbjct: 504  NQAFASCSTDQRIHVCRLG-VNE--PIKTFKGHTNEVNAIKWCPQ--GQLLASCSDDMTL 558

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL--ASAGCDNT 734
             +++   D         QAH   +  + W+P+       G G ++P   L  ASA  D+T
Sbjct: 559  KIWSMNRDRCCHDL---QAHSKEIYTIKWSPT-------GPGTNNPNTNLILASASFDST 608

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            V++W +  G     C   L  HT  V  VA++P+       +AS S D  V IW+     
Sbjct: 609  VRLWDVERG----SCIHTLTKHTEPVYSVAFSPD----GKHLASGSFDKCVHIWSTQ--- 657

Query: 915  DQWEGKVLYDFNTP--VWRVSWSLTGNLLAVASGDNNV 1022
                G++++ +     ++ V W+  G  +  ++ D +V
Sbjct: 658  ---TGQLVHSYKGTGGIFEVCWNSKGTKVGASASDGSV 692



 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 70/270 (25%), Positives = 105/270 (38%), Gaps = 5/270 (1%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I        S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 422  GSLLATGSYDGYARIWKTDGRLAS----TLGQHKGPIFALKWN--KCGNYILSAGVDKTT 475

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  + TQ   F  H +    + W  ++     A  S+D  I V      G  + 
Sbjct: 476  IIW-DASTGQCTQQFAF--HSAPALDVDWQTNQ---AFASCSTDQRIHVCRL---GVNEP 526

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
             +  + H   V A+ W P                Q LAS   D T+K+W +        C
Sbjct: 527  IKTFKGHTNEVNAIKWCPQG--------------QLLASCSDDMTLKIWSMNRD----RC 568

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H+  +  + W+P     N       +ASAS D  V +W V +         L  
Sbjct: 569  CHDLQAHSKEIYTIKWSPTGPGTNNPNTNLILASASFDSTVRLWDVERGSCI---HTLTK 625

Query: 945  FNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               PV+ V++S  G  LA  S D  V +W+
Sbjct: 626  HTEPVYSVAFSPDGKHLASGSFDKCVHIWS 655



>pir|AE1861|AE1861 serine/threonine kinase with WD-40 repeat
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_681430 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 677

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 69/236 (29%), Positives = 103/236 (43%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGHSD VH +++   GK + + S D ++K   V N +T + + TL GH    W  S A  
Sbjct: 475  TGHSDAVHTLAISPNGKTLVSGSDDNTVK---VWNLNTGRLINTLTGH--TFWVRSVAIS 529

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G  +AS SFD  V +W   N    T  H    +  +V SI++ P   G  LA  S D 
Sbjct: 530  PDGVNIASGSFDKTVKIW---NLETGTLTHTLAGNGETVTSIAFNPD--GNTLASASRDR 584

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
             I ++     G     R  +     +T+++++P                  LASA  D T
Sbjct: 585  TIKIWKV---GAGTRVRTLKGSTETITSIAFSPD--------------GNTLASASRDQT 627

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
            +K+W L  G         L+ H N V  VA+ P+     + + S S D  + IW +
Sbjct: 628  IKLWNLETG----KEIRTLEGHENTVTTVAFTPD----GANLVSGSGDNTMRIWRI 675



 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 74/283 (26%), Positives = 116/283 (40%), Gaps = 5/283 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHS  V+ V     GK + +   D +IKI    N  T + + T+ GH   V  +  A   
Sbjct: 434  GHSRKVNAVVFSPDGKTLVSGGDDNTIKIW---NLKTGKVIRTITGHSDAVHTL--AISP 488

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  L S S D  V VW   N N     +    H   V S++ +P   G+ +A GS D  
Sbjct: 489  NGKTLVSGSDDNTVKVW---NLNTGRLINTLTGHTFWVRSVAISPD--GVNIASGSFDKT 543

Query: 558  ISVYTARSDGGWDTARIDQAHPIG-----VTAVSWAPSMAPGALVGSGLHDPVQKLASAG 722
            + +        W+       H +      VT++++ P                  LASA 
Sbjct: 544  VKI--------WNLETGTLTHTLAGNGETVTSIAFNPDG--------------NTLASAS 581

Query: 723  CDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
             D T+K+WK+  G         L+  T  +  +A++P+     +T+ASAS D  + +W +
Sbjct: 582  RDRTIKIWKVGAGTRVR----TLKGSTETITSIAFSPD----GNTLASASRDQTIKLWNL 633

Query: 903  AKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                   E + L      V  V+++  G  L   SGDN + +W
Sbjct: 634  ETGK---EIRTLEGHENTVTTVAFTPDGANLVSGSGDNTMRIW 673



 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 61/225 (27%), Positives = 91/225 (40%)
 Frame = +3

Query: 357  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA 536
            VS A    G ++ASC  D  + +W+     + +       H   VN++ ++P   G  L 
Sbjct: 398  VSLAISPNGQIIASCGSDRTIKIWQLATGEDISS---LKGHSRKVNAVVFSPD--GKTLV 452

Query: 537  CGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLAS 716
             G  D  I ++  ++       R    H   V  ++ +P+               + L S
Sbjct: 453  SGGDDNTIKIWNLKTG---KVIRTITGHSDAVHTLAISPN--------------GKTLVS 495

Query: 717  AGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
               DNTVKVW L  G         L  HT WVR VA +P+       IAS S D  V IW
Sbjct: 496  GSDDNTVKVWNLNTG----RLINTLTGHTFWVRSVAISPD----GVNIASGSFDKTVKIW 547

Query: 897  TVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
             + + G       L      V  ++++  GN LA AS D  + +W
Sbjct: 548  NL-ETGTLTH--TLAGNGETVTSIAFNPDGNTLASASRDRTIKIW 589



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 35/125 (28%), Positives = 56/125 (44%), Gaps = 3/125 (2%)
 Frame = +3

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
            A V   +    Q +AS G D T+K+W+L  G    +   +L+ H+  V  V ++P+    
Sbjct: 396  AFVSLAISPNGQIIASCGSDRTIKIWQLATG----EDISSLKGHSRKVNAVVFSPD---- 447

Query: 849  KSTIASASEDGKVVIWTVAKEGDQWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNN 1019
              T+ S  +D  + IW +        GKV+      +  V  ++ S  G  L   S DN 
Sbjct: 448  GKTLVSGGDDNTIKIWNLK------TGKVIRTITGHSDAVHTLAISPNGKTLVSGSDDNT 501

Query: 1020 VTLWN 1034
            V +WN
Sbjct: 502  VKVWN 506



>gb:AY339886_1320854 Crassostrea gigas WD40 protein Ciao1-like protein
            mRNA, partial cds.
          Length = 188

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 60/213 (28%), Positives = 101/213 (47%), Gaps = 3/213 (1%)
 Frame = +3

Query: 384  SLLASCSFDGKVIVW-KEGNQNEWTQAHVFND-HKSSVNSISWAPHELGLCLACGSSDGN 557
            SLLASC  D  + +W KEG++  W    +  + H+ ++ S+ W+P   G  LA  S D  
Sbjct: 1    SLLASCGGDKTIRIWGKEGDK--WVCKSILAEGHQRTIRSVGWSP--CGNYLASASFDAT 56

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
             +++ +R +G ++     + H   V AVSWAP+   G L           LA+   D +V
Sbjct: 57   TNIW-SRKEGEFECIASLEGHENEVKAVSWAPT---GLL-----------LATCSRDKSV 101

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
             +W++     + +C   +  HT  V+ V W P     +  +AS S D  + ++   +E D
Sbjct: 102  WIWEVTEDE-EYECASVISSHTQDVKYVVWHPT----REMLASCSYDNTIKLF--KEEID 154

Query: 918  QWE-GKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
             W     L    + VW++S+  TG+ +   S D
Sbjct: 155  DWTCCNTLESLTSTVWKISFDQTGHRIVSCSDD 187



 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 50/177 (28%), Positives = 77/177 (43%)
 Frame = +3

Query: 525  LCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQ 704
            L  +CG  D  I ++    D     + + + H   + +V W+P                 
Sbjct: 2    LLASCGG-DKTIRIWGKEGDKWVCKSILAEGHQRTIRSVGWSPCG--------------N 46

Query: 705  KLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
             LASA  D T  +W    G  + +C  +L+ H N V+ V+WAP  GL    +A+ S D  
Sbjct: 47   YLASASFDATTNIWSRKEG--EFECIASLEGHENEVKAVSWAPT-GL---LLATCSRDKS 100

Query: 885  VVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            V IW V ++ +     V+      V  V W  T  +LA  S DN + L+ E +D +W
Sbjct: 101  VWIWEVTEDEEYECASVISSHTQDVKYVVWHPTREMLASCSYDNTIKLFKEEID-DW 156



 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 51/153 (33%), Positives = 67/153 (43%), Gaps = 2/153 (1%)
 Frame = +3

Query: 132 GDHTFIRSSDKEGKMPAQK--IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNS 305
           GD T IR   KEG     K  +  GH  T+  V     G  +A+AS DA+  I       
Sbjct: 8   GDKT-IRIWGKEGDKWVCKSILAEGHQRTIRSVGWSPCGNYLASASFDATTNIWS-RKEG 65

Query: 306 TSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKS 485
             + +A+L GH   V  VSWA    G LLA+CS D  V +W+     E+  A V + H  
Sbjct: 66  EFECIASLEGHENEVKAVSWAPT--GLLLATCSRDKSVWIWEVTEDEEYECASVISSHTQ 123

Query: 486 SVNSISWAPHELGLCLACGSSDGNISVYTARSD 584
            V  + W  H     LA  S D  I ++    D
Sbjct: 124 DVKYVVW--HPTREMLASCSYDNTIKLFKEEID 154



>pir|AI2493|AI2493 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120) plasmid pCC7120alpha>gb:BA000020_686489 Nostoc
            sp. PCC 7120 plasmid pCC7120alpha DNA, complete genome.
          Length = 1189

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 79/277 (28%), Positives = 122/277 (44%), Gaps = 3/277 (1%)
 Frame = +3

Query: 213  VHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLL 392
            +  V+    G ++AT+ +   I I  V+N    + L     H+  +W V+++      +L
Sbjct: 565  ITSVAFSRDGCQLATSDTSGVINIWDVNNG---KQLFNCQEHNSWIWDVAFS--SVAPVL 619

Query: 393  ASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYT 572
            ASC  D  + +W       +   H    H S V S++++P   G  LA  S D ++ V+ 
Sbjct: 620  ASCGQDHTIKLWNTTTGECFNTLH---GHTSIVTSVAFSPE--GKLLASSSYDHSVKVWD 674

Query: 573  ARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
                   DT    Q   +G  A  W+    P   VG       Q LA+AG DNT+K+W+L
Sbjct: 675  L------DTGECLQTF-LGHDACVWSVVFHP---VG-------QILATAGEDNTIKLWEL 717

Query: 753  YNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGK 932
             +G     C   LQ H +WV+ +A+  N G     +AS S D  V +W      D   GK
Sbjct: 718  QSGC----CLKTLQGHQHWVKTIAF--NSG--GRILASGSFDQNVKLW------DIHTGK 763

Query: 933  ---VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                L      V  V+++   NLL   S D +V +W+
Sbjct: 764  CVMTLQGHTGVVTSVAFNPKDNLLLSGSYDQSVKVWD 800



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 82/328 (25%), Positives = 128/328 (39%), Gaps = 49/328 (14%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V  V+    GK +A++S D S+K+  +    T + L T  GH   VW V + HP 
Sbjct: 644  GHTSIVTSVAFSPEGKLLASSSYDHSVKVWDLD---TGECLQTFLGHDACVWSVVF-HP- 698

Query: 378  FGSLLASCSFDGKVIVWK----------EGNQNEWTQAHVFNDHKSSVNSISWAPHELGL 527
             G +LA+   D  + +W+          +G+Q+ W +   FN                G 
Sbjct: 699  VGQILATAGEDNTIKLWELQSGCCLKTLQGHQH-WVKTIAFNSG--------------GR 743

Query: 528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK 707
             LA GS D N+ ++   +     T    Q H   VT+V++ P      L+ SG +D   K
Sbjct: 744  ILASGSFDQNVKLWDIHTGKCVMTL---QGHTGVVTSVAFNPK---DNLLLSGSYDQSVK 797

Query: 708  L-------------------------------ASAGCDNTVKVWKLYNGVWKMDCFPALQ 794
            +                                S G D+  K+W+L  G     C    Q
Sbjct: 798  VWDRKTGRCLDTLKKHTNRIWSVAFHPQGHLFVSGGDDHAAKIWELGTG----QCIKTFQ 853

Query: 795  MHTNWVRDVA--WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG------KVLYDFN 950
             H+N    +A  W  +L      +AS  ED  + +W +               ++L   +
Sbjct: 854  GHSNATYTIAHNWEHSL------LASGHEDQTIKLWDLNLHSPHKSNVNTHPFRILQGHS 907

Query: 951  TPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              V+ V +S TG LLA  S D  + LW+
Sbjct: 908  NRVFSVVFSSTGQLLASGSADRTIKLWS 935



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 70/269 (26%), Positives = 117/269 (43%), Gaps = 22/269 (8%)
 Frame = +3

Query: 186  KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
            +I  GHS+ V  V     G+ +A+ S+D +IK+    +  T Q L TL GH   VW +++
Sbjct: 901  RILQGHSNRVFSVVFSSTGQLLASGSADRTIKLW---SPHTGQCLHTLHGHGSWVWAIAF 957

Query: 366  AHPKFGSLLASCSFDGKVIVW--KEGNQNEWTQAHVFN--------DHKSSVNS-----I 500
            +      LLAS S+D  V +W    G   +  Q H  +        D K+  +S     +
Sbjct: 958  SLDD--KLLASGSYDHTVKIWDVSSGQCLQTLQGHPGSVLAVAFSCDGKTLFSSGYEKLV 1015

Query: 501  SWAPHELGLCLACGSSDGNI--SVYTARSD-----GGWDTARIDQAHPIGVTAVSWAPSM 659
                 E G CL    +D N   +V  +R +     GG D+  + +   IG        S 
Sbjct: 1016 KQWDVETGYCLQTWEADSNRVWAVAVSRDNQYLATGGDDS--VVRLWDIGKGVCVRTFSG 1073

Query: 660  APGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNL 839
                ++        +++ S+  D T+K+W +  G    +C   LQ H +WV    W+  L
Sbjct: 1074 HTSQVICILFTKDGRRMISSSSDRTIKIWNVSTG----ECLATLQAHDHWV----WSLYL 1125

Query: 840  GLPKSTIASASEDGKVVIWTVAKEGDQWE 926
               + T+ S+S D  +  W ++  G+ W+
Sbjct: 1126 TPDEKTLLSSSWDETIKCWNIS-TGECWQ 1153



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 64/288 (22%), Positives = 119/288 (41%), Gaps = 9/288 (3%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVS------NNSTSQHLATLAGHHGPVWQV 359
            GHS+  + ++ ++    +A+   D +IK+  ++      +N  +     L GH   V+ V
Sbjct: 854  GHSNATYTIAHNWEHSLLASGHEDQTIKLWDLNLHSPHKSNVNTHPFRILQGHSNRVFSV 913

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC 539
             ++    G LLAS S D  + +W   + +     H  + H S V +I+++  +    LA 
Sbjct: 914  VFSST--GQLLASGSADRTIKLW---SPHTGQCLHTLHGHGSWVWAIAFSLDDK--LLAS 966

Query: 540  GSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASA 719
            GS D  + ++   S     T    Q HP  V AV+++                 + L S+
Sbjct: 967  GSYDHTVKIWDVSSGQCLQTL---QGHPGSVLAVAFSCDG--------------KTLFSS 1009

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
            G +  VK W +  G     C    +  +N V    WA  +      +A+  +D  V +W 
Sbjct: 1010 GYEKLVKQWDVETGY----CLQTWEADSNRV----WAVAVSRDNQYLATGGDDSVVRLWD 1061

Query: 900  VAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            + K      G  +  F+   + V  + ++  G  +  +S D  + +WN
Sbjct: 1062 IGK------GVCVRTFSGHTSQVICILFTKDGRRMISSSSDRTIKIWN 1103



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 82/321 (25%), Positives = 123/321 (38%), Gaps = 42/321 (13%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V  V+ +     + + S D S+K   V +  T + L TL  H   +W V++ HP+
Sbjct: 770  GHTGVVTSVAFNPKDNLLLSGSYDQSVK---VWDRKTGRCLDTLKKHTNRIWSVAF-HPQ 825

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS--WAPHELGLCLACGSSD 551
             G L  S   D    +W+ G          F  H ++  +I+  W  H L   LA G  D
Sbjct: 826  -GHLFVSGGDDHAAKIWELGTGQ---CIKTFQGHSNATYTIAHNWE-HSL---LASGHED 877

Query: 552  GNISVYTA------RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL- 710
              I ++        +S+      RI Q H   V +V ++ +   G L+ SG  D   KL 
Sbjct: 878  QTIKLWDLNLHSPHKSNVNTHPFRILQGHSNRVFSVVFSST---GQLLASGSADRTIKLW 934

Query: 711  ------------------------------ASAGCDNTVKVWKLYNGVWKMDCFPALQMH 800
                                          AS   D+TVK+W + +G     C   LQ H
Sbjct: 935  SPHTGQCLHTLHGHGSWVWAIAFSLDDKLLASGSYDHTVKIWDVSSG----QCLQTLQGH 990

Query: 801  TNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG---DQWEGKVLYDFNTPVWRVS 971
               V  VA++        T+ S+  +  V  W V + G     WE       +  VW V+
Sbjct: 991  PGSVLAVAFS----CDGKTLFSSGYEKLVKQWDV-ETGYCLQTWEAD-----SNRVWAVA 1040

Query: 972  WSLTGNLLAVASGDNNVTLWN 1034
             S     LA    D+ V LW+
Sbjct: 1041 VSRDNQYLATGGDDSVVRLWD 1061



 Score = 41.2 bits (95), Expect = 0.039
 Identities = 35/107 (32%), Positives = 53/107 (49%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            GD + +R  D  GK    +  +GH+  V  +     G+R+ ++SSD +IKI  V   ST 
Sbjct: 1052 GDDSVVRLWDI-GKGVCVRTFSGHTSQVICILFTKDGRRMISSSSDRTIKIWNV---STG 1107

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEW 452
            + LATL  H   VW + +  P   +LL+S S+D  +  W       W
Sbjct: 1108 ECLATLQAHDHWVWSL-YLTPDEKTLLSS-SWDETIKCWNISTGECW 1152



>gb:CZA382_119892 Amycolatopsis orientalis cosmid pCZA382.
          Length = 1241

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 79/314 (25%), Positives = 140/314 (44%), Gaps = 2/314 (0%)
 Frame = +3

Query: 99   SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASI 278
            S D R+ +   GD + +R  D   + P     TGH+  V+ ++    G  +ATAS+D ++
Sbjct: 634  SPDGRVLATAAGDSS-VRLWDIASRQPLGNPLTGHTGMVNGLAFSPDGTTLATASADRTV 692

Query: 279  KIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ 458
            ++  V+ +        ++GH   V  ++++    G LL + S DG V  W   ++    +
Sbjct: 693  RLWDVARHRPIGE--PMSGHTNTVTSIAFSSD--GRLLVTGSADGTVRTWDITSRTPIGE 748

Query: 459  AHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTA-RIDQAHPI-GV 632
              V   HK  + +++ +P   G+  A  S+D  + +        W+ A R     P+ G 
Sbjct: 749  PMV--GHKGPITAVALSPD--GVTAATSSNDKTVRL--------WNVATRAPIGDPLTGH 796

Query: 633  TAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWV 812
            T+V+   + +P            Q LAS   D TV++W   N   +      L  HTN  
Sbjct: 797  TSVTNGVAFSPDG----------QILASTSGDKTVRLW---NVATRAPIGDPLTGHTNVT 843

Query: 813  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNL 992
              VA++P+      T+A++S D  V IW       Q  G  L    + V+ +++S  G+ 
Sbjct: 844  YGVAFSPD----GRTLATSSWDKTVRIWDTTSRRQQ--GTALIGSTSSVFNIAFSPDGSA 897

Query: 993  LAVASGDNNVTLWN 1034
            LA    D++  +W+
Sbjct: 898  LAGGDSDSSTLVWS 911



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 74/279 (26%), Positives = 122/279 (43%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+  V DV+    G+ +ATA+ D+S+++  +++     +   L GH G V  ++++   
Sbjct: 623  GHTGEVRDVAFSPDGRVLATAAGDSSVRLWDIASRQPLGN--PLTGHTGMVNGLAFSPD- 679

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+ LA+ S D  V +W         +    + H ++V SI+++    G  L  GS+DG 
Sbjct: 680  -GTTLATASADRTVRLWDVARHRPIGEP--MSGHTNTVTSIAFSSD--GRLLVTGSADGT 734

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            +          WD   I    PIG   V     +   AL   G+       A++  D TV
Sbjct: 735  VRT--------WD---ITSRTPIGEPMVGHKGPITAVALSPDGV-----TAATSSNDKTV 778

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            ++W   N   +      L  HT+    VA++P+       +AS S D  V +W VA    
Sbjct: 779  RLW---NVATRAPIGDPLTGHTSVTNGVAFSPD----GQILASTSGDKTVRLWNVATRAP 831

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               G  L       + V++S  G  LA +S D  V +W+
Sbjct: 832  --IGDPLTGHTNVTYGVAFSPDGRTLATSSWDKTVRIWD 868



 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 91/351 (25%), Positives = 142/351 (40%), Gaps = 37/351 (10%)
 Frame = +3

Query: 99   SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASI 278
            S D ++ +   GD T +R  +   + P     TGH++  + V+    G+ +AT+S D ++
Sbjct: 806  SPDGQILASTSGDKT-VRLWNVATRAPIGDPLTGHTNVTYGVAFSPDGRTLATSSWDKTV 864

Query: 279  KI-------------IG----VSNNSTSQHLATLAGHHGPVWQVSW--------AHPKF- 380
            +I             IG    V N + S   + LAG       + W        AH    
Sbjct: 865  RIWDTTSRRQQGTALIGSTSSVFNIAFSPDGSALAGGDSDSSTLVWSLRGTLVPAHADAV 924

Query: 381  --------GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA 536
                    G +L + + D KV +W+     E         H + V S++++P   G  LA
Sbjct: 925  YAVALSPEGRVLGTGADDRKVRLWETSTHRELVAP--LTGHTAEVRSMAFSPQ--GGILA 980

Query: 537  CGSSDGNISVYTARSDGGWDTARIDQAHPIGVTA---VSWAPSMAPGALVGSGLHDPVQK 707
             GS DG + +        WD A      PIG      V W   +A               
Sbjct: 981  TGSWDGTLRL--------WDAAN---RAPIGSPLTGHVDWVRGLA--------FSPDGHF 1021

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
            +A+AG D TV++W   N   +    P L  HTN V  +A++P+      ++A+A+ D  +
Sbjct: 1022 VATAGMDMTVRLW---NVATRAPFGPPLTGHTNSVTGIAFSPD----GRSLATAANDKTI 1074

Query: 888  VIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             +W V        G+ L    + V  V +S  G LLA A  D  V LW+ A
Sbjct: 1075 RLWDVPSRSPI--GEPLTGHTSVVRDVVFSPDGKLLASAGDDKTVRLWDVA 1123



 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 62/238 (26%), Positives = 98/238 (41%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
            L GH G V  V+++    G +LA+ + D  V +W   ++      +    H   VN +++
Sbjct: 621  LLGHTGEVRDVAFSPD--GRVLATAAGDSSVRLWDIASRQPL--GNPLTGHTGMVNGLAF 676

Query: 507  APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG 686
            +P   G  LA  S+D  + +        WD AR     PIG        ++   A    G
Sbjct: 677  SPD--GTTLATASADRTVRL--------WDVAR---HRPIGEPMSGHTNTVTSIAFSSDG 723

Query: 687  LHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS 866
                 + L +   D TV+ W + +   +      +  H   +  VA +P+      T A+
Sbjct: 724  -----RLLVTGSADGTVRTWDITS---RTPIGEPMVGHKGPITAVALSPD----GVTAAT 771

Query: 867  ASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            +S D  V +W VA       G  L    +    V++S  G +LA  SGD  V LWN A
Sbjct: 772  SSNDKTVRLWNVATRAPI--GDPLTGHTSVTNGVAFSPDGQILASTSGDKTVRLWNVA 827



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 12/203 (5%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGH+++V  ++    G+ +ATA++D +I++  V + S       L GH   V  V ++  
Sbjct: 1047 TGHTNSVTGIAFSPDGRSLATAANDKTIRLWDVPSRSPIGE--PLTGHTSVVRDVVFSPD 1104

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G LLAS   D  V +W   ++   T       H   V  ++ +P   G  LA  S D 
Sbjct: 1105 --GKLLASAGDDKTVRLWDVASR---TLIATLEGHTGEVLKLAISPD--GRELASTSLDK 1157

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV----------- 701
             + +        WDTA       +  +      +  P  LV  G+   V           
Sbjct: 1158 TVRL--------WDTANRSTTTVLSASTGLAGVAYTPDGLVTGGVTGNVLLWTTDVTRLA 1209

Query: 702  -QKLASAGCDNTVKVWKLYNGVW 767
             Q  A+ G + +   W+ Y   W
Sbjct: 1210 GQVCAATGSELSDDEWRRYLPTW 1232



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 55/251 (21%), Positives = 97/251 (38%)
 Frame = +3

Query: 147  IRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT 326
            +R  D   + P     TGH D V  ++    G  VATA  D ++++  V+  +       
Sbjct: 988  LRLWDAANRAPIGSPLTGHVDWVRGLAFSPDGHFVATAGMDMTVRLWNVATRAPFG--PP 1045

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
            L GH   V  ++++    G  LA+ + D  + +W   +++   +      H S V  + +
Sbjct: 1046 LTGHTNSVTGIAFSPD--GRSLATAANDKTIRLWDVPSRSPIGEP--LTGHTSVVRDVVF 1101

Query: 507  APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG 686
            +P   G  LA    D  + +        WD A    +  +  T       +   A+   G
Sbjct: 1102 SPD--GKLLASAGDDKTVRL--------WDVA----SRTLIATLEGHTGEVLKLAISPDG 1147

Query: 687  LHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS 866
                 ++LAS   D TV++W   N          L   T  +  VA+ P+       + +
Sbjct: 1148 -----RELASTSLDKTVRLWDTAN----RSTTTVLSASTG-LAGVAYTPD------GLVT 1191

Query: 867  ASEDGKVVIWT 899
                G V++WT
Sbjct: 1192 GGVTGNVLLWT 1202



>gb:AP002843_1823096 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0407B12.>gb:AP003328_1827968 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:B1040D09.
          Length = 324

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 69/304 (22%), Positives = 125/304 (41%), Gaps = 26/304 (8%)
 Frame = +3

Query: 222  VSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASC 401
            V  ++ G+R+A  + D  + +    + S     +    H   +  + W  P +G  +A  
Sbjct: 16   VGWNHCGRRLAAGAVDGFVSVY--DSQSQPSPSSKWQAHKHAILNIVWLPPDYGDAIACV 73

Query: 402  SFDGKVIVWKEGNQNE----WTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVY 569
              DG + +W+E ++++    W +  VF    S +  + +      L +    SDG + VY
Sbjct: 74   CADGTLSLWEEVSEDDQLPTWRKCKVFESGNSHILHVQFGLQLSSLKMVTAYSDGQVKVY 133

Query: 570  TARSDGGWDTARIDQAHPIGVT---AVSWAPSMAPGALVGSGLHDPVQKLASA---GCD- 728
                    D  ++ QA    +T   + S  P+    ++  S      Q+ + A     D 
Sbjct: 134  ELLDSLELDKWQL-QAEFQNITDPVSRSGKPACTSASIAWSPRRGESQQASFAIGFNSDS 192

Query: 729  ---NTVKVWKLYNGVWKMDCFPALQMHT-----NWVRDVAWAPNLGLPKSTIASASEDGK 884
               N+ K+W+      +    P +++ +     + V  VAWAPN+G P   IA A+  G 
Sbjct: 193  PNFNSCKIWEFEEAHQRW--LPLVELGSPQDKGDIVHAVAWAPNIGRPYEIIAVATCKG- 249

Query: 885  VVIWTVAKEGDQWEGK-------VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAV 1043
            + IW +    +  +G        VL   +  V ++ W + G  LA   GD  V LW   +
Sbjct: 250  IAIWHIGLSAES-DGSLSTENVAVLSGHDGEVLQLEWDMGGMTLASTGGDGMVKLWQANL 308

Query: 1044 DGEW 1055
            +G W
Sbjct: 309  NGVW 312



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 4/67 (5%)
 Frame = +3

Query: 285 IGVSNNS----TSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEW 452
           IG+S  S    +++++A L+GH G V Q+ W     G  LAS   DG V +W+      W
Sbjct: 255 IGLSAESDGSLSTENVAVLSGHDGEVLQLEW--DMGGMTLASTGGDGMVKLWQANLNGVW 312

Query: 453 TQAHVFN 473
            +  V +
Sbjct: 313 HEQAVLD 319



>gb:BA000045_742319 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1721

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 76/284 (26%), Positives = 122/284 (42%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D V+DV     G+  AT SSD +I +  V        + TL GH   V  +S+   +
Sbjct: 1304 GHTDGVYDVVFSQDGQTFATGSSDRTIMLWHVDGTL----IRTLRGHSASVNSLSFG--R 1357

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
                L +   D  + +WK  N N   QA      ++ V SI+  P E    L  G SDG 
Sbjct: 1358 SDRTLVTGGDDSNLRIWKLSNFNTSFQA-----FENPVRSIALGPQE--QFLIAGGSDGT 1410

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I ++    + G   + + + H   V  +S +P                + +ASAG D T+
Sbjct: 1411 IKIW---GNNGRQISTL-RGHIRTVHDISISPDK--------------KMIASAGWDKTI 1452

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            K+W         +    L+ H+  V  VA +PN       + SA  D  +++W    + D
Sbjct: 1453 KLWHTSG-----ELIQTLREHSRPVFSVAISPN----GQYLVSAGADKNIIVW----KAD 1499

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
              + +VL   ++ V RV ++ +G  +     D  + LWN  +DG
Sbjct: 1500 GTKLRVLKGHSSEVNRVFFTASGQEIISGGADGKLILWN--IDG 1541



 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 78/288 (27%), Positives = 123/288 (42%), Gaps = 4/288 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   +  ++    GK +A+AS+D ++KI     NS      TL      V  VS++   
Sbjct: 1099 GHKSWISSIAHSPDGKAIASASADKTVKIW----NSNGTSFKTLFTDTSDVRAVSYSPD- 1153

Query: 378  FGSLLASCSFDGKVIVW-KEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
             G L+A+ + +G + +W  EG    +  AHV       +  +S++P   G  +   S DG
Sbjct: 1154 -GRLIATGNLNGGLNLWLAEGKWLRFIPAHV-----QRITGLSFSPD--GQKIVTSSYDG 1205

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
             I V+  R +G     +    H   V  V+++P                + +ASA  D T
Sbjct: 1206 TIKVW--RING--KLIKTLTGHNDKVIDVAFSPD--------------GKWIASASADKT 1247

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            VKVW+  +G+        L+ HT  +  V ++PN       IA+AS D  V +W      
Sbjct: 1248 VKVWR-DDGILS----KTLKGHTEQIESVTFSPN----SQMIATASVDKTVKLW------ 1292

Query: 915  DQWEG---KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
             Q  G   + +      V+ V +S  G   A  S D  + LW+  VDG
Sbjct: 1293 -QLNGVLIRTVRGHTDGVYDVVFSQDGQTFATGSSDRTIMLWH--VDG 1337



>gb:BA000045_740981 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 551

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 68/241 (28%), Positives = 101/241 (41%), Gaps = 4/241 (1%)
 Frame = +3

Query: 324  TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
            T+  H GPVW  S   P  G + AS   DG + +W        T       H  +V ++ 
Sbjct: 266  TVGAHPGPVW-ASAVRPD-GRMYASGDDDGAIRLWSPAG----TLLQTLEGHTGTVRAVV 319

Query: 504  WAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI-GVTAVSWAPSMAPGALVG 680
            + P   G  LA   SD  + +        WD       H + G +   W  +MAP   + 
Sbjct: 320  FTPD--GRALASAGSDRRVRL--------WDVGTGKLRHTLKGHSQPVWTLAMAPDGRI- 368

Query: 681  SGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTI 860
                     LAS   D +V++W + +G         L+ H +WV  VA++P+      T+
Sbjct: 369  ---------LASGSGDRSVRLWDIASGRQLY----RLRGHGDWVFAVAFSPD----GRTL 411

Query: 861  ASASEDGKVVIWTVAKEGDQWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            ASA +D  + +W  A      +GK+L      + PV  + WS  G  LA AS D  V LW
Sbjct: 412  ASAGKDETIRLWNSA------DGKLLATLRGHSAPVRALDWSKDGRTLASASWDKTVALW 465

Query: 1032 N 1034
            +
Sbjct: 466  D 466



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 53/184 (28%), Positives = 86/184 (46%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH D V  V+    G+ +A+A  D +I++    N++  + LATL GH  PV  + W+  K
Sbjct: 394 GHGDWVFAVAFSPDGRTLASAGKDETIRLW---NSADGKLLATLRGHSAPVRALDWS--K 448

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  LAS S+D  V +W    +   T+    + H   V ++S AP   G  +A GS DG 
Sbjct: 449 DGRTLASASWDKTVALWDVPGRTVRTR---LSGHTGRVTAVSLAPD--GQLVASGSIDGT 503

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
           + ++        DT R  Q H   +          P  ++  G     + L + G D+T+
Sbjct: 504 VRLWRP------DTRR--QIHRFDL----------PDWVLSLGFSPDGRMLIAGGKDSTL 545

Query: 738 KVWK 749
           ++W+
Sbjct: 546 RLWQ 549



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 74/264 (28%), Positives = 110/264 (41%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G+  A+   D +I++   +       L TL GH G V  V +     G  LAS   D +V
Sbjct: 283  GRMYASGDDDGAIRLWSPAGTL----LQTLEGHTGTVRAVVFTPD--GRALASAGSDRRV 336

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +W  G        H    H   V +++ AP   G  LA GS D ++ ++   S  G   
Sbjct: 337  RLWDVGTGK---LRHTLKGHSQPVWTLAMAPD--GRILASGSGDRSVRLWDIAS--GRQL 389

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
             R+ + H   V AV+++P                + LASAG D T+++W   +G      
Sbjct: 390  YRL-RGHGDWVFAVAFSPDG--------------RTLASAGKDETIRLWNSADG----KL 430

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPV 959
               L+ H+  VR + W+ +      T+ASAS D  V +W V     +     L      V
Sbjct: 431  LATLRGHSAPVRALDWSKD----GRTLASASWDKTVALWDVPGRTVRTR---LSGHTGRV 483

Query: 960  WRVSWSLTGNLLAVASGDNNVTLW 1031
              VS +  G L+A  S D  V LW
Sbjct: 484  TAVSLAPDGQLVASGSIDGTVRLW 507



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 41/147 (27%), Positives = 64/147 (43%), Gaps = 9/147 (6%)
 Frame = +3

Query: 627  GVTAVSWAPSMA------PGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPA 788
            G    SW  + A      PG +  S +    +  AS   D  +++W     + +      
Sbjct: 253  GNNCPSWQQARARTVGAHPGPVWASAVRPDGRMYASGDDDGAIRLWSPAGTLLQ-----T 307

Query: 789  LQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKV---LYDFNTPV 959
            L+ HT  VR V + P+       +ASA  D +V +W V        GK+   L   + PV
Sbjct: 308  LEGHTGTVRAVVFTPD----GRALASAGSDRRVRLWDVGT------GKLRHTLKGHSQPV 357

Query: 960  WRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            W ++ +  G +LA  SGD +V LW+ A
Sbjct: 358  WTLAMAPDGRILASGSGDRSVRLWDIA 384



>pir|AB2410|AB2410 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120)>gb:BA000019_685823 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1551

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 75/280 (26%), Positives = 116/280 (41%), Gaps = 1/280 (0%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   V  VS    G+ + TAS D + ++     N   + L +L GH   +W  +++   
Sbjct: 951  GHQAWVRSVSFSRDGQYILTASDDCTARLW----NLQGKQLISLQGHEDTIWSANFSPD- 1005

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +A+ S D    +W    Q    Q   F  H+  V S+S++P   G  +A    D  
Sbjct: 1006 -GKYIATASSDRTARLWNFSGQ----QLAKFQGHQGYVRSVSFSPD--GKHIATAGDD-- 1056

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
               +TAR    W  +        G     W  S +P      G H     +A+A  D  V
Sbjct: 1057 ---HTARL---WSFSGQQLVQFPGHQGTVWCISFSP-----DGKH-----IATAADDRIV 1100

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG- 914
            ++W L   +  +  FP    H + V DV+++P+       IA+AS DG   +W +A E  
Sbjct: 1101 RLWNLKGKL--LVRFPG---HQDCVWDVSFSPD----SQYIATASSDGTSRLWNLAGEQI 1151

Query: 915  DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             ++ G         VW V +S  G  +A  S D    +WN
Sbjct: 1152 TRFRG-----HQGVVWSVRFSPNGQYIATTSSDRTARVWN 1186



 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 78/288 (27%), Positives = 129/288 (44%), Gaps = 2/288 (0%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH D V  VS    GK +ATASSD ++++  ++     Q  +   GH   V  V ++  
Sbjct: 1196 SGHQDYVRSVSFSPDGKYIATASSDRTVRLWHLN----KQQFSAFQGHQSTVRSVDFSPD 1251

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G  + + + D  V +W    +    +   F  H+  V S+S++P   G  +A  SSD 
Sbjct: 1252 --GQKVVTAADDRTVRLWNIKGE----ELLQFLGHRGKVWSVSFSPD--GKYIATTSSDR 1303

Query: 555  NISVYTARSDGGWD-TARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
             + +        WD T ++ Q  P G     W+ S +P            Q +A+A  D 
Sbjct: 1304 TVRL--------WDITGQLLQQFP-GHQGTVWSVSFSPDG----------QHIATASSDL 1344

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA-K 908
            T ++W L +G   M      + H  WVR V+++ N       IA+A++D    +W +A +
Sbjct: 1345 TTRLWSL-DGQELMQ----FKGHDKWVRYVSFSCN----GQHIATAADDCTARLWNLAGR 1395

Query: 909  EGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            +  Q+ G       + VW V++S     L  AS D+   LW   +DG+
Sbjct: 1396 QVGQFLG-----HQSIVWSVNFSPDCQYLVTASEDHTAKLW--TLDGQ 1436



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 80/312 (25%), Positives = 122/312 (39%), Gaps = 33/312 (10%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH DT+   +    GK +ATASSD + ++     N + Q LA   GH G V  VS++   
Sbjct: 992  GHEDTIWSANFSPDGKYIATASSDRTARLW----NFSGQQLAKFQGHQGYVRSVSFSPD- 1046

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +A+   D    +W    Q    Q   F  H+ +V  IS++P   G  +A  + D  
Sbjct: 1047 -GKHIATAGDDHTARLWSFSGQ----QLVQFPGHQGTVWCISFSPD--GKHIATAADDRI 1099

Query: 558  ISVY------------------------------TARSDGG---WDTARIDQAHPIGVTA 638
            + ++                              TA SDG    W+ A        G   
Sbjct: 1100 VRLWNLKGKLLVRFPGHQDCVWDVSFSPDSQYIATASSDGTSRLWNLAGEQITRFRGHQG 1159

Query: 639  VSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRD 818
            V W+   +P            Q +A+   D T +VW L NG            H ++VR 
Sbjct: 1160 VVWSVRFSPNG----------QYIATTSSDRTARVWNL-NG----QQLAQFSGHQDYVRS 1204

Query: 819  VAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLA 998
            V+++P+       IA+AS D  V +W + K+    +        + V  V +S  G  + 
Sbjct: 1205 VSFSPD----GKYIATASSDRTVRLWHLNKQ----QFSAFQGHQSTVRSVDFSPDGQKVV 1256

Query: 999  VASGDNNVTLWN 1034
             A+ D  V LWN
Sbjct: 1257 TAADDRTVRLWN 1268



 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 64/240 (26%), Positives = 101/240 (42%), Gaps = 4/240 (1%)
 Frame = +3

Query: 333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSISWA 509
            GH   V  VS++    G  + + S D    +W  +G Q    Q H     + ++ S +++
Sbjct: 951  GHQAWVRSVSFSRD--GQYILTASDDCTARLWNLQGKQLISLQGH-----EDTIWSANFS 1003

Query: 510  PHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGL 689
            P   G  +A  SSD    ++      G   A+  Q H   V +VS++P          G 
Sbjct: 1004 PD--GKYIATASSDRTARLWNF---SGQQLAKF-QGHQGYVRSVSFSPD---------GK 1048

Query: 690  HDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASA 869
            H     +A+AG D+T ++W  ++G   +  FP  Q          W  +       IA+A
Sbjct: 1049 H-----IATAGDDHTARLWS-FSGQQLVQ-FPGHQ-------GTVWCISFSPDGKHIATA 1094

Query: 870  SEDGKVVIWTVAKEGDQWEGKVLYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            ++D  V +W +       +GK+L  F      VW VS+S     +A AS D    LWN A
Sbjct: 1095 ADDRIVRLWNL-------KGKLLVRFPGHQDCVWDVSFSPDSQYIATASSDGTSRLWNLA 1147



 Score = 37.4 bits (85), Expect = 0.57
 Identities = 33/124 (26%), Positives = 52/124 (41%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   V  V+     + + TAS D + K+  +      Q +    GH  PV    ++H  
Sbjct: 1402 GHQSIVWSVNFSPDCQYLVTASEDHTAKLWTLDG----QIVTEFRGHQAPVKSAVFSHN- 1456

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +A+ S D    +W    Q    Q   F  HK +V SIS +P +    +A  S D  
Sbjct: 1457 -GQYIATSSDDRTARLWNLNGQ----QLAQFKGHKGAVRSISISPDD--QYIATASDDRT 1509

Query: 558  ISVY 569
            + ++
Sbjct: 1510 VRLW 1513



>gb:CR380959_1654023 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 337

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 68/286 (23%), Positives = 119/286 (41%), Gaps = 17/286 (5%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ-HLATLAGHHGPVWQVSWAHPK 377
            H+D V  +  +     +AT S+D +IK++ + N   +   +     H   V  V+W    
Sbjct: 12   HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR--P 69

Query: 378  FGSLLASCSFDGKVIVW-------KEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA 536
               LLA+ SFD  + +W       +EG + E     +   H++ V  ISW+    G  LA
Sbjct: 70   HSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQD--GCLLA 127

Query: 537  CGSSDGNISVYTARSDGG-WDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
              S D ++ ++     G  ++   + Q H   V  V W              H     LA
Sbjct: 128  TCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVW--------------HTKHNLLA 173

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTI--ASASEDGKV 887
            S+  D+TV++WK Y+  W  +C   L  H   +    W  +    +  I   S S+D  V
Sbjct: 174  SSSYDDTVRIWKDYDDDW--ECAAVLTGHEGTI----WCSDFSKEEDPIRLCSGSDDSTV 227

Query: 888  VIWTVAKEGD----QW--EGKVLYDFNTPVWRVSWSLTGNLLAVAS 1007
             +W    + +    +W  E  +     + ++ V+WS +G + +V +
Sbjct: 228  RVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGA 273



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 58/202 (28%), Positives = 93/202 (46%), Gaps = 9/202 (4%)
 Frame = +3

Query: 477  HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARI--DQAHPIGVTAVSWA 650
            H   V SI + P   GL LA GS+D  I V   ++ G  +   +  D  H   V +V+W 
Sbjct: 12   HNDKVWSIDFEPVR-GL-LATGSTDRAIKVLQLKN-GKENLLDVLDDTVHKKAVRSVAWR 68

Query: 651  PSMAPGALVGSGLHDPVQKLASAGCDNTVKVWK-----LYNGV-WKMDCFPALQMHTNWV 812
            P            H  +  LA+   D+T+ +W      L  G   +M+    ++ H N V
Sbjct: 69   P------------HSDL--LAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEV 114

Query: 813  RDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG-KVLYDFNTPVWRVSWSLTGN 989
            + ++W+ +  L    +A+ S D  V IW   + G+++E   VL + +  V  V W    N
Sbjct: 115  KGISWSQDGCL----LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHN 170

Query: 990  LLAVASGDNNVTLWNEAVDGEW 1055
            LLA +S D+ V +W +  D +W
Sbjct: 171  LLASSSYDDTVRIWKD-YDDDW 191



>pir|G85034|G85034 probable WD-repeat protein [imported] - Arabidopsis
            thaliana>gb:AC004044_1531334 Arabidopsis thaliana BAC
            T5J8 from chromosome IV, top arm, complete
            sequence.>gb:ATCHRIV7_1546782 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 7.>gb:AY088121_1573144
            Arabidopsis thaliana clone 41490 mRNA, complete
            sequence.>gb:AY125558_1580363 Arabidopsis thaliana
            AT4g02730/T5J8_2 mRNA, complete cds.>gb:AF439825_1800001
            Arabidopsis thaliana AT4g02730/T5J8_2 mRNA, complete cds.
          Length = 333

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 67/244 (27%), Positives = 110/244 (45%), Gaps = 1/244 (0%)
 Frame = +3

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
            +HL TL GH   +  V +++   G+LLAS S D  +I+W   N   ++  H +  H S +
Sbjct: 34   RHLKTLEGHTAAISCVKFSND--GNLLASASVDKTMILWSATN---YSLIHRYEGHSSGI 88

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
            + ++W+      C A  S D  + ++ ARS   ++  ++ + H   V  V++ P      
Sbjct: 89   SDLAWSSDSHYTCSA--SDDCTLRIWDARSP--YECLKVLRGHTNFVFCVNFNP------ 138

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
                    P   + S   D T+++W++  G     C   ++ H+  +  V    +     
Sbjct: 139  --------PSNLIVSGSFDETIRIWEVKTG----KCVRMIKAHSMPISSV----HFNRDG 182

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTP-VWRVSWSLTGNLLAVASGDNNVTL 1028
            S I SAS DG   IW  AKEG     K L D  +P V    +S  G  + VA+ D+ + L
Sbjct: 183  SLIVSASHDGSCKIWD-AKEGTCL--KTLIDDKSPAVSFAKFSPNGKFILVATLDSTLKL 239

Query: 1029 WNEA 1040
             N A
Sbjct: 240  SNYA 243



>sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase pkwA
            (EC 2.7.1.37).>gb:AF115313_480098 Thermomonospora curvata
            PkwR (pkwR) and PkwA (pkwA) genes, complete cds.
          Length = 742

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 72/276 (26%), Positives = 114/276 (41%), Gaps = 38/276 (13%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D V  V+    G  +A+ S DA++++  V+    ++  A   GH   V  ++++   
Sbjct: 499  GHTDWVRAVAFSPDGALLASGSDDATVRLWDVA---AAEERAVFEGHTHYVLDIAFSPD- 554

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             GS++AS S DG   +W   N    T+  V   H   V +++++P   G  +A GS DG 
Sbjct: 555  -GSMVASGSRDGTARLW---NVATGTEHAVLKGHTDYVYAVAFSPD--GSMVASGSRDGT 608

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I +        WD A   +   +           AP   V S    P   +   G D+TV
Sbjct: 609  IRL--------WDVATGKERDVL----------QAPAENVVSLAFSPDGSMLVHGSDSTV 650

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKS--------------------- 854
             +W + +G    +     + HT+WVR VA++P+  L  S                     
Sbjct: 651  HLWDVASG----EALHTFEGHTDWVRAVAFSPDGALLASGSDDRTIRLWDVAAQEEHTTL 706

Query: 855  -----------------TIASASEDGKVVIWTVAKE 911
                             T+ASASEDG + IW +A E
Sbjct: 707  EGHTEPVHSVAFHPEGTTLASASEDGTIRIWPIATE 742



 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 77/274 (28%), Positives = 118/274 (43%), Gaps = 3/274 (1%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A  S D   K+I V + ++   L TL GH    W  + A    G+LLAS S D  V
Sbjct: 471  GSLLAGGSGD---KLIHVWDVASGDELHTLEGHTD--WVRAVAFSPDGALLASGSDDATV 525

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +W      E     VF  H   V  I+++P   G  +A GS DG   ++   +  G + 
Sbjct: 526  RLWDVAAAEERA---VFEGHTHYVLDIAFSPD--GSMVASGSRDGTARLWNVAT--GTEH 578

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
            A + + H   V AV+++P    G++V SG  D            T+++W +  G  +   
Sbjct: 579  AVL-KGHTDYVYAVAFSPD---GSMVASGSRD-----------GTIRLWDVATGKER--- 620

Query: 780  FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTP- 956
               LQ     V  +A++P+      ++     D  V +W VA       G+ L+ F    
Sbjct: 621  -DVLQAPAENVVSLAFSPD-----GSMLVHGSDSTVHLWDVAS------GEALHTFEGHT 668

Query: 957  --VWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
              V  V++S  G LLA  S D  + LW+ A   E
Sbjct: 669  DWVRAVAFSPDGALLASGSDDRTIRLWDVAAQEE 702



>gb:AF098070_1240741 Drosophila melanogaster Lis1 homolog mRNA,
           complete cds.
          Length = 409

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 66/239 (27%), Positives = 104/239 (43%), Gaps = 6/239 (2%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+D+V DV+ D  GK +A+ S+D SIK+       + + + T+ GH   V  V++    
Sbjct: 146 GHTDSVQDVAFDAQGKLLASCSADLSIKLWDF--QQSYECIKTMHGHDHNVSSVAFV--P 201

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  + S S D  + +W+            +  H+  V  +    H  G   A  S+D  
Sbjct: 202 AGDYVLSASRDRTIKMWEVAT---GYCVKTYTGHREWVRMV--RVHIEGSIFATCSNDQT 256

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL-VGSGL-----HDPVQKLASA 719
           I V+   S    D     + H   V  ++WAP  A  A+   +G      H     LAS 
Sbjct: 257 IRVWLTNSK---DCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASG 313

Query: 720 GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             D T+++W +  G+    C   L  H NWVR +A+ P        + SAS+D  + +W
Sbjct: 314 SRDKTIRIWDVSVGL----CLLTLSGHDNWVRGLAFHPG----GKYLVSASDDKTIRVW 364



>gb:AE013599_1132149 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132150 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1132151
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132152 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1132153
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132154 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003808_1225603
           Drosophila melanogaster chromosome 2R, section 42 of 74
           of the complete sequence.>gb:AE003808_1225604 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225605 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225606 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225607 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225608 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AF117606_1242609 Drosophila
           melanogaster lissencephaly-1 (Lis-1) mRNA, complete
           cds.>gb:AF152419_1245602 Drosophila melanogaster WD-40
           protein LIS1 (Lis1) mRNA, complete cds.
          Length = 411

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 66/239 (27%), Positives = 104/239 (43%), Gaps = 6/239 (2%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+D+V DV+ D  GK +A+ S+D SIK+       + + + T+ GH   V  V++    
Sbjct: 148 GHTDSVQDVAFDAQGKLLASCSADLSIKLWDF--QQSYECIKTMHGHDHNVSSVAFV--P 203

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  + S S D  + +W+            +  H+  V  +    H  G   A  S+D  
Sbjct: 204 AGDYVLSASRDRTIKMWEVAT---GYCVKTYTGHREWVRMV--RVHIEGSIFATCSNDQT 258

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL-VGSGL-----HDPVQKLASA 719
           I V+   S    D     + H   V  ++WAP  A  A+   +G      H     LAS 
Sbjct: 259 IRVWLTNSK---DCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASG 315

Query: 720 GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             D T+++W +  G+    C   L  H NWVR +A+ P        + SAS+D  + +W
Sbjct: 316 SRDKTIRIWDVSVGL----CLLTLSGHDNWVRGLAFHPG----GKYLVSASDDKTIRVW 366



>gb:AY524043_625304 Micromonospora echinospora ATCC 15835 gentamicin
            biosynthesis gene cluster, complete sequence.
          Length = 311

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 79/279 (28%), Positives = 120/279 (43%), Gaps = 1/279 (0%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGH+DTV  V  D  G+ +A+AS D + +I  VS     Q    L GH   V+ V++ HP
Sbjct: 59   TGHTDTVWLVVFDPEGRLLASASEDRTARIWDVSTG--EQVGEPLTGHTAGVYGVAF-HP 115

Query: 375  KFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSD 551
              G LLA+ S D  V +WK  G +          +    ++ +++ P            D
Sbjct: 116  D-GGLLATGSADHTVRLWKVPGGE---PVGEPLTESTDEIDGVAFHP------------D 159

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G++   T  +   +DTA      P+G   V         A    G     + LAS   D 
Sbjct: 160  GHLVASTGDAVRLYDTA---TGRPVGTPLVGHTKGAVSVAFSPDG-----RLLASGSDDL 211

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
            TV++W    G   ++    L  HT+ V  V + PN  L    + SA+ED  V +W VA  
Sbjct: 212  TVRIWDHAAGGAAVE---PLVGHTDAVDGVVFHPNGRL----LVSAAEDCTVRVWDVAT- 263

Query: 912  GDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTL 1028
              +  G+V      PVW +++  +G  +  AS D    +
Sbjct: 264  -GRQVGEVETGHTAPVWNIAFDRSGERIVTASQDGTARI 301



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 40/120 (33%), Positives = 58/120 (48%)
 Frame = +3

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
            ++G+  H     +A++G D TV++W    G         L  HT+ V  V + P   L  
Sbjct: 22   VIGAVFHPDDHLVATSGEDGTVRLWDATTGE---QVGRTLTGHTDTVWLVVFDPEGRL-- 76

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              +ASASED    IW V+  G+Q  G+ L      V+ V++   G LLA  S D+ V LW
Sbjct: 77   --LASASEDRTARIWDVST-GEQ-VGEPLTGHTAGVYGVAFHPDGGLLATGSADHTVRLW 132



 Score = 37.7 bits (86), Expect = 0.43
 Identities = 22/59 (37%), Positives = 31/59 (52%)
 Frame = +3

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +A++ EDG V +W  A  G+Q  G+ L      VW V +   G LLA AS D    +W+
Sbjct: 34   VATSGEDGTVRLWD-ATTGEQ-VGRTLTGHTDTVWLVVFDPEGRLLASASEDRTARIWD 90



 Score = 34.7 bits (78), Expect = 3.7
 Identities = 57/227 (25%), Positives = 82/227 (36%), Gaps = 6/227 (2%)
 Frame = +3

Query: 387  LLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV 566
            L+A+   DG V +W      +         H  +V  + + P   G  LA  S D    +
Sbjct: 33   LVATSGEDGTVRLWDATTGEQ--VGRTLTGHTDTVWLVVFDPE--GRLLASASEDRTARI 88

Query: 567  YTARSDGGWDTARIDQA------HPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
                    WD +  +Q       H  GV  V++ P          GL      LA+   D
Sbjct: 89   --------WDVSTGEQVGEPLTGHTAGVYGVAFHPD--------GGL------LATGSAD 126

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            +TV++WK+  G         L   T+ +  VA+ P+  L  ST       G  V      
Sbjct: 127  HTVRLWKVPGGE---PVGEPLTESTDEIDGVAFHPDGHLVAST-------GDAVRLYDTA 176

Query: 909  EGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
             G    G  L         V++S  G LLA  S D  V +W+ A  G
Sbjct: 177  TGRP-VGTPLVGHTKGAVSVAFSPDGRLLASGSDDLTVRIWDHAAGG 222



 Score = 34.3 bits (77), Expect = 4.8
 Identities = 13/34 (38%), Positives = 24/34 (70%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKII 287
           ++ETGH+  V +++ D  G+R+ TAS D + +I+
Sbjct: 269 EVETGHTAPVWNIAFDRSGERIVTASQDGTARIL 302



>gb:MPU575934_149470 Micromonospora purpurea DOS biosynthetic gene
            cluster.
          Length = 298

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 79/279 (28%), Positives = 120/279 (43%), Gaps = 1/279 (0%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGH+DTV  V  D  G+ +A+AS D + +I  VS     Q    L GH   V+ V++ HP
Sbjct: 46   TGHTDTVWLVVFDPEGRLLASASEDRTARIWDVSTG--EQVGEPLTGHTAGVYGVAF-HP 102

Query: 375  KFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSD 551
              G LLA+ S D  V +WK  G +          +    ++ +++ P            D
Sbjct: 103  D-GGLLATGSADHTVRLWKVPGGE---PVGEPLTESTDEIDGVAFHP------------D 146

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G++   T  +   +DTA      P+G   V         A    G     + LAS   D 
Sbjct: 147  GHLVASTGDAVRLYDTA---TGRPVGTPLVGHTKGAVSVAFSPDG-----RLLASGSDDL 198

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
            TV++W    G   ++    L  HT+ V  V + PN  L    + SA+ED  V +W VA  
Sbjct: 199  TVRIWDHAAGGAAVE---PLVGHTDAVDGVVFHPNGRL----LVSAAEDCTVRVWDVAT- 250

Query: 912  GDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTL 1028
              +  G+V      PVW +++  +G  +  AS D    +
Sbjct: 251  -GRQVGEVETGHTAPVWNIAFDRSGERIVTASQDGTARI 288



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 40/120 (33%), Positives = 58/120 (48%)
 Frame = +3

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
            ++G+  H     +A++G D TV++W    G         L  HT+ V  V + P   L  
Sbjct: 9    VIGAVFHPDDHLVATSGEDGTVRLWDATTGE---QVGRTLTGHTDTVWLVVFDPEGRL-- 63

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              +ASASED    IW V+  G+Q  G+ L      V+ V++   G LLA  S D+ V LW
Sbjct: 64   --LASASEDRTARIWDVST-GEQ-VGEPLTGHTAGVYGVAFHPDGGLLATGSADHTVRLW 119



 Score = 37.7 bits (86), Expect = 0.43
 Identities = 22/59 (37%), Positives = 31/59 (52%)
 Frame = +3

Query: 858  IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +A++ EDG V +W  A  G+Q  G+ L      VW V +   G LLA AS D    +W+
Sbjct: 21   VATSGEDGTVRLWD-ATTGEQ-VGRTLTGHTDTVWLVVFDPEGRLLASASEDRTARIWD 77



 Score = 34.7 bits (78), Expect = 3.7
 Identities = 57/227 (25%), Positives = 82/227 (36%), Gaps = 6/227 (2%)
 Frame = +3

Query: 387  LLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV 566
            L+A+   DG V +W      +         H  +V  + + P   G  LA  S D    +
Sbjct: 20   LVATSGEDGTVRLWDATTGEQ--VGRTLTGHTDTVWLVVFDPE--GRLLASASEDRTARI 75

Query: 567  YTARSDGGWDTARIDQA------HPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
                    WD +  +Q       H  GV  V++ P          GL      LA+   D
Sbjct: 76   --------WDVSTGEQVGEPLTGHTAGVYGVAFHPD--------GGL------LATGSAD 113

Query: 729  NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
            +TV++WK+  G         L   T+ +  VA+ P+  L  ST       G  V      
Sbjct: 114  HTVRLWKVPGGE---PVGEPLTESTDEIDGVAFHPDGHLVAST-------GDAVRLYDTA 163

Query: 909  EGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
             G    G  L         V++S  G LLA  S D  V +W+ A  G
Sbjct: 164  TGRP-VGTPLVGHTKGAVSVAFSPDGRLLASGSDDLTVRIWDHAAGG 209



 Score = 34.3 bits (77), Expect = 4.8
 Identities = 13/34 (38%), Positives = 24/34 (70%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKII 287
           ++ETGH+  V +++ D  G+R+ TAS D + +I+
Sbjct: 256 EVETGHTAPVWNIAFDRSGERIVTASQDGTARIL 289



>gb:NC9G6_1688870 Neurospora crassa DNA linkage group V Cosmid contig
            9G6.
          Length = 730

 Score = 70.9 bits (172), Expect = 5e-11
 Identities = 73/280 (26%), Positives = 114/280 (40%), Gaps = 22/280 (7%)
 Frame = +3

Query: 261  SSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW-----------------AHPKFGS- 386
            SS AS K + V+N         L GH GPV+ VS+                 A P   + 
Sbjct: 428  SSVASEKDLQVNNRK-------LIGHSGPVYGVSFSDSIANLDRNVFPEADGAKPDTSTK 480

Query: 387  LLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV 566
            LL SCS DG+V +W   + + W    ++  H   V  + W PH  G   A G  D  + V
Sbjct: 481  LLVSCSADGQVRLW---SLDHWACLCIYKAHDGPVFRVLWGPH--GHYFATGGWDKTVRV 535

Query: 567  YTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVW 746
            +   +       RI   H   ++A++W P+   G  + S         AS   D ++++W
Sbjct: 536  F---AQDRASALRIMVGHDTPISAIAWHPN---GTYIFS---------ASDDTDKSIRMW 580

Query: 747  KLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK----EG 914
             +  G    +C      HT+++  +  APN       +ASA   G +  W +AK    + 
Sbjct: 581  SVVTG----NCVRIFTGHTDYISALQCAPN----GKILASADTGGNIFFWDIAKGARIKR 632

Query: 915  DQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +  GK        +  +S+S   N+L     D  V LW+
Sbjct: 633  CRGHGK------GGIPSLSFSAESNVLVSGGLDGTVRLWD 666



>gb:AE017350_1759247 Cryptococcus neoformans var. neoformans JEC21
            chromosome 10, complete sequence.
          Length = 440

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 90/383 (23%), Positives = 146/383 (38%), Gaps = 94/383 (24%)
 Frame = +3

Query: 180  AQKIETGHSDTVHDVSMDYYGKRVATASSDASI----KIIGVSNNSTSQH---------- 317
            A+ IET H  TV  ++    G+ +A+ S D+++    ++I +S++   +           
Sbjct: 65   AKVIETDHKRTVRSIAWSPDGRTLASGSFDSTVGVWEEVIPLSDDEEEEDEGAQGVYKPA 124

Query: 318  ------------------LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQ 443
                              + TL GH      V ++    G+LLASCS D  V VW+    
Sbjct: 125  GVDSDGDGDGGKEKEWECVTTLEGHESECKSVGFSSD--GALLASCSRDKSVWVWEVQPD 182

Query: 444  NEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHP 623
             ++    V  +H   V SI+W PHE    LA  S D  I  + A  D   D     + HP
Sbjct: 183  ADFECIAVMMEHSQDVKSIAWHPHE--EILASASYDSYI--HLAYDDPDSDWCIFQKLHP 238

Query: 624  IGVTAVSWAPSMAPGALVGSGLHDPVQK----------------------------LASA 719
               +     PS +P  L+ + +    +K                            LAS 
Sbjct: 239  SLPSTPLTIPSTSPSHLIDALVPTEEEKKAEAELQVPPLEEDETVWCLAWSPDGRWLASG 298

Query: 720  GCDNTVKVWKLYNGVWKMDCFPAL---QMHTNWVRDVAWAP------NLGLPKST----I 860
            G +  +++W+   G      F  +     H+  V  ++W+P      + G   ST    +
Sbjct: 299  GDNGGIRLWQ-RTGSQPDSAFKEILHTAAHSRSVFSLSWSPPYPSAESAGSTDSTDLGML 357

Query: 861  ASASEDGKVVIWTV---------AKEGD-----------QWEGKVLYDFNTPVWRVSWSL 980
            ASA EDGK++IW +         ++E D           Q +   + D N+  W V    
Sbjct: 358  ASAGEDGKIIIWQITVPPSPSSASQEIDNEQISIRPIAAQKDAHGVNDINSVAWCVREDK 417

Query: 981  TG-NLLAVASGDNNVTLWNEAVD 1046
             G  +L+ A  D +V +W    D
Sbjct: 418  KGWGMLSSAGDDGSVKVWRVVRD 440



 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 66/262 (25%), Positives = 105/262 (40%), Gaps = 14/262 (5%)
 Frame = +3

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVW-------------KEGNQNEW 452
            Q L +L  H  P W VS+   +  SLLASCS D  + ++             ++ +Q  +
Sbjct: 5    QSLGSLPAHAEPAWTVSFNPTR--SLLASCSTDRTIRLYSYIIPSSSDGLPSQDDSQAVF 62

Query: 453  TQAHVFN-DHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIG 629
            + A V   DHK +V SI+W+P   G  LA GS D  + V+        D    D+     
Sbjct: 63   SLAKVIETDHKRTVRSIAWSPD--GRTLASGSFDSTVGVWEEVIPLSDDEEEEDEG---- 116

Query: 630  VTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNW 809
                      A G    +G+          G     K W         +C   L+ H + 
Sbjct: 117  ----------AQGVYKPAGVDSD-----GDGDGGKEKEW---------ECVTTLEGHESE 152

Query: 810  VRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGN 989
             + V ++ +  L    +AS S D  V +W V  + D     V+ + +  V  ++W     
Sbjct: 153  CKSVGFSSDGAL----LASCSRDKSVWVWEVQPDADFECIAVMMEHSQDVKSIAWHPHEE 208

Query: 990  LLAVASGDNNVTLWNEAVDGEW 1055
            +LA AS D+ + L  +  D +W
Sbjct: 209  ILASASYDSYIHLAYDDPDSDW 230



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 71/337 (21%), Positives = 124/337 (36%), Gaps = 49/337 (14%)
 Frame = +3

Query: 168  GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKII---------GVSNNSTSQHL 320
            G +PA      H++    VS +     +A+ S+D +I++          G+ +   SQ +
Sbjct: 8    GSLPA------HAEPAWTVSFNPTRSLLASCSTDRTIRLYSYIIPSSSDGLPSQDDSQAV 61

Query: 321  ATLA-----GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKE----------------- 434
             +LA      H   V  ++W+    G  LAS SFD  V VW+E                 
Sbjct: 62   FSLAKVIETDHKRTVRSIAWSPD--GRTLASGSFDSTVGVWEEVIPLSDDEEEEDEGAQG 119

Query: 435  ---------------GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVY 569
                           G + EW        H+S   S+ ++    G  LA  S D ++ V+
Sbjct: 120  VYKPAGVDSDGDGDGGKEKEWECVTTLEGHESECKSVGFSSD--GALLASCSRDKSVWVW 177

Query: 570  TARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWK 749
              + D  ++   +   H   V +++W P            H+ +  LASA  D+ + +  
Sbjct: 178  EVQPDADFECIAVMMEHSQDVKSIAWHP------------HEEI--LASASYDSYIHL-- 221

Query: 750  LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG 929
             Y+              ++W       P+L     TI S S    +      +E  + E 
Sbjct: 222  AYD-----------DPDSDWCIFQKLHPSLPSTPLTIPSTSPSHLIDALVPTEEEKKAEA 270

Query: 930  KVL---YDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            ++     + +  VW ++WS  G  LA    +  + LW
Sbjct: 271  ELQVPPLEEDETVWCLAWSPDGRWLASGGDNGGIRLW 307



>gb:AY059116_1564480 Arabidopsis thaliana unknown protein (At1g64350)
            mRNA, complete cds.>gb:AF370222_1792107 Arabidopsis
            thaliana unknown protein (At1g64350) mRNA, complete cds.
          Length = 326

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 72/310 (23%), Positives = 122/310 (39%), Gaps = 33/310 (10%)
 Frame = +3

Query: 225  SMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT--LAGHHGPVWQVSWAHPKFGSLLAS 398
            S +  G R+A  S +  + I   S +S+S    T  +      + ++ W   ++G  +A 
Sbjct: 16   SWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIVKIVWLPSEYGDAVAC 75

Query: 399  CSFDGKVIVWKEGNQN----EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV 566
               DG + +W+E +++    EW       +  S V  + +      L +    SDG + V
Sbjct: 76   VCEDGSLSIWEELSEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRKSLKMVAAYSDGYLRV 135

Query: 567  YTARSD---GGWDTAR-----IDQAHPIGV-----TAVSWAP----SMAPGALVGSGLHD 695
            +   +      W         ID    +G       +VSW P       P  ++      
Sbjct: 136  FELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKGEEQEPSFVLAFNSDS 195

Query: 696  PVQKLASAGCDNTVKVWKL--YNGVWKMDCFPAL-QMHTNWVRDVAWAPNLGLPKSTIAS 866
            P          N+ K+W+    +  W      AL +   + V  ++WAPN+G P   +A 
Sbjct: 196  PHL--------NSSKIWEFDEAHNRWLAVAELALPEDKGDPVYALSWAPNIGRPYEVVAV 247

Query: 867  ASEDGKVVIWTVAKEGDQWEGKV-------LYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
            A+  G + IW V    D  EG++       L      VW++ W ++G  LA    D  V 
Sbjct: 248  ATHKG-IGIWHVGLAPDL-EGRLPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVK 305

Query: 1026 LWNEAVDGEW 1055
            LW   ++GEW
Sbjct: 306  LWQSNLNGEW 315



>sp|Q9BQ87|TBLY_HUMAN F-box-like/WD-repeat protein TBL1Y (Transducin
            beta-like 1Y protein) (Transducin-beta-like 1,
            Y-linked).>gb:AF332220_1897069 Homo sapiens transducin
            beta-like 1 (TBL1) mRNA, complete cds, alternatively
            spliced.>gb:AF332221_1897070 Homo sapiens transducin
            beta-like 1 (TBL1) mRNA, complete cds, alternatively
            spliced.>gb:AF332222_1897071 Homo sapiens transducin
            beta-like 1 (TBL1) mRNA, complete cds, alternatively
            spliced.
          Length = 522

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 78/271 (28%), Positives = 110/271 (40%), Gaps = 6/271 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A  S D   +I   + N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 247  GTLLAMGSYDGFARIWTENGNLAS----TLGQHKGPIFALKWN--KKGNYVLSAGVDKTT 300

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W   +  +  A  S+D  I V     D     
Sbjct: 301  IIW-DAHTGEAKQQFPF--HSAPALDVDW---QNNMTFASCSTDMCIHVCRLGCD---HP 351

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD- 776
             +  Q H   V A+ W PS   G L           LAS   D T+K+W +     K D 
Sbjct: 352  VKTFQGHTNEVNAIKWDPS---GML-----------LASCSDDMTLKIWSM-----KQDA 392

Query: 777  CFPALQMHTNWVRDVAWAPN---LGLPKSTI--ASASEDGKVVIWTVAKEGDQWEGKVLY 941
            C   LQ H+  +  + W+P       P S+I  ASAS D  V +W V +         L 
Sbjct: 393  CVHDLQAHSKEIYTIKWSPTGPATSNPNSSIMLASASFDSTVRLWDVEQGVCT---HTLM 449

Query: 942  DFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                PV+ V++S  G  LA  S D  V +WN
Sbjct: 450  KHQEPVYSVAFSPDGKYLASGSFDKYVHIWN 480



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 63/251 (25%), Positives = 90/251 (35%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-----EGNQNEWTQAHVFND----- 476
            L GH   V+  +W       LLAS S D    +W       G   +    H   +     
Sbjct: 175  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDV 232

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   + G   + + Q H   + A+ W  
Sbjct: 233  PSNKDVTSLDW--NSDGTLLAMGSYDGFARIWT---ENGNLASTLGQ-HKGPIFALKW-- 284

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 285  ------------NKKGNYVLSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQN 328

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N+     T AS S D  +    V + G     K        V  + W  +G LLA  S D
Sbjct: 329  NM-----TFASCSTDMCI---HVCRLGCDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDD 380

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 381  MTLKIWSMKQD 391



>gb:BC053205_2550597 Danio rerio platelet-activating factor
            acetylhydrolase, isoform Ib, alpha subunit a, mRNA (cDNA
            clone MGC:64021 IMAGE:6793127), complete cds.
          Length = 410

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 81/332 (24%), Positives = 132/332 (39%), Gaps = 14/332 (4%)
 Frame = +3

Query: 78   QRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETG--------HSDTVHDVSMD 233
            +++ L+    P    +F    + I S+ ++  +     ETG        H+D+V D+S D
Sbjct: 100  EKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDHETGDFERTLKGHTDSVQDISFD 159

Query: 234  YYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDG 413
            + GK +A+ S+D +IK+         + + T+ GH   V  V  A    G  + S S D 
Sbjct: 160  HTGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMPNGDHIVSASRDK 214

Query: 414  KVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW 593
             + +W+            F  H+  V  +   P++ G  +A  S+D  + V+   +    
Sbjct: 215  TIKMWEVAT---GYCVKTFTGHREWVRMV--RPNQDGTLIASSSNDQTVRVWVVATK--- 266

Query: 594  DTARIDQAHPIGVTAVSWAPSMA-PGALVGSGLH-----DPVQKLASAGCDNTVKVWKLY 755
            +     + H   V  +SWAP  A P  L  +G        P   L S   D T+K+W + 
Sbjct: 267  ECKAELREHEHVVECISWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVS 326

Query: 756  NGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKV 935
             G+    C   L  H NWVR V   P        I S ++D  + IW    +      K 
Sbjct: 327  IGM----CLMTLVGHDNWVRGVLVHPG----GKYIVSCADDKTLRIWDYKNKRCT---KT 375

Query: 936  LYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            L      V  + +  T   +   S D  V +W
Sbjct: 376  LSAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



 Score = 35.0 bits (79), Expect = 2.8
 Identities = 28/83 (33%), Positives = 38/83 (45%)
 Frame = +3

Query: 786  ALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWR 965
            AL  H + V  V + P      S I SASED  + +W    E   +E + L      V  
Sbjct: 103  ALSGHRSPVTRVIFHPVF----SVIVSASEDATIKVWD--HETGDFE-RTLKGHTDSVQD 155

Query: 966  VSWSLTGNLLAVASGDNNVTLWN 1034
            +S+  TG LLA  S D  + LW+
Sbjct: 156  ISFDHTGKLLASCSADMTIKLWD 178



>gb:AL603745_2071172 Mouse DNA sequence from clone RP23-392I13 on
            chromosome 11 Contains the 5' end of the Rad51l3 gene for
            RAD51-like 3 (S. cerevisiae), two novel genes, the gene
            for a novel WD40 repeat containing protein, the Cmya4
            gene for cardiomyopathy associated 4, a novel gene, the
            Slfn5, Slfn9, Slfn8 and Slfn2 genes for schlafen 5, 9, 8
            and 2, a SET domain-containing protein 8 (Set8)
            pseudogene, a ribosomal protein L12 (Rpl12) pseudogene, a
            schlafen (Slfn) pseudogene and a CpG island, complete
            sequence.
          Length = 485

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 77/291 (26%), Positives = 114/291 (39%), Gaps = 8/291 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHS+ V  V+    GK +A+ S D +++   +S  +      T  GH   V  +SW+   
Sbjct: 112  GHSEAVISVAFSPTGKYLASGSGDTTVRFWDLSTETPH---FTCKGHRHWVLSISWSPD- 167

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP-HELGLC--LACGSS 548
             G  LAS   +G+V++W      +         H   +  +SW P H    C  +A  S 
Sbjct: 168  -GKKLASGCKNGQVLLWDPSTGLQ--VGRTLTGHSKWITGLSWEPLHMNPECRYVASSSK 224

Query: 549  DGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
            DG++ V        WDT      RI   H   VT + W          G GL      L 
Sbjct: 225  DGSVRV--------WDTTAGRCERILTGHTQSVTCLRWG---------GDGL------LY 261

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            SA  D T+KVW+ ++GV        LQ H +WV  +A + +  L       A        
Sbjct: 262  SASQDRTIKVWRAHDGV----LCRTLQGHGHWVNTMALSTDYALRTGAFEPAEA------ 311

Query: 894  WTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVD 1046
             TV  +  Q   K L +  +  + +        L   S D  + LW+ A D
Sbjct: 312  -TVNAQDLQGSLKELKERASSRYNLVRGQGPERLVSGSDDFTLFLWSPAED 361



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 48/165 (29%), Positives = 72/165 (43%)
 Frame = +3

Query: 75  SQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVA 254
           S R+ L     P        D T    S  E K P  ++ TGH   ++ V      + VA
Sbjct: 330 SSRYNLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLARM-TGHQALINQVLFSPDSRIVA 388

Query: 255 TASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKE 434
           +AS D SIK+    +  T ++LA+L GH   V+Q++W+      LL S S D  + VW  
Sbjct: 389 SASFDKSIKLW---DGRTGKYLASLRGHVAAVYQIAWSAD--SRLLVSGSSDSTLKVWDV 443

Query: 435 GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVY 569
             Q   T       H   V ++ W+P   G  +A G  D  + ++
Sbjct: 444 KAQKLATD---LPGHADEVYAVDWSPD--GQRVASGGKDKCLRIW 483



 Score = 40.0 bits (92), Expect = 0.087
 Identities = 65/311 (20%), Positives = 116/311 (37%), Gaps = 32/311 (10%)
 Frame = +3

Query: 195  TGHSDTVHDVS-----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            TGHS  +  +S     M+   + VA++S D S+++   +     +    L GH   V  +
Sbjct: 196  TGHSKWITGLSWEPLHMNPECRYVASSSKDGSVRVWDTTAGRCER---ILTGHTQSVTCL 252

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC 539
             W       LL S S D  + VW+    ++         H   VN+++ +       L  
Sbjct: 253  RWGGD---GLLYSASQDRTIKVWRA---HDGVLCRTLQGHGHWVNTMALSTD---YALRT 303

Query: 540  GSSD------------GNISVYTARSDGGWDTARIDQAHPI-----GVTAVSWAPS---- 656
            G+ +            G++     R+   ++  R      +       T   W+P+    
Sbjct: 304  GAFEPAEATVNAQDLQGSLKELKERASSRYNLVRGQGPERLVSGSDDFTLFLWSPAEDKK 363

Query: 657  -----MAPGALVGSGLHDPVQKL-ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRD 818
                     AL+   L  P  ++ ASA  D ++K+W    G +      +L+ H   V  
Sbjct: 364  PLARMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKY----LASLRGHVAAVYQ 419

Query: 819  VAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLA 998
            +AW+ +  L    + S S D  + +W V  +    +   L      V+ V WS  G  +A
Sbjct: 420  IAWSADSRL----LVSGSSDSTLKVWDVKAQKLATD---LPGHADEVYAVDWSPDGQRVA 472

Query: 999  VASGDNNVTLW 1031
                D  + +W
Sbjct: 473  SGGKDKCLRIW 483



>gb:AK030547_1162058 Mus musculus adult male pituitary gland cDNA,
            RIKEN full-length enriched library, clone:5330429M20
            product:transducin (beta)-like 1, full insert sequence.
          Length = 527

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 80/274 (29%), Positives = 110/274 (40%), Gaps = 9/274 (3%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 250  GTLLATGSYDGFARIWTEDGNLAS----TLGQHKGPIFALKWN--KKGNYILSAGVDKTT 303

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W   +     A  S+D  I V     D    T
Sbjct: 304  IIW-DAHTGEAKQQFPF--HSAPALDVDW---QNNTTFASCSTDMCIHVCRLGCDRPVKT 357

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD- 776
                Q H   V A+ W PS   G L           LAS   D T+K+W +     K D 
Sbjct: 358  F---QGHTNEVNAIKWDPS---GML-----------LASCSDDMTLKIWSM-----KQDA 395

Query: 777  CFPALQMHTNWVRDVAWAPN---LGLPKSTI--ASASEDGKVVIWTVAKEGDQWEGKVLY 941
            C   LQ H+  +  + W+P       P S I  ASAS D  V +W V +      G  ++
Sbjct: 396  CVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVER------GVCIH 449

Query: 942  DFNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                   PV+ V++S  G  LA  S D  V +WN
Sbjct: 450  TLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWN 483



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 64/251 (25%), Positives = 88/251 (35%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-----EGNQNEWTQAHVFND----- 476
            L GH   V+  +W       LLAS S D    +W       G   +    H   +     
Sbjct: 178  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDV 235

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 236  PSNKDVTSLDW--NSDGTLLATGSYDGFARIWT--EDGNLASTLGQHKGPI--FALKW-- 287

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 288  ------------NKKGNYILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQN 331

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V + G     K        V  + W  +G LLA  S D
Sbjct: 332  N-----TTFASCSTDMCI---HVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDD 383

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 384  MTLKIWSMKQD 394



>sp|Q9QXE7|TBLX_MOUSE F-box-like/WD-repeat protein TBL1X (Transducin
            beta-like 1X protein).>gb:AK038674_1165137 Mus musculus
            adult male hypothalamus cDNA, RIKEN full-length enriched
            library, clone:A230054B22 product:transducin (beta)-like
            1, full insert sequence.>gb:BC043105_2098837 Mus musculus
            transducin (beta)-like 1 X-linked, mRNA (cDNA clone
            MGC:58025 IMAGE:6406579), complete cds.
          Length = 527

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 80/274 (29%), Positives = 110/274 (40%), Gaps = 9/274 (3%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 250  GTLLATGSYDGFARIWTEDGNLAS----TLGQHKGPIFALKWN--KKGNYILSAGVDKTT 303

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W   +     A  S+D  I V     D    T
Sbjct: 304  IIW-DAHTGEAKQQFPF--HSAPALDVDW---QNNTTFASCSTDMCIHVCRLGCDRPVKT 357

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD- 776
                Q H   V A+ W PS   G L           LAS   D T+K+W +     K D 
Sbjct: 358  F---QGHTNEVNAIKWDPS---GML-----------LASCSDDMTLKIWSM-----KQDA 395

Query: 777  CFPALQMHTNWVRDVAWAPN---LGLPKSTI--ASASEDGKVVIWTVAKEGDQWEGKVLY 941
            C   LQ H+  +  + W+P       P S I  ASAS D  V +W V +      G  ++
Sbjct: 396  CVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVER------GVCIH 449

Query: 942  DFNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                   PV+ V++S  G  LA  S D  V +WN
Sbjct: 450  TLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWN 483



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 64/251 (25%), Positives = 88/251 (35%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-----EGNQNEWTQAHVFND----- 476
            L GH   V+  +W       LLAS S D    +W       G   +    H   +     
Sbjct: 178  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDV 235

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 236  PSNKDVTSLDW--NSDGTLLATGSYDGFARIWT--EDGNLASTLGQHKGPI--FALKW-- 287

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 288  ------------NKKGNYILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQN 331

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V + G     K        V  + W  +G LLA  S D
Sbjct: 332  N-----TTFASCSTDMCI---HVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDD 383

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 384  MTLKIWSMKQD 394



>gb:BC052304_1984804 Homo sapiens transducin (beta)-like 1X-linked,
            mRNA (cDNA clone MGC:59682 IMAGE:6378852), complete
            cds.>gb:HSTBL1_2020646 Homo sapiens mRNA for transducin
            (beta) like 1 protein.
          Length = 577

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 77/270 (28%), Positives = 105/270 (38%), Gaps = 5/270 (1%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W     G+ + S   D   
Sbjct: 300  GTLLATGSYDGFARIWTEDGNLAS----TLGQHKGPIFALKWNRK--GNYILSAGVDKTT 353

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W   +     A  S+D  I V     D    T
Sbjct: 354  IIW-DAHTGEAKQQFPF--HSAPALDVDW---QNNTTFASCSTDMCIHVCRLGCDRPVKT 407

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W PS   G L           LAS   D T+K+W +   V    C
Sbjct: 408  F---QGHTNEVNAIKWDPS---GML-----------LASCSDDMTLKIWSMKQEV----C 446

Query: 780  FPALQMHTNWVRDVAWAPN---LGLPKSTI--ASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P       P S I  ASAS D  V +W + +         L  
Sbjct: 447  IHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGVCT---HTLTK 503

Query: 945  FNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               PV+ V++S  G  LA  S D  V +WN
Sbjct: 504  HQEPVYSVAFSPDGKYLASGSFDKCVHIWN 533



>gb:BC002884_1968496 Homo sapiens Notchless gene homolog
           (Drosophila), mRNA (cDNA clone IMAGE:3943492), partial
           cds.
          Length = 484

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/224 (27%), Positives = 94/224 (41%), Gaps = 8/224 (3%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GHS+ V  V+    GK +A+ S D +++   +S  +      T  GH   V  +SW+   
Sbjct: 111 GHSEAVISVAFSPTGKYLASGSGDTTVRFWDLSTETPH---FTCKGHRHWVLSISWSPD- 166

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP-HELGLC--LACGSS 548
            G  LAS   +G++++W      +         H   +  +SW P H    C  +A  S 
Sbjct: 167 -GKKLASGCKNGQILLWDPSTGKQ--VGRTLAGHSKWITGLSWEPLHANPECRYVASSSK 223

Query: 549 DGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
           DG++ +        WDT      RI   H   VT + W          G GL      L 
Sbjct: 224 DGSVRI--------WDTTAGRCERILTGHTQSVTCLRWG---------GDGL------LY 260

Query: 714 SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
           SA  D T+KVW+ ++GV        LQ H +WV  +A + +  L
Sbjct: 261 SASQDRTIKVWRAHDGV----LCRTLQGHGHWVNTMALSTDYAL 300



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 44/145 (30%), Positives = 67/145 (46%)
 Frame = +3

Query: 135 DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
           D T    S  E K P  ++ TGH   ++ V      + VA+AS D SIK+    +  T +
Sbjct: 349 DFTLFLWSPAEDKKPLTRM-TGHQALINQVLFSPDSRIVASASFDKSIKLW---DGRTGK 404

Query: 315 HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
           +LA+L GH   V+Q++W+      LL S S D  + VW    Q     A     H   V 
Sbjct: 405 YLASLRGHVAAVYQIAWSAD--SRLLVSGSSDSTLKVWDVKAQK---LAMDLPGHADEVY 459

Query: 495 SISWAPHELGLCLACGSSDGNISVY 569
           ++ W+P   G  +A G  D  + ++
Sbjct: 460 AVDWSPD--GQRVASGGKDKCLRIW 482



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 77/313 (24%), Positives = 122/313 (38%), Gaps = 34/313 (10%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW---- 365
            GH   V  +S    GK++A+   +  I +   S     Q   TLAGH   +  +SW    
Sbjct: 153  GHRHWVLSISWSPDGKKLASGCKNGQILLWDPSTGK--QVGRTLAGHSKWITGLSWEPLH 210

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            A+P+    +AS S DG V +W   +        +   H  SV  + W    L   L   S
Sbjct: 211  ANPEC-RYVASSSKDGSVRIW---DTTAGRCERILTGHTQSVTCLRWGGDGL---LYSAS 263

Query: 546  SDGNISVY---------TARSDGGW-DTARIDQAHPIGVTAVSWAP-SMAPGALVGS--- 683
             D  I V+         T +  G W +T  +   + +   A   A  S+ P  L GS   
Sbjct: 264  QDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQE 323

Query: 684  ------GLHDPV-----QKLASAGCDNTVKVWKLYNGVWKMDCFPALQM--HTNWVRDVA 824
                    ++ V     ++L S   D T+ +W         D  P  +M  H   +  V 
Sbjct: 324  LKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPAE-----DKKPLTRMTGHQALINQVL 378

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLL 995
            ++P+  +    +ASAS D  + +W      D   GK L         V++++WS    LL
Sbjct: 379  FSPDSRI----VASASFDKSIKLW------DGRTGKYLASLRGHVAAVYQIAWSADSRLL 428

Query: 996  AVASGDNNVTLWN 1034
               S D+ + +W+
Sbjct: 429  VSGSSDSTLKVWD 441



 Score = 37.7 bits (86), Expect = 0.43
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 1/122 (0%)
 Frame = +3

Query: 669  ALVGSGLHDPVQKL-ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
            AL+   L  P  ++ ASA  D ++K+W    G +      +L+ H   V  +AW+ +  L
Sbjct: 372  ALINQVLFSPDSRIVASASFDKSIKLWDGRTGKY----LASLRGHVAAVYQIAWSADSRL 427

Query: 846  PKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
                + S S D  + +W V  +    +   L      V+ V WS  G  +A    D  + 
Sbjct: 428  ----LVSGSSDSTLKVWDVKAQKLAMD---LPGHADEVYAVDWSPDGQRVASGGKDKCLR 480

Query: 1026 LW 1031
            +W
Sbjct: 481  IW 482



>gb:AX135811_1461885 Sequence 5 from Patent WO0132614.
          Length = 485

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/224 (27%), Positives = 94/224 (41%), Gaps = 8/224 (3%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GHS+ V  V+    GK +A+ S D +++   +S  +      T  GH   V  +SW+   
Sbjct: 112 GHSEAVISVAFSPTGKYLASGSGDTTVRFWDLSTETPH---FTCKGHRHWVLSISWSPD- 167

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP-HELGLC--LACGSS 548
            G  LAS   +G++++W      +         H   +  +SW P H    C  +A  S 
Sbjct: 168 -GKKLASGCKNGQILLWDPSTGKQ--VGRTLAGHSKWITGLSWEPLHANPECRYVASSSK 224

Query: 549 DGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
           DG++ +        WDT      RI   H   VT + W          G GL      L 
Sbjct: 225 DGSVRI--------WDTTAGRCERILTGHTQSVTCLRWG---------GDGL------LY 261

Query: 714 SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
           SA  D T+KVW+ ++GV        LQ H +WV  +A + +  L
Sbjct: 262 SASQDRTIKVWRAHDGV----LCRTLQGHGHWVNTMALSTDYAL 301



 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 44/145 (30%), Positives = 67/145 (46%)
 Frame = +3

Query: 135 DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
           D T    S  E K P  ++ TGH   ++ V      + VA+AS D SIK+    +  T +
Sbjct: 350 DFTLFLWSPAEDKKPLTRM-TGHQALINQVXFSPDSRIVASASFDKSIKLW---DGRTGK 405

Query: 315 HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
           +LA+L GH   V+Q++W+      LL S S D  + VW    Q     A     H   V 
Sbjct: 406 YLASLRGHVAAVYQIAWSAD--SRLLVSGSSDSTLKVWDVKAQK---LAMDLPGHADEVY 460

Query: 495 SISWAPHELGLCLACGSSDGNISVY 569
           ++ W+P   G  +A G  D  + ++
Sbjct: 461 AVDWSPD--GQRVASGGKDKCLRIW 483



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 77/313 (24%), Positives = 122/313 (38%), Gaps = 34/313 (10%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW---- 365
            GH   V  +S    GK++A+   +  I +   S     Q   TLAGH   +  +SW    
Sbjct: 154  GHRHWVLSISWSPDGKKLASGCKNGQILLWDPSTGK--QVGRTLAGHSKWITGLSWEPLH 211

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            A+P+    +AS S DG V +W   +        +   H  SV  + W    L   L   S
Sbjct: 212  ANPEC-RYVASSSKDGSVRIW---DTTAGRCERILTGHTQSVTCLRWGGDGL---LYSAS 264

Query: 546  SDGNISVY---------TARSDGGW-DTARIDQAHPIGVTAVSWAP-SMAPGALVGS--- 683
             D  I V+         T +  G W +T  +   + +   A   A  S+ P  L GS   
Sbjct: 265  QDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQE 324

Query: 684  ------GLHDPV-----QKLASAGCDNTVKVWKLYNGVWKMDCFPALQM--HTNWVRDVA 824
                    ++ V     ++L S   D T+ +W         D  P  +M  H   +  V 
Sbjct: 325  LKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPAE-----DKKPLTRMTGHQALINQVX 379

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLL 995
            ++P+  +    +ASAS D  + +W      D   GK L         V++++WS    LL
Sbjct: 380  FSPDSRI----VASASFDKSIKLW------DGRTGKYLASLRGHVAAVYQIAWSADSRLL 429

Query: 996  AVASGDNNVTLWN 1034
               S D+ + +W+
Sbjct: 430  VSGSSDSTLKVWD 442



 Score = 35.8 bits (81), Expect = 1.6
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 1/122 (0%)
 Frame = +3

Query: 669  ALVGSGLHDPVQKL-ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
            AL+      P  ++ ASA  D ++K+W    G +      +L+ H   V  +AW+ +  L
Sbjct: 373  ALINQVXFSPDSRIVASASFDKSIKLWDGRTGKY----LASLRGHVAAVYQIAWSADSRL 428

Query: 846  PKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
                + S S D  + +W V  +    +   L      V+ V WS  G  +A    D  + 
Sbjct: 429  ----LVSGSSDSTLKVWDVKAQKLAMD---LPGHADEVYAVDWSPDGQRVASGGKDKCLR 481

Query: 1026 LW 1031
            +W
Sbjct: 482  IW 483



>gb:CR857200_1181447 Pongo pygmaeus mRNA; cDNA DKFZp468I2316 (from
           clone DKFZp468I2316).
          Length = 485

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/224 (27%), Positives = 94/224 (41%), Gaps = 8/224 (3%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GHS+ V  V+    GK +A+ S D +++   +S  +      T  GH   V  +SW+   
Sbjct: 112 GHSEAVISVAFSPTGKYLASGSGDTTVRFWDLSTETPH---FTCKGHRHWVLSISWSPD- 167

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP-HELGLC--LACGSS 548
            G  LAS   +G++++W      +         H   +  +SW P H    C  +A  S 
Sbjct: 168 -GKKLASGCKNGQILLWDPSTGKQ--VGRTLAGHSKWITGLSWEPLHANPECRYVASSSK 224

Query: 549 DGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
           DG++ +        WDT      RI   H   VT + W          G GL      L 
Sbjct: 225 DGSVRI--------WDTTAGRCERILTGHTQSVTCLRWG---------GDGL------LY 261

Query: 714 SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
           SA  D T+KVW+ ++GV        LQ H +WV  +A + +  L
Sbjct: 262 SASQDRTIKVWRAHDGV----LCRTLQGHGHWVNTMALSTDYAL 301



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 44/145 (30%), Positives = 67/145 (46%)
 Frame = +3

Query: 135 DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
           D T    S  E K P  ++ TGH   ++ V      + VA+AS D SIK+    +  T +
Sbjct: 350 DFTLFLWSPAEDKKPLTRM-TGHQALINQVLFSPDSRIVASASFDKSIKLW---DGRTGK 405

Query: 315 HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
           +LA+L GH   V+Q++W+      LL S S D  + VW    Q     A     H   V 
Sbjct: 406 YLASLRGHVAAVYQIAWSAD--SRLLVSGSSDSTLKVWDVKAQK---LAMDLPGHADEVY 460

Query: 495 SISWAPHELGLCLACGSSDGNISVY 569
           ++ W+P   G  +A G  D  + ++
Sbjct: 461 AVDWSPD--GQRVASGGKDKCLRIW 483



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 76/313 (24%), Positives = 119/313 (38%), Gaps = 34/313 (10%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW---- 365
            GH   V  +S    GK++A+   +  I +   S     Q   TLAGH   +  +SW    
Sbjct: 154  GHRHWVLSISWSPDGKKLASGCKNGQILLWDPSTGK--QVGRTLAGHSKWITGLSWEPLH 211

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            A+P+    +AS S DG V +W   +        +   H  SV  + W    L   L   S
Sbjct: 212  ANPEC-RYVASSSKDGSVRIW---DTTAGRCERILTGHTQSVTCLRWGGDGL---LYSAS 264

Query: 546  SDGNISVY---------TARSDGGW-DTARIDQAHPIGVTAVSWAP-SMAPGALVGSGLH 692
             D  I V+         T +  G W +T  +   + +   A   A  S+ P  L GS   
Sbjct: 265  QDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQE 324

Query: 693  --------------DPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQM--HTNWVRDVA 824
                             ++L S   D T+ +W         D  P  +M  H   +  V 
Sbjct: 325  LKERALSRYNLMRGQGPERLVSGSDDFTLFLWSPAE-----DKKPLTRMTGHQALINQVL 379

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLL 995
            ++P+  +    +ASAS D  + +W      D   GK L         V++++WS    LL
Sbjct: 380  FSPDSRI----VASASFDKSIKLW------DGRTGKYLASLRGHVAAVYQIAWSADSRLL 429

Query: 996  AVASGDNNVTLWN 1034
               S D+ + +W+
Sbjct: 430  VSGSSDSTLKVWD 442



 Score = 37.7 bits (86), Expect = 0.43
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 1/122 (0%)
 Frame = +3

Query: 669  ALVGSGLHDPVQKL-ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
            AL+   L  P  ++ ASA  D ++K+W    G +      +L+ H   V  +AW+ +  L
Sbjct: 373  ALINQVLFSPDSRIVASASFDKSIKLWDGRTGKY----LASLRGHVAAVYQIAWSADSRL 428

Query: 846  PKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
                + S S D  + +W V  +    +   L      V+ V WS  G  +A    D  + 
Sbjct: 429  ----LVSGSSDSTLKVWDVKAQKLAMD---LPGHADEVYAVDWSPDGQRVASGGKDKCLR 481

Query: 1026 LW 1031
            +W
Sbjct: 482  IW 483



>gb:AK031937_1162655 Mus musculus adult male medulla oblongata cDNA,
            RIKEN full-length enriched library, clone:6330503H01
            product:transducin (beta)-like 1, full insert sequence.
          Length = 412

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 80/274 (29%), Positives = 110/274 (40%), Gaps = 9/274 (3%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 135  GTLLATGSYDGFARIWTEDGNLAS----TLGQHKGPIFALKWN--KKGNYILSAGVDKTT 188

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W   +     A  S+D  I V     D    T
Sbjct: 189  IIW-DAHTGEAKQQFPF--HSAPALDVDW---QNNTTFASCSTDMCIHVCRHGCDRPVKT 242

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD- 776
                Q H   V A+ W PS   G L           LAS   D T+K+W +     K D 
Sbjct: 243  F---QGHTNEVNAIKWDPS---GML-----------LASCSDDMTLKIWSM-----KQDA 280

Query: 777  CFPALQMHTNWVRDVAWAPN---LGLPKSTI--ASASEDGKVVIWTVAKEGDQWEGKVLY 941
            C   LQ H+  +  + W+P       P S I  ASAS D  V +W V +      G  ++
Sbjct: 281  CVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVER------GVCIH 334

Query: 942  DFNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                   PV+ V++S  G  LA  S D  V +WN
Sbjct: 335  TLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWN 368



 Score = 50.4 bits (119), Expect = 6e-05
 Identities = 64/251 (25%), Positives = 88/251 (35%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-----EGNQNEWTQAHVFND----- 476
            L GH   V+  +W       LLAS S D    +W       G   +    H   +     
Sbjct: 63   LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDV 120

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 121  PSNKDVTSLDW--NSDGTLLATGSYDGFARIWT--EDGNLASTLGQHKGPI--FALKW-- 172

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 173  ------------NKKGNYILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQN 216

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V + G     K        V  + W  +G LLA  S D
Sbjct: 217  N-----TTFASCSTDMCI---HVCRHGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDD 268

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 269  MTLKIWSMKQD 279



>pir|AB2202|AB2202 hypothetical protein all3169 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_684158 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 559

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 75/280 (26%), Positives = 124/280 (44%), Gaps = 1/280 (0%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GHS  V  VS    G+ +ATAS D +IK+  +    TS  + TL GH  PV  VS++  
Sbjct: 308  SGHSQAVTSVSFSPQGEILATASDDKTIKLWHL---PTSSEVFTLNGHTNPVKSVSFS-- 362

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G +LAS S+D +V +W      E    +    H+  V++++++P   G  LA  S D 
Sbjct: 363  PNGQILASGSWDKQVKLWDVTTGKE---IYALKAHQLQVSAVAFSPQ--GEILASASFDR 417

Query: 555  NISVY-TARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
             I ++   ++   +   +    H   V A++++P    G +           LA+   DN
Sbjct: 418  TIRLWQITQNHPRYTLIKTLSGHTRAVLAIAFSPD---GKI-----------LATGSDDN 463

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
            T+K+W +  G         L  H+  V  V +  +      T+ SAS D  + +W V+  
Sbjct: 464  TIKLWDINTG----QLIATLLGHSWSVVAVTFTAD----NKTLISASWDKTIKLWKVSTT 515

Query: 912  GDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                E   L      V  V+ +    ++A +S D  + LW
Sbjct: 516  E---EIVTLASHLDSVCAVAVNPVTQVIASSSRDKTIKLW 552



 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 69/267 (25%), Positives = 111/267 (41%), Gaps = 9/267 (3%)
 Frame = +3

Query: 261  SSDASIKIIGVSNN--------STSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGK 416
            S+D  ++++G+           S  Q L TL G+      +S      G+ LAS   D  
Sbjct: 237  SADEVMQVMGIEGKILHYPPPPSPWQCLHTLTGYSTNSLAIS----PDGNKLASGGDDKI 292

Query: 417  VIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWD 596
            + +W+   Q        F+ H  +V S+S++P   G  LA  S D  I ++   +     
Sbjct: 293  IRLWELNTQKLLA---CFSGHSQAVTSVSFSPQ--GEILATASDDKTIKLWHLPTSSEVF 347

Query: 597  TARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD 776
            T      H   V +VS++P+               Q LAS   D  VK+W +  G     
Sbjct: 348  TLN---GHTNPVKSVSFSPNG--------------QILASGSWDKQVKLWDVTTGKE--- 387

Query: 777  CFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG-KVLYDFNT 953
               AL+ H   V  VA++P        +ASAS D  + +W + +   ++   K L     
Sbjct: 388  -IYALKAHQLQVSAVAFSPQ----GEILASASFDRTIRLWQITQNHPRYTLIKTLSGHTR 442

Query: 954  PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             V  +++S  G +LA  S DN + LW+
Sbjct: 443  AVLAIAFSPDGKILATGSDDNTIKLWD 469



 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 53/211 (25%), Positives = 92/211 (43%), Gaps = 26/211 (12%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH++ V  VS    G+ +A+ S D  +K+  V+   T + +  L  H   V  V+++   
Sbjct: 351 GHTNPVKSVSFSPNGQILASGSWDKQVKLWDVT---TGKEIYALKAHQLQVSAVAFSPQ- 406

Query: 378 FGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
            G +LAS SFD  + +W+   N   +T     + H  +V +I+++P   G  LA GS D 
Sbjct: 407 -GEILASASFDRTIRLWQITQNHPRYTLIKTLSGHTRAVLAIAFSPD--GKILATGSDDN 463

Query: 555 NISVYTARSDG--------GWDTARID-QAHPIGVTAVSWAPSM------APGALVGSGL 689
            I ++   +           W    +   A    + + SW  ++          +V    
Sbjct: 464 TIKLWDINTGQLIATLLGHSWSVVAVTFTADNKTLISASWDKTIKLWKVSTTEEIVTLAS 523

Query: 690 H---------DPV-QKLASAGCDNTVKVWKL 752
           H         +PV Q +AS+  D T+K+W+L
Sbjct: 524 HLDSVCAVAVNPVTQVIASSSRDKTIKLWQL 554



>sp|O60907|TBLX_HUMAN F-box-like/WD-repeat protein TBL1X (Transducin
            beta-like 1X protein) (Transducin-beta-like 1, X-linked)
            (SMAP55).>gb:BC032708_1980633 Homo sapiens transducin
            (beta)-like 1X-linked, mRNA (cDNA clone MGC:45225
            IMAGE:5496758), complete cds.
          Length = 526

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 77/270 (28%), Positives = 105/270 (38%), Gaps = 5/270 (1%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W     G+ + S   D   
Sbjct: 249  GTLLATGSYDGFARIWTEDGNLAS----TLGQHKGPIFALKWNRK--GNYILSAGVDKTT 302

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W   +     A  S+D  I V     D    T
Sbjct: 303  IIW-DAHTGEAKQQFPF--HSAPALDVDW---QNNTTFASCSTDMCIHVCRLGCDRPVKT 356

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W PS   G L           LAS   D T+K+W +   V    C
Sbjct: 357  F---QGHTNEVNAIKWDPS---GML-----------LASCSDDMTLKIWSMKQEV----C 395

Query: 780  FPALQMHTNWVRDVAWAPN---LGLPKSTI--ASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P       P S I  ASAS D  V +W + +         L  
Sbjct: 396  IHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGVCT---HTLTK 452

Query: 945  FNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               PV+ V++S  G  LA  S D  V +WN
Sbjct: 453  HQEPVYSVAFSPDGKYLASGSFDKCVHIWN 482



>sp|Q8VEJ4|HUS7_MOUSE WD-repeat protein HUSSY-07.>gb:BC018399_2092702
            Mus musculus cDNA sequence BC018399, mRNA (cDNA clone
            MGC:25690 IMAGE:3491925), complete cds.
          Length = 485

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 76/291 (26%), Positives = 114/291 (39%), Gaps = 8/291 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHS+ V  V+    GK +A+ S D +++   +S  +      T  GH   V  +SW+   
Sbjct: 112  GHSEAVISVAFSPTGKYLASGSGDTTVRFWDLSTETPH---FTCKGHRHWVLSISWSPD- 167

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP-HELGLC--LACGSS 548
             G  LAS   +G++++W      +         H   +  +SW P H    C  +A  S 
Sbjct: 168  -GKKLASGCKNGQILLWDPSTGLQ--VGRTLTGHSKWITGLSWEPLHMNPECRYVASSSK 224

Query: 549  DGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
            DG++ V        WDT      RI   H   VT + W          G GL      L 
Sbjct: 225  DGSVRV--------WDTTAGRCERILTGHTQSVTCLRWG---------GDGL------LY 261

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            SA  D T+KVW+ ++GV        LQ H +WV  +A + +  L       A        
Sbjct: 262  SASQDRTIKVWRAHDGV----LCRTLQGHGHWVNTMALSTDYALRTGAFEPAEA------ 311

Query: 894  WTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVD 1046
             TV  +  Q   K L +  +  + +        L   S D  + LW+ A D
Sbjct: 312  -TVNAQDLQGSLKELKERASSRYNLVRGQGPERLVSGSDDFTLFLWSPAED 361



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 48/165 (29%), Positives = 72/165 (43%)
 Frame = +3

Query: 75  SQRFPLT*SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVA 254
           S R+ L     P        D T    S  E K P  ++ TGH   ++ V      + VA
Sbjct: 330 SSRYNLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLARM-TGHQALINQVLFSPDSRIVA 388

Query: 255 TASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKE 434
           +AS D SIK+    +  T ++LA+L GH   V+Q++W+      LL S S D  + VW  
Sbjct: 389 SASFDKSIKLW---DGRTGKYLASLRGHVAAVYQIAWSAD--SRLLVSGSSDSTLKVWDV 443

Query: 435 GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVY 569
             Q   T       H   V ++ W+P   G  +A G  D  + ++
Sbjct: 444 KAQKLATD---LPGHADEVYAVDWSPD--GQRVASGGKDKCLRIW 483



 Score = 40.0 bits (92), Expect = 0.087
 Identities = 65/311 (20%), Positives = 116/311 (37%), Gaps = 32/311 (10%)
 Frame = +3

Query: 195  TGHSDTVHDVS-----MDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            TGHS  +  +S     M+   + VA++S D S+++   +     +    L GH   V  +
Sbjct: 196  TGHSKWITGLSWEPLHMNPECRYVASSSKDGSVRVWDTTAGRCER---ILTGHTQSVTCL 252

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC 539
             W       LL S S D  + VW+    ++         H   VN+++ +       L  
Sbjct: 253  RWGGD---GLLYSASQDRTIKVWRA---HDGVLCRTLQGHGHWVNTMALSTD---YALRT 303

Query: 540  GSSD------------GNISVYTARSDGGWDTARIDQAHPI-----GVTAVSWAPS---- 656
            G+ +            G++     R+   ++  R      +       T   W+P+    
Sbjct: 304  GAFEPAEATVNAQDLQGSLKELKERASSRYNLVRGQGPERLVSGSDDFTLFLWSPAEDKK 363

Query: 657  -----MAPGALVGSGLHDPVQKL-ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRD 818
                     AL+   L  P  ++ ASA  D ++K+W    G +      +L+ H   V  
Sbjct: 364  PLARMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKY----LASLRGHVAAVYQ 419

Query: 819  VAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLA 998
            +AW+ +  L    + S S D  + +W V  +    +   L      V+ V WS  G  +A
Sbjct: 420  IAWSADSRL----LVSGSSDSTLKVWDVKAQKLATD---LPGHADEVYAVDWSPDGQRVA 472

Query: 999  VASGDNNVTLW 1031
                D  + +W
Sbjct: 473  SGGKDKCLRIW 483



>sp|Q9NVX2|HUS7_HUMAN WD-repeat protein
           HUSSY-07.>gb:AX405715_1467643 Sequence 130 from Patent
           WO0222660.>gb:AX876494_1476557 Sequence 11399 from
           Patent EP1074617.>gb:AK001320_1908367 Homo sapiens cDNA
           FLJ10458 fis, clone NT2RP1001457, highly similar to Homo
           sapiens partial mRNA for beta-transducin family
           protein.>gb:BC012075_1973417 Homo sapiens Notchless gene
           homolog (Drosophila), mRNA (cDNA clone MGC:19970
           IMAGE:4652713), complete cds.
          Length = 485

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 62/224 (27%), Positives = 94/224 (41%), Gaps = 8/224 (3%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GHS+ V  V+    GK +A+ S D +++   +S  +      T  GH   V  +SW+   
Sbjct: 112 GHSEAVISVAFSPTGKYLASGSGDTTVRFWDLSTETPH---FTCKGHRHWVLSISWSPD- 167

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP-HELGLC--LACGSS 548
            G  LAS   +G++++W      +         H   +  +SW P H    C  +A  S 
Sbjct: 168 -GKKLASGCKNGQILLWDPSTGKQ--VGRTLAGHSKWITGLSWEPLHANPECRYVASSSK 224

Query: 549 DGNISVYTARSDGGWDTA-----RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
           DG++ +        WDT      RI   H   VT + W          G GL      L 
Sbjct: 225 DGSVRI--------WDTTAGRCERILTGHTQSVTCLRWG---------GDGL------LY 261

Query: 714 SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
           SA  D T+KVW+ ++GV        LQ H +WV  +A + +  L
Sbjct: 262 SASQDRTIKVWRAHDGV----LCRTLQGHGHWVNTMALSTDYAL 301



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 44/145 (30%), Positives = 67/145 (46%)
 Frame = +3

Query: 135 DHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQ 314
           D T    S  E K P  ++ TGH   ++ V      + VA+AS D SIK+    +  T +
Sbjct: 350 DFTLFLWSPAEDKKPLTRM-TGHQALINQVLFSPDSRIVASASFDKSIKLW---DGRTGK 405

Query: 315 HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVN 494
           +LA+L GH   V+Q++W+      LL S S D  + VW    Q     A     H   V 
Sbjct: 406 YLASLRGHVAAVYQIAWSAD--SRLLVSGSSDSTLKVWDVKAQK---LAMDLPGHADEVY 460

Query: 495 SISWAPHELGLCLACGSSDGNISVY 569
           ++ W+P   G  +A G  D  + ++
Sbjct: 461 AVDWSPD--GQRVASGGKDKCLRIW 483



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 77/313 (24%), Positives = 122/313 (38%), Gaps = 34/313 (10%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW---- 365
            GH   V  +S    GK++A+   +  I +   S     Q   TLAGH   +  +SW    
Sbjct: 154  GHRHWVLSISWSPDGKKLASGCKNGQILLWDPSTGK--QVGRTLAGHSKWITGLSWEPLH 211

Query: 366  AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            A+P+    +AS S DG V +W   +        +   H  SV  + W    L   L   S
Sbjct: 212  ANPEC-RYVASSSKDGSVRIW---DTTAGRCERILTGHTQSVTCLRWGGDGL---LYSAS 264

Query: 546  SDGNISVY---------TARSDGGW-DTARIDQAHPIGVTAVSWAP-SMAPGALVGS--- 683
             D  I V+         T +  G W +T  +   + +   A   A  S+ P  L GS   
Sbjct: 265  QDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQE 324

Query: 684  ------GLHDPV-----QKLASAGCDNTVKVWKLYNGVWKMDCFPALQM--HTNWVRDVA 824
                    ++ V     ++L S   D T+ +W         D  P  +M  H   +  V 
Sbjct: 325  LKERALSRYNLVRGQGPERLVSGSDDFTLFLWSPAE-----DKKPLTRMTGHQALINQVL 379

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLL 995
            ++P+  +    +ASAS D  + +W      D   GK L         V++++WS    LL
Sbjct: 380  FSPDSRI----VASASFDKSIKLW------DGRTGKYLASLRGHVAAVYQIAWSADSRLL 429

Query: 996  AVASGDNNVTLWN 1034
               S D+ + +W+
Sbjct: 430  VSGSSDSTLKVWD 442



 Score = 37.7 bits (86), Expect = 0.43
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 1/122 (0%)
 Frame = +3

Query: 669  ALVGSGLHDPVQKL-ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
            AL+   L  P  ++ ASA  D ++K+W    G +      +L+ H   V  +AW+ +  L
Sbjct: 373  ALINQVLFSPDSRIVASASFDKSIKLWDGRTGKY----LASLRGHVAAVYQIAWSADSRL 428

Query: 846  PKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
                + S S D  + +W V  +    +   L      V+ V WS  G  +A    D  + 
Sbjct: 429  ----LVSGSSDSTLKVWDVKAQKLAMD---LPGHADEVYAVDWSPDGQRVASGGKDKCLR 481

Query: 1026 LW 1031
            +W
Sbjct: 482  IW 483



>gb:AY087489_1572520 Arabidopsis thaliana clone 35985 mRNA, complete
            sequence.
          Length = 326

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 72/310 (23%), Positives = 121/310 (39%), Gaps = 33/310 (10%)
 Frame = +3

Query: 225  SMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT--LAGHHGPVWQVSWAHPKFGSLLAS 398
            S +  G R+A  S +  + I   S +S+S    T  +      + ++ W    +G  +A 
Sbjct: 16   SWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIVKIVWLPSVYGDAVAC 75

Query: 399  CSFDGKVIVWKEGNQN----EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV 566
               DG + +W+E +++    EW       +  S V  + +      L +    SDG + V
Sbjct: 76   VCEDGSLSIWEELSEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRKSLKMVAAYSDGYLRV 135

Query: 567  YTARSD---GGWDTAR-----IDQAHPIGV-----TAVSWAP----SMAPGALVGSGLHD 695
            +   +      W         ID    +G       +VSW P       P  ++      
Sbjct: 136  FELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKGEEQEPSFVLAFNSDS 195

Query: 696  PVQKLASAGCDNTVKVWKL--YNGVWKMDCFPAL-QMHTNWVRDVAWAPNLGLPKSTIAS 866
            P          N+ K+W+    +  W      AL +   + V  ++WAPN+G P   +A 
Sbjct: 196  PHL--------NSSKIWEFDEAHNRWLAVAELALPEDKGDPVYALSWAPNIGRPYEVVAV 247

Query: 867  ASEDGKVVIWTVAKEGDQWEGKV-------LYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
            A+  G + IW V    D  EG++       L      VW++ W ++G  LA    D  V 
Sbjct: 248  ATHKG-IGIWHVGLAPDL-EGRLPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVK 305

Query: 1026 LWNEAVDGEW 1055
            LW   ++GEW
Sbjct: 306  LWQSNLNGEW 315



>gb:AY032881_2508795 Xenopus laevis LIS1 mRNA, complete cds.
          Length = 410

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 74/284 (26%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + L T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECLRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +   +    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSTISDATGSETKRSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V + P        I S ++D  + IW 
Sbjct: 315  SRDKTIKMWDISIGM----CLMTLVGHDNWVRGVQFHPG----GKFILSCADDKTIRIWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:AP005546_1853876 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OJ1003_C09.>gb:AP005558_1854043 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1155_H10.
          Length = 975

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 61/235 (25%), Positives = 99/235 (42%), Gaps = 25/235 (10%)
 Frame = +3

Query: 381  GSLLASCSFDGKVIVW------KEGNQNEWTQAHV--FNDHKSSVNSISWAPHELGLCLA 536
            G   A+   D K+ +W      K+ + ++ +Q  +    DH  +VN + WA H  G  LA
Sbjct: 25   GIRFATGGGDQKIRIWSMKSVAKDNDSDDSSQRLLATIRDHFGTVNCVRWAHH--GRYLA 82

Query: 537  CGSSDGNISVYTARSDGG--------------WDTARIDQAHPIGVTAVSWAPSMAPGAL 674
             GS D  I ++  ++  G              W      + H   V  ++W+P  +    
Sbjct: 83   SGSDDQVIQIHERKAGTGTSEFGSGEPPDVENWKVVMTLRGHTADVVDLNWSPDDST--- 139

Query: 675  VGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKS 854
                       LAS   DNTV +W + NG+    C   L+ H++ V+ V W P +G   S
Sbjct: 140  -----------LASGSLDNTVHIWSMANGI----CTAVLRGHSSLVKGVTWDP-IG---S 180

Query: 855  TIASASEDGKVVIWTVA--KEGDQWEGKVLYDFNTPVW-RVSWSLTGNLLAVASG 1010
             IAS S+D  V+IW  +      + EG       +  + R++WS  G+ +    G
Sbjct: 181  FIASQSDDKTVIIWRTSDWSLAHRTEGHWSKSLGSTFFRRLAWSPCGHFITTTHG 235



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 55/222 (24%), Positives = 93/222 (41%), Gaps = 24/222 (10%)
 Frame = +3

Query: 240 GKRVATASSDASIKIIGV--------SNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLA 395
           G R AT   D  I+I  +        S++S+ + LAT+  H G V  V WAH   G  LA
Sbjct: 25  GIRFATGGGDQKIRIWSMKSVAKDNDSDDSSQRLLATIRDHFGTVNCVRWAH--HGRYLA 82

Query: 396 SCSFDGKVIVWKE--------------GNQNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
           S S D  + + +                +   W        H + V  ++W+P +    L
Sbjct: 83  SGSDDQVIQIHERKAGTGTSEFGSGEPPDVENWKVVMTLRGHTADVVDLNWSPDD--STL 140

Query: 534 ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
           A GS D  + +++  +  G  TA + + H   V  V+W P       +GS        +A
Sbjct: 141 ASGSLDNTVHIWSMAN--GICTA-VLRGHSSLVKGVTWDP-------IGS-------FIA 183

Query: 714 SAGCDNTVKVWKL--YNGVWKMDCFPALQMHTNWVRDVAWAP 833
           S   D TV +W+   ++   + +   +  + + + R +AW+P
Sbjct: 184 SQSDDKTVIIWRTSDWSLAHRTEGHWSKSLGSTFFRRLAWSP 225



>gb:BC051783_2550450 Danio rerio zgc:56312, mRNA (cDNA clone MGC:56312
            IMAGE:5603337), complete cds.
          Length = 347

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 75/287 (26%), Positives = 116/287 (40%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A++  D  I +  V  +   ++ ATL GH G V ++ +   
Sbjct: 53   SGHEGEVYCCKFHPNGATLASSGYDRLILMWNVYGDC--ENYATLKGHSGAVMELHYNTD 110

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GSLL S S D  V VW   +     +      H S VNS    P   G  LAC GS D
Sbjct: 111  --GSLLFSASTDKTVCVW---DSETGERVKRLKGHTSFVNSCF--PARRGPQLACTGSDD 163

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + +        WD  +    H    T            ++    +D   ++ S G DN
Sbjct: 164  GTVKL--------WDIRKKASVHTFQNTY----------QVLSVTFNDTSDQIISGGIDN 205

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L           ++Q H + V  ++    L    S + S S D  V +W +   
Sbjct: 206  DIKVWDLRQN----KLIYSMQGHGDSVTGLS----LSADGSYLLSNSMDNSVRVWDIRPF 257

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 258  APKERCVKIFQGNV-HNFEKNLLRCSWSADGSKIAAGSADRFVYIWD 303



>gb:BC066132_2554253 Xenopus tropicalis hypothetical protein MGC76037,
            mRNA (cDNA clone MGC:76037 IMAGE:5385003), complete
            cds.>gb:BC077270_2559984 Xenopus laevis cDNA clone
            MGC:80035 IMAGE:4030874, complete cds.
          Length = 410

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 73/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +   +    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSTISDATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V + P        I S ++D  + IW 
Sbjct: 315  SRDKTIKMWDISIGM----CLMTLVGHDNWVRGVQFHPG----GKFILSCADDKTIRIWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:BC044530_2548832 Danio rerio platelet-activating factor
           acetylhydrolase, isoform Ib, alpha subunit b, mRNA (cDNA
           clone MGC:55898 IMAGE:3818837), complete cds.
          Length = 410

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 65/239 (27%), Positives = 102/239 (42%), Gaps = 6/239 (2%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+D+V D+S D  GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148 GHTDSVQDISFDQTGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  + S S D  + +W+            F  H+  V  +   P++ G  LA  S+D  
Sbjct: 203 NGDHIVSASRDKTMKMWEVAT---GYCVKTFTGHREWVRMV--RPNQDGTLLASCSNDQT 257

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMA-PGALVGSGLHD-----PVQKLASA 719
           + V+   +    +     + H   V  +SWAP  A P     +G  +     P   L S 
Sbjct: 258 VRVWVVATK---ECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSG 314

Query: 720 GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             D T+K+W +  G+    C   L  H NWVR V + P        + S ++D  + IW
Sbjct: 315 SRDKTIKMWDISTGM----CLMTLVGHDNWVRGVLFHPG----GRFVVSCADDKTLRIW 365



 Score = 35.0 bits (79), Expect = 2.8
 Identities = 27/83 (32%), Positives = 38/83 (45%)
 Frame = +3

Query: 786  ALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWR 965
            AL  H + V  V + P   L    + SASED  + +W    E   +E + L      V  
Sbjct: 103  ALSGHRSPVTRVIFHPVFSL----MVSASEDATIKVWDY--EAGDFE-RTLKGHTDSVQD 155

Query: 966  VSWSLTGNLLAVASGDNNVTLWN 1034
            +S+  TG LLA  S D  + LW+
Sbjct: 156  ISFDQTGKLLASCSADMTIKLWD 178



>gb:AF325901_1786615 Arabidopsis thaliana seh1-like protein mRNA,
            complete cds.
          Length = 326

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 66/308 (21%), Positives = 120/308 (38%), Gaps = 31/308 (10%)
 Frame = +3

Query: 225  SMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT--LAGHHGPVWQVSWAHPKFGSLLAS 398
            S +  G R+A  S +  + I   S +S+S    T  +      + ++ W   ++G  +A 
Sbjct: 16   SWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIVKIVWLPSEYGDAVAC 75

Query: 399  CSFDGKVIVWKEGNQN----EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISV 566
               DG + +W+E +++    EW       +  S V  + +      L +    SDG + V
Sbjct: 76   VCEDGSLSIWEELSEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRKSLKMVAAYSDGYLRV 135

Query: 567  YTARSD---GGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            +   +      W   + +  + I   +    PS    ++  + +    Q+ +     N+ 
Sbjct: 136  FELLNPLELKNWQL-QAEFQNVIDSLSTLGKPSSLSASVSWNPMKGEEQEPSFVLTFNSD 194

Query: 738  KVWKLYNGVWKMDCFPALQMHTNW---------------VRDVAWAPNLGLPKSTIASAS 872
                  +  W+ D     + H  W               V  ++WAPN+G P   +A A+
Sbjct: 195  SPHLNSSKNWEFD-----EAHNRWLAVAELALPEDKGDPVYALSWAPNIGRPYEVVAVAT 249

Query: 873  EDGKVVIWTVAKEGDQWEGKV-------LYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              G + IW V    D  EG++       L      VW++ W ++G  LA    D  V LW
Sbjct: 250  HKG-IGIWHVGLAPDL-EGRLPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVKLW 307

Query: 1032 NEAVDGEW 1055
               ++GEW
Sbjct: 308  QSNLNGEW 315



>pir|AF1890|AF1890 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120)>gb:BA000019_681663 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 265

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 71/276 (25%), Positives = 120/276 (43%), Gaps = 5/276 (1%)
 Frame = +3

Query: 222  VSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASC 401
            ++M   G+ + + S D  IK+  +  N+    ++TL GH   V  V  A    G L+AS 
Sbjct: 4    LAMSVDGRILVSGSWDNRIKLWNLETNTL---ISTLDGHKDDVQTV--AISPNGKLVASG 58

Query: 402  SFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARS 581
            S D  + +W      +         +     SI+++P      L  GS++G+I ++    
Sbjct: 59   SADNTIKLWNLDTHKQLLTLQ----NADWARSIAFSPDNQ--TLVSGSTNGSIKIW---- 108

Query: 582  DGGWDTARIDQAHPIGV-TAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYN 758
                   ++    PI + T +  + ++    +   G     Q LAS   D T+K+W    
Sbjct: 109  -------QLTTPRPIPLYTIIGHSQAVRSVVISPDG-----QTLASGSVDQTIKLWS--- 153

Query: 759  GVWK-MDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKV 935
              W+  +    L  H+  V  VA++PN      T+AS S D  +  W +A       G++
Sbjct: 154  --WRDRNLLRTLTGHSGAVWSVAFSPN----GQTLASGSNDRTIKRWDIAT------GQL 201

Query: 936  LYDF---NTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            + +F     PVW V++S  G  LA  SGD  + LW+
Sbjct: 202  IDNFVGHTNPVWSVTFSPDGQTLASGSGDQTIKLWS 237



 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 65/238 (27%), Positives = 99/238 (41%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH D V  V++   GK VA+ S+D +IK+    N  T + L TL       W  S A   
Sbjct: 38  GHKDDVQTVAISPNGKLVASGSADNTIKLW---NLDTHKQLLTLQNAD---WARSIAFSP 91

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
               L S S +G + +W+          +    H  +V S+  +P   G  LA GS D  
Sbjct: 92  DNQTLVSGSTNGSIKIWQLTTPRP-IPLYTIIGHSQAVRSVVISPD--GQTLASGSVDQT 148

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
           I +++ R      T         G +   W+ + +P            Q LAS   D T+
Sbjct: 149 IKLWSWRDRNLLRTLT-------GHSGAVWSVAFSPNG----------QTLASGSNDRTI 191

Query: 738 KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
           K W +  G   +D F     HTN V  V ++P+      T+AS S D  + +W++  +
Sbjct: 192 KRWDIATGQL-IDNFVG---HTNPVWSVTFSPD----GQTLASGSGDQTIKLWSIKSD 241



>gb:AJ719937_2502124 Gallus gallus mRNA for hypothetical protein,
            clone 8j10.
          Length = 473

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 78/277 (28%), Positives = 109/277 (39%), Gaps = 9/277 (3%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 236  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 289

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 290  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 343

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD- 776
                Q H   V A+ W P+   G L           LAS   D T+K+W +     K D 
Sbjct: 344  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSM-----KQDS 381

Query: 777  CFPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLY 941
            C   LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++
Sbjct: 382  CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWGVDR------GICIH 435

Query: 942  DFNT---PVWRVSWSLTGNLLAVASGDNNVTLWNEAV 1043
                   PV+ V++S  G  LA  S D  V +WN  V
Sbjct: 436  TLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQV 472



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 69/251 (27%), Positives = 92/251 (36%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK--EGNQNEWTQA---HVFND----- 476
            L GH   V+  +W       LLAS S D    +W   E + +  TQ    H   +     
Sbjct: 164  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDV 221

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 222  PSNKDVTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW-- 273

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 274  ------------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQS 317

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V K G     K        V  + W  TGNLLA  S D
Sbjct: 318  N-----NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDD 369

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 370  MTLKIWSMKQD 380



>gb:AF268193_1893996 Homo sapiens IRA1 mRNA, complete cds,
            alternatively spliced.
          Length = 514

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 75/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 237  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 290

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 291  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 344

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+K+W +       +C
Sbjct: 345  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSMKQD----NC 383

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 384  VHDLQQHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 437

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 438  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 69/251 (27%), Positives = 92/251 (36%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK--EGNQNEWTQA---HVFND----- 476
            L GH   V+  +W       LLAS S D    +W   E + +  TQ    H   +     
Sbjct: 165  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDV 222

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 223  PSNKDVTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW-- 274

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 275  ------------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQS 318

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V K G     K        V  + W  TGNLLA  S D
Sbjct: 319  N-----NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDD 370

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 371  MTLKIWSMKQD 381



>gb:AK002371_1151155 Mus musculus adult male kidney cDNA, RIKEN
            full-length enriched library, clone:0610009C03 product:U5
            SNRNP-SPECIFIC 40 KDA PROTEIN homolog [Homo sapiens],
            full insert sequence.
          Length = 370

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 76/292 (26%), Positives = 118/292 (40%), Gaps = 7/292 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A+A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 64   SGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 121

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GS+L S S D  V VW   +     +      H S VNS    P   G  L C GS D
Sbjct: 122  --GSMLFSASTDKTVAVW---DSETGERVKRLKGHTSFVNSCY--PARRGPQLVCTGSDD 174

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V AV++              +D   ++ S G DN
Sbjct: 175  GTVKLWDIRKRAAVQTFQ----NTYQVLAVTF--------------NDTSDQIISGGIDN 216

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            ++ H + V D++    L    S + S + D  V +W V   
Sbjct: 217  DIKVWDLRQNKLTY----TMRGHADSVTDLS----LSSEGSYLLSNAMDNTVRVWDVRPF 268

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W    +G
Sbjct: 269  APKERCVKIFQGNV-HNFEKNLLRCSWSPDGSKIAAGSADRFVYVWTPQAEG 319



>gb:BC073215_2557068 Xenopus laevis cDNA clone MGC:80502
            IMAGE:5156883, complete cds.
          Length = 522

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 75/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 245  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 298

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 299  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 352

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+K+W + +      C
Sbjct: 353  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSMKHDT----C 391

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 392  VHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 445

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 446  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 478



 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 68/247 (27%), Positives = 91/247 (36%), Gaps = 11/247 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK--EGNQNEWTQA---HVFND----- 476
            L GH   V+  +W       LLAS S D    +W   E + +  TQ    H   +     
Sbjct: 173  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDV 230

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 231  PSNKDVTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW-- 282

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 283  ------------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQS 326

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V K G     K        V  + W  TGNLLA  S D
Sbjct: 327  N-----NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDD 378

Query: 1014 NNVTLWN 1034
              + +W+
Sbjct: 379  MTLKIWS 385



>gb:AY225088_2520401 Xenopus laevis nuclear receptor co-repressor
            complex subunit TBLR1 mRNA, complete cds.
          Length = 519

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 75/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 242  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 295

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 296  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 349

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+K+W + +      C
Sbjct: 350  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSMKHDT----C 388

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 389  VHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 442

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 443  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 475



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 69/253 (27%), Positives = 92/253 (36%), Gaps = 11/253 (4%)
 Frame = +3

Query: 309  SQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK--EGNQNEWTQA---HVFN 473
            S     L GH   V+  +W       LLAS S D    +W   E + +  TQ    H   
Sbjct: 164  SSKAVVLRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIR 221

Query: 474  D------HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVT 635
            +          V S+ W  +  G  LA GS DG   ++T   DG   +       PI   
Sbjct: 222  EGGQDVPSNKDVTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--F 275

Query: 636  AVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVR 815
            A+ W              +     + SAG D T  +W  + G  K   FP    H+    
Sbjct: 276  ALKW--------------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPAL 317

Query: 816  DVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLL 995
            DV W  N     +T AS S D  +    V K G     K        V  + W  TGNLL
Sbjct: 318  DVDWQSN-----NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLL 369

Query: 996  AVASGDNNVTLWN 1034
            A  S D  + +W+
Sbjct: 370  ASCSDDMTLKIWS 382



>gb:AF268195_2060958 Mus musculus strain BALB/c IRA1 mRNA, complete
            cds.
          Length = 514

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 75/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 237  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 290

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 291  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 344

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+K+W +       +C
Sbjct: 345  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSMKQD----NC 383

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 384  VHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 437

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 438  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 77/306 (25%), Positives = 111/306 (36%), Gaps = 2/306 (0%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQK--IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST 308
            +HT +   D + ++P+ K  +  GH   V   + +     + + S D++ +I  +S NST
Sbjct: 144  NHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDLLVSGSGDSTARIWNLSENST 203

Query: 309  SQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSS 488
            S          GP   V          L  C         +EG Q+              
Sbjct: 204  S----------GPTQLV----------LRHCI--------REGGQDV--------PSNKD 227

Query: 489  VNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPG 668
            V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W       
Sbjct: 228  VTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW------- 274

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
                   +     + SAG D T  +W  + G  K   FP    H+    DV W  N    
Sbjct: 275  -------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQSN---- 319

Query: 849  KSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTL 1028
             +T AS S D  +    V K G     K        V  + W  TGNLLA  S D  + +
Sbjct: 320  -NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI 375

Query: 1029 WNEAVD 1046
            W+   D
Sbjct: 376  WSMKQD 381



>gb:AX882446_1478938 Sequence 17351 from Patent
            EP1074617.>gb:AK022956_1909398 Homo sapiens cDNA FLJ12894
            fis, clone NT2RP2004170, moderately similar to Homo
            sapiens mRNA for transducin (beta) like 1 protein.
          Length = 514

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 75/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 237  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 290

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 291  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 344

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+K+W +       +C
Sbjct: 345  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSMKQD----NC 383

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 384  VHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 437

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 438  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 69/251 (27%), Positives = 92/251 (36%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK--EGNQNEWTQA---HVFND----- 476
            L GH   V+  +W       LLAS S D    +W   E + +  TQ    H   +     
Sbjct: 165  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDV 222

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 223  PSNKDVTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW-- 274

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 275  ------------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQS 318

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V K G     K        V  + W  TGNLLA  S D
Sbjct: 319  N-----NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDD 370

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 371  MTLKIWSMKQD 381



>sp|P74442|Y143_SYNY3 Hypothetical WD-repeat protein
            slr0143.>pir|S76414|S76414 beta transducin-like protein,
            132K - Synechocystis sp.  (strain PCC
            6803)>gb:BA000022_689324 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 1191

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 65/238 (27%), Positives = 104/238 (43%), Gaps = 3/238 (1%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
            L GH   V  V+ +  K  +L+AS S DG V +W    Q E+ +   F  H  S+  + +
Sbjct: 556  LTGHRDGVTSVAISSHK--NLIASASRDGTVHLWTP--QGEFLRE--FTGHTGSIYRVDF 609

Query: 507  APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG 686
            +P+  G   A    D  + ++    DG  +  +  + H   V +VS++P           
Sbjct: 610  SPN--GKIFATAGQDQTVKIWDL--DG--NLLQTLKGHQDSVYSVSFSPDG--------- 654

Query: 687  LHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS 866
                 + LAS   D TV++W   +G         L  HT  V D  ++P+      T+ S
Sbjct: 655  -----EILASTSRDRTVRLWHWRSG----KTLAVLGGHTKSVDDAQFSPD----GQTLVS 701

Query: 867  ASEDGKVVIWTVAKEGDQWEGKVLYDFNTP---VWRVSWSLTGNLLAVASGDNNVTLW 1031
               DG++ +W +       +G ++  F  P    + V+W   GNLLAVA+ D  V LW
Sbjct: 702  VCRDGQIRLWDL-------DGNLIRQFGLPEVAFFGVNWHPNGNLLAVAADDGTVRLW 752



 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 73/283 (25%), Positives = 117/283 (41%), Gaps = 3/283 (1%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGH+ +++ V     GK  ATA  D ++KI  +  N     L TL GH   V+ VS++  
Sbjct: 598  TGHTGSIYRVDFSPNGKIFATAGQDQTVKIWDLDGNL----LQTLKGHQDSVYSVSFSPD 653

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G +LAS S D  V +W   +        V   H  SV+   ++P    L   C   DG
Sbjct: 654  --GEILASTSRDRTVRLW---HWRSGKTLAVLGGHTKSVDDAQFSPDGQTLVSVC--RDG 706

Query: 555  NISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
             I ++    DG       +     G+  V         A  G   H     LA A  D T
Sbjct: 707  QIRLWDL--DG-------NLIRQFGLPEV---------AFFGVNWHPNGNLLAVAADDGT 748

Query: 735  VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG 914
            V++W         +    L  H  +V  V + P+       + S+S +G V+ W+ +   
Sbjct: 749  VRLWTPQG-----EIKATLSGHDEFVTRVVFTPD----GKQLFSSSSNGSVIHWSTS--- 796

Query: 915  DQWEGKVLYDFN---TPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                GK+L  +      ++ ++ +  G LLA+ + +N V +W+
Sbjct: 797  ----GKMLKKYQGYPEAIFGLALASNGALLAIGAENNLVKVWD 835



>sp|Q8BHJ5|TBLR_MOUSE F-box-like/WD-repeat protein TBLR1 (Nuclear
            receptor corepressor/HDAC3 complex subunit TBLR1)
            (TBL1-related protein 1).>gb:AK029595_1161569 Mus
            musculus adult male testis cDNA, RIKEN full-length
            enriched library, clone:4930407K10 product:IRA1 protein,
            full insert sequence.>gb:AK033347_1163286 Mus musculus 15
            days embryo male testis cDNA, RIKEN full-length enriched
            library, clone:8030499H02 product:IRA1 protein, full
            insert sequence.>gb:BC087181_2565038 Xenopus laevis
            hypothetical LOC495857, mRNA (cDNA clone MGC:97978
            IMAGE:7198109), complete cds.
          Length = 514

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 75/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 237  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 290

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 291  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 344

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+K+W +       +C
Sbjct: 345  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSMKQD----NC 383

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 384  VHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 437

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 438  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 78/306 (25%), Positives = 112/306 (36%), Gaps = 2/306 (0%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQK--IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST 308
            +HT +   D + ++P+ K  +  GH   V   + +     +A+ S D++ +I  +S NST
Sbjct: 144  NHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENST 203

Query: 309  SQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSS 488
            S          GP   V          L  C         +EG Q+              
Sbjct: 204  S----------GPTQLV----------LRHCI--------REGGQDV--------PSNKD 227

Query: 489  VNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPG 668
            V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W       
Sbjct: 228  VTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW------- 274

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
                   +     + SAG D T  +W  + G  K   FP    H+    DV W  N    
Sbjct: 275  -------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQSN---- 319

Query: 849  KSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTL 1028
             +T AS S D  +    V K G     K        V  + W  TGNLLA  S D  + +
Sbjct: 320  -NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKI 375

Query: 1029 WNEAVD 1046
            W+   D
Sbjct: 376  WSMKQD 381



>sp|Q9BZK7|TBLR_HUMAN F-box-like/WD-repeat protein TBLR1 (Nuclear
            receptor corepressor/HDAC3 complex subunit TBLR1)
            (TBL1-related protein 1).>gb:AF314544_1896406 Homo
            sapiens nuclear receptor co-repressor/HDAC3 complex
            subunit TBLR1 (TBLR1) mRNA, complete cds.
          Length = 514

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 75/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 237  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 290

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 291  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 344

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+K+W +       +C
Sbjct: 345  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLKIWSMKQD----NC 383

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 384  VHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 437

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 438  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 69/251 (27%), Positives = 92/251 (36%), Gaps = 11/251 (4%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK--EGNQNEWTQA---HVFND----- 476
            L GH   V+  +W       LLAS S D    +W   E + +  TQ    H   +     
Sbjct: 165  LRGHESEVFICAWN--PVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDV 222

Query: 477  -HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAP 653
                 V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W  
Sbjct: 223  PSNKDVTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW-- 274

Query: 654  SMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAP 833
                        +     + SAG D T  +W  + G  K   FP    H+    DV W  
Sbjct: 275  ------------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQS 318

Query: 834  NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGD 1013
            N     +T AS S D  +    V K G     K        V  + W  TGNLLA  S D
Sbjct: 319  N-----NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDD 370

Query: 1014 NNVTLWNEAVD 1046
              + +W+   D
Sbjct: 371  MTLKIWSMKQD 381



>gb:AC024818_1204836 Caenorhabditis elegans cosmid Y54H5A, complete
           sequence.
          Length = 453

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 49/189 (25%), Positives = 84/189 (44%), Gaps = 2/189 (1%)
 Frame = +3

Query: 357 VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQ-AHVFNDHKSSVNSISWAPHELGLCL 533
           ++W+  K G L A+     K+ +W+     +W   A+    HK SV  ++W+P E GL  
Sbjct: 234 LAWSSLKTGDL-ATGDIIKKIYLWQMKEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLA 292

Query: 534 ACGSSDGNISVYTARS-DGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
           +C S+DG+I ++  RS         + +AH   V  +SW              H+ +  +
Sbjct: 293 SC-SADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISW------------NRHENL--I 337

Query: 711 ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
            S G D  +K+W L   +         + H + +  V W P+     +T  ++ ED +  
Sbjct: 338 VSGGDDGELKIWSL-KTIQFGQPVALFKYHNSPITSVDWHPH---ETTTFMASGEDDQTT 393

Query: 891 IWTVAKEGD 917
           IW +A E D
Sbjct: 394 IWDIATEAD 402



 Score = 39.7 bits (91), Expect = 0.11
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 2/111 (1%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNG-VWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
            LA+      + +W++  G  W +   P L  H   V D+AW+P        +AS S DG 
Sbjct: 244  LATGDIIKKIYLWQMKEGGQWAVGANP-LTGHKKSVEDLAWSPT---ETGLLASCSADGS 299

Query: 885  VVIW-TVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            + +W T +   D     V     + V  +SW+   NL+     D  + +W+
Sbjct: 300  IKLWDTRSAPKDACVCTVQKAHESDVNVISWNRHENLIVSGGDDGELKIWS 350



>gb:AF164430_1246631 Caenorhabditis elegans LIS-1 (lis-1) mRNA,
           complete cds.>gb:CET03F6_1367086 Caenorhabditis elegans
           cosmid T03F6, complete sequence.
          Length = 404

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 61/239 (25%), Positives = 101/239 (42%), Gaps = 1/239 (0%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+D V+D+++D  GK++ + SSD SIK+       T   L +L GH   V  V++    
Sbjct: 146 GHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDF--GQTYDCLKSLKGHEHTVSSVTFL--P 201

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  + S S D  +  W   + +     + F  H   V  I  +    G   A  S D  
Sbjct: 202 TGDFVLSASRDHTIKQW---DISTGYCVYTFRGHNDWVRMIRISND--GTLFASASLDQT 256

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLH-DPVQKLASAGCDNT 734
           ++V++  +        + + H   V  V WAP  A   + G     +    L S   D +
Sbjct: 257 VTVWSFATK---SAKLVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRS 313

Query: 735 VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
           +K W +  G    D    L  H NWVR +A+ P        + S ++D  + +W ++ +
Sbjct: 314 IKAWNINTG----DVLFTLLAHENWVRGLAFHPK----GKYLISVADDKTLRVWELSAQ 364



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 69/252 (27%), Positives = 107/252 (42%), Gaps = 16/252 (6%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSIS 503
            L GH  P+ +V + HP + +++ASCS D  + VW  E  Q E T       H  +VN I 
Sbjct: 102  LTGHRLPITRVIF-HPLW-TIMASCSEDATIKVWDYETGQLERT----LKGHTDAVNDI- 154

Query: 504  WAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGS 683
             A    G  L   SSD +I ++       +D  +  + H   V++V++ P+   G  V  
Sbjct: 155  -AIDAAGKQLVSCSSDLSIKLWDFGQT--YDCLKSLKGHEHTVSSVTFLPT---GDFV-- 206

Query: 684  GLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIA 863
                      SA  D+T+K W +  G     C    + H +WVR +     +    +  A
Sbjct: 207  ---------LSASRDHTIKQWDISTGY----CVYTFRGHNDWVRMI----RISNDGTLFA 249

Query: 864  SASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSW-------SLTG--------NLLA 998
            SAS D  V +W+ A +  +    VL D    V  V W       ++TG        ++L 
Sbjct: 250  SASLDQTVTVWSFATKSAK---LVLRDHEHAVECVEWAPDTAYTNVTGQQPEGNSTHILF 306

Query: 999  VASGDNNVTLWN 1034
              S D ++  WN
Sbjct: 307  SGSRDRSIKAWN 318



>gb:AC114263_1205598 Dictyostelium discoideum chromosome 2 map
           215673-367476 strain AX4, complete sequence.
          Length = 1114

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 43/135 (31%), Positives = 70/135 (51%), Gaps = 8/135 (5%)
 Frame = +3

Query: 189 IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNS-----TSQH---LATLAGHHG 344
           IE  H  +V+ V     GK +A+ S D    I G+SNN+     T+++   +ATL GH  
Sbjct: 63  IENAHFHSVNSVKWSKDGKYLASGSDDKLCMIWGLSNNNSLLKNTTENWVCVATLRGHAS 122

Query: 345 PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELG 524
            + +VSW+       +A+CSFD  +I+W+    N++       +HK  V  ++W P  LG
Sbjct: 123 DISEVSWSPDN--KYIATCSFDKSIIIWE---TNKFQMVSKLEEHKGFVKGLTWDP--LG 175

Query: 525 LCLACGSSDGNISVY 569
             LA  S D ++ ++
Sbjct: 176 RYLASQSEDKSLIIW 190



 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 56/243 (23%), Positives = 93/243 (38%), Gaps = 24/243 (9%)
 Frame = +3

Query: 369  HPKFGSLLASCSFDGKVIVWK-------EGNQNEWTQ---AHVFNDHKSSVNSISWAPHE 518
            HP  G+ +A+   D K+ +W        E  ++         + N H  SVNS+ W+   
Sbjct: 22   HPD-GTRVATGGGDAKIKIWSMAPISLLEAEEDAGIPKLLCSIENAHFHSVNSVKWSKD- 79

Query: 519  LGLCLACGSSD--------GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL 674
             G  LA GS D         N +     +   W      + H   ++ VSW+P       
Sbjct: 80   -GKYLASGSDDKLCMIWGLSNNNSLLKNTTENWVCVATLRGHASDISEVSWSPDN----- 133

Query: 675  VGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKS 854
                     + +A+   D ++ +W+      K      L+ H  +V+ + W P LG    
Sbjct: 134  ---------KYIATCSFDKSIIIWETN----KFQMVSKLEEHKGFVKGLTWDP-LG---R 176

Query: 855  TIASASEDGKVVIWTVAKEGDQWEGKVL------YDFNTPVWRVSWSLTGNLLAVASGDN 1016
             +AS SED  ++IW  +     W  + +      +  N+   R SW+  G  +    G N
Sbjct: 177  YLASQSEDKSLIIWRTS----DWVVETIVTEPFKHSGNSFFLRPSWTPDGQFIVATHGIN 232

Query: 1017 NVT 1025
            N T
Sbjct: 233  NAT 235



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 46/183 (25%), Positives = 75/183 (40%), Gaps = 10/183 (5%)
 Frame = +3

Query: 513  HELGLCLACGSSDGNISVYT--------ARSDGGWDT--ARIDQAHPIGVTAVSWAPSMA 662
            H  G  +A G  D  I +++        A  D G       I+ AH   V +V W+    
Sbjct: 22   HPDGTRVATGGGDAKIKIWSMAPISLLEAEEDAGIPKLLCSIENAHFHSVNSVKWSKD-- 79

Query: 663  PGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLG 842
             G  + SG  D +  +     +N++    L N      C   L+ H + + +V+W+P+  
Sbjct: 80   -GKYLASGSDDKLCMIWGLSNNNSL----LKNTTENWVCVATLRGHASDISEVSWSPD-- 132

Query: 843  LPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNV 1022
                 IA+ S D  ++IW   K   Q   K L +    V  ++W   G  LA  S D ++
Sbjct: 133  --NKYIATCSFDKSIIIWETNKF--QMVSK-LEEHKGFVKGLTWDPLGRYLASQSEDKSL 187

Query: 1023 TLW 1031
             +W
Sbjct: 188  IIW 190



 Score = 40.4 bits (93), Expect = 0.067
 Identities = 42/171 (24%), Positives = 67/171 (39%), Gaps = 23/171 (13%)
 Frame = +3

Query: 210 TVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH---------LATLA-GHHGPVWQV 359
           +++ + +   G RVAT   DA IKI  ++  S  +          L ++   H   V  V
Sbjct: 15  SIYSIDIHPDGTRVATGGGDAKIKIWSMAPISLLEAEEDAGIPKLLCSIENAHFHSVNSV 74

Query: 360 SWAHPKFGSLLASCSFDGKVIVWKEGNQN--------EWTQAHVFNDHKSSVNSISWAPH 515
            W+  K G  LAS S D   ++W   N N         W        H S ++ +SW+P 
Sbjct: 75  KWS--KDGKYLASGSDDKLCMIWGLSNNNSLLKNTTENWVCVATLRGHASDISEVSWSPD 132

Query: 516 ELGLCLACGSSDGNISVYTARSDGGWDTARID-----QAHPIGVTAVSWAP 653
                +A  S D +I +        W+T +       + H   V  ++W P
Sbjct: 133 --NKYIATCSFDKSIII--------WETNKFQMVSKLEEHKGFVKGLTWDP 173



 Score = 33.5 bits (75), Expect = 8.2
 Identities = 28/133 (21%), Positives = 52/133 (39%), Gaps = 18/133 (13%)
 Frame = +3

Query: 687  LHDPVQKLASAGCDNTVKVWKLYN----------GVWKMDCFPALQMHTNWVRDVAWAPN 836
            +H    ++A+ G D  +K+W +            G+ K+ C      H + V  V W+ +
Sbjct: 21   IHPDGTRVATGGGDAKIKIWSMAPISLLEAEEDAGIPKLLC-SIENAHFHSVNSVKWSKD 79

Query: 837  LGLPKSTIASASEDGKVVIWTVAKEGDQWEGKV--------LYDFNTPVWRVSWSLTGNL 992
                   +AS S+D   +IW ++      +           L    + +  VSWS     
Sbjct: 80   ----GKYLASGSDDKLCMIWGLSNNNSLLKNTTENWVCVATLRGHASDISEVSWSPDNKY 135

Query: 993  LAVASGDNNVTLW 1031
            +A  S D ++ +W
Sbjct: 136  IATCSFDKSIIIW 148



>gb:AP003517_1830286 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC
            clone:OSJNBa0062J02.>gb:AP005453_1852064 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0453H04.
          Length = 654

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 65/263 (24%), Positives = 114/263 (43%)
 Frame = +3

Query: 117  HSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVS 296
            + L QG+ T   S+   GK P    + GHS  V+  +   +G  + ++SSD++I++    
Sbjct: 381  NGLSQGERT---SASDYGKRPYTLFQ-GHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTK 436

Query: 297  NNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND 476
             N+   +L    GH+ PVW V ++    G   AS S D    +W   + ++     +   
Sbjct: 437  LNA---NLVCYKGHNYPVWDVQFS--PVGHYFASASHDRTARIW---SMDKIQPLRIMAG 488

Query: 477  HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS 656
            H S V+ + W  H     +A GSSD  + ++  ++    +  R+   H   V +++ +P 
Sbjct: 489  HLSDVDCVQW--HVNCNYIATGSSDKTVRLWDVQTG---ECIRMFIGHRSMVLSLAMSPD 543

Query: 657  MAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN 836
                           + +AS   D T+ +W L +G     C   L  H++ V    W+  
Sbjct: 544  --------------GRYMASGDEDGTIMMWDLSSG----RCVSPLGGHSSCV----WSLA 581

Query: 837  LGLPKSTIASASEDGKVVIWTVA 905
                 + +AS S D  V +W VA
Sbjct: 582  YSCEGALLASGSADCTVKLWDVA 604



 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 73/301 (24%), Positives = 116/301 (38%), Gaps = 29/301 (9%)
 Frame = +3

Query: 225  SMDYYGKRVATASSDASIKIIGVSN-------------NSTSQHLATLA----------- 332
            S+ + G  V    SD+S+K+  +S              N  SQ   T A           
Sbjct: 343  SISHDGSLVVGGFSDSSVKVWDMSKIGQPPKTSSPQGENGLSQGERTSASDYGKRPYTLF 402

Query: 333  -GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEG-NQNEWTQAHVFNDHKSSVNSISW 506
             GH GPV+  +++   FG  L S S D  + +W    N N       +  H   V  + +
Sbjct: 403  QGHSGPVYSAAFS--PFGDFLLSSSSDSTIRLWSTKLNAN----LVCYKGHNYPVWDVQF 456

Query: 507  APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG 686
            +P  +G   A  S D    +++          RI   H   V  V W             
Sbjct: 457  SP--VGHYFASASHDRTARIWSMDKI---QPLRIMAGHLSDVDCVQW------------- 498

Query: 687  LHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS 866
             H     +A+   D TV++W +  G    +C      H + V  +A +P+       +AS
Sbjct: 499  -HVNCNYIATGSSDKTVRLWDVQTG----ECIRMFIGHRSMVLSLAMSPD----GRYMAS 549

Query: 867  ASEDGKVVIWTVAKEGDQWEGKV---LYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
              EDG +++W ++       G+    L   ++ VW +++S  G LLA  S D  V LW+ 
Sbjct: 550  GDEDGTIMMWDLSS------GRCVSPLGGHSSCVWSLAYSCEGALLASGSADCTVKLWDV 603

Query: 1038 A 1040
            A
Sbjct: 604  A 604



>gb:CEF55B12_1364502 Caenorhabditis elegans cosmid F55B12, complete
            sequence.
          Length = 585

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 69/284 (24%), Positives = 116/284 (40%), Gaps = 8/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+ TV  ++M   G  + T S D ++++  V +    +HLATL GHH  V  V +    
Sbjct: 334  GHTSTVRCMAMA--GSILVTGSRDTTLRVWDVESG---RHLATLHGHHAAVRCVQFD--- 385

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+ + S  +D  V +W   N +          H + V S+ +      +C   GS D +
Sbjct: 386  -GTTVVSGGYDFTVKIW---NAHTGRCIRTLTGHNNRVYSLLFESERSIVC--SGSLDTS 439

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I V+      G +   + Q H                  + SG+      L S   D+ V
Sbjct: 440  IRVWDFTRPEGQECVALLQGH----------------TSLTSGMQLRGNILVSCNADSHV 483

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            +VW ++ G     C   L  H + +  + W       ++ +A++S+DG V +W + +   
Sbjct: 484  RVWDIHEGT----CVHMLSGHRSAITSLQW-----FGRNMVATSSDDGTVKLWDIER--- 531

Query: 918  QWEGKVLYDFNT--------PVWRVSWSLTGNLLAVASGDNNVT 1025
               G ++ D  T         +WR+    T  +LA A G  N T
Sbjct: 532  ---GALIRDLVTLDSGGNGGCIWRL--CSTSTMLACAVGSRNNT 570



 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 81/313 (25%), Positives = 120/313 (38%), Gaps = 16/313 (5%)
 Frame = +3

Query: 144  FIRSSDKEGKMPAQKIET--------------GHSDTVHDVSMDYYGKRVATASSDASIK 281
            F R++DK   + A KIE               GH D V    M  +   + T S D ++K
Sbjct: 219  FERAADKSRYLRADKIEKNWNANPIMGSAVLRGHEDHVI-TCMQIHDDVLVTGSDDNTLK 277

Query: 282  IIGVSNNSTSQHLATLAGHHGPVW--QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWT 455
            +  +        + TL GH G VW  Q+S    + G  + S S D  V VW   +  + +
Sbjct: 278  VWCIDKGEV---MYTLVGHTGGVWTSQIS----QCGRYIVSGSTDRTVKVW---STVDGS 327

Query: 456  QAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVT 635
              H    H S+V  ++ A    G  L  GS D  + V+   S     T      H   V 
Sbjct: 328  LLHTLQGHTSTVRCMAMA----GSILVTGSRDTTLRVWDVESGRHLATLH---GHHAAVR 380

Query: 636  AVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVR 815
             V +      G  V SG           G D TVK+W  + G     C   L  H N V 
Sbjct: 381  CVQF-----DGTTVVSG-----------GYDFTVKIWNAHTG----RCIRTLTGHNNRVY 420

Query: 816  DVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLL 995
             + +       +S + S S D  + +W   +   Q E   L   +T +      L GN+L
Sbjct: 421  SLLFESE----RSIVCSGSLDTSIRVWDFTRPEGQ-ECVALLQGHTSLTS-GMQLRGNIL 474

Query: 996  AVASGDNNVTLWN 1034
               + D++V +W+
Sbjct: 475  VSCNADSHVRVWD 487



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 32/125 (25%), Positives = 61/125 (48%)
 Frame = +3

Query: 195 TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
           TGH++ V+ +  +     V + S D SI++   +     + +A L GH      ++    
Sbjct: 413 TGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTS----LTSGMQ 468

Query: 375 KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
             G++L SC+ D  V VW   + +E T  H+ + H+S++ S+ W    +   +A  S DG
Sbjct: 469 LRGNILVSCNADSHVRVW---DIHEGTCVHMLSGHRSAITSLQWFGRNM---VATSSDDG 522

Query: 555 NISVY 569
            + ++
Sbjct: 523 TVKLW 527



>gb:AK036064_1164339 Mus musculus 16 days neonate cerebellum cDNA,
            RIKEN full-length enriched library, clone:9630032A08
            product:IRA1 protein, full insert sequence.
          Length = 514

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 74/273 (27%), Positives = 107/273 (39%), Gaps = 8/273 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +AT S D   +I     N  S    TL  H GP++ + W   K G+ + S   D   
Sbjct: 237  GTLLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWN--KKGNFILSAGVDKTT 290

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            I+W + +  E  Q   F  H +    + W  +      A  S+D  I V     D    T
Sbjct: 291  IIW-DAHTGEAKQQFPF--HSAPALDVDWQSNNT---FASCSTDMCIHVCKLGQDRPIKT 344

Query: 600  ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDC 779
                Q H   V A+ W P+   G L           LAS   D T+++W +       +C
Sbjct: 345  F---QGHTNEVNAIKWDPT---GNL-----------LASCSDDMTLRIWSMKQD----NC 383

Query: 780  FPALQMHTNWVRDVAWAP-----NLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
               LQ H   +  + W+P     N       +ASAS D  V +W V +      G  ++ 
Sbjct: 384  VHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDR------GICIHT 437

Query: 945  FNT---PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                  PV+ V++S  G  LA  S D  V +WN
Sbjct: 438  LTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 78/306 (25%), Positives = 112/306 (36%), Gaps = 2/306 (0%)
 Frame = +3

Query: 135  DHTFIRSSDKEGKMPAQK--IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNST 308
            +HT +   D + ++P+ K  +  GH   V   + +     +A+ S D++ +I  +S NST
Sbjct: 144  NHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENST 203

Query: 309  SQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSS 488
            S          GP   V          L  C         +EG Q+              
Sbjct: 204  S----------GPTQLV----------LRHCI--------REGGQDV--------PSNKD 227

Query: 489  VNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPG 668
            V S+ W  +  G  LA GS DG   ++T   DG   +       PI   A+ W       
Sbjct: 228  VTSLDW--NSEGTLLATGSYDGFARIWT--KDGNLASTLGQHKGPI--FALKW------- 274

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
                   +     + SAG D T  +W  + G  K   FP    H+    DV W  N    
Sbjct: 275  -------NKKGNFILSAGVDKTTIIWDAHTGEAKQQ-FP---FHSAPALDVDWQSN---- 319

Query: 849  KSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTL 1028
             +T AS S D  +    V K G     K        V  + W  TGNLLA  S D  + +
Sbjct: 320  -NTFASCSTDMCI---HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLRI 375

Query: 1029 WNEAVD 1046
            W+   D
Sbjct: 376  WSMKQD 381



>pir|T22703|T22703 hypothetical protein F55B12.3 - Caenorhabditis
            elegans
          Length = 579

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 69/284 (24%), Positives = 116/284 (40%), Gaps = 8/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+ TV  ++M   G  + T S D ++++  V +    +HLATL GHH  V  V +    
Sbjct: 328  GHTSTVRCMAMA--GSILVTGSRDTTLRVWDVESG---RHLATLHGHHAAVRCVQFD--- 379

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+ + S  +D  V +W   N +          H + V S+ +      +C   GS D +
Sbjct: 380  -GTTVVSGGYDFTVKIW---NAHTGRCIRTLTGHNNRVYSLLFESERSIVC--SGSLDTS 433

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I V+      G +   + Q H                  + SG+      L S   D+ V
Sbjct: 434  IRVWDFTRPEGQECVALLQGH----------------TSLTSGMQLRGNILVSCNADSHV 477

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            +VW ++ G     C   L  H + +  + W       ++ +A++S+DG V +W + +   
Sbjct: 478  RVWDIHEGT----CVHMLSGHRSAITSLQW-----FGRNMVATSSDDGTVKLWDIER--- 525

Query: 918  QWEGKVLYDFNT--------PVWRVSWSLTGNLLAVASGDNNVT 1025
               G ++ D  T         +WR+    T  +LA A G  N T
Sbjct: 526  ---GALIRDLVTLDSGGNGGCIWRL--CSTSTMLACAVGSRNNT 564



 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 81/313 (25%), Positives = 120/313 (38%), Gaps = 16/313 (5%)
 Frame = +3

Query: 144  FIRSSDKEGKMPAQKIET--------------GHSDTVHDVSMDYYGKRVATASSDASIK 281
            F R++DK   + A KIE               GH D V    M  +   + T S D ++K
Sbjct: 213  FERAADKSRYLRADKIEKNWNANPIMGSAVLRGHEDHVI-TCMQIHDDVLVTGSDDNTLK 271

Query: 282  IIGVSNNSTSQHLATLAGHHGPVW--QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWT 455
            +  +        + TL GH G VW  Q+S    + G  + S S D  V VW   +  + +
Sbjct: 272  VWCIDKGEV---MYTLVGHTGGVWTSQIS----QCGRYIVSGSTDRTVKVW---STVDGS 321

Query: 456  QAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVT 635
              H    H S+V  ++ A    G  L  GS D  + V+   S     T      H   V 
Sbjct: 322  LLHTLQGHTSTVRCMAMA----GSILVTGSRDTTLRVWDVESGRHLATLH---GHHAAVR 374

Query: 636  AVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVR 815
             V +      G  V SG           G D TVK+W  + G     C   L  H N V 
Sbjct: 375  CVQF-----DGTTVVSG-----------GYDFTVKIWNAHTG----RCIRTLTGHNNRVY 414

Query: 816  DVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLL 995
             + +       +S + S S D  + +W   +   Q E   L   +T +      L GN+L
Sbjct: 415  SLLFESE----RSIVCSGSLDTSIRVWDFTRPEGQ-ECVALLQGHTSLTS-GMQLRGNIL 468

Query: 996  AVASGDNNVTLWN 1034
               + D++V +W+
Sbjct: 469  VSCNADSHVRVWD 481



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 32/125 (25%), Positives = 61/125 (48%)
 Frame = +3

Query: 195 TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
           TGH++ V+ +  +     V + S D SI++   +     + +A L GH      ++    
Sbjct: 407 TGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTS----LTSGMQ 462

Query: 375 KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
             G++L SC+ D  V VW   + +E T  H+ + H+S++ S+ W    +   +A  S DG
Sbjct: 463 LRGNILVSCNADSHVRVW---DIHEGTCVHMLSGHRSAITSLQWFGRNM---VATSSDDG 516

Query: 555 NISVY 569
            + ++
Sbjct: 517 TVKLW 521



>sp|Q93794|SE10_CAEEL F-box/WD-repeat protein sel-10
            (Suppressor/enhancer of lin-12) (Sel-10
            protein).>gb:AF020788_1233356 Caenorhabditis elegans
            SEL-10 (sel-10) mRNA, complete cds.>gb:CEF55B12_1364501
            Caenorhabditis elegans cosmid F55B12, complete sequence.
          Length = 587

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 69/284 (24%), Positives = 116/284 (40%), Gaps = 8/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+ TV  ++M   G  + T S D ++++  V +    +HLATL GHH  V  V +    
Sbjct: 336  GHTSTVRCMAMA--GSILVTGSRDTTLRVWDVESG---RHLATLHGHHAAVRCVQFD--- 387

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+ + S  +D  V +W   N +          H + V S+ +      +C   GS D +
Sbjct: 388  -GTTVVSGGYDFTVKIW---NAHTGRCIRTLTGHNNRVYSLLFESERSIVC--SGSLDTS 441

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            I V+      G +   + Q H                  + SG+      L S   D+ V
Sbjct: 442  IRVWDFTRPEGQECVALLQGH----------------TSLTSGMQLRGNILVSCNADSHV 485

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            +VW ++ G     C   L  H + +  + W       ++ +A++S+DG V +W + +   
Sbjct: 486  RVWDIHEGT----CVHMLSGHRSAITSLQW-----FGRNMVATSSDDGTVKLWDIER--- 533

Query: 918  QWEGKVLYDFNT--------PVWRVSWSLTGNLLAVASGDNNVT 1025
               G ++ D  T         +WR+    T  +LA A G  N T
Sbjct: 534  ---GALIRDLVTLDSGGNGGCIWRL--CSTSTMLACAVGSRNNT 572



 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 81/313 (25%), Positives = 120/313 (38%), Gaps = 16/313 (5%)
 Frame = +3

Query: 144  FIRSSDKEGKMPAQKIET--------------GHSDTVHDVSMDYYGKRVATASSDASIK 281
            F R++DK   + A KIE               GH D V    M  +   + T S D ++K
Sbjct: 221  FERAADKSRYLRADKIEKNWNANPIMGSAVLRGHEDHVI-TCMQIHDDVLVTGSDDNTLK 279

Query: 282  IIGVSNNSTSQHLATLAGHHGPVW--QVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWT 455
            +  +        + TL GH G VW  Q+S    + G  + S S D  V VW   +  + +
Sbjct: 280  VWCIDKGEV---MYTLVGHTGGVWTSQIS----QCGRYIVSGSTDRTVKVW---STVDGS 329

Query: 456  QAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVT 635
              H    H S+V  ++ A    G  L  GS D  + V+   S     T      H   V 
Sbjct: 330  LLHTLQGHTSTVRCMAMA----GSILVTGSRDTTLRVWDVESGRHLATLH---GHHAAVR 382

Query: 636  AVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVR 815
             V +      G  V SG           G D TVK+W  + G     C   L  H N V 
Sbjct: 383  CVQF-----DGTTVVSG-----------GYDFTVKIWNAHTG----RCIRTLTGHNNRVY 422

Query: 816  DVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLL 995
             + +       +S + S S D  + +W   +   Q E   L   +T +      L GN+L
Sbjct: 423  SLLFESE----RSIVCSGSLDTSIRVWDFTRPEGQ-ECVALLQGHTSLTS-GMQLRGNIL 476

Query: 996  AVASGDNNVTLWN 1034
               + D++V +W+
Sbjct: 477  VSCNADSHVRVWD 489



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 32/125 (25%), Positives = 61/125 (48%)
 Frame = +3

Query: 195 TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
           TGH++ V+ +  +     V + S D SI++   +     + +A L GH      ++    
Sbjct: 415 TGHNNRVYSLLFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTS----LTSGMQ 470

Query: 375 KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
             G++L SC+ D  V VW   + +E T  H+ + H+S++ S+ W    +   +A  S DG
Sbjct: 471 LRGNILVSCNADSHVRVW---DIHEGTCVHMLSGHRSAITSLQWFGRNM---VATSSDDG 524

Query: 555 NISVY 569
            + ++
Sbjct: 525 TVKLW 529



>gb:CR382132_1665406 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 624

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 52/201 (25%), Positives = 86/201 (42%), Gaps = 8/201 (3%)
 Frame = +3

Query: 465  VFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVS 644
            VF  H + +N I +    +GL LA  S D ++ ++  RS     T      H   V  V 
Sbjct: 430  VFKGHSAGINDIQF--DHVGLLLASASDDHSVRLWQGRSVASTATLL---GHTAPVMVVR 484

Query: 645  WAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
            W P +    LVG      +  + SA  D T +VW   N      C   L +H + +    
Sbjct: 485  WLPLLNAANLVGGANIGTMSLVVSASLDGTARVWLPENA----RCLAVLALHESAI---- 536

Query: 825  WAPNLGLPKSTIASASEDGKVVIWTVAKEGD-----QWEGKVL--YDFNTPVWRVSWSLT 983
            +A  +   +  +A+   DG +V+W +A   D     +  G+ L   +   P+  + W+L 
Sbjct: 537  FAMEISPDRKWLATGGMDGVLVLWDLAGLEDNECTEEGAGRALARLEIGAPIDCIGWNLE 596

Query: 984  GNLLAV-ASGDNNVTLWNEAV 1043
             +++ V  SG + V  WNE +
Sbjct: 597  SDVICVGTSGKSYVVEWNEGM 617



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 46/151 (30%), Positives = 67/151 (44%), Gaps = 13/151 (8%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKII-GVSNNSTSQHLATLAGHHGPVWQVSW--- 365
           GHS  ++D+  D+ G  +A+AS D S+++  G S  ST    ATL GH  PV  V W   
Sbjct: 433 GHSAGINDIQFDHVGLLLASASDDHSVRLWQGRSVAST----ATLLGHTAPVMVVRWLPL 488

Query: 366 ---------AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHE 518
                    A+    SL+ S S DG   VW   N        V   H+S++ ++  +P  
Sbjct: 489 LNAANLVGGANIGTMSLVVSASLDGTARVWLPENAR---CLAVLALHESAIFAMEISPDR 545

Query: 519 LGLCLACGSSDGNISVYTARSDGGWDTARID 611
               LA G  DG + +        WD A ++
Sbjct: 546 --KWLATGGMDGVLVL--------WDLAGLE 566



>gb:CER06A4_1366510 Caenorhabditis elegans cosmid R06A4, complete
            sequence.
          Length = 809

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 79/332 (23%), Positives = 123/332 (37%), Gaps = 36/332 (10%)
 Frame = +3

Query: 144  FIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA 323
            FIR++  + K P           V+ V     GKR+ T        +     N T+ +  
Sbjct: 124  FIRTAMNKVKCP-----------VYSVCWSPEGKRLITGCQTGEFTLW----NGTAFNFE 168

Query: 324  T-LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKS-SVNS 497
            T L  H   +  + WA  +    L S    G V  W+    N    AH+F+ HK  ++  
Sbjct: 169  TILQAHDSAIRALKWASNE--QWLLSADQGGYVKYWQPNMNN----AHMFSAHKDEAIRG 222

Query: 498  ISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQ-----AHPIGVTAVSWAPSMA 662
            +++AP ++    A  S DG   V        WD AR  +      H   V  + W P+  
Sbjct: 223  LAFAPTDVKFATA--SDDGTARV--------WDFARYTEERVLRGHGAEVRCIDWHPTKG 272

Query: 663  PGALVGSGLHDPVQKLA-----SAGCDNTVKVWKLY--------NGVW------------ 767
               L+ +G  D  Q +      S  C  T++  K          NG W            
Sbjct: 273  ---LIATGSRDTQQPVKIWDPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKM 329

Query: 768  ----KMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKV 935
                 M      + H   V  +AW P   + +    S   DG +V W V  +G++  G +
Sbjct: 330  YDIRMMKEMRTYRAHKKEVISLAWHP---IHEGLFVSGGGDGSIVYWMV--DGEKEIGLL 384

Query: 936  LYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
             +  +  +W + W   G++LA  S DNN   W
Sbjct: 385  EHAHDQAIWSMKWHPLGHILATGSNDNNTKFW 416



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 39/157 (24%), Positives = 61/157 (38%), Gaps = 2/157 (1%)
 Frame = +3

Query: 201 HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
           H  +V  V  +  G  + T   D  +K+  +      + + T   H   V  ++W HP  
Sbjct: 302 HKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIR---MMKEMRTYRAHKKEVISLAW-HPIH 357

Query: 381 GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
             L  S   DG ++ W    + E     + + H  ++ S+ W  H LG  LA GS+D N 
Sbjct: 358 EGLFVSGGGDGSIVYWMVDGEKE--IGLLEHAHDQAIWSMKW--HPLGHILATGSNDNNT 413

Query: 561 SVYTARSDGGW--DTARIDQAHPIGVTAVSWAPSMAP 665
             +     G    D   +   + IG       P MAP
Sbjct: 414 KFWARNRPGDTVEDIFGLSNTNMIGHLDKEREPRMAP 450



>gb:BA000045_743736 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1682

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 83/318 (26%), Positives = 134/318 (42%), Gaps = 31/318 (9%)
 Frame = +3

Query: 177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ 356
            P ++   GH+D V        G  VA+A  D + ++     +   + LA L GH   V +
Sbjct: 1370 PLRRTLYGHTDGVLSARFSPDGALVASAGDDRTTRLW----SRDGKPLAILRGHAQAVIE 1425

Query: 357  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA 536
            V+++ PK G  LA+   DG V +W+     + T     + H   V+S+ ++P        
Sbjct: 1426 VAFS-PK-GDRLATGGGDGTVRLWRR----DGTALGQLSGHSGPVHSLHYSP-------- 1471

Query: 537  CGSSDGNISVYTARSDGGWDTARIDQAH----PIGVTAVSWAPS---MAPGALVG----- 680
                DG I      +   W+   I QA     P GV  V+++P    +A G   G     
Sbjct: 1472 ----DGQILAAAGETVRLWNAQGILQAAFGGTPGGVLEVAFSPKGDRLATGGGDGTVRLW 1527

Query: 681  ----------SGLHDPV---------QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHT 803
                      SG   PV         Q LA+AG +  V++W+  +G+ + +       HT
Sbjct: 1528 RRDGTALGQLSGHSGPVHSLHYSPDGQILAAAGEEGMVRIWEA-DGLLRQNW----AAHT 1582

Query: 804  NWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLT 983
            +W+  +A++P+      T+A+A  D  V +W++    D    KVL     PV  V +S  
Sbjct: 1583 DWIGALAFSPD----GRTLATAGHDRLVKLWSL----DGTLLKVLEGHTAPVTSVGFSPD 1634

Query: 984  GNLLAVASGDNNVTLWNE 1037
               +  A  D  V LWN+
Sbjct: 1635 SRTVISAGLDKTVLLWND 1652



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 72/258 (27%), Positives = 107/258 (41%), Gaps = 29/258 (11%)
 Frame = +3

Query: 345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFN--DHKSSVNSISWAPHE 518
            P W  S A     +LLAS S DG+V +W+         A + +  DHK ++  + ++P  
Sbjct: 1088 PQWVTSVAFSPGAALLASGSVDGQVRLWRPDGTLVRKIAALASSTDHKPNLQ-VRFSPD- 1145

Query: 519  LGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG---- 686
             G  LA    DG +++   RS+GG  T      HP GV  V ++P  A  A   S     
Sbjct: 1146 -GGLLAVARDDGIVALQ--RSEGGPVTTL---RHPRGVYDVRFSPGEATLATASSDGCVR 1199

Query: 687  -----------LHDPVQK------------LASAGCDNTVKVWKLYNGVWKMDCFPALQM 797
                       L DP               +A+A  D  +++W+    +        L+ 
Sbjct: 1200 VWSIEGRLLRTLADPGNPVFALAFSPDGDLIAAASADGAIRLWRRDGRLGA-----TLRG 1254

Query: 798  HTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS 977
            H +W   VA +P+       IAS    G V +W+  +EG     K L   +  V+ V++S
Sbjct: 1255 HRDWALAVAVSPD----GRVIASGDRTGAVRLWS--REGHGL--KSLRGHSEAVFAVAFS 1306

Query: 978  LTGNLLAVASGDNNVTLW 1031
              G LLA A  D  V LW
Sbjct: 1307 PDGALLATAGFDRTVRLW 1324



>gb:BA000045_740800 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1671

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 61/243 (25%), Positives = 112/243 (46%)
 Frame = +3

Query: 306  TSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKS 485
            +++ +  L GH   + QVS++  +   L+AS S+D  + +W    Q +     +   H +
Sbjct: 1050 SNRQINRLEGHSDFISQVSFSSSR--KLMASASWDRTIRLW----QLDGMPIKILKGHAN 1103

Query: 486  SVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAP 665
            ++ SI ++P   G  +A     G+I ++T++ +       + + H     A  W+   +P
Sbjct: 1104 NITSICFSPD--GEFMASADDRGSIYLWTSKGE----LRTVIRGH----NATIWSLRFSP 1153

Query: 666  GALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGL 845
             + +          LASA  D TV++W     + +      L  H + V  V ++P+   
Sbjct: 1154 DSKL----------LASASQDKTVRLWNRNGKILR-----TLMGHQDEVMSVDFSPD--- 1195

Query: 846  PKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
               T+ASAS DG V +W +  +G+     +L +    +W V++S  G  LA A  D  + 
Sbjct: 1196 -GQTLASASWDGTVRMWGI--QGNLIS--ILKEHKDGIWSVAFSPDGQRLASAGQDKTLR 1250

Query: 1026 LWN 1034
            LWN
Sbjct: 1251 LWN 1253



 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 68/282 (24%), Positives = 118/282 (41%), Gaps = 3/282 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GHSD +  VS     K +A+AS D +I++  +        +  L GH   +  + ++   
Sbjct: 1059 GHSDFISQVSFSSSRKLMASASWDRTIRLWQLDG----MPIKILKGHANNITSICFSPD- 1113

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS    G + +W    +       V   H +++ S+ ++P      LA  S D  
Sbjct: 1114 -GEFMASADDRGSIYLWTSKGELRT----VIRGHNATIWSLRFSPDSK--LLASASQDKT 1166

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
            + ++           R    H   V +V ++P                Q LASA  D TV
Sbjct: 1167 VRLWNRNGK----ILRTLMGHQDEVMSVDFSPDG--------------QTLASASWDGTV 1208

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            ++W +   +  +     L+ H + +  VA++P+       +ASA +D  + +W V     
Sbjct: 1209 RMWGIQGNLISI-----LKEHKDGIWSVAFSPD----GQRLASAGQDKTLRLWNV----- 1254

Query: 918  QWEGKVLY---DFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               G++L+   D  TP   V +S  G++LA  S D  V LW+
Sbjct: 1255 --HGQLLHTLSDNTTPFLSVRFSPDGSILASGSVDKTVRLWS 1294



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 88/376 (23%), Positives = 140/376 (37%), Gaps = 74/376 (19%)
 Frame = +3

Query: 126  FQGDHTFIRSSDKEG-------KMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKI 284
            F  D  F+ S+D  G       K   + +  GH+ T+  +      K +A+AS D ++++
Sbjct: 1110 FSPDGEFMASADDRGSIYLWTSKGELRTVIRGHNATIWSLRFSPDSKLLASASQDKTVRL 1169

Query: 285  IGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-EGNQNEWTQA 461
                 N   + L TL GH   V  V ++    G  LAS S+DG V +W  +GN       
Sbjct: 1170 W----NRNGKILRTLMGHQDEVMSVDFSPD--GQTLASASWDGTVRMWGIQGNL-----I 1218

Query: 462  HVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAV 641
             +  +HK  + S++++P   G  LA    D  + ++     G       D   P    +V
Sbjct: 1219 SILKEHKDGIWSVAFSPD--GQRLASAGQDKTLRLWNVH--GQLLHTLSDNTTPF--LSV 1272

Query: 642  SWAPSMAPGALVGSGLHDPVQKL------------------------------ASAGCDN 731
             ++P    G+++ SG  D   +L                              ASA  D 
Sbjct: 1273 RFSPD---GSILASGSVDKTVRLWSREGVLLSSLHGHTGRVNSLDFSADGRILASASDDK 1329

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT---- 899
            T+ +W+LY          A + H  WV  V ++P+        A+A  DG + +W     
Sbjct: 1330 TLLLWRLYGPP-----LTAFRGHGQWVSCVGFSPD----SQAFATAGGDGTLDLWDRQGR 1380

Query: 900  ----------------------VAKEGDQ-----W--EGKVLYDFN---TPVWRVSWSLT 983
                                  +A  G+      W   G  L  F+     V  +S+S  
Sbjct: 1381 LENRVIPPATIFALAYSPDGTIIASGGNDRAVRLWTRHGSYLSQFDKQGAAVTSLSFSPN 1440

Query: 984  GNLLAVASGDNNVTLW 1031
            GNL+A    D  V LW
Sbjct: 1441 GNLIAAGGPDGLVWLW 1456



 Score = 43.1 bits (100), Expect = 0.010
 Identities = 51/217 (23%), Positives = 89/217 (41%)
 Frame = +3

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            G+L+A+   DG  +VW  G++ +  +    +   + +  + + P  L L  A G  D  I
Sbjct: 1441 GNLIAAGGPDG--LVWLWGHKGKLFKK--ISTGHAELAVVRFGPRGLFLATA-GGVDRTI 1495

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVK 740
             +++          R  + HP  +T ++++P                Q L SA  D T++
Sbjct: 1496 RIWSQTGT----LLRTLRGHPDLITDLTFSPDN--------------QVLVSASRDGTLR 1537

Query: 741  VWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQ 920
             W +   + K      +  H+N V  + ++ +      T+ASA  DG V +W    E   
Sbjct: 1538 YWTIAGQLLK-----TINAHSNRVTSIDFSAD----GKTVASAGADGTVRLWGPVGESVA 1588

Query: 921  WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                VLY     V  V +S    +L   + D +V LW
Sbjct: 1589 ----VLYGHKDSVGAVRFSPDSKILLSGAADGSVFLW 1621



 Score = 33.9 bits (76), Expect = 6.3
 Identities = 60/276 (21%), Positives = 99/276 (35%), Gaps = 10/276 (3%)
 Frame = +3

Query: 126  FQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNS 305
            +  D T I S    G   A ++ T H   +     D  G  V + S   +  +I      
Sbjct: 1396 YSPDGTIIASG---GNDRAVRLWTRHGSYLSQ--FDKQGAAVTSLSFSPNGNLIAAGG-- 1448

Query: 306  TSQHLATLAGHHGPVWQ-VSWAHPKF--------GSLLASCS-FDGKVIVWKEGNQNEWT 455
                L  L GH G +++ +S  H +         G  LA+    D  + +W +      T
Sbjct: 1449 -PDGLVWLWGHKGKLFKKISTGHAELAVVRFGPRGLFLATAGGVDRTIRIWSQTG----T 1503

Query: 456  QAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVT 635
                   H   +  ++++P    L  A  S DG +  +T          +   AH   VT
Sbjct: 1504 LLRTLRGHPDLITDLTFSPDNQVLVSA--SRDGTLRYWTIAGQ----LLKTINAHSNRVT 1557

Query: 636  AVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVR 815
            ++ ++   A G  V           ASAG D TV++W         +    L  H + V 
Sbjct: 1558 SIDFS---ADGKTV-----------ASAGADGTVRLWGPVG-----ESVAVLYGHKDSVG 1598

Query: 816  DVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQW 923
             V ++P+       + S + DG V +W   +    W
Sbjct: 1599 AVRFSPD----SKILLSGAADGSVFLWQAWRTEANW 1630



>pir|C84870|C84870 probable splicing factor [imported] - Arabidopsis
            thaliana>gb:AC002333_1530348 Arabidopsis thaliana
            chromosome 2 clone F18O19 map CIC10F02, complete
            sequence.>gb:AY093182_1575136 Arabidopsis thaliana
            putative splicing factor (At2g43770) mRNA, complete
            cds.>gb:BT008828_1640024 Arabidopsis thaliana At2g43770
            mRNA, complete cds.
          Length = 343

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 77/322 (23%), Positives = 126/322 (39%), Gaps = 6/322 (1%)
 Frame = +3

Query: 87   PLT*SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASS 266
            P+  S  P   S   G +   R+S  E  +    + +GH   V+ +  +  G  +A+ S 
Sbjct: 17   PMEWSTVPHSASQGPGPNGKNRTSSLEAPI---MLLSGHPSAVYTMKFNPAGTLIASGSH 73

Query: 267  DASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQN 446
            D  I +  V  +   ++   L GH   +  + W     GS + S S D  V  W   +  
Sbjct: 74   DREIFLWRVHGDC--KNFMVLKGHKNAILDLHWTSD--GSQIVSASPDKTVRAW---DVE 126

Query: 447  EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI 626
               Q     +H S VNS         L ++ GS DG   ++  R  G   T         
Sbjct: 127  TGKQIKKMAEHSSFVNSCCPTRRGPPLIIS-GSDDGTAKLWDMRQRGAIQTF----PDKY 181

Query: 627  GVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTN 806
             +TAVS++              D   K+ + G DN VKVW L  G   M     L+ H +
Sbjct: 182  QITAVSFS--------------DAADKIFTGGVDNDVKVWDLRKGEATM----TLEGHQD 223

Query: 807  WVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQ------WEGKVLYDFNTPVWRV 968
             +  ++ +P+     S + +   D K+ +W +     Q      +EG   ++F   + + 
Sbjct: 224  TITGMSLSPD----GSYLLTNGMDNKLCVWDMRPYAPQNRCVKIFEGH-QHNFEKNLLKC 278

Query: 969  SWSLTGNLLAVASGDNNVTLWN 1034
            SWS  G  +   S D  V +W+
Sbjct: 279  SWSPDGTKVTAGSSDRMVHIWD 300



>gb:AF113946_2474699 Gallus gallus LIS1 (LIS1) mRNA, complete cds.
          Length = 410

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 116/284 (40%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHTGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +   +    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSTISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDISTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  FKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



 Score = 33.9 bits (76), Expect = 6.3
 Identities = 27/83 (32%), Positives = 38/83 (45%)
 Frame = +3

Query: 786  ALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWR 965
            AL  H + V  V + P      S + SASED  + +W    E   +E + L      V  
Sbjct: 103  ALSGHRSPVTRVIFHPVF----SVMVSASEDATIKVWDY--ETGDFE-RTLKGHTDSVQD 155

Query: 966  VSWSLTGNLLAVASGDNNVTLWN 1034
            +S+  TG LLA  S D  + LW+
Sbjct: 156  ISFDHTGKLLASCSADMTIKLWD 178



>gb:AF400434_1901097 Homo sapiens platelet-activating factor acetyl
            hydrolase isoform Ib alpha subunit (PHFAH1B1) mRNA,
            complete cds.>gb:BC064638_1986604 Homo sapiens
            platelet-activating factor acetylhydrolase, isoform Ib,
            alpha subunit 45kDa, mRNA (cDNA clone MGC:70757
            IMAGE:5786560), complete cds.>gb:HSLIS10_2017041 Human
            platelet activating factor acetylhydrolase, brain
            isoform, 45 kDa subunit (LIS1) gene, exon 11 and complete
            cds.>gb:HUMLIS1A_2034075 Homo sapiens(clone 71)
            Miller-Dieker lissencephaly protein (LIS1) mRNA, complete
            cds.>gb:HUMLIS1B_2034076 Homo sapiens (clone 47)
            Miller-Dieker lissencephaly protein (LIS1) mRNA, complete
            cds.
          Length = 410

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:AF208838_1890046 Homo sapiens isolate 4 Miller-Dieker
            lissencephaly protein (MDCR) mRNA, complete cds.
          Length = 410

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 118/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+    +    + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLASCSADMTIKL---RDFQGFECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:AF208837_1890045 Homo sapiens isolate 3 Miller-Dieker
            lissencephaly protein (MDCR) mRNA, complete cds.
          Length = 410

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:BOVPAF45K_1435710 Bovine mRNA for PAF acetylhydrolase 45 kDa
            subunit, complete cds.
          Length = 410

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVEDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:BA000045_741705 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1730

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 83/323 (25%), Positives = 132/323 (40%), Gaps = 32/323 (9%)
 Frame = +3

Query: 165  EGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASI-------KIIGVSNNST----- 308
            +GK+ A+ I  GH D V +  +   GK++ + SSD +I       K++ +    T     
Sbjct: 1410 DGKLIAKLI--GHEDLVQNFDIRPDGKQIVSVSSDRTIRLWSSQGKLLKIFPRQTNWPFF 1467

Query: 309  ----SQHLATLAGHHGPV--WQVSWA---------HPKFGSLL-----ASCSFDGKVIVW 428
                S  +   AGH   V  W +  +             G+LL     AS S+DG + +W
Sbjct: 1468 IRYISSDIIASAGHDNQVHLWSLDGSLLQTFKGHTDSTTGALLLQDKMASFSWDGTIRLW 1527

Query: 429  KEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARI 608
                Q       V   HK  + S  + P +    LA   S+G I ++  R DG      +
Sbjct: 1528 ----QLNGKLIKVLTGHKGQIYSFDFQPAD--NILASADSEGEIRLW--RGDG--SLLAV 1577

Query: 609  DQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPA 788
               H   +  + ++P    G +           LAS   D TV++W       +      
Sbjct: 1578 LSGHRGSIYNLKFSPD---GRI-----------LASGSMDGTVRLWTA-----RGKLLAV 1618

Query: 789  LQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRV 968
            L  H++ +RDV ++PN       +A+ASEDG V IW +  +GD        D    V  +
Sbjct: 1619 LAHHSDSIRDVRFSPN----GKYLATASEDGTVRIWNL--KGDLLS---TLDVGNSVTAL 1669

Query: 969  SWSLTGNLLAVASGDNNVTLWNE 1037
            ++S  G+ LA  S D  + LW +
Sbjct: 1670 AFSPDGHTLASGSADGTLELWKQ 1692



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 71/306 (23%), Positives = 124/306 (40%), Gaps = 5/306 (1%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            G+   IR     G++   K   GH++ VH +     G+ +A+ SS+ SIK+     + T 
Sbjct: 1152 GEDKIIRLWSVNGEL--LKTLRGHTERVHSIRYSSSGRLLASMSSN-SIKLW----DKTG 1204

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSV 491
            + + ++  + G      W+  +   LLA     G  +   E          V   H   V
Sbjct: 1205 KFIRSINRNIGEAIAFGWSPDE--ELLAIPIIAGNSV---EITSLSGQLLRVLKGHTQPV 1259

Query: 492  NSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGA 671
            N  +++P   G  +A  SSD  + ++ A+S       +   A+  G T   W    +P +
Sbjct: 1260 NGANFSPD--GNQIASFSSDKTVRLWNAKS------GKFQHAYS-GHTDAIWQVEFSPDS 1310

Query: 672  LVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPK 851
             +           ASAG D TV++W       K+     L  HT+ V DV ++P      
Sbjct: 1311 SI----------FASAGEDRTVRLWSKDGHSLKI-----LSGHTDRVMDVRFSPE----G 1351

Query: 852  STIASASEDGKVVIWTVAKEGDQWEGKVLYDFN-----TPVWRVSWSLTGNLLAVASGDN 1016
            + + SAS D  + +W V           LY  +     + V  + +S   N +  A+ + 
Sbjct: 1352 THLLSASFDKSIRLWQVNN---------LYRLSFKGNGSEVLSMRFSPVNNRVLAAAANK 1402

Query: 1017 NVTLWN 1034
            ++ LW+
Sbjct: 1403 DIYLWS 1408



 Score = 37.0 bits (84), Expect = 0.74
 Identities = 36/112 (32%), Positives = 53/112 (47%)
 Frame = +3

Query: 99   SADPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASI 278
            S D R+ +    D T +R     GK+ A  +   HSD++ DV     GK +ATAS D ++
Sbjct: 1591 SPDGRILASGSMDGT-VRLWTARGKLLA--VLAHHSDSIRDVRFSPNGKYLATASEDGTV 1647

Query: 279  KIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKE 434
            +I     N     L+TL   +      + A    G  LAS S DG + +WK+
Sbjct: 1648 RIW----NLKGDLLSTLDVGNS---VTALAFSPDGHTLASGSADGTLELWKQ 1692



>pir|S48052|S48052 platelet-activating factor acetylhydrolase 45K
            chain - bovine>gb:AY665240_1958545 Saimiri boliviensis
            platelet-activating factor acetylhydrolase isoform 1B
            alpha subunit mRNA, complete cds.>gb:AF016049_2050881
            Rattus norvegicus platelet-activating factor
            acetylhydrolase beta subunit (PAF-AH beta) mRNA, complete
            cds.>gb:AL607024_2071474 Mouse DNA sequence from clone
            RP23-194P5 on chromosome 11 Contains a novel gene, the
            Pafah1b1 gene for platelet-activating factor
            acetylhydrolase isoform 1b beta1 subunit, the 5' end of a
            novel gene and two CpG islands, complete
            sequence.>gb:AY189217_2078817 Mus musculus strain NOD/LtJ
            platelet-activating factor acetylhydrolase isoform 1b
            beta1 subunit (Pafah1b1) mRNA, complete
            cds.>gb:AY189218_2078818 Mus musculus strain C57BL/6
            platelet-activating factor acetylhydrolase isoform 1b
            beta1 subunit (Pafah1b1) mRNA, complete
            cds.>gb:BC014831_2092054 Mus musculus platelet-activating
            factor acetylhydrolase, isoform 1b, beta1 subunit, mRNA
            (cDNA clone MGC:25297 IMAGE:4507474), complete
            cds.>gb:BC026141_2095267 Mus musculus platelet-activating
            factor acetylhydrolase, isoform 1b, beta1 subunit, mRNA
            (cDNA clone MGC:13913 IMAGE:4017963), complete
            cds.>gb:BC072510_2106527 Rattus norvegicus
            platelet-activating factor acetylhydrolase, isoform Ib,
            alpha subunit 45kDa, mRNA (cDNA clone MGC:91446
            IMAGE:7104733), complete cds.>gb:MMPAFALIS4_2116875 Mus
            musculus Pafaha/Lis1 exon 4, Pafaha/Lis1 exon 5,
            Pafaha/Lis1 exon 6, Pafaha/Lis1 exon 7, Pafaha/Lis1 exon
            8, Pafaha/Lis1 exon 9, Pafaha/Lis1 exon 10, Pafaha/Lis1
            exon 11, Pafaha/Lis1 exon 11, and Pafaha/Lis1 exon 12,
            complete sequence; and platelet-activating factor
            acetylhydrolase 45kD subunit (Pafaha/Lis1) gene,
            alternative splice products, complete
            cds.>gb:MMU95116_2124130 Mus musculus lissencephaly-1
            protein (LIS-1) mRNA, complete cds.
          Length = 410

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>pir|S36113|S36113 LIS-1 protein - human
          Length = 409

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 147  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 201

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 202  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 256

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 257  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 313

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 314  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 365

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 366  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 406



>sp|P43035|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB
            alpha subunit (PAF acetylhydrolase 45 kDa subunit)
            (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha)
            (Lissencephaly-1 protein) (LIS-1).
          Length = 409

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 147  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 201

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 202  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 256

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 257  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 313

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 314  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 365

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 366  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 406



>sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB
            alpha subunit (PAF acetylhydrolase 45 kDa subunit)
            (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha)
            (Lissencephaly-1 protein) (LIS-1).
          Length = 409

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 147  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 201

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 202  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 256

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 257  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 313

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 314  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 365

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 366  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 406



>sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB
            alpha subunit (PAF acetylhydrolase 45 kDa subunit)
            (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha)
            (Lissencephaly-1 protein) (LIS-1).
          Length = 409

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 71/284 (25%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 147  GHTDSVEDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 201

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 202  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 256

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 257  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 313

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 314  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 365

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 366  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 406



>gb:CR382131_1664016 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 303

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 66/261 (25%), Positives = 111/261 (42%), Gaps = 8/261 (3%)
 Frame = +3

Query: 147 IRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT 326
           IRS++ +  M  +    GH+  V  ++  Y GK + T+S D ++K+  +   +  ++   
Sbjct: 60  IRSNNPKAVMTFE----GHTGNVTALAFQYDGKWMVTSSEDGTVKVWDMRTATVQRNYK- 114

Query: 327 LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
              H  PV  V   HP  G ++ SC  +G + +W  G +N  T   +  +    V S+S 
Sbjct: 115 ---HRCPVNDVV-IHPNQGEII-SCDQEGNIRIWDLG-ENTCTH-QLIPEEDVPVRSVSV 167

Query: 507 APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIG--------VTAVSWAPSMA 662
           A    G  L  G++ GN  V+   +     T  +   HPI         +T V  +P   
Sbjct: 168 ASD--GSMLVAGNNKGNCYVWKMHN-----TRDVTSLHPITKFRSHSKYITKVLLSPD-- 218

Query: 663 PGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLG 842
                       V+ LA+   DNT ++W + NG         L  H  WV D A++ +  
Sbjct: 219 ------------VKHLATCSADNTARIWSIKNG---FSLETTLTGHQRWVWDCAFSAD-- 261

Query: 843 LPKSTIASASEDGKVVIWTVA 905
              + + +AS D  V +W +A
Sbjct: 262 --SAYLVTASSDHYVRLWELA 280



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 64/272 (23%), Positives = 118/272 (43%), Gaps = 6/272 (2%)
 Frame = +3

Query: 243  KRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVI 422
            KR   A+   ++++  + +N+    + T  GH G V  +++ +   G  + + S DG V 
Sbjct: 44   KRYLAAAGGNTVRLYDIRSNNPKA-VMTFEGHTGNVTALAFQYD--GKWMVTSSEDGTVK 100

Query: 423  VWKEGNQNEWTQAHVFND--HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWD 596
            VW      +   A V  +  H+  VN +   P++ G  ++C   +GNI ++    D G +
Sbjct: 101  VW------DMRTATVQRNYKHRCPVNDVVIHPNQ-GEIISC-DQEGNIRIW----DLGEN 148

Query: 597  TA--RIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYN--GV 764
            T   ++     + V +VS A   + G+++ +G +                VWK++N   V
Sbjct: 149  TCTHQLIPEEDVPVRSVSVA---SDGSMLVAGNNK-----------GNCYVWKMHNTRDV 194

Query: 765  WKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYD 944
              +      + H+ ++  V  +P++      +A+ S D    IW++ K G   E   L  
Sbjct: 195  TSLHPITKFRSHSKYITKVLLSPDV----KHLATCSADNTARIWSI-KNGFSLE-TTLTG 248

Query: 945  FNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
                VW  ++S     L  AS D+ V LW  A
Sbjct: 249  HQRWVWDCAFSADSAYLVTASSDHYVRLWELA 280



>gb:MUSLISB_2128749 Mus musculus LIS mRNA, partial cds.
          Length = 277

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 63/239 (26%), Positives = 104/239 (43%), Gaps = 6/239 (2%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 34  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 88

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 89  NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 143

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
           + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 144 VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 200

Query: 720 GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W
Sbjct: 201 SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVW 251



 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 61/220 (27%), Positives = 93/220 (42%), Gaps = 1/220 (0%)
 Frame = +3

Query: 369  HPKFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
            HP F S++ S S D  + VW  E    E T       H  SV  IS+     G  LA  S
Sbjct: 3    HPVF-SVMVSASEDATIKVWDYETGDFERT----LKGHTDSVQDISF--DHSGKLLASCS 55

Query: 546  SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            +D  I ++  +   G++  R    H   V++V         A++ +G H     + SA  
Sbjct: 56   ADMTIKLWDFQ---GFECIRTMHGHDHNVSSV---------AIMPNGDH-----IVSASR 98

Query: 726  DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
            D T+K+W++  G     C      H  WVR V   PN     + IAS S D  V +W VA
Sbjct: 99   DKTIKMWEVQTGY----CVKTFTGHREWVRMVR--PNQD--GTLIASCSNDQTVRVWVVA 150

Query: 906  KEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
             +  + E   L +    V  +SW+   +  +++    + T
Sbjct: 151  TKECKAE---LREHEHVVECISWAPESSYSSISEATGSET 187



>gb:MMPAFALIS4_2116876 Mus musculus Pafaha/Lis1 exon 4, Pafaha/Lis1
           exon 5, Pafaha/Lis1 exon 6, Pafaha/Lis1 exon 7,
           Pafaha/Lis1 exon 8, Pafaha/Lis1 exon 9, Pafaha/Lis1 exon
           10, Pafaha/Lis1 exon 11, Pafaha/Lis1 exon 11, and
           Pafaha/Lis1 exon 12, complete sequence; and
           platelet-activating factor acetylhydrolase 45kD subunit
           (Pafaha/Lis1) gene, alternative splice products,
           complete cds.
          Length = 391

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 63/239 (26%), Positives = 104/239 (43%), Gaps = 6/239 (2%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148 GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203 NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
           + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258 VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720 GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W
Sbjct: 315 SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVW 365



 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 67/234 (28%), Positives = 102/234 (43%), Gaps = 1/234 (0%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSIS 503
            L+GH  PV +V + HP F S++ S S D  + VW  E    E T       H  SV  IS
Sbjct: 104  LSGHRSPVTRVIF-HPVF-SVMVSASEDATIKVWDYETGDFERT----LKGHTDSVQDIS 157

Query: 504  WAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGS 683
            +     G  LA  S+D  I ++  +   G++  R    H   V++V         A++ +
Sbjct: 158  F--DHSGKLLASCSADMTIKLWDFQ---GFECIRTMHGHDHNVSSV---------AIMPN 203

Query: 684  GLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIA 863
            G H     + SA  D T+K+W++  G     C      H  WVR V   PN     + IA
Sbjct: 204  GDH-----IVSASRDKTIKMWEVQTGY----CVKTFTGHREWVRMVR--PNQD--GTLIA 250

Query: 864  SASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
            S S D  V +W VA +  + E   L +    V  +SW+   +  +++    + T
Sbjct: 251  SCSNDQTVRVWVVATKECKAE---LREHEHVVECISWAPESSYSSISEATGSET 301



>gb:AY665285_1958590 Pan troglodytes platelet-activating factor
           acetylhydrolase isoform 1B alpha subunit mRNA, complete
           cds.
          Length = 410

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 63/239 (26%), Positives = 104/239 (43%), Gaps = 6/239 (2%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148 GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203 NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
           + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258 VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720 GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
             D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W
Sbjct: 315 SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVW 365



 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 67/234 (28%), Positives = 102/234 (43%), Gaps = 1/234 (0%)
 Frame = +3

Query: 327  LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWK-EGNQNEWTQAHVFNDHKSSVNSIS 503
            L+GH  PV +V + HP F S++ S S D  + VW  E    E T       H  SV  IS
Sbjct: 104  LSGHRSPVTRVIF-HPVF-SVMVSASEDATIKVWDYETGDFERT----LKGHTDSVQDIS 157

Query: 504  WAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGS 683
            +     G  LA  S+D  I ++  +   G++  R    H   V++V         A++ +
Sbjct: 158  F--DHSGKLLASCSADMTIKLWDFQ---GFECIRTMHGHDHNVSSV---------AIMPN 203

Query: 684  GLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIA 863
            G H     + SA  D T+K+W++  G     C      H  WVR V   PN     + IA
Sbjct: 204  GDH-----IVSASRDKTIKMWEVQTGY----CVKTFTGHREWVRMVR--PNQD--GTLIA 250

Query: 864  SASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVT 1025
            S S D  V +W VA +  + E   L +    V  +SW+   +  +++    + T
Sbjct: 251  SCSNDQTVRVWVVATKECKAE---LREHEHVVECISWAPESSYSSISEATGSET 301



>gb:AB083321_1871858 Macaca fascicularis pafah1b1 mRNA for platelet
            activating factor acetylhydrolase Ib-alpha subunit,
            complete cds.
          Length = 410

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 71/284 (25%), Positives = 116/284 (40%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK + + S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLTSCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  L S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHLVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:AE017344_1756215 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 418

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 66/247 (26%), Positives = 101/247 (40%), Gaps = 11/247 (4%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH+  V DV  D  G  +AT SSD ++K+   +N  T  ++ TL GH   V  V +    
Sbjct: 130 GHTKAVMDVDFDPRGGLMATCSSDLTLKLWDTANQYT--NVKTLHGHDHSVSSVRFMPD- 186

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G  L S S D  + VW+    +       F+ H   V      P E G  L   S+D  
Sbjct: 187 -GETLVSASRDKTIRVWQ---VSSGYCIKTFSGHAEWVREA--VPSEDGRWLVSASNDQT 240

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMA-PGALVGSGLHDPVQK--------- 707
             ++   +    +T    + H   V    +AP  A P     +GL  P  +         
Sbjct: 241 SRIWDFSTG---ETKMELRGHEHVVECAVFAPVNAYPAIRELAGLKPPAPRDTRAKSPGV 297

Query: 708 -LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
             A+   D T+K+W   +G     C   L  H NW+R + + P+       + SAS+D  
Sbjct: 298 YAATGSRDKTIKLWDALSG----QCLRTLVGHDNWIRALVFHPS----GKYLLSASDDKT 349

Query: 885 VVIWTVA 905
           + +W +A
Sbjct: 350 IKVWDLA 356



 Score = 40.8 bits (94), Expect = 0.051
 Identities = 35/108 (32%), Positives = 48/108 (44%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
            LASA  D TVK+W    G    D    L+ HT  V DV + P  GL    +A+ S D  +
Sbjct: 105  LASASEDATVKLWDWEAG----DMERTLKGHTKAVMDVDFDPRGGL----MATCSSDLTL 156

Query: 888  VIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
             +W  A +      K L+  +  V  V +   G  L  AS D  + +W
Sbjct: 157  KLWDTANQ--YTNVKTLHGHDHSVSSVRFMPDGETLVSASRDKTIRVW 202



>gb:AF319658_1418326 Sus scrofa platelet-activating factor
            acetylhydrolase Ib-alpha subunit mRNA, complete cds.
          Length = 410

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 70/284 (24%), Positives = 117/284 (41%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 148  GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 202

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S + D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 203  NGDHIVSAARDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 257

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 258  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 314

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C   L  H NWVR V +          I S ++D  + +W 
Sbjct: 315  SRDKTIKMWDVSTGM----CLMTLVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 366

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 367  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 407



>gb:MMTBL1_2117530 Mus musculus partial Tbl1 gene.
          Length = 313

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 72/251 (28%), Positives = 105/251 (41%), Gaps = 9/251 (3%)
 Frame = +3

Query: 321  ATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSI 500
            +TL  H GP++ + W   K G+ + S   D   I+W + +  E  Q   F+    +++ +
Sbjct: 72   STLGQHKGPIFALKWN--KKGNYILSAGVDKTTIIW-DAHTGEAKQQFPFHSAAPALD-V 127

Query: 501  SWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG 680
             W   +     A  S+D  I V     D    T    Q H   V A+ W PS   G L  
Sbjct: 128  DW---QNNTTFASCSTDMCIHVCRLGCDRPVKTF---QGHT-EVNAIKWDPS---GML-- 175

Query: 681  SGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD-CFPALQMHTNWVRDVAWAPN---LGLP 848
                     LAS   D T+K+W +     K D C   LQ H+  +  + W+P       P
Sbjct: 176  ---------LASCSDDMTLKIWSM-----KQDACVHDLQAHSKEIYTIKWSPTGPATSNP 221

Query: 849  KSTI--ASASEDGKVVIWTVAKEGDQWEGKVLYDFNT---PVWRVSWSLTGNLLAVASGD 1013
             S I  ASAS D  V +W V +      G  ++       PV+ V++S  G  LA  S D
Sbjct: 222  NSNIMLASASFDSTVRLWDVER------GVCIHTLTKHQEPVYSVAFSPDGKYLASGSFD 275

Query: 1014 NNVTLWNEAVD 1046
              V +WN  V+
Sbjct: 276  KCVHIWNTQVE 286



>gb:BC058365_2103177 Mus musculus U5 snRNP-specific protein
            (Prp8-binding), mRNA (cDNA clone MGC:66747
            IMAGE:5714866), complete cds.
          Length = 358

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 74/287 (25%), Positives = 116/287 (40%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A+A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 64   SGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 121

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GS+L S S D  V VW   +     +      H S VNS    P   G  L C GS D
Sbjct: 122  --GSMLFSASTDKTVAVW---DSETGERVKRLKGHTSFVNSCY--PARRGPQLVCTGSDD 174

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V AV++              +D   ++ S G DN
Sbjct: 175  GTVKLWDIRKKAAVQTFQ----NTYQVLAVTF--------------NDTSDQIISGGIDN 216

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            ++ H + V  ++    L    S + S + D  V +W V   
Sbjct: 217  DIKVWDLRQNKLTY----TMRGHADSVTGLS----LSSEGSYLLSNAMDNTVRVWDVRPF 268

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 269  APKERCVKIFQGNV-HNFEKNLLRCSWSPDGSKIAAGSADRFVYVWD 314



>gb:AF083383_1881616 Homo sapiens 38kDa splicing factor mRNA, complete
            cds.
          Length = 310

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 74/287 (25%), Positives = 116/287 (40%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A+A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 4    SGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 61

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GS+L S S D  V VW   +     +      H S VNS    P   G  L C GS D
Sbjct: 62   --GSMLFSASTDKTVAVW---DSETGERVKRLKGHTSFVNSCY--PARRGPQLVCTGSDD 114

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V AV++              +D   ++ S G DN
Sbjct: 115  GTVKLWDIRKKAAVQTFQ----NTYQVLAVTF--------------NDTSDQIISGGIDN 156

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            ++ H + V  ++    L    S + S + D  V +W V   
Sbjct: 157  DIKVWDLRQNKLTY----TMRGHADSVTGLS----LSSEGSYLLSNAMDNTVRVWDVRPF 208

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 209  APKERCVKIFQGNV-HNFEKNLLRCSWSPDGSKIAAGSADRFVYVWD 254



>gb:AF323581_1786291 Podospora anserina beta transducin-like protein
            HET-E4s (het-e) gene, het-e4s allele, complete cds.
          Length = 1065

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 45/135 (33%), Positives = 68/135 (50%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH  +V  V+    G+RVA+ S D +IKI   ++ + +Q   TL GH G VW V+++   
Sbjct: 839  GHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTGTQ---TLEGHGGSVWSVAFSPD- 894

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  +AS S DG + +W   +    T       H   V+S++++P   G  +A GSSD  
Sbjct: 895  -GQRVASGSIDGTIKIWDAAS---GTCTQTLEGHGGWVHSVAFSPD--GQRVASGSSDNT 948

Query: 558  ISVYTARSDGGWDTA 602
            I +        WDTA
Sbjct: 949  IKI--------WDTA 955



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 44/164 (26%), Positives = 74/164 (45%)
 Frame = +3

Query: 270  ASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNE 449
            ++I ++    N+ +Q   TL GH   V  V+++    G  +AS S D  + +W   +   
Sbjct: 821  STISVVEAEWNACTQ---TLEGHGSSVLSVAFSPD--GQRVASGSGDKTIKIWDTASG-- 873

Query: 450  WTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIG 629
             T       H  SV S++++P   G  +A GS DG I ++ A S     T    + H   
Sbjct: 874  -TGTQTLEGHGGSVWSVAFSPD--GQRVASGSIDGTIKIWDAASGTCTQTL---EGHGGW 927

Query: 630  VTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNG 761
            V +V+++P                Q++AS   DNT+K+W   +G
Sbjct: 928  VHSVAFSPDG--------------QRVASGSSDNTIKIWDTASG 957



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 33/113 (29%), Positives = 51/113 (45%)
 Frame = +3

Query: 702  QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDG 881
            Q++AS   D T+K+W   +G         L+ H   V  VA++P+       +AS S DG
Sbjct: 854  QRVASGSGDKTIKIWDTASGTGTQ----TLEGHGGSVWSVAFSPD----GQRVASGSIDG 905

Query: 882  KVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             + IW  A        + L      V  V++S  G  +A  S DN + +W+ A
Sbjct: 906  TIKIWDAASGTCT---QTLEGHGGWVHSVAFSPDGQRVASGSSDNTIKIWDTA 955



 Score = 43.1 bits (100), Expect = 0.010
 Identities = 35/99 (35%), Positives = 49/99 (49%)
 Frame = +3

Query: 132  GDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTS 311
            GD T I+  D       Q +E GH  +V  V+    G+RVA+ S D +IKI   ++ + +
Sbjct: 861  GDKT-IKIWDTASGTGTQTLE-GHGGSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCT 918

Query: 312  QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVW 428
            Q   TL GH G  W  S A    G  +AS S D  + +W
Sbjct: 919  Q---TLEGHGG--WVHSVAFSPDGQRVASGSSDNTIKIW 952



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 1/89 (1%)
 Frame = +3

Query: 777  CFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW-TVAKEGDQWEGKVLYDFNT 953
            C   L+ H + V  VA++P+       +AS S D  + IW T +  G Q     L     
Sbjct: 833  CTQTLEGHGSSVLSVAFSPD----GQRVASGSGDKTIKIWDTASGTGTQ----TLEGHGG 884

Query: 954  PVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
             VW V++S  G  +A  S D  + +W+ A
Sbjct: 885  SVWSVAFSPDGQRVASGSIDGTIKIWDAA 913



 Score = 33.5 bits (75), Expect = 8.2
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL 320
            GH   VH V+    G+RVA+ SSD +IKI   ++ + +Q L
Sbjct: 923  GHGGWVHSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTL 963



>gb:PCWO3G5_1699544 Pneumocystis carinii telomeric cosmid, WO3G5.
          Length = 442

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 73/306 (23%), Positives = 127/306 (41%), Gaps = 14/306 (4%)
 Frame = +3

Query: 177  PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQ 356
            PA+   TGH   +  ++       +A+AS D++IKI    +  T     TL GH   V  
Sbjct: 106  PAKHTLTGHRQPITSLAFHSVFTILASASEDSTIKIW---DWETGDFERTLKGHTKAVLD 162

Query: 357  VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLA 536
            + +      S L SCS D  + +W   ++NE+        H  S++SI + P   G  + 
Sbjct: 163  IEFNTFSDSSCLVSCSSDLTIKLW--DSKNEYKNIKTLYGHDHSISSIKFLPPN-GDRIV 219

Query: 537  CGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLAS 716
              S D NI ++   +  G+    I  AH      + W  ++ P         +  + L S
Sbjct: 220  SVSRDKNIKIWEIST--GFCIKTISNAH------IDWIRTICPS--------NDGKLLLS 263

Query: 717  AGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN-----------LGLPKST-- 857
            AG D   K++  +NG  K++     Q H + +    +APN           + L K++  
Sbjct: 264  AGNDRIAKIFNTHNGECKLE----FQGHEHVIECAIFAPNSAYKFLMQLSGVHLSKNSMG 319

Query: 858  -IASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +A+ S D  + +W   + G     K L   +  +  + +  +G  L  AS D  +  W+
Sbjct: 320  YVATGSRDKTIKLWG-CQNGQII--KTLLGHDNWLRALVFHPSGRYLISASDDKTIRCWD 376

Query: 1035 EAVDGE 1052
             +  G+
Sbjct: 377  LSQSGK 382



>gb:CQ782448_1451984 Sequence 2588 from Patent
            EP1396543.>gb:AL451070_1928151 Human DNA sequence from
            clone RP11-266K22 on chromosome 1 Contains the 5' end of
            the gene for U5 snRNP-specific 40 kDa protein
            (hPrp8-binding) (HPRP8BP), the gene for putative S1 RNA
            binding domain protein (PS1D), a novel gene and the FABP3
            gene for fatty acid binding protein 3 muscle and heart
            (mammary-derived growth inhibitor), complete
            sequence.>gb:BC001494_1967633 Homo sapiens U5
            snRNP-specific 40 kDa protein (hPrp8-binding), mRNA (cDNA
            clone MGC:1910 IMAGE:3504573), complete cds.
          Length = 357

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 74/287 (25%), Positives = 116/287 (40%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A+A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 63   SGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 120

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GS+L S S D  V VW   +     +      H S VNS    P   G  L C GS D
Sbjct: 121  --GSMLFSASTDKTVAVW---DSETGERVKRLKGHTSFVNSCY--PARRGPQLVCTGSDD 173

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V AV++              +D   ++ S G DN
Sbjct: 174  GTVKLWDIRKKAAIQTFQ----NTYQVLAVTF--------------NDTSDQIISGGIDN 215

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            ++ H + V  ++    L    S + S + D  V +W V   
Sbjct: 216  DIKVWDLRQNKLTY----TMRGHADSVTGLS----LSSEGSYLLSNAMDNTVRVWDVRPF 267

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 268  APKERCVKIFQGNV-HNFEKNLLRCSWSPDGSKIAAGSADRFVYVWD 313



>gb:HUMLIS1C_2034077 Homo sapiens (clone 6-1) Miller-Dieker
            lissencephaly protein (LIS1) mRNA, complete cds.
          Length = 288

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 70/284 (24%), Positives = 116/284 (40%), Gaps = 6/284 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH+D+V D+S D+ GK +A+ S+D +IK+         + + T+ GH   V  V  A   
Sbjct: 26   GHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG---FECIRTMHGHDHNVSSV--AIMP 80

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G  + S S D  + +W+   Q  +     F  H+  V  +   P++ G  +A  S+D  
Sbjct: 81   NGDHIVSASRDKTIKMWEV--QTGYC-VKTFTGHREWVRMV--RPNQDGTLIASCSNDQT 135

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL---VGSGLH---DPVQKLASA 719
            + V+   +    +     + H   V  +SWAP  +  ++    GS       P   L S 
Sbjct: 136  VRVWVVATK---ECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSG 192

Query: 720  GCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWT 899
              D T+K+W +  G+    C      H NWVR V +          I S ++D  + +W 
Sbjct: 193  SRDKTIKMWDVSTGM----CLMTXVGHDNWVRGVLFHSG----GKFILSCADDKTLRVWD 244

Query: 900  VAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
               +      K L      V  + +  T   +   S D  V +W
Sbjct: 245  YKNKRCM---KTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVW 285



>gb:AY463620_1607709 Arabidopsis thaliana TAF5 (At5g25150) mRNA,
            complete cds.
          Length = 669

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 73/292 (25%), Positives = 115/292 (39%), Gaps = 22/292 (7%)
 Frame = +3

Query: 225  SMDYYGKRVATASSDASIKI-------------IGVSNNSTSQHLAT--------LAGHH 341
            S+ + G  VA   SD+SIK+             +   N+S+ Q +          L GH 
Sbjct: 359  SISHDGSLVAGGFSDSSIKVWDMAKIGQAGSGALQAENDSSDQSIGPNGRRSYTLLLGHS 418

Query: 342  GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEG-NQNEWTQAHVFNDHKSSVNSISWAPHE 518
            GPV+  +++ P  G  + S S D  + +W    N N       +  H   V    ++P  
Sbjct: 419  GPVYSATFSPP--GDFVLSSSADTTIRLWSTKLNAN----LVCYKGHNYPVWDAQFSP-- 470

Query: 519  LGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDP 698
             G   A  S D    ++   S       RI   H   V  V W P+              
Sbjct: 471  FGHYFASCSHDRTARIW---SMDRIQPLRIMAGHLSDVDCVQWHPNC------------- 514

Query: 699  VQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASED 878
               +A+   D TV++W +  G    +C      H + V  +A +P+       +AS  ED
Sbjct: 515  -NYIATGSSDKTVRLWDVQTG----ECVRIFIGHRSMVLSLAMSPD----GRYMASGDED 565

Query: 879  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            G +++W ++          L   N+ VW +S+S  G+LLA  S D  V LW+
Sbjct: 566  GTIMMWDLSTARCITP---LMGHNSCVWSLSYSGEGSLLASGSADCTVKLWD 614



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 32/109 (29%), Positives = 56/109 (51%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           +I  GH   V  ++M   G+ +A+   D +I +  +S   T++ +  L GH+  VW +S+
Sbjct: 538 RIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLS---TARCITPLMGHNSCVWSLSY 594

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP 512
           +    GSLLAS S D  V +W   +  + T+A   N + + + S+   P
Sbjct: 595 SGE--GSLLASGSADCTVKLWDVTSSTKLTKAEEKNGNSNRLRSLRTFP 641



>gb:SPBC713_1720377 S.pombe chromosome II cosmid c713.
          Length = 297

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 62/239 (25%), Positives = 100/239 (41%), Gaps = 1/239 (0%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH   + D+ + Y   + A+   D  I++  V+     + L    GH   +  + +    
Sbjct: 54  GHGHEILDLDLVYDSTKFASCGGDKFIQVWDVNTGKVDRRLG---GHLAQINTIRYNEDS 110

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             S+LAS SFD KV +W +   N ++   V  D K SV+SI  A H     +  GS+DG 
Sbjct: 111 --SILASGSFDSKVRLW-DCRSNSFSPIQVLADAKDSVSSIDIAEH----LIVTGSTDGT 163

Query: 558 ISVYTARSDGGWDTARIDQ-AHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNT 734
           +  Y  R      T   D  +HPI     S + S +  + + S +H   Q+        T
Sbjct: 164 LRTYDIRKG----TLSSDYFSHPITSVKTSKSASFSLISSLNSSIHLLDQE--------T 211

Query: 735 VKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
            K+ K Y G+  M+       + +              ++ + S SEDGKV +W +  E
Sbjct: 212 GKILKSYIGLKNMEYRVRSSFNQS--------------ETIVFSGSEDGKVYLWDLENE 256



>gb:PFMAL8P1_1192072 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 323

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 79/290 (27%), Positives = 118/290 (40%), Gaps = 8/290 (2%)
 Frame = +3

Query: 189  IETGHSDTVHDVSM--DYYGKRVATASSDASIKIIGVSNNSTSQHLAT----LAGHHGPV 350
            +E GHSD V  VS   D   K + +AS D  + +  ++ +  S  + T    L GH   +
Sbjct: 16   LEGGHSDWVTSVSTPTDPKLKTIVSASRDKKLIVWNINTDDDSGEIGTAKKSLTGHSQAI 75

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
              VS +    G    S S+D  V +W   + +       F  H S V S+S++P    + 
Sbjct: 76   NDVSISSD--GLFALSGSWDHSVRLW---DLSLGETIRSFIGHTSDVFSVSFSPDNRQIV 130

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
             A  S D  I ++   +   +     DQ H   +T V ++PS     +V           
Sbjct: 131  SA--SRDKTIKLWNTLAQCKYTIT--DQQHTDWITCVRFSPSPNQAIIV----------- 175

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
             S G D  VKVW L N     D    L+ HT  +  V  +P+     S  AS  +DG   
Sbjct: 176  -SCGWDKLVKVWNLKN----CDLNKNLEGHTGVLNTVTISPD----GSLCASGGKDGVAK 226

Query: 891  IWTVAKEGDQWEGKVLYDFNT--PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +W V       EGK LY   T   +  + +S     L  A+ D  + +WN
Sbjct: 227  LWDVK------EGKHLYSLETGSTINSLCFSPCDYWLCAAT-DRFIRIWN 269



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 62/287 (21%), Positives = 115/287 (40%), Gaps = 33/287 (11%)
 Frame = +3

Query: 147 IRSSDKEGKM-PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA 323
           I + D  G++  A+K  TGHS  ++DVS+   G    + S D S+++  +S   T   + 
Sbjct: 52  INTDDDSGEIGTAKKSLTGHSQAINDVSISSDGLFALSGSWDHSVRLWDLSLGET---IR 108

Query: 324 TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
           +  GH   V+ VS++       + S S D  + +W    Q ++T       H   +  + 
Sbjct: 109 SFIGHTSDVFSVSFSPD--NRQIVSASRDKTIKLWNTLAQCKYTITD--QQHTDWITCVR 164

Query: 504 WAPH-ELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG 680
           ++P     + ++CG  D  + V+  ++    D  +  + H   +  V+ +P    G+L  
Sbjct: 165 FSPSPNQAIIVSCG-WDKLVKVWNLKN---CDLNKNLEGHTGVLNTVTISPD---GSLCA 217

Query: 681 SGLHDPVQKL-----------------------------ASAGCDNTVKVWKLYNGVWKM 773
           SG  D V KL                               A  D  +++W L + +   
Sbjct: 218 SGGKDGVAKLWDVKEGKHLYSLETGSTINSLCFSPCDYWLCAATDRFIRIWNLESKLIIS 277

Query: 774 DCFPALQ--MHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
           + +P  Q  +   W   + W+ N  L    +   S DG + ++ V K
Sbjct: 278 EIYPVKQSKIGVPWCTSLTWSANGQL----LYCGSTDGNIYVYEVKK 320



>gb:AK089463_1175945 Mus musculus B6-derived CD11 +ve dendritic
           cells cDNA, RIKEN full-length enriched library,
           clone:F730035H20 product:PCAF ASSOCIATED FACTOR 65 BETA
           (PUTATIVE TRANSCRIPTION FACTOR) homolog [Homo sapiens],
           full insert sequence.
          Length = 560

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 61/239 (25%), Positives = 107/239 (44%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           KI  GH   V+          + + S D SI+   + + + +       GH  PVW V  
Sbjct: 336 KILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNT---VLYQGHAYPVWDVDI 392

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           +   F    AS S D    +W   + +      ++  H + V+ + + P+     LA GS
Sbjct: 393 S--PFSLYFASGSHDRTARLW---SFDRTYPLRIYAGHLADVDCVKFHPNSN--YLATGS 445

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
           +D  + +++A+     ++ R+   H   V ++S++P+               + LASAG 
Sbjct: 446 TDKTVRLWSAQQG---NSVRLFTGHRGPVLSLSFSPNG--------------KYLASAGE 488

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
           D  +K+W L +G      F  L+ HT+ +  +A++P+ GL    IASAS D  V +W +
Sbjct: 489 DQRLKLWDLASGT----LFKELRGHTDSITSLAFSPDSGL----IASASMDNSVRVWDI 539



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 60/245 (24%), Positives = 103/245 (42%)
 Frame = +3

Query: 300  NSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDH 479
            ++T   +  L GH GPV+   +     G  L SCS D  +  W  G+   +T   ++  H
Sbjct: 329  DNTGTEMKILRGHCGPVYSTRFLADSSG--LLSCSEDMSIRYWDLGS---FTNTVLYQGH 383

Query: 480  KSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSM 659
               V  +  +P    L  A GS D    +++            D+ +P+ +    +A  +
Sbjct: 384  AYPVWDVDISP--FSLYFASGSHDRTARLWS-----------FDRTYPLRI----YAGHL 426

Query: 660  APGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNL 839
            A    V    H     LA+   D TV++W    G    +       H   V  ++++PN 
Sbjct: 427  ADVDCVK--FHPNSNYLATGSTDKTVRLWSAQQG----NSVRLFTGHRGPVLSLSFSPN- 479

Query: 840  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNN 1019
                  +ASA ED ++ +W +A  G  +  K L      +  +++S    L+A AS DN+
Sbjct: 480  ---GKYLASAGEDQRLKLWDLAS-GTLF--KELRGHTDSITSLAFSPDSGLIASASMDNS 533

Query: 1020 VTLWN 1034
            V +W+
Sbjct: 534  VRVWD 538



>sp|Q91WQ5|TA5L_MOUSE TAF5-like RNA polymerase II
           p300/CBP-associated factor-associated factor 65 kDa
           subunit 5L (PCAF associated factor 65 beta) (PAF65-
           beta).>gb:AK033477_1163354 Mus musculus adult male colon
           cDNA, RIKEN full-length enriched library,
           clone:9030217F08 product:PCAF ASSOCIATED FACTOR 65 BETA
           (PUTATIVE TRANSCRIPTION FACTOR) homolog [Homo sapiens],
           full insert sequence.>gb:BC013550_2091832 Mus musculus
           TAF5-like RNA polymerase II, p300/CBP-associated factor
           (PCAF)-associated factor, mRNA (cDNA clone MGC:19341
           IMAGE:4222283), complete cds.
          Length = 589

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 61/239 (25%), Positives = 107/239 (44%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           KI  GH   V+          + + S D SI+   + + + +       GH  PVW V  
Sbjct: 336 KILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNT---VLYQGHAYPVWDVDI 392

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           +   F    AS S D    +W   + +      ++  H + V+ + + P+     LA GS
Sbjct: 393 S--PFSLYFASGSHDRTARLW---SFDRTYPLRIYAGHLADVDCVKFHPNSN--YLATGS 445

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
           +D  + +++A+     ++ R+   H   V ++S++P+               + LASAG 
Sbjct: 446 TDKTVRLWSAQQG---NSVRLFTGHRGPVLSLSFSPNG--------------KYLASAGE 488

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
           D  +K+W L +G      F  L+ HT+ +  +A++P+ GL    IASAS D  V +W +
Sbjct: 489 DQRLKLWDLASGT----LFKELRGHTDSITSLAFSPDSGL----IASASMDNSVRVWDI 539



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 60/245 (24%), Positives = 103/245 (42%)
 Frame = +3

Query: 300  NSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDH 479
            ++T   +  L GH GPV+   +     G  L SCS D  +  W  G+   +T   ++  H
Sbjct: 329  DNTGTEMKILRGHCGPVYSTRFLADSSG--LLSCSEDMSIRYWDLGS---FTNTVLYQGH 383

Query: 480  KSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSM 659
               V  +  +P    L  A GS D    +++            D+ +P+ +    +A  +
Sbjct: 384  AYPVWDVDISP--FSLYFASGSHDRTARLWS-----------FDRTYPLRI----YAGHL 426

Query: 660  APGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNL 839
            A    V    H     LA+   D TV++W    G    +       H   V  ++++PN 
Sbjct: 427  ADVDCVK--FHPNSNYLATGSTDKTVRLWSAQQG----NSVRLFTGHRGPVLSLSFSPN- 479

Query: 840  GLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNN 1019
                  +ASA ED ++ +W +A  G  +  K L      +  +++S    L+A AS DN+
Sbjct: 480  ---GKYLASAGEDQRLKLWDLAS-GTLF--KELRGHTDSITSLAFSPDSGLIASASMDNS 533

Query: 1020 VTLWN 1034
            V +W+
Sbjct: 534  VRVWD 538



>gb:AJ719967_2502154 Gallus gallus mRNA for hypothetical protein,
            clone 8n22.
          Length = 388

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 75/287 (26%), Positives = 116/287 (40%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A+A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 94   SGHEGEVYCCKFHPGGNTLASAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 151

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GS+L S S D  V VW   +     +      H S VNS    P   G  L C GS D
Sbjct: 152  --GSMLFSASTDKTVAVW---DSETGERVKRLKGHTSFVNSCY--PARRGPQLVCTGSDD 204

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V AV++              +D   ++ S G DN
Sbjct: 205  GTVKLWDIRKKAAVQTFQ----NTYQVLAVTF--------------NDTSDQIISGGIDN 246

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            ++ H + V  ++    L    S + S + D  V IW V   
Sbjct: 247  DIKVWDLRQNKLTY----TMRGHADSVTGLS----LSSEGSYLLSNAMDNTVRIWDVRPF 298

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 299  APKERCVKIFQGNV-HNFEKNLLRCSWSPDGSKIAGGSADRFVYVWD 344



>gb:CR857310_1181554 Pongo pygmaeus mRNA; cDNA DKFZp469N2132 (from
            clone DKFZp469N2132).
          Length = 357

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 73/287 (25%), Positives = 117/287 (40%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A+A  D  I +  V  +  +   ATL G+ G V ++ +   
Sbjct: 63   SGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCGNY--ATLKGYSGAVMELHYNTD 120

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GS+L S S D  V VW   +     +      H S VNS    P   G  L C GS D
Sbjct: 121  --GSMLFSASTDKTVAVW---DSETGERVKRLKGHTSFVNSCY--PARRGPQLVCTGSDD 173

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V AV++              +D   ++ S G DN
Sbjct: 174  GTVKLWDIRKKAAIQTFQ----NTYQVLAVTF--------------NDTSDQIISGGIDN 215

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            ++ H + V  ++    L    S + S + D  V +W V   
Sbjct: 216  DIKVWDLRQNKLTY----TMRGHADSVTGLS----LSSEGSYLLSNAMDNTVRVWDVRPF 267

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D +V +W+
Sbjct: 268  APKERCVKIFQGNV-HNFEKNLLRCSWSPDGSKIAAGSADRSVCVWD 313



>gb:AE014134_1126890 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003589_1216771 Drosophila melanogaster
           chromosome 2L, section 2 of 83 of the complete
           sequence.>gb:AY089286_1296942 Drosophila melanogaster
           AT08344 full insert cDNA.
          Length = 488

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 57/212 (26%), Positives = 93/212 (43%), Gaps = 3/212 (1%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH++ V  ++    G  +A+ S D ++++  +  N+ + H  T  GH   V  VSWA   
Sbjct: 117 GHAEAVVSLNFSPDGAHLASGSGDTTVRLWDL--NTETPHF-TCTGHKQWVLCVSWAPD- 172

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP-HELGLC--LACGSS 548
            G  LAS    G +I+W      +  +    + HK  +N ++W P H    C  LA  S 
Sbjct: 173 -GKRLASGCKAGSIIIWDPETGQQ--KGRPLSGHKKHINCLAWEPYHRDPECRKLASASG 229

Query: 549 DGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
           DG+  ++  +   G     I   H   VTAV W          G+GL      + ++  D
Sbjct: 230 DGDCRIWDVKL--GQCLMNI-AGHTNAVTAVRWG---------GAGL------IYTSSKD 271

Query: 729 NTVKVWKLYNGVWKMDCFPALQMHTNWVRDVA 824
            TVK+W+  +G+           H +WV ++A
Sbjct: 272 RTVKMWRAADGI----LCRTFSGHAHWVNNIA 299



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 69/295 (23%), Positives = 116/295 (39%), Gaps = 15/295 (5%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGK-----RVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQV 359
            +GH   ++ ++ + Y +     ++A+AS D   +I  V      Q L  +AGH   V  V
Sbjct: 201  SGHKKHINCLAWEPYHRDPECRKLASASGDGDCRIWDVK---LGQCLMNIAGHTNAVTAV 257

Query: 360  SWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC 539
             W       L+ + S D  V +W+     +      F+ H   VN+I+ +   +      
Sbjct: 258  RWGG---AGLIYTSSKDRTVKMWRAA---DGILCRTFSGHAHWVNNIALSTDYV------ 305

Query: 540  GSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLH-------DP 698
                                 R    HP+   + S   S++   L  S L        D 
Sbjct: 306  --------------------LRTGPFHPVKDRSKSHL-SLSTEELQESALKRYQAVCPDE 344

Query: 699  VQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASED 878
            V+ L S   DNT+ +W+         C   +  H N V DV ++P++ L    IASAS D
Sbjct: 345  VESLVSCSDDNTLYLWRNNQN----KCVERMTGHQNVVNDVKYSPDVKL----IASASFD 396

Query: 879  GKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              V +W  +      +G+ +  F      V+ V+WS    L+   S D+ + +W+
Sbjct: 397  KSVRLWRAS------DGQYMATFRGHVQAVYTVAWSADSRLIVSGSKDSTLKVWS 445



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 56/196 (28%), Positives = 83/196 (42%), Gaps = 1/196 (0%)
 Frame = +3

Query: 321 ATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSI 500
           +++ GH   V  ++++    G+ LAS S D  V +W   + N  T       HK  V  +
Sbjct: 113 SSMPGHAEAVVSLNFSPD--GAHLASGSGDTTVRLW---DLNTETPHFTCTGHKQWVLCV 167

Query: 501 SWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG 680
           SWAP   G  LA G   G+I ++   +  G    R    H   +  ++W P         
Sbjct: 168 SWAPD--GKRLASGCKAGSIIIWDPET--GQQKGRPLSGHKKHINCLAWEPYH------- 216

Query: 681 SGLHDP-VQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST 857
               DP  +KLASA  D   ++W +  G     C   +  HTN V  V W    GL    
Sbjct: 217 ---RDPECRKLASASGDGDCRIWDVKLG----QCLMNIAGHTNAVTAVRWG-GAGL---- 264

Query: 858 IASASEDGKVVIWTVA 905
           I ++S+D  V +W  A
Sbjct: 265 IYTSSKDRTVKMWRAA 280



 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 38/125 (30%), Positives = 58/125 (46%)
 Frame = +3

Query: 195 TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
           TGH + V+DV      K +A+AS D S+++   S+    Q++AT  GH   V+ V+W+  
Sbjct: 372 TGHQNVVNDVKYSPDVKLIASASFDKSVRLWRASDG---QYMATFRGHVQAVYTVAWSAD 428

Query: 375 KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
               L+ S S D  + VW    +     A     H   V  + WAP   G  +A G  D 
Sbjct: 429 --SRLIVSGSKDSTLKVWSVQTKK---LAQELPGHADEVFGVDWAPD--GSRVASGGKDK 481

Query: 555 NISVY 569
            I ++
Sbjct: 482 VIKLW 486



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 40/143 (27%), Positives = 58/143 (40%), Gaps = 8/143 (5%)
 Frame = +3

Query: 630  VTAVSWAPSMAPG---ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMH 800
            V  V+   S  PG   A+V          LAS   D TV++W L        C      H
Sbjct: 105  VRPVTRCTSSMPGHAEAVVSLNFSPDGAHLASGSGDTTVRLWDLNTETPHFTCTG----H 160

Query: 801  TNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSW-- 974
              WV  V+WAP+       +AS  + G ++IW    E  Q +G+ L      +  ++W  
Sbjct: 161  KQWVLCVSWAPD----GKRLASGCKAGSIIIWD--PETGQQKGRPLSGHKKHINCLAWEP 214

Query: 975  ---SLTGNLLAVASGDNNVTLWN 1034
                     LA ASGD +  +W+
Sbjct: 215  YHRDPECRKLASASGDGDCRIWD 237



>pir|JC7987|JC7987 receptor for activated C kinase, RACK protein -
            Plasmodium falciparum>gb:AY174059_1306698 Plasmodium
            falciparum activated protein kinase C receptor (RACK)
            mRNA, complete cds.>gb:AY174060_1306699 Plasmodium
            falciparum activated protein kinase C receptor (RACK)
            gene, partial cds.
          Length = 323

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 79/290 (27%), Positives = 118/290 (40%), Gaps = 8/290 (2%)
 Frame = +3

Query: 189  IETGHSDTVHDVSM--DYYGKRVATASSDASIKIIGVSNNSTSQHLAT----LAGHHGPV 350
            +E GHSD V  VS   D   K + +AS D  + +  ++ +  S  + T    L GH   +
Sbjct: 16   LEGGHSDWVTSVSTPTDPKLKTIVSASRDKKLIVWNINTDDDSGEIGTARKSLTGHSQAI 75

Query: 351  WQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC 530
              VS +    G    S S+D  V +W   + +       F  H S V S+S++P    + 
Sbjct: 76   NDVSISSD--GLFALSGSWDRSVRLW---DLSLGETIRSFIGHTSDVFSVSFSPDNRQIV 130

Query: 531  LACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL 710
             A  S D  I ++   +   +     DQ H   +T V ++PS     +V           
Sbjct: 131  SA--SRDKTIKLWNTLAQCKYTIT--DQQHTDWITYVRFSPSPNQAIIV----------- 175

Query: 711  ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVV 890
             S G D  VKVW L N     D    L+ HT  +  V  +P+     S  AS  +DG   
Sbjct: 176  -SCGWDKLVKVWNLKN----CDLNKNLEGHTGVLNTVTISPD----GSLCASGGKDGVAK 226

Query: 891  IWTVAKEGDQWEGKVLYDFNT--PVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +W V       EGK LY   T   +  + +S     L  A+ D  + +WN
Sbjct: 227  LWDVK------EGKHLYSLETGSTINSLCFSPCDYWLCAAT-DRFIRIWN 269



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 62/287 (21%), Positives = 115/287 (40%), Gaps = 33/287 (11%)
 Frame = +3

Query: 147 IRSSDKEGKM-PAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA 323
           I + D  G++  A+K  TGHS  ++DVS+   G    + S D S+++  +S   T   + 
Sbjct: 52  INTDDDSGEIGTARKSLTGHSQAINDVSISSDGLFALSGSWDRSVRLWDLSLGET---IR 108

Query: 324 TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
           +  GH   V+ VS++       + S S D  + +W    Q ++T       H   +  + 
Sbjct: 109 SFIGHTSDVFSVSFSPD--NRQIVSASRDKTIKLWNTLAQCKYTITD--QQHTDWITYVR 164

Query: 504 WAPH-ELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVG 680
           ++P     + ++CG  D  + V+  ++    D  +  + H   +  V+ +P    G+L  
Sbjct: 165 FSPSPNQAIIVSCG-WDKLVKVWNLKN---CDLNKNLEGHTGVLNTVTISPD---GSLCA 217

Query: 681 SGLHDPVQKL-----------------------------ASAGCDNTVKVWKLYNGVWKM 773
           SG  D V KL                               A  D  +++W L + +   
Sbjct: 218 SGGKDGVAKLWDVKEGKHLYSLETGSTINSLCFSPCDYWLCAATDRFIRIWNLESKLIIS 277

Query: 774 DCFPALQ--MHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAK 908
           + +P  Q  +   W   + W+ N  L    +   S DG + ++ V K
Sbjct: 278 EIYPVKQSKIGVPWCTSLTWSANGQL----LYCGSTDGNIYVYEVKK 320



>gb:AP005063_1847406 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OSJNBa0016I05.>gb:AP005462_1852269 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0613B07.
          Length = 609

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 65/242 (26%), Positives = 102/242 (42%), Gaps = 11/242 (4%)
 Frame = +3

Query: 336  HHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQN-------EWTQAHVFNDHKSSVN 494
            H  P   V W +    +  A+CS D  + V K G+Q            +  F+   S VN
Sbjct: 410  HSAPTLDVDWRN---NNSFATCSTDNMIYVCKIGDQRPVKSFSGHQHSSPAFSKKNSEVN 466

Query: 495  SISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL 674
            +I W P   G  LA  S D     +TA+                 +  + W+P+      
Sbjct: 467  AIKWDP--TGSLLASCSDD-----WTAKE----------------IYTIRWSPT------ 497

Query: 675  VGSGLHDPVQKL--ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
             G G ++P Q+L  ASA  D+T+K+W++  G        +L  H   V  VA++P     
Sbjct: 498  -GPGTNNPNQQLLLASASFDSTIKLWEVEQG----RLLYSLAGHRQPVYSVAFSPG---- 548

Query: 849  KSTIASASEDGKVVIWTVAKEGDQWEGKVL--YDFNTPVWRVSWSLTGNLLAVASGDNNV 1022
               +AS S D  + IW+V       EG++L  Y  +  ++ V W+  G+ +A    +N V
Sbjct: 549  GEYLASGSLDQCLHIWSVK------EGRILKTYRGSGGIFEVCWNKEGSKIAACFSNNTV 602

Query: 1023 TL 1028
             L
Sbjct: 603  CL 604



>gb:AB006703_1509953 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MRH10.
          Length = 523

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 82/318 (25%), Positives = 127/318 (39%), Gaps = 31/318 (9%)
 Frame = +3

Query: 171  KMPAQKIE--TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHG 344
            ++P++ ++    H + V  V     GK +ATASSD +  I  V +++  +   TL  H  
Sbjct: 211  QIPSETVQILVAHKNEVWFVQFSNSGKYLATASSDCTAIIWKVLDDNKVELKHTLESHQN 270

Query: 345  PVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKS--SVNSISWAPHE 518
            PV  VSW+ P    LL      G   V K  + +     H F ++ +  +V+S +W P  
Sbjct: 271  PVSFVSWS-PDDTKLLTC----GNAEVLKLWDVDTGVLRHTFGNNNTGFTVSSCAWFPDS 325

Query: 519  LGLCLACGSSDGNISVYTARSDG----GWDTARIDQAHPIGVT--AVSWAPSMAPGALVG 680
                L CGSSD    +    +DG     W   RI +   + VT    S     +   +  
Sbjct: 326  TR--LVCGSSDPERGIVMWDTDGNEIKAWRGTRIPKVVDLAVTPDGESMITVFSDKEIRI 383

Query: 681  SGLHDPVQKLAS--------------------AGCDNTVKVWKLYNGVWKMDCFPALQMH 800
              L   V+++ S                      C   + +W L  G WK     +    
Sbjct: 384  LNLETKVERVISEEQPITSLSISGDGKFFIVNLSCQE-IHLWDL-AGEWKQPLKFSGHRQ 441

Query: 801  TNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWS- 977
            + +V    +    GL  S IAS SED +V IW +         +VL   +  V  VSW+ 
Sbjct: 442  SKYVIRSCFG---GLDSSFIASGSEDSQVYIWNLKNTKPL---EVLSGHSMTVNCVSWNP 495

Query: 978  LTGNLLAVASGDNNVTLW 1031
                +LA AS D  + +W
Sbjct: 496  KNPRMLASASDDQTIRIW 513



 Score = 36.6 bits (83), Expect = 0.97
 Identities = 23/67 (34%), Positives = 36/67 (53%)
 Frame = +3

Query: 249 VATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVW 428
           +A+ S D+ + I  + N   ++ L  L+GH   V  VSW +PK   +LAS S D  + +W
Sbjct: 458 IASGSEDSQVYIWNLKN---TKPLEVLSGHSMTVNCVSW-NPKNPRMLASASDDQTIRIW 513

Query: 429 KEGNQNE 449
             G  N+
Sbjct: 514 GPGKPNK 520



>gb:CR858112_1182299 Pongo pygmaeus mRNA; cDNA DKFZp469O1927 (from
            clone DKFZp469O1927).
          Length = 451

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 81/318 (25%), Positives = 129/318 (40%), Gaps = 35/318 (11%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   +  + +   GK++ATAS D  + +     ++ +       GH   V  V ++   
Sbjct: 16   GHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYV---GHKDVVTSVQFS--P 70

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+LLAS S D  V +W    + ++++   F  H + V S+ ++    G  LA  S D +
Sbjct: 71   HGNLLASASRDRTVRLWIPDKRGKFSE---FKAHTAPVRSVDFSAD--GQFLATASEDKS 125

Query: 558  ISVYTA-RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKL-------- 710
            I V++  R    +   R    H   V    ++P    G L+ S   D   K+        
Sbjct: 126  IKVWSMYRQRFLYSLYR----HTHWVRCAKFSPD---GRLIVSCSEDKTIKIWDTTNKQC 178

Query: 711  -----------------------ASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDV 821
                                   ASAG D TVKVW +   V K+      Q+H+  V  +
Sbjct: 179  VNNFSDSVGFANFVDFNPSGTCIASAGSDQTVKVWDVR--VNKL--LQHYQVHSGGVNCI 234

Query: 822  AWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNT---PVWRVSWSLTGNL 992
            ++ P+     + + +AS DG + I       D  EG+++Y       PV+ VS+S  G L
Sbjct: 235  SFHPS----DNYLVTASSDGTLKIL------DLLEGRLIYTLQGHTGPVFTVSFSKGGEL 284

Query: 993  LAVASGDNNVTLWNEAVD 1046
             A    D  V LW    D
Sbjct: 285  FASGGADTQVLLWRTNFD 302



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 66/246 (26%), Positives = 97/246 (39%)
 Frame = +3

Query: 159 DKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGH 338
           DK GK    K    H+  V  V     G+ +ATAS D SIK+  +      + L +L  H
Sbjct: 90  DKRGKFSEFK---AHTAPVRSVDFSADGQFLATASEDKSIKVWSMYR---QRFLYSLYRH 143

Query: 339 HGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHE 518
               W         G L+ SCS D  + +W   N+      + F+D     N + + P  
Sbjct: 144 --THWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQ---CVNNFSDSVGFANFVDFNPS- 197

Query: 519 LGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDP 698
            G C+A   SD  + V+  R +      +  Q H  GV  +S+ PS              
Sbjct: 198 -GTCIASAGSDQTVKVWDVRVN---KLLQHYQVHSGGVNCISFHPS-------------- 239

Query: 699 VQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASED 878
              L +A  D T+K+  L  G         LQ HT  V  V+++    L     AS   D
Sbjct: 240 DNYLVTASSDGTLKILDLLEG----RLIYTLQGHTGPVFTVSFSKGGEL----FASGGAD 291

Query: 879 GKVVIW 896
            +V++W
Sbjct: 292 TQVLLW 297



>pir|T49682|T49682 hypothetical protein B8B20.360 [imported] -
            Neurospora crassa>gb:NCB8B20_1690256 Neurospora crassa
            DNA linkage group II BAC clone B8B20.
          Length = 468

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 81/374 (21%), Positives = 134/374 (35%), Gaps = 84/374 (22%)
 Frame = +3

Query: 117  HSLFQGDHT-FIRSS---DKEGKMPAQ-----KIETGHSDTVHDVSMDYYGKRVATASSD 269
            HS+  G HT  +RS+      GK+  +     ++ TG  DT   V     G+R    S +
Sbjct: 65   HSVLTGGHTRSVRSAAWQPPRGKVSGKEAKRLRLVTGSFDTTAGVWTWDQGRR--EESLE 122

Query: 270  ASIKIIGVSNNSTSQH----------LATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
              I++    N+  ++              L GH   V  V+++    G  LA+CS D  V
Sbjct: 123  REIRLQSGENDQEAEEEEEAEDEWELTLVLEGHENEVKSVNYSPS--GQYLATCSRDKSV 180

Query: 420  IVWKE-GNQN--------------EWTQAHVFNDHKSSVNSISWAPHELGL--------- 527
             +W++ GN N              EW    V  +H   V +++W P   G          
Sbjct: 181  WIWEDVGNPNPSSEEEDEEEEDEDEWETVAVLQEHDGDVKAVAWCPDVPGRKGKYAPPRR 240

Query: 528  ----CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHD 695
                 LA  S D  + ++    DG W    + + H   V  V+W              +D
Sbjct: 241  YGDDVLASASYDNTVRLWREDGDGEWVCVAVLEGHEGTVWGVAWEGRPRE--------ND 292

Query: 696  PVQKLASAGCDNTVKVWKLY----------------NGVW--------------KMDCFP 785
               +L S G D  ++VW L                 N  W              + +C  
Sbjct: 293  KFPRLLSWGADEVIRVWSLKEPEEEEHGEGAAGGGGNNTWGFGVPNTMRRSLKEEWECTA 352

Query: 786  AL-QMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW------TVAKEGDQWEGKVLYD 944
             L ++H   +  VAW+   GL    ++S   DG + ++      T   E ++  G+    
Sbjct: 353  VLPKVHKGDIYSVAWSTETGL----LSSVGSDGVLALYQETANTTEKNEENETNGEAPTT 408

Query: 945  FNTPVWRVSWSLTG 986
             +   W+V  ++ G
Sbjct: 409  TSAGGWKVLTTVKG 422



 Score = 40.8 bits (94), Expect = 0.051
 Identities = 68/293 (23%), Positives = 107/293 (36%), Gaps = 41/293 (13%)
 Frame = +3

Query: 300  NSTSQHLATLAGHHGPVWQVSWA---HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF 470
            ++T+  +  L      ++Q +WA   HP    L+A+C     V V+     ++   + + 
Sbjct: 14   SATTAEITPLPAFSPDLYQRAWASIPHPSL-PLIATCHAHS-VTVFSLSTLSK--HSVLT 69

Query: 471  NDHKSSVNSISWAP--------HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI 626
              H  SV S +W P            L L  GS D    V+T      WD  R ++    
Sbjct: 70   GGHTRSVRSAAWQPPRGKVSGKEAKRLRLVTGSFDTTAGVWT------WDQGRREE---- 119

Query: 627  GVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTN 806
                     S+     + SG +D   +      D            W++     L+ H N
Sbjct: 120  ---------SLEREIRLQSGENDQEAEEEEEAEDE-----------WELTL--VLEGHEN 157

Query: 807  WVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA--------------KEGDQWEG-KVLY 941
             V+ V ++P+       +A+ S D  V IW                 ++ D+WE   VL 
Sbjct: 158  EVKSVNYSPS----GQYLATCSRDKSVWIWEDVGNPNPSSEEEDEEEEDEDEWETVAVLQ 213

Query: 942  DFNTPVWRVSWS---------------LTGNLLAVASGDNNVTLWNEAVDGEW 1055
            + +  V  V+W                   ++LA AS DN V LW E  DGEW
Sbjct: 214  EHDGDVKAVAWCPDVPGRKGKYAPPRRYGDDVLASASYDNTVRLWREDGDGEW 266



>gb:BC067651_2554823 Danio rerio cDNA clone IMAGE:6963216, partial
            cds.
          Length = 745

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 60/248 (24%), Positives = 100/248 (40%)
 Frame = +3

Query: 291  VSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVF 470
            + +  TS     L GH GPV+ VS++  +  + L S S DG + +W   +   +T    +
Sbjct: 472  IMDEKTSSESKILHGHSGPVYGVSFSPDR--NYLLSSSEDGTIRLW---SLQTFTCLVGY 526

Query: 471  NDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWA 650
              H   V    ++P   G     G  D    V    +   +   RI   H   VT   + 
Sbjct: 527  KGHNYPVWDTQFSP--FGYYFVSGGHD---RVARLWATDHYQPLRIFAGHLADVTCTRFH 581

Query: 651  PSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWA 830
            P+                 +A+   D TV++W + NG    +C      H   +  +A++
Sbjct: 582  PNS--------------NYVATGSSDRTVRLWDVLNG----NCVRIFTGHKGPIHSLAFS 623

Query: 831  PNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASG 1010
            PN       +AS S DG+V++W +   G       L      ++ + +S  G ++A  S 
Sbjct: 624  PN----GKFLASGSTDGRVLLWDI---GHGLMIAELKGHTGTIYALKFSRDGEIIASGSI 676

Query: 1011 DNNVTLWN 1034
            DN V LW+
Sbjct: 677  DNTVRLWD 684



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 52/222 (23%), Positives = 90/222 (40%), Gaps = 9/222 (4%)
 Frame = +3

Query: 126  FQGDHTFIRSSDKEGKMPAQKIET--------GHSDTVHDVSMDYYGKRVATASSDASIK 281
            F  D  ++ SS ++G +    ++T        GH+  V D     +G    +   D   +
Sbjct: 496  FSPDRNYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQFSPFGYYFVSGGHDRVAR 555

Query: 282  IIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA 461
            +    +    Q L   AGH   V    + HP   + +A+ S D  V +W   N N     
Sbjct: 556  LWATDHY---QPLRIFAGHLADVTCTRF-HPN-SNYVATGSSDRTVRLWDVLNGN---CV 607

Query: 462  HVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTAR-IDQAHPIGVTA 638
             +F  HK  ++S++++P+  G  LA GS+DG + +        WD    +  A   G T 
Sbjct: 608  RIFTGHKGPIHSLAFSPN--GKFLASGSTDGRVLL--------WDIGHGLMIAELKGHTG 657

Query: 639  VSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGV 764
              +A   +    +          +AS   DNTV++W +   +
Sbjct: 658  TIYALKFSRDGEI----------IASGSIDNTVRLWDVMRAI 689



 Score = 40.8 bits (94), Expect = 0.051
 Identities = 39/154 (25%), Positives = 65/154 (42%), Gaps = 1/154 (0%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           +I  GH   V           VAT SSD ++++  V N +    +    GH GP+  +++
Sbjct: 566 RIFAGHLADVTCTRFHPNSNYVATGSSDRTVRLWDVLNGNC---VRIFTGHKGPIHSLAF 622

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           +    G  LAS S DG+V++W  G+            H  ++ ++ ++    G  +A GS
Sbjct: 623 SPN--GKFLASGSTDGRVLLWDIGH---GLMIAELKGHTGTIYALKFSRD--GEIIASGS 675

Query: 546 SDGNISVYTARSDGGWDTAR-IDQAHPIGVTAVS 644
            D  + +        WD  R ID       TA +
Sbjct: 676 IDNTVRL--------WDVMRAIDDVETDDFTAAT 701



 Score = 33.9 bits (76), Expect = 6.3
 Identities = 31/114 (27%), Positives = 48/114 (42%)
 Frame = +3

Query: 693  DPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASAS 872
            D    +A    D+TV+VW +                   +R V  A +L L    I   S
Sbjct: 425  DDSSLIAGGFADSTVRVWSVT---------------PKKLRKVKSAADLNL----IDKES 465

Query: 873  EDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +D   V+  +  E    E K+L+  + PV+ VS+S   N L  +S D  + LW+
Sbjct: 466  DD---VLERIMDEKTSSESKILHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWS 516



>gb:BC055275_2551353 Danio rerio zgc:63538, mRNA (cDNA clone MGC:63538
            IMAGE:3815924), complete cds.
          Length = 490

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/215 (24%), Positives = 94/215 (43%)
 Frame = +3

Query: 390  LASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVY 569
            LA+ S D  +++W   N     +A  F  H   +  +++AP   G  +A  S D  + ++
Sbjct: 33   LATGSCDKSLMIW---NLAPKARAFRFVGHTDVITGVNFAPS--GSLVASSSRDQTVRLW 87

Query: 570  TARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWK 749
            T    G    + + +AH   V +V+++                 Q+L +A  D +VKVW 
Sbjct: 88   TPSIKG---ESTVFKAHTASVRSVNFSRDG--------------QRLVTASDDKSVKVW- 129

Query: 750  LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG 929
               GV +     +L  HTNWVR   ++P+  L    IAS  +D  V +W  +        
Sbjct: 130  ---GVERKKFLYSLNRHTNWVRCARFSPDGRL----IASCGDDRTVRLWDTSSHQCT--- 179

Query: 930  KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +  D+      V ++ +G  +A +  DN + +W+
Sbjct: 180  NIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWD 214



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 75/313 (23%), Positives = 123/313 (39%), Gaps = 30/313 (9%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D +     +   K++AT S D S+ I  ++  + +       GH   +  V++A   
Sbjct: 16   GHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFV---GHTDVITGVNFAPS- 71

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             GSL+AS S D  V +W    + E T   VF  H +SV S++++    G  L   S D +
Sbjct: 72   -GSLVASSSRDQTVRLWTPSIKGEST---VFKAHTASVRSVNFSRD--GQRLVTASDDKS 125

Query: 558  ISV---------YTARSDGGWDTARIDQAHPIGVTAVS---------WAPSMAP------ 665
            + V         Y+      W   R  +  P G    S         W  S         
Sbjct: 126  VKVWGVERKKFLYSLNRHTNW--VRCARFSPDGRLIASCGDDRTVRLWDTSSHQCTNIFT 183

Query: 666  ---GALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN 836
               G+      +     +AS+G DNT+K+W +             ++H   V   ++ P+
Sbjct: 184  DYGGSATFVDFNSSGTCIASSGADNTIKIWDIRTN----KLIQHYKVHNAGVNCFSFHPS 239

Query: 837  LGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLLAVAS 1007
                 + + S S D  + I       D  EG+++Y  +    PV  V++S  G+L A   
Sbjct: 240  ----GNYLISGSSDSTIKIL------DLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGG 289

Query: 1008 GDNNVTLWNEAVD 1046
             D+ V +W    D
Sbjct: 290  ADSQVLMWKTNFD 302



 Score = 37.0 bits (84), Expect = 0.74
 Identities = 22/90 (24%), Positives = 42/90 (46%)
 Frame = +3

Query: 783  PALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVW 962
            P L+ H    +DV    +       +A+ S D  ++IW +A +   +           + 
Sbjct: 8    PTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFR---FVGHTDVIT 64

Query: 963  RVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
             V+++ +G+L+A +S D  V LW  ++ GE
Sbjct: 65   GVNFAPSGSLVASSSRDQTVRLWTPSIKGE 94



>gb:AJ721075_2503262 Gallus gallus mRNA for hypothetical protein,
           clone 34f17.
          Length = 529

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 261 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 315

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 316 SN----GLMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 367

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 368 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 408

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 409 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 455



>gb:BC034261_2097619 Mus musculus F-box and WD-40 domain protein 11,
           mRNA (cDNA clone MGC:28671 IMAGE:4237375), complete cds.
          Length = 563

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 295 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 349

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 350 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 401

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 402 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 442

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 443 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 489



>gb:AL669844_2072493 Mouse DNA sequence from clone RP23-395O6 on
           chromosome 11 Contains the 3' end of a novel gene, a
           novel gene, the Stk10 gene for serine/threonine kinase
           10, the 5' end of the Fbxw1b gene for F-box and WD-40
           domain protein 1B and two CpG islands, complete
           sequence.>gb:AL669951_2072607 Mouse DNA sequence from
           clone RP23-94F11 on chromosome 11 Contains three novel
           genes, a ribosomal protein L9 (Rpl9) pseudogene, a
           transcription elongation factor A (SII) 3 (Tcea3)
           pseudogene and the 3' end of the Fbxw1b gene for F-box
           and WD-40 domain protein 1B, complete sequence.
          Length = 542

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 274 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 328

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 329 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 380

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 381 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 421

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 422 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 468



>gb:AB093260_2048045 Mus musculus mRNA for mKIAA0696 protein.
          Length = 555

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 287 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 341

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 342 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 393

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 394 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 434

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 435 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 481



>gb:AF090988_1882483 Homo sapiens U5 snRNP-specific 40 kDa protein
            mRNA, complete cds.
          Length = 357

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 73/287 (25%), Positives = 115/287 (40%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +A+A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 63   SGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 120

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GS+L S S D  V VW   +     +      H S VNS    P      L C GS D
Sbjct: 121  --GSMLFSASTDKTVAVW---DSETGERVKRLKGHTSFVNSCY--PARKSPQLVCTGSDD 173

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V AV++              +D   ++ S G DN
Sbjct: 174  GTVKLWDIRKKAAIQTFQ----NTYQVLAVTF--------------NDTSDQIISGGIDN 215

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            ++ H + V  ++    L    S + S + D  V +W V   
Sbjct: 216  DIKVWDLRQNKLTY----TMRGHADSVTGLS----LSSEGSYLLSNAMDNTVRVWDVRPF 267

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 268  APKERCVKIFQGNV-HNFEKNLLRCSWSPDGSKIAAGSADRFVYVWD 313



>gb:AB033280_1866304 Homo sapiens BTRCP2 mRNA for F-box and
           WD-repeats protein beta-TRCP2 isoform B, complete
           cds.>gb:BC026213_1978739 Homo sapiens F-box and WD-40
           domain protein 11, transcript variant 2, mRNA (cDNA
           clone MGC:21122 IMAGE:4419029), complete cds.
          Length = 529

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 261 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 315

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 316 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 367

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 368 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 408

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 409 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 455



>gb:AB033279_1866303 Homo sapiens BTRCP2 mRNA for F-box and
           WD-repeats protein beta-TRCP2 isoform A, complete cds.
          Length = 508

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 240 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 294

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 295 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 346

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 347 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 387

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 388 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 434



>gb:AB014596_1864625 Homo sapiens mRNA for KIAA0696 protein, partial
           cds.
          Length = 550

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 282 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 336

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 337 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 388

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 389 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 429

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 430 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 476



>gb:AE017348_1758402 Cryptococcus neoformans var. neoformans JEC21
            chromosome 8, complete sequence.
          Length = 813

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 73/283 (25%), Positives = 116/283 (40%), Gaps = 13/283 (4%)
 Frame = +3

Query: 111  RLHSLFQGDHTFIRSSDKEGKM------PAQKIETGHSDTVHDVSMD-YYGKR-----VA 254
            RL SL +GD    +  D EG +      P +K+  GHS  V+ +S D  YG       + 
Sbjct: 489  RLWSL-KGDKLKKKKVDIEGNLVEDEGLPMRKL-VGHSGPVYSLSFDPLYGSAGPPSTLL 546

Query: 255  TASSDASIKIIGVSNNSTSQHLATLAGH-HGPVWQVSWAHPKFGSLLASCSFDGKVIVWK 431
            ++S D SI++  +    T  +L    GH   PVW V W     G   AS S D    +W 
Sbjct: 547  SSSQDGSIRLWSMD---TYSNLVVYRGHGKDPVWDVEWG--PMGVYFASASRDRTARLW- 600

Query: 432  EGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARID 611
              + +      ++  H S VN + + P+ L   LA  S+D +  ++  +        R+ 
Sbjct: 601  --SSDRVAPLRMYTGHLSDVNCVKFHPNSL--YLATASTDTSCRLWDVQRGA---CVRLF 653

Query: 612  QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPAL 791
              H   VT +S +P                + LASAG D+++ +W L +          +
Sbjct: 654  LGHTDSVTTLSISPDG--------------KTLASAGLDSSIWLWDLGSA----RPIKKM 695

Query: 792  QMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQ 920
            + HT  V  + ++       S + S   DG V  W V   G +
Sbjct: 696  EGHTGAVTSLTFSAE----SSVLVSGGLDGTVRCWDVKSAGGE 734



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 4/83 (4%)
 Frame = +3

Query: 798  HTNWVRDVAWAPNLGL--PKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFN--TPVWR 965
            H+  V  +++ P  G   P ST+ S+S+DG + +W++    D +   V+Y  +   PVW 
Sbjct: 523  HSGPVYSLSFDPLYGSAGPPSTLLSSSQDGSIRLWSM----DTYSNLVVYRGHGKDPVWD 578

Query: 966  VSWSLTGNLLAVASGDNNVTLWN 1034
            V W   G   A AS D    LW+
Sbjct: 579  VEWGPMGVYFASASRDRTARLWS 601



>gb:AK041532_1166020 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630019L11
           product:F-BOX/WD-REPEAT PROTEIN 1B (F-BOX AND WD-REPEATS
           PROTEIN BETA-TRCP2) homolog [Homo sapiens], full insert
           sequence.>gb:AL669844_2072494 Mouse DNA sequence from
           clone RP23-395O6 on chromosome 11 Contains the 3' end of
           a novel gene, a novel gene, the Stk10 gene for
           serine/threonine kinase 10, the 5' end of the Fbxw1b
           gene for F-box and WD-40 domain protein 1B and two CpG
           islands, complete sequence.>gb:AL669951_2072606 Mouse
           DNA sequence from clone RP23-94F11 on chromosome 11
           Contains three novel genes, a ribosomal protein L9
           (Rpl9) pseudogene, a transcription elongation factor A
           (SII) 3 (Tcea3) pseudogene and the 3' end of the Fbxw1b
           gene for F-box and WD-40 domain protein 1B, complete
           sequence.
          Length = 529

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 261 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 315

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 316 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 367

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 368 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 408

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 409 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 455



>sp|P41318|YNA6_YEAST Hypothetical 34.0 kDa Trp-Asp repeats
           containing protein in SIS1-MRPL2 intergenic
           region.>pir|S45461|S45461 hypothetical protein YNL006w -
           yeast (Saccharomyces cerevisiae)>gb:SCN200XG_1708817
           s.cerevisiae N2005, N2007, N2009, N2012, N2014, N2016
           genes.>gb:SCYNL006W_1713589 S.cerevisiae chromosome XIV
           reading frame ORF YNL006w.
          Length = 303

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 63/236 (26%), Positives = 108/236 (45%)
 Frame = +3

Query: 198 GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
           GH   V  VS     + + T+S D +IK+  V + S  ++      H+ PV +V   HP 
Sbjct: 73  GHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK----HNAPVNEVV-IHPN 127

Query: 378 FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
            G L+ SC  DG + +W  G +N+ T   +  +  +S+ S+S A    G  LA  ++ GN
Sbjct: 128 QGELI-SCDRDGNIRIWDLG-ENQCTH-QLTPEDDTSLQSLSMASD--GSMLAAANTKGN 182

Query: 558 ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
             V+   +         D +H   VT      +     L+ S     V+ LA+   D+T 
Sbjct: 183 CYVWEMPN-------HTDASHLKPVTKFRAHSTYITRILLSS----DVKHLATCSADHTA 231

Query: 738 KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVA 905
           +VW + +  +K++    L  H  WV D A++ +     + + +AS D  V +W ++
Sbjct: 232 RVWSI-DDDFKLE--TTLDGHQRWVWDCAFSAD----SAYLVTASSDHYVRLWDLS 280



 Score = 38.5 bits (88), Expect = 0.25
 Identities = 60/285 (21%), Positives = 116/285 (40%), Gaps = 7/285 (2%)
 Frame = +3

Query: 201  HSDT-VHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            HSD+ V+ + +    K +ATA    ++++  +   + +  +A+  GH G V  VS+    
Sbjct: 30   HSDSQVNRLEITNDKKLLATAGHQ-NVRLYDIRTTNPNP-VASFEGHRGNVTSVSFQQDN 87

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
                + + S DG + VW   + +          H + VN +   P++ G  ++C   DGN
Sbjct: 88   --RWMVTSSEDGTIKVWDVRSPSIPRNYK----HNAPVNEVVIHPNQ-GELISC-DRDGN 139

Query: 558  ISVYTARSDGGWDTARIDQAH---PIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCD 728
            I +        WD       H   P   T++      + G++           LA+A   
Sbjct: 140  IRI--------WDLGENQCTHQLTPEDDTSLQSLSMASDGSM-----------LAAANTK 180

Query: 729  NTVKVWKLYNGVWKMDCFPALQM--HTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
                VW++ N        P  +   H+ ++  +  + ++      +A+ S D    +W++
Sbjct: 181  GNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDV----KHLATCSADHTARVWSI 236

Query: 903  AKEGDQWEGKVLYDFNTP-VWRVSWSLTGNLLAVASGDNNVTLWN 1034
                D ++ +   D +   VW  ++S     L  AS D+ V LW+
Sbjct: 237  ---DDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278



>sp|Q9UKB1|FW1B_HUMAN F-box/WD-repeat protein 1B (F-box and
           WD-repeats protein beta-TrCP2).>gb:AB033281_1866305 Homo
           sapiens BTRCP2 mRNA for F-box and WD-repeats protein
           isoform C, complete cds.>gb:AF176022_1887992 Homo
           sapiens F-box protein Fbw1b (FBW1B) mRNA, complete cds.
          Length = 542

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/237 (22%), Positives = 100/237 (42%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           K+ TGH+ +V  + + Y  + + T SSD+++++  V+   T + L TL  H+  V  + +
Sbjct: 274 KVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVN---TGEVLNTLIHHNEAVLHLRF 328

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           ++     L+ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 329 SN----GLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDK----YIVSAS 380

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V+   S    +  R    H  G+  + +   +                + S   
Sbjct: 381 GDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL----------------VVSGSS 421

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +  G     C   L+ H   VR + +          I S + DGK+ +W
Sbjct: 422 DNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVSGAYDGKIKVW 468



>gb:CR382128_1660900 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 409

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 68/272 (25%), Positives = 109/272 (40%), Gaps = 20/272 (7%)
 Frame = +3

Query: 249  VATASSDASIKIIGVS------NNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFD 410
            +AT  +D S+ +   S      +N   +  ATL  H+   W +SW     G LL +CS D
Sbjct: 150  IATIGADGSVLMFDKSKHPANPSNDECKADATLCHHNSEGWSLSWNTKDRGKLL-TCSSD 208

Query: 411  GKVIVW---------KEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNIS 563
            G V +W          +G         VF  H+ SVN ++W P E  L  + G  D  + 
Sbjct: 209  GTVALWDLVNDYKSRSDGKMVTIAPKQVFIHHQGSVNDVTWHPSEKTLFASVG-DDQKLY 267

Query: 564  VYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKV 743
            V         DT      +       S + + +P        ++ V  +A++G D  V +
Sbjct: 268  VI--------DTTDNSTVYETDTRTASLSVAFSP-------FNNRV--VATSGEDGIVNL 310

Query: 744  WKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQW 923
            W + +          L  H   V  + W+P+       + S SED + +IW ++K G + 
Sbjct: 311  WDIKS--TSQTPIGRLVGHEGPVGSLDWSPH---NPRLLVSGSEDKRAIIWDISKIGQKD 365

Query: 924  EGKVLY---DFNTPVWRVSW--SLTGNLLAVA 1004
              + L+        V  V W  SL G + +VA
Sbjct: 366  GSEKLFVHAGHTEKVTEVGWNRSLEGVIGSVA 397



>gb:AY597210_1617101 Chlamydomonas reinhardtii katanin p80 subunit
            PF15p mRNA, complete cds.
          Length = 798

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 67/250 (26%), Positives = 104/250 (41%), Gaps = 4/250 (1%)
 Frame = +3

Query: 297  NNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND 476
            ++S    L   A H G V  V     K   +L +   D KV VW  G     T +     
Sbjct: 2    SSSRYAKLVEFAAHAGDVRCVRIGR-KTAGVLVTGGDDKKVNVWALGKT---TASFSLTG 57

Query: 477  HKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS 656
            H+SSV S+S+   E+   +A G S+G+I V+  ++       +    H   V  ++W P 
Sbjct: 58   HQSSVESVSFDNDEM--VVAAGGSNGSIKVFELQTG---KVTKSLSGHKSNVMCLAWHP- 111

Query: 657  MAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN 836
                       +D    + S   D  VK+W L +     +     + H   V  V ++P+
Sbjct: 112  -----------YDST--IISGSMDTNVKLWNLRD----KEAVMTFKGHNAGVTHVRYSPD 154

Query: 837  LGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTP----VWRVSWSLTGNLLAVA 1004
                 + +ASAS DG V IW V       +G++L D   P    +  V +S T  L+A +
Sbjct: 155  ----GNWVASASGDGAVKIWDVR------QGRLLQDLCPPTKYEITGVEFSPTEYLMATS 204

Query: 1005 SGDNNVTLWN 1034
            S D  V  W+
Sbjct: 205  SRDKLVRFWD 214



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 40/137 (29%), Positives = 62/137 (45%)
 Frame = +3

Query: 168 GKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGP 347
           GK  A    TGH  +V  VS D     VA   S+ SIK+  +     ++   +L+GH   
Sbjct: 47  GKTTASFSLTGHQSSVESVSFDNDEMVVAAGGSNGSIKVFELQTGKVTK---SLSGHKSN 103

Query: 348 VWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGL 527
           V  ++W HP + S + S S D  V +W   N  +      F  H + V  + ++P   G 
Sbjct: 104 VMCLAW-HP-YDSTIISGSMDTNVKLW---NLRDKEAVMTFKGHNAGVTHVRYSPD--GN 156

Query: 528 CLACGSSDGNISVYTAR 578
            +A  S DG + ++  R
Sbjct: 157 WVASASGDGAVKIWDVR 173



>gb:CQ783661_1452567 Sequence 3801 from Patent
            EP1396543.>gb:AK074772_1912684 Homo sapiens cDNA FLJ90291
            fis, clone NT2RP1001031, weakly similar to VEGETATIBLE
            INCOMPATIBILITY PROTEIN HET-E-1.>gb:BC026080_1978688 Homo
            sapiens WD repeat domain 51B, mRNA (cDNA clone MGC:26753
            IMAGE:4827689), complete cds.
          Length = 478

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 80/318 (25%), Positives = 126/318 (39%), Gaps = 35/318 (11%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   +  + +   GK++ATAS D  + +     ++ +       GH   V  V ++   
Sbjct: 16   GHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYR---YVGHKDVVTSVQFS--P 70

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             G+LLAS S D  V +W    + ++++   F  H + V S+ ++    G  LA  S D +
Sbjct: 71   HGNLLASASRDRTVRLWIPDKRGKFSE---FKAHTAPVRSVDFSAD--GQFLATASEDKS 125

Query: 558  ISVYTA-RSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK--------- 707
            I V++  R    +   R    H   V    ++P    G L+ S   D   K         
Sbjct: 126  IKVWSMYRQRFLYSLYR----HTHWVRCAKFSPD---GRLIVSCSEDKTIKIWDTTNKQC 178

Query: 708  ----------------------LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDV 821
                                  +ASAG D TVKVW     V         Q+H+  V  +
Sbjct: 179  VNNFSDSVGFANFVDFNPSGTCIASAGSDQTVKVW----DVRVNKLLQHYQVHSGGVNCI 234

Query: 822  AWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDF---NTPVWRVSWSLTGNL 992
            ++ P+     + + +AS DG + I       D  EG+++Y       PV+ VS+S  G L
Sbjct: 235  SFHPS----GNYLITASSDGTLKIL------DLLEGRLIYTLQGHTGPVFTVSFSKGGEL 284

Query: 993  LAVASGDNNVTLWNEAVD 1046
             A    D  V LW    D
Sbjct: 285  FASGGADTQVLLWRTNFD 302



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 66/246 (26%), Positives = 97/246 (39%)
 Frame = +3

Query: 159 DKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGH 338
           DK GK    K    H+  V  V     G+ +ATAS D SIK+  +      + L +L  H
Sbjct: 90  DKRGKFSEFK---AHTAPVRSVDFSADGQFLATASEDKSIKVWSMYR---QRFLYSLYRH 143

Query: 339 HGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHE 518
               W         G L+ SCS D  + +W   N+      + F+D     N + + P  
Sbjct: 144 --THWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQ---CVNNFSDSVGFANFVDFNPS- 197

Query: 519 LGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDP 698
            G C+A   SD  + V+  R +      +  Q H  GV  +S+ PS              
Sbjct: 198 -GTCIASAGSDQTVKVWDVRVN---KLLQHYQVHSGGVNCISFHPS-------------- 239

Query: 699 VQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASED 878
              L +A  D T+K+  L  G         LQ HT  V  V+++    L     AS   D
Sbjct: 240 GNYLITASSDGTLKILDLLEG----RLIYTLQGHTGPVFTVSFSKGGEL----FASGGAD 291

Query: 879 GKVVIW 896
            +V++W
Sbjct: 292 TQVLLW 297



>pir|T16607|T16607 hypothetical protein K10B2.1 - Caenorhabditis
           elegans
          Length = 701

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 55/237 (23%), Positives = 105/237 (44%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           +I +GH+ +V  + + Y  + + + SSDA++++  V    T + + TL  H   V  + +
Sbjct: 292 RILSGHTGSV--LCLQYDNRVIISGSSDATVRVWDVE---TGECIKTLIHHCEAVLHLRF 346

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           A+     ++ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 347 AN----GIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDR----YIVSAS 398

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V++  +    +  R    H  G+  + +      G LV SG             
Sbjct: 399 GDRTIKVWSMDT---LEFVRTLAGHRRGIACLQYR-----GRLVVSG-----------SS 439

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +++GV    C   L+ H   VR + +       +  I S + DGK+ +W
Sbjct: 440 DNTIRLWDIHSGV----CLRVLEGHEELVRCIRF------DEKRIVSGAYDGKIKVW 486



>sp|Q09990|LI23_CAEEL F-box/WD-repeat protein
           lin-23.>gb:AF275253_1257840 Caenorhabditis elegans
           LIN-23 (lin-23) mRNA, complete cds.>gb:U28730_1402485
           Caenorhabditis elegans cosmid K10B2, complete sequence.
          Length = 665

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 55/237 (23%), Positives = 105/237 (44%)
 Frame = +3

Query: 186 KIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW 365
           +I +GH+ +V  + + Y  + + + SSDA++++  V    T + + TL  H   V  + +
Sbjct: 256 RILSGHTGSV--LCLQYDNRVIISGSSDATVRVWDVE---TGECIKTLIHHCEAVLHLRF 310

Query: 366 AHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGS 545
           A+     ++ +CS D  + VW   +  + T   V   H+++VN + +        +   S
Sbjct: 311 AN----GIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDR----YIVSAS 362

Query: 546 SDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGC 725
            D  I V++  +    +  R    H  G+  + +      G LV SG             
Sbjct: 363 GDRTIKVWSMDT---LEFVRTLAGHRRGIACLQYR-----GRLVVSG-----------SS 403

Query: 726 DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIW 896
           DNT+++W +++GV    C   L+ H   VR + +       +  I S + DGK+ +W
Sbjct: 404 DNTIRLWDIHSGV----CLRVLEGHEELVRCIRF------DEKRIVSGAYDGKIKVW 450



>gb:AY422998_2532084 Danio rerio TUWD12 (TUWD12) mRNA, complete cds.
          Length = 490

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 53/215 (24%), Positives = 94/215 (43%)
 Frame = +3

Query: 390  LASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVY 569
            LA+ S D  +++W   N     +A  F  H   +  +++AP   G  +A  S D  + ++
Sbjct: 33   LATGSCDKSLMIW---NLAPKARAFRFVGHTDVITGVNFAPS--GSLVASSSRDQTVRLW 87

Query: 570  TARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWK 749
            T    G    + + +AH   V +V+++                 Q+L +A  D +VKVW 
Sbjct: 88   TPSIKG---ESTVFKAHTASVRSVNFSRDG--------------QRLVTASDDKSVKVW- 129

Query: 750  LYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEG 929
               GV +     +L  HTNWVR   ++P+  L    IAS  +D  V +W  +        
Sbjct: 130  ---GVERKKFLYSLNRHTNWVRCARFSPDGRL----IASCGDDRTVRLWDTSSHQCI--- 179

Query: 930  KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +  D+      V ++ +G  +A +  DN + +W+
Sbjct: 180  NIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWD 214



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 75/313 (23%), Positives = 123/313 (39%), Gaps = 30/313 (9%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH D +     +   K++AT S D S+ I  ++  + +       GH   +  V++A   
Sbjct: 16   GHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFV---GHTDVITGVNFAPS- 71

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
             GSL+AS S D  V +W    + E T   VF  H +SV S++++    G  L   S D +
Sbjct: 72   -GSLVASSSRDQTVRLWTPSIKGEST---VFKAHTASVRSVNFSRD--GQRLVTASDDKS 125

Query: 558  ISV---------YTARSDGGWDTARIDQAHPIGVTAVS---------WAPSMAP------ 665
            + V         Y+      W   R  +  P G    S         W  S         
Sbjct: 126  VKVWGVERKKFLYSLNRHTNW--VRCARFSPDGRLIASCGDDRTVRLWDTSSHQCINIFT 183

Query: 666  ---GALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPN 836
               G+      +     +AS+G DNT+K+W +             ++H   V   ++ P+
Sbjct: 184  DYGGSATFVDFNSSGTCIASSGADNTIKIWDIRTN----KLIQHYKVHNAGVNCFSFHPS 239

Query: 837  LGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFN---TPVWRVSWSLTGNLLAVAS 1007
                 + + S S D  + I       D  EG+++Y  +    PV  V++S  G+L A   
Sbjct: 240  ----GNYLISGSSDSTIKIL------DLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGG 289

Query: 1008 GDNNVTLWNEAVD 1046
             D+ V +W    D
Sbjct: 290  ADSQVLMWKTNFD 302



 Score = 37.0 bits (84), Expect = 0.74
 Identities = 22/90 (24%), Positives = 42/90 (46%)
 Frame = +3

Query: 783  PALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVW 962
            P L+ H    +DV    +       +A+ S D  ++IW +A +   +           + 
Sbjct: 8    PTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFR---FVGHTDVIT 64

Query: 963  RVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
             V+++ +G+L+A +S D  V LW  ++ GE
Sbjct: 65   GVNFAPSGSLVASSSRDQTVRLWTPSIKGE 94



>gb:AC117072_1207632 Dictyostelium discoideum chromosome 2 map
            3879572-4071762 strain AX4, complete sequence.
          Length = 355

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 63/284 (22%), Positives = 112/284 (39%), Gaps = 5/284 (1%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPK 377
            GH   ++    + YG  +A+  SD  I +  V     +   + L GH G + ++ W+   
Sbjct: 60   GHKGEIYSCKFNSYGTALASGGSDKEIFLWNVYGECINY--SVLKGHKGTILELHWSTDS 117

Query: 378  FGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGN 557
               +  +C+ D  + VW + N+ E  +     +H   VNS   A     L +A GS D +
Sbjct: 118  -NEIYTACT-DKSIGVW-DSNKGELIKR--IREHSGVVNSCCPARRGPPL-VASGSDDRS 171

Query: 558  ISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTV 737
              ++  RS G     +    H   VT+V ++              D   +L + G DN +
Sbjct: 172  ARIFDTRSKGSTHLFQ----HKYPVTSVCFS--------------DASDQLITGGIDNVI 213

Query: 738  KVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            +VW + N   + D    L  H    +D   + ++    + + S S D    IW +     
Sbjct: 214  RVWDIRN---QEDPLYTLAGH----QDTITSTSVSKDGAYLLSNSMDNSCKIWDIRPYAP 266

Query: 918  QWEGKVLYD-----FNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
                   ++     F   + + SWS+ G  +   S D  V +W+
Sbjct: 267  PNRNIKTFNGAQNNFEKNLIKSSWSIDGRRIGCGSSDRQVYIWD 310



>gb:BC085436_2564385 Danio rerio zgc:101778, mRNA (cDNA clone
            MGC:101778 IMAGE:7230517), complete cds.
          Length = 897

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 68/295 (23%), Positives = 117/295 (39%), Gaps = 10/295 (3%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQH-LATLAGHHGPVWQVSWAHP 374
            GH+DT+  + +   G   AT + D S+++  +  +S   H +A   GH   V  ++ +  
Sbjct: 384  GHTDTILSIDVFRKGSMFATCAKDKSVRVWRMDVSSGRVHCVAQGTGHSNAVGSIACSRM 443

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAH---------VFNDHKSSVNSISWAPHELGL 527
            K    + S S D  V VW   +  E T A              H+  VNS+  +P++   
Sbjct: 444  K-QQFVVSGSQDCTVKVW---DLPETTGAEGVMMMKARSTERAHEKDVNSVCVSPND--K 497

Query: 528  CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK 707
             LA GS D    ++ A SD       + + H  GV +V ++P                Q 
Sbjct: 498  LLASGSQDRTAKLW-ALSD--LRLLGVCRGHRRGVWSVQFSP--------------VDQI 540

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
            L SA  D +V++W + +      C    + H   V  + +        + + S+  DG V
Sbjct: 541  LGSASADGSVRIWSIQD----FSCLKTFEGHDASVLKIIFVSR----GTQLVSSGSDGLV 592

Query: 888  VIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
             +WT+         + L      VW +       L+   S D+ +T+W +  + E
Sbjct: 593  KLWTIKTNECV---RTLDAHQDKVWALHGGCRDELMVTGSADSTITVWKDVTEVE 644



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 29/109 (26%), Positives = 51/109 (46%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKV 887
            LA+ GCD T+K+W     V K  C   L+  +  V  V + P++   +  + S+S D  +
Sbjct: 121  LATGGCDGTIKLW----DVIKQYCTHNLKGSSGVVHLVEFHPDIS--RLQLFSSSSDCAI 174

Query: 888  VIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             IW +          VL    +PV  +++S  G+ L  +  D   ++W+
Sbjct: 175  RIWDLRSSRCVC---VLESHYSPVTALAFSPDGHTLVSSGRDKICSVWD 220



>gb:AF197225_1776129 Emericella nidulans TUPA (tupA) gene, complete
            cds.
          Length = 619

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 69/276 (25%), Positives = 115/276 (41%), Gaps = 9/276 (3%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            GK +AT + D  I++  ++   T +H+   +GH   ++ + +A    G  +AS S D  V
Sbjct: 363  GKYLATGAEDKQIRVWDIATR-TIKHI--FSGHEQDIYSLDFAGN--GRYIASGSGDKTV 417

Query: 420  IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
             +W            +    +  V +++ +P   GL +A GS D  + V+   +  G+  
Sbjct: 418  RLWDIAEGKLVYTLSI----EDGVTTVAMSPD--GLYVAAGSLDKTVRVWDTTT--GYLV 469

Query: 600  ARIDQ--AHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL------Y 755
             R++    H   V +V++AP+               ++L S   D T+K+W+L      Y
Sbjct: 470  ERLENPDGHKDSVYSVAFAPNG--------------KELVSGSLDKTIKLWELNLPRQQY 515

Query: 756  NGVWKMD-CFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGK 932
            N   K   C    + H ++V  V   P+       + S S+D  V  W       Q    
Sbjct: 516  NSAGKGGKCHRTFEGHKDFVLSVCLTPD----GHWVMSGSKDRGVQFWDPITGNAQM--- 568

Query: 933  VLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            +L      V  V+ S TGNL A  SGD    +W  A
Sbjct: 569  MLQGHKNSVISVAPSPTGNLFATGSGDMRARIWRYA 604



>gb:AC079736_1732768 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBa0003G23 map MAP_LOC, complete
            sequence.>gb:AC087412_1734030 Oryza sativa chromosome 3
            BAC OSJNBb0070O09 genomic sequence, complete sequence.
          Length = 316

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 72/272 (26%), Positives = 111/272 (40%), Gaps = 9/272 (3%)
 Frame = +3

Query: 243  KRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVI 422
            KR   A+ +  I++  +++NS +  + +   H   V  V +     G+ + S S DG V 
Sbjct: 47   KRFLAAAGNPHIRLFDINSNS-NHPVISYDSHTSNVMAVGFHCD--GNWMYSGSEDGTVR 103

Query: 423  VWKEGN---QNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGW 593
            +W       Q E+       + +++VN++   P++  L    G  +GNI V        W
Sbjct: 104  IWDLRTATCQREY-------ESRAAVNTVVLHPNQKELI--SGDQNGNIRV--------W 146

Query: 594  DTARID---QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGV 764
            D A      +  P   TAV     M  G++V            +A    T  VW+L  G 
Sbjct: 147  DLAANSCSCELVPEVDTAVRSLTVMWDGSMV-----------VAANNRGTCYVWRLLKGT 195

Query: 765  WKMDCFPAL---QMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKV 935
              + CF  L   Q H  ++     +P    P   +A+AS D  V IW V  +G + E K 
Sbjct: 196  QTITCFEPLHKLQAHDGYILKCLLSPEFCDPNRYLATASSDHTVKIWNV--DGFKLE-KT 252

Query: 936  LYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
            L      VW   +S+ G  L  AS D    LW
Sbjct: 253  LVGHQRWVWDCVFSVDGAYLITASSDTTARLW 284



>pir|T48933|T48933 WD repeat domain protein - Arabidopsis
            thaliana>gb:ATF14L2_1548584 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F14L2.
          Length = 1051

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 52/196 (26%), Positives = 79/196 (40%), Gaps = 17/196 (8%)
 Frame = +3

Query: 474  DHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGG--------------WDTARID 611
            DH  SVN + WA +     +A GS D  I ++  +   G              W      
Sbjct: 57   DHFGSVNCVRWAKNSR--YVASGSDDQVIQIHERKPGSGTTEFGSGEAPDVENWKAVMTL 114

Query: 612  QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPAL 791
            + H   V  ++W+P  +               LAS   DNTV +W +  G+    C   L
Sbjct: 115  RGHTADVVDLNWSPDDS--------------MLASGSLDNTVHIWNMRTGM----CTTVL 156

Query: 792  QMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG--DQWEGKVLYDFNTPVW- 962
            + H + V+ V W P +G   S IAS S+D  V+IW  +  G   + +G       +  + 
Sbjct: 157  RGHLSLVKGVTWDP-IG---SFIASQSDDKTVIIWRTSDWGMAHRTDGHWAKSLGSTFFR 212

Query: 963  RVSWSLTGNLLAVASG 1010
            R+ WS  G+ L    G
Sbjct: 213  RLGWSPCGHFLTTTHG 228



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 53/224 (23%), Positives = 87/224 (38%), Gaps = 17/224 (7%)
 Frame = +3

Query: 213 VHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHL-ATLAGHHGPVWQVSWAHPKFGSL 389
           +  + +   G+R AT   D       + N  T + L ATL  H G V  V WA  K    
Sbjct: 16  IFSIDVQPNGERFATGGGDHKSVDKDLQNIDTKERLLATLRDHFGSVNCVRWA--KNSRY 73

Query: 390 LASCSFDGKVIVWKE--------------GNQNEWTQAHVFNDHKSSVNSISWAPHELGL 527
           +AS S D  + + +                +   W        H + V  ++W+P +   
Sbjct: 74  VASGSDDQVIQIHERKPGSGTTEFGSGEAPDVENWKAVMTLRGHTADVVDLNWSPDD--S 131

Query: 528 CLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQK 707
            LA GS D  + ++  R+  G  T  + + H   V  V+W P       +GS        
Sbjct: 132 MLASGSLDNTVHIWNMRT--GMCTT-VLRGHLSLVKGVTWDP-------IGS-------F 174

Query: 708 LASAGCDNTVKVWKL--YNGVWKMDCFPALQMHTNWVRDVAWAP 833
           +AS   D TV +W+   +    + D   A  + + + R + W+P
Sbjct: 175 IASQSDDKTVIIWRTSDWGMAHRTDGHWAKSLGSTFFRRLGWSP 218



 Score = 35.0 bits (79), Expect = 2.8
 Identities = 29/96 (30%), Positives = 41/96 (42%), Gaps = 7/96 (7%)
 Frame = +3

Query: 789  LQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRV 968
            L+ HT  V D+ W+P+     S +AS S D  V IW +          VL    + V  V
Sbjct: 114  LRGHTADVVDLNWSPD----DSMLASGSLDNTVHIWNMRTGMCT---TVLRGHLSLVKGV 166

Query: 969  SWSLTGNLLAVASGDNNVTLWNEA-------VDGEW 1055
            +W   G+ +A  S D  V +W  +        DG W
Sbjct: 167  TWDPIGSFIASQSDDKTVIIWRTSDWGMAHRTDGHW 202



>gb:BC067546_2554724 Danio rerio retinoblastoma binding protein 4,
           like, mRNA (cDNA clone MGC:85617 IMAGE:6524543),
           complete cds.
          Length = 448

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 61/248 (24%), Positives = 107/248 (43%), Gaps = 19/248 (7%)
 Frame = +3

Query: 135 DHTF----IRSSDKEGKM-PAQKIETGHSDTVHDVSMDYYGKRV-ATASSDASIKIIGVS 296
           DHT     I  + KEGK+  A+ I TGH+  V DVS     + +  + + D  + I    
Sbjct: 199 DHTICLWDISGAPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTR 258

Query: 297 NNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFND 476
           +N+TS+   ++  H   V  +S+ +P    +LA+ S D  V +W   N     + H F  
Sbjct: 259 SNNTSKPSHSVDAHTAEVNCLSF-NPYSEFILATGSADKTVALWDLRNLK--LKLHSFES 315

Query: 477 HKSSVNSISWAPHELGLCLACGSSDGNISVYTA-----------RSDGGWDTARIDQAHP 623
           HK  +  + W+PH   + LA   +D  ++V+               DG  +   I   H 
Sbjct: 316 HKDEIFQVQWSPHNETI-LASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHT 374

Query: 624 IGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMD--CFPALQM 797
             ++  SW P            ++P   + S   DN ++VW++   ++  +    PA ++
Sbjct: 375 AKISDFSWNP------------NEP-WVICSVSEDNIMQVWQMAENIYNDEEPDTPASEL 421

Query: 798 HTNWVRDV 821
            T  + D+
Sbjct: 422 GTGVITDL 429



>gb:BC045356_2549198 Danio rerio F-box and WD-40 domain protein 1B,
           mRNA (cDNA clone MGC:55481 IMAGE:2640421), complete cds.
          Length = 527

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 55/250 (22%), Positives = 104/250 (41%)
 Frame = +3

Query: 147 IRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT 326
           I+  DK+  +   K+ TGH+ +V  + + Y  + + T SSD+++++  VS+      L T
Sbjct: 247 IKIWDKQS-LECLKVLTGHTGSV--LCLQYDERVIVTGSSDSTVRVWDVSSGEV---LNT 300

Query: 327 LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
           L  H+  V  + + +     L+ +CS D  + VW   +  + +   V   H+++VN + +
Sbjct: 301 LIHHNEAVLHLRFCN----GLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDF 356

Query: 507 APHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSG 686
                   +   S D  I V+   S    +  R    H  G+  + +   +         
Sbjct: 357 DDK----YIVSASGDRTIKVW---STSTCEFVRTLNGHKRGIACLQYRDRL--------- 400

Query: 687 LHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS 866
                  + S   DNT+++W +  G     C   L+ H   VR + +          I S
Sbjct: 401 -------VVSGSSDNTIRLWDIECGA----CLRVLEGHEELVRCIRF------DNKRIVS 443

Query: 867 ASEDGKVVIW 896
            + DGK+ +W
Sbjct: 444 GAYDGKIKVW 453



>gb:AB086191_2047797 Mus musculus mRNA for putative WDC146, complete
            cds.
          Length = 1330

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 80/338 (23%), Positives = 121/338 (35%), Gaps = 35/338 (10%)
 Frame = +3

Query: 144  FIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA 323
            F+R+S  + K P           V  V     G+R+ T +S     +    N  T     
Sbjct: 110  FVRTSTNKVKCP-----------VFVVRWTPEGRRLVTGASSGEFTLW---NGLTFNFET 155

Query: 324  TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
             L  H  PV  ++W+H     L A     G V  W+    N      +F  HK ++   S
Sbjct: 156  ILQAHDSPVRAMTWSHNDMWMLTAD--HGGYVKYWQSNMNN----VKMFQAHKEAIREAS 209

Query: 504  WAPHELGLCLACGSSDGNISVYTARSDGGWD-----TARIDQAHPIGVTAVSWAPSMAPG 668
            ++P +     A  S DG + +        WD       RI + H   V  V W P+    
Sbjct: 210  FSPTDNKF--ATCSDDGTVRI--------WDFLRCHEERILRGHGADVKCVDWHPTKG-- 257

Query: 669  ALVGSGLHD---PV--------QKLASAGCD-NTVKVWKL-YNGVWKMDC---------- 779
             LV SG  D   P+        Q LA+     NTV   KL  NG W +            
Sbjct: 258  -LVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFD 316

Query: 780  -------FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVL 938
                       + H      VAW P   + +   AS   DG ++ W V  E +    ++ 
Sbjct: 317  IRNLKEELQVFRGHKKEATAVAWHP---VHEGLFASGGSDGSLLFWHVGVEKEVGGMEMA 373

Query: 939  YDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            ++    +W ++W   G++L   S D+    W     G+
Sbjct: 374  HE--GMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGD 409



>gb:AK050653_1169412 Mus musculus 2 days neonate thymus thymic cells
            cDNA, RIKEN full-length enriched library,
            clone:C920029N20 product:WDC146 homolog [Homo sapiens],
            full insert sequence.
          Length = 530

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 80/338 (23%), Positives = 121/338 (35%), Gaps = 35/338 (10%)
 Frame = +3

Query: 144  FIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA 323
            F+R+S  + K P           V  V     G+R+ T +S     +    N  T     
Sbjct: 110  FVRTSTNKVKCP-----------VFVVRWTPEGRRLVTGASSGEFTLW---NGLTFNFET 155

Query: 324  TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
             L  H  PV  ++W+H     L A     G V  W+    N      +F  HK ++   S
Sbjct: 156  ILQAHDSPVRAMTWSHNDMWMLTAD--HGGYVKYWQSNMNN----VKMFQAHKEAIREAS 209

Query: 504  WAPHELGLCLACGSSDGNISVYTARSDGGWD-----TARIDQAHPIGVTAVSWAPSMAPG 668
            ++P +     A  S DG + +        WD       RI + H   V  V W P+    
Sbjct: 210  FSPTDNKF--ATCSDDGTVRI--------WDFLRCHEERILRGHGADVKCVDWHPTKG-- 257

Query: 669  ALVGSGLHD---PV--------QKLASAGCD-NTVKVWKL-YNGVWKMDC---------- 779
             LV SG  D   P+        Q LA+     NTV   KL  NG W +            
Sbjct: 258  -LVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFD 316

Query: 780  -------FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVL 938
                       + H      VAW P   + +   AS   DG ++ W V  E +    ++ 
Sbjct: 317  IRNLKEELQVFRGHKKEATAVAWHP---VHEGLFASGGSDGSLLFWHVGVEKEVGGMEMA 373

Query: 939  YDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            ++    +W ++W   G++L   S D+    W     G+
Sbjct: 374  HE--GMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGD 409



>gb:AE014296_1136134 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003538_1214557 Drosophila melanogaster
            chromosome 3L, section 47 of 83 of the complete
            sequence.>gb:AY069349_1294079 Drosophila melanogaster
            LD05671 full length cDNA.
          Length = 391

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 59/235 (25%), Positives = 104/235 (44%), Gaps = 1/235 (0%)
 Frame = +3

Query: 333  GHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAP 512
            GH G + Q+ +     G+ +A+ S D  VI+W   N N+  +   F  H + VN ++W+P
Sbjct: 16   GHSGGITQLRFGPD--GAQIATSSTDSTVILW---NLNQAARCIRFASHSAPVNGVAWSP 70

Query: 513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLH 692
               G  +A    D  + ++  +  G    +    AH   V +V +  +   G L      
Sbjct: 71   K--GNLVASAGHDRTVKIWEPKLRG---VSGEFVAHSKAVRSVDFDST---GHL------ 116

Query: 693  DPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASAS 872
                 + +A  D + K+W+    V +     +     NWVR   ++PN  L    +A+AS
Sbjct: 117  -----MLTASDDKSAKIWR----VARRQFVSSFAQQNNWVRSAKFSPNGKL----VATAS 163

Query: 873  EDGKVVIWTVAKEGDQWEG-KVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            +D  V I+ V    D  E  +   +      +++W   GN+LAVA G N + +++
Sbjct: 164  DDKSVRIYDV----DSGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNRIKIFD 214



 Score = 41.2 bits (95), Expect = 0.039
 Identities = 33/112 (29%), Positives = 48/112 (42%)
 Frame = +3

Query: 705  KLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGK 884
            ++A++  D+TV +W L        C      H+  V  VAW+P   L    +ASA  D  
Sbjct: 32   QIATSSTDSTVILWNLNQAA---RCI-RFASHSAPVNGVAWSPKGNL----VASAGHDRT 83

Query: 885  VVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEA 1040
            V IW     G   E       +  V  V +  TG+L+  AS D +  +W  A
Sbjct: 84   VKIWEPKLRGVSGE---FVAHSKAVRSVDFDSTGHLMLTASDDKSAKIWRVA 132



 Score = 40.4 bits (93), Expect = 0.067
 Identities = 70/321 (21%), Positives = 123/321 (38%), Gaps = 42/321 (13%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGHS  +  +     G ++AT+S+D+++ +    N + +      A H  PV  V+W+ P
Sbjct: 15   TGHSGGITQLRFGPDGAQIATSSTDSTVIL---WNLNQAARCIRFASHSAPVNGVAWS-P 70

Query: 375  KFGSLLASCSFDGKVIVWK---EGNQNEW-------------TQAHVF---NDHKSS--- 488
            K G+L+AS   D  V +W+    G   E+             +  H+    +D KS+   
Sbjct: 71   K-GNLVASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTASDDKSAKIW 129

Query: 489  -----------------VNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQA 617
                             V S  ++P+  G  +A  S D ++ +Y   S     T   ++A
Sbjct: 130  RVARRQFVSSFAQQNNWVRSAKFSPN--GKLVATASDDKSVRIYDVDSGECVRTFTEERA 187

Query: 618  HPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQM 797
             P  +    W   +A                 + GC N +K++ +              +
Sbjct: 188  APRQLAWHPWGNMLA----------------VALGC-NRIKIFDVSGS----QLLQLYVV 226

Query: 798  HTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDF---NTPVWRV 968
            H+  V DVA+ P+       + S S+D  + I       D  EG+ +Y        V  V
Sbjct: 227  HSAPVNDVAFHPS----GHFLLSGSDDRTIRIL------DLLEGRPIYTLTGHTDAVNAV 276

Query: 969  SWSLTGNLLAVASGDNNVTLW 1031
            ++S  G+  A    D  + +W
Sbjct: 277  AFSRDGDKFATGGSDRQLLVW 297



 Score = 37.4 bits (85), Expect = 0.57
 Identities = 25/89 (28%), Positives = 38/89 (42%)
 Frame = +3

Query: 783  PALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVW 962
            PAL+ H             G   + IA++S D  V++W + +             + PV 
Sbjct: 8    PALERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIR---FASHSAPVN 64

Query: 963  RVSWSLTGNLLAVASGDNNVTLWNEAVDG 1049
             V+WS  GNL+A A  D  V +W   + G
Sbjct: 65   GVAWSPKGNLVASAGHDRTVKIWEPKLRG 93



>gb:AE010953_267897 Methanosarcina acetivorans str. C2A, section 298
            of 534 of the complete genome.>gb:AE010299_908456
            Methanosarcina acetivorans str. C2A, complete genome.
          Length = 1051

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 81/339 (23%), Positives = 131/339 (38%), Gaps = 61/339 (17%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATL----------------- 329
            H+D + DV+    G++VATAS+D + ++  V   ST + +A L                 
Sbjct: 567  HTDVMRDVAFSPDGEKVATASADRTSRLWNV---STGKEIAVLKHDYSIKKVFFSPDGKK 623

Query: 330  -----AGHHGPVWQ----------------VSWAHPKFGSLLASCSFDGKVIVWKEGNQN 446
                 A     +W                 V  A    G  +A+ S D    +W     +
Sbjct: 624  VATASADETARLWDAYTGKEIAIMNHGKDVVDIAFSPDGKKVATASADNTSCIW-----D 678

Query: 447  EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTA---------RSDGGWDT 599
             +T+  V N HK SV ++ ++P   G+ +A  S D    V+ A         + D G + 
Sbjct: 679  VYTEIPVLN-HKDSVLNVEFSPD--GVYVATASQDNTARVWDAYTGEEISVLKHDAGINK 735

Query: 600  ARIDQAHPIGVTAVS------WAPSMAPGALV--GSGLHDPV-----QKLASAGCDNTVK 740
            A  ++      TA        W  S      +  G G+ D       + +A+A  DNT +
Sbjct: 736  AVFNRDGKYVATASQDNTARVWNTSTGKDITLKHGGGVLDVAFSPDGKYVATASQDNTAR 795

Query: 741  VWKLYNGVWKMDCFPALQM-HTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGD 917
            VW      W       + + H  WV  + ++P+       +A+AS D    IW+ A  G 
Sbjct: 796  VWN-----WNAPTGENITLKHEGWVNKIVFSPD----GKYVATASADNTARIWS-ASTGK 845

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
            Q +   +   +  V  V +S  G  +A AS DN   +WN
Sbjct: 846  QID---VISHDGSVQDVEFSSDGKYVATASDDNTAKVWN 881



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 78/306 (25%), Positives = 126/306 (41%), Gaps = 22/306 (7%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGV--SNNSTSQHLATLAGHHGPVWQVSWAHP 374
            H+D V DV +   GK +ATAS D + ++  V  + N T +H      H+G V  V+++  
Sbjct: 442  HADKVCDVELSPDGKYIATASQDNTSRLWDVTEAENITLKHTLK---HNGSVLDVTFSPD 498

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLC------LA 536
              G  +A+ S D    +W      + T   V N H +SV+ I ++     +       +A
Sbjct: 499  --GEKVATASQDKTACIWDVSTGKQIT---VLN-HSNSVSKIIFSSDGKKVAMMISGNIA 552

Query: 537  C-GSSDGNISVYTARSDGGWDTARIDQAHPIGVTA---VSWAPSMAPGALVGSGLHD--- 695
            C  +S G        +D   D A       +   +    S   +++ G  +    HD   
Sbjct: 553  CLWNSTGKQIDVMNHTDVMRDVAFSPDGEKVATASADRTSRLWNVSTGKEIAVLKHDYSI 612

Query: 696  -------PVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKS 854
                     +K+A+A  D T ++W  Y G        A+  H   V D+A++P+      
Sbjct: 613  KKVFFSPDGKKVATASADETARLWDAYTGK-----EIAIMNHGKDVVDIAFSPD----GK 663

Query: 855  TIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
             +A+AS D    IW V  E        + +    V  V +S  G  +A AS DN   +W 
Sbjct: 664  KVATASADNTSCIWDVYTE------IPVLNHKDSVLNVEFSPDGVYVATASQDNTARVW- 716

Query: 1035 EAVDGE 1052
            +A  GE
Sbjct: 717  DAYTGE 722



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 65/286 (22%), Positives = 111/286 (38%), Gaps = 1/286 (0%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKF 380
            H D+V +V     G  VATAS D + ++           L   AG +  V+       + 
Sbjct: 688  HKDSVLNVEFSPDGVYVATASQDNTARVWDAYTGEEISVLKHDAGINKAVFN------RD 741

Query: 381  GSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNI 560
            G  +A+ S D    VW     N  T   +   H   V  ++++P   G  +A  S D   
Sbjct: 742  GKYVATASQDNTARVW-----NTSTGKDITLKHGGGVLDVAFSPD--GKYVATASQDNTA 794

Query: 561  SVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVK 740
             V+   +  G     I   H   V  + ++P                + +A+A  DNT +
Sbjct: 795  RVWNWNAPTG---ENITLKHEGWVNKIVFSPDG--------------KYVATASADNTAR 837

Query: 741  VWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV-AKEGD 917
            +W    G  ++D       H   V+DV ++ +       +A+AS+D    +W        
Sbjct: 838  IWSASTGK-QIDVIS----HDGSVQDVEFSSD----GKYVATASDDNTAKVWNWNTSTRK 888

Query: 918  QWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
                K   + +  V  V++S  G  +A AS D N  +WN ++  ++
Sbjct: 889  NITLKHTLNHSNKVHDVAFSPDGKKVATASWDKNARIWNLSISNDF 934



 Score = 41.6 bits (96), Expect = 0.030
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 2/124 (1%)
 Frame = +3

Query: 201  HSDTVHDVSMDYYGKRVATASSDASIKI--IGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            HS+ VHDV+    GK+VATAS D + +I  + +SN+ T+        H   V +V ++  
Sbjct: 898  HSNKVHDVAFSPDGKKVATASWDKNARIWNLSISNDFTN------LSHDDYVSRVEFSSD 951

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G  +A+ S+     +W     ++         H   VN + ++P+  G  +A  S D 
Sbjct: 952  --GKFIATTSYGETAFIWDASTGDKIAAI----SHDGVVNDVVFSPN--GKYIATASDDN 1003

Query: 555  NISV 566
               V
Sbjct: 1004 TAKV 1007



>pir|T26531|T26531 hypothetical protein Y18D10A.9 - Caenorhabditis
           elegans
          Length = 314

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 70/268 (26%), Positives = 109/268 (40%), Gaps = 32/268 (11%)
 Frame = +3

Query: 189 IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA 368
           ++  H+  V  V+    GK + +AS DAS+ +    +   ++ +  L GH   V    ++
Sbjct: 62  LDDSHTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAE-VNKLEGHESEVKCAVFS 120

Query: 369 HPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSS 548
             K    LA+CS D  V  W++    +++ + +   H   V  ++W P E  L ++C S 
Sbjct: 121 --KSDEFLATCSRDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTE-DLLVSC-SY 176

Query: 549 DGNISVYTARSDG-GWDT-ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAG 722
           D +I  Y  R DG  W T  +ID  H +G   V           +GS   D     + A 
Sbjct: 177 DSSIRFY--RFDGEDWVTQQKIDGCH-VGTLFVR--------ENIGSKSADQDTWKSVAR 225

Query: 723 CDNTVKVWKLYNGVWKM----------DC------------FPALQ------MHTNWVRD 818
            D     W LY+  W            DC             P ++       H   V  
Sbjct: 226 YDVENTRWPLYSVAWNSTNDVIATGGGDCKIRLFKISSTPESPVIEHLGVVGRHELDVNH 285

Query: 819 VAWAPNLGLPK--STIASASEDGKVVIW 896
           VAW PN   PK  + + SAS+DG + +W
Sbjct: 286 VAWNPN---PKFSNLLTSASDDGTIRLW 310



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 60/260 (23%), Positives = 97/260 (37%), Gaps = 32/260 (12%)
 Frame = +3

Query: 348  VWQVSWAHPKFGSLLASCSFDGKVIVWK-----EGNQNEWTQAHVFNDHKSSVNSISWAP 512
            VW   W H   G +LASC  D  V VW      +       +  + + H  +V S++++ 
Sbjct: 20   VWMTCWHHG--GRILASCGDDKAVRVWSLVGEPDSKMRLECRTTLDDSHTRAVRSVAFSN 77

Query: 513  HELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLH 692
               G CL   S D ++ VY  + DG +      + H   V    ++ S            
Sbjct: 78   D--GKCLVSASFDASVVVY-QQEDGEFAEVNKLEGHESEVKCAVFSKS------------ 122

Query: 693  DPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKST----- 857
               + LA+   D +V  W+  +          LQ HT  V+ VAW P   L  S      
Sbjct: 123  --DEFLATCSRDKSVWFWQ-QDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSS 179

Query: 858  -----------IASASEDGKVV--------IWTVAKEGDQWEGKVLYDFNT---PVWRVS 971
                       +     DG  V        I + + + D W+    YD      P++ V+
Sbjct: 180  IRFYRFDGEDWVTQQKIDGCHVGTLFVRENIGSKSADQDTWKSVARYDVENTRWPLYSVA 239

Query: 972  WSLTGNLLAVASGDNNVTLW 1031
            W+ T +++A   GD  + L+
Sbjct: 240  WNSTNDVIATGGGDCKIRLF 259



 Score = 41.6 bits (96), Expect = 0.030
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 4/65 (6%)
 Frame = +3

Query: 249 VATASSDASIKIIGVSNNSTS---QHLATLAGHHGPVWQVSW-AHPKFGSLLASCSFDGK 416
           +AT   D  I++  +S+   S   +HL  +  H   V  V+W  +PKF +LL S S DG 
Sbjct: 247 IATGGGDCKIRLFKISSTPESPVIEHLGVVGRHELDVNHVAWNPNPKFSNLLTSASDDGT 306

Query: 417 VIVWK 431
           + +W+
Sbjct: 307 IRLWE 311



 Score = 41.6 bits (96), Expect = 0.030
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 4/120 (3%)
 Frame = +3

Query: 708  LASAGCDNTVKVWKLY---NGVWKMDCFPAL-QMHTNWVRDVAWAPNLGLPKSTIASASE 875
            LAS G D  V+VW L    +   +++C   L   HT  VR VA++ +       + SAS 
Sbjct: 32   LASCGDDKAVRVWSLVGEPDSKMRLECRTTLDDSHTRAVRSVAFSND----GKCLVSASF 87

Query: 876  DGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGEW 1055
            D  VV++   ++G+  E   L    + V    +S +   LA  S D +V  W +  D ++
Sbjct: 88   DASVVVYQ-QEDGEFAEVNKLEGHESEVKCAVFSKSDEFLATCSRDKSVWFWQQDEDEDF 146



>sp|Q9C0J8|W146_HUMAN WD-repeat protein WDC146.>gb:AB044749_1867154
            Homo sapiens mRNA for WDC146, complete cds.
          Length = 1336

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 80/338 (23%), Positives = 121/338 (35%), Gaps = 35/338 (10%)
 Frame = +3

Query: 144  FIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLA 323
            F+R+S  + K P           V  V     G+R+ T +S     +    N  T     
Sbjct: 110  FVRTSTNKVKCP-----------VFVVRWTPEGRRLVTGASSGEFTLW---NGLTFNFET 155

Query: 324  TLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSIS 503
             L  H  PV  ++W+H     L A     G V  W+    N      +F  HK ++   S
Sbjct: 156  ILQAHDSPVRAMTWSHNDMWMLTAD--HGGYVKYWQSNMNN----VKMFQAHKEAIREAS 209

Query: 504  WAPHELGLCLACGSSDGNISVYTARSDGGWD-----TARIDQAHPIGVTAVSWAPSMAPG 668
            ++P +     A  S DG + +        WD       RI + H   V  V W P+    
Sbjct: 210  FSPTDNKF--ATCSDDGTVRI--------WDFLRCHEERILRGHGADVKCVDWHPTKG-- 257

Query: 669  ALVGSGLHD---PV--------QKLASAGCD-NTVKVWKL-YNGVWKMDC---------- 779
             LV SG  D   P+        Q LA+     NTV   KL  NG W +            
Sbjct: 258  -LVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFD 316

Query: 780  -------FPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVL 938
                       + H      VAW P   + +   AS   DG ++ W V  E +    ++ 
Sbjct: 317  IRNLKEELQVFRGHKKEATAVAWHP---VHEGLFASGGSDGSLLFWHVGVEKEVGGMEMA 373

Query: 939  YDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVDGE 1052
            ++    +W ++W   G++L   S D+    W     G+
Sbjct: 374  HE--GMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGD 409



>gb:BC045034_2548989 Xenopus laevis U5 snRNP-specific 40 kDa protein
            (hPrp8-binding), mRNA (cDNA clone MGC:53216
            IMAGE:5543312), complete cds.
          Length = 337

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 72/287 (25%), Positives = 112/287 (39%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +++A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 43   SGHEGEVYCCKFHPNGVTLSSAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 100

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GSLL S S D  V +W   +     +      H S VNS    P   G  L C GS D
Sbjct: 101  --GSLLFSASTDKTVAIW---DCQTGERVKRLKGHTSYVNSCY--PARRGPQLICTGSDD 153

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V +V++              +D   ++ S G DN
Sbjct: 154  GTVKLWDFRKKAAVQTFQ----NTYQVLSVTF--------------NDTSDQIISGGIDN 195

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            L        D     +L    S + S + D  V +W V   
Sbjct: 196  DIKVWDLRQN--------KLMYTMRGHGDSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPF 247

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 248  APKERCVKIFQGNV-HNFEKNLLRCSWSADGSKIAAGSADRFVYVWD 293



>gb:BT008213_2151145 Synthetic construct Homo sapiens CDC20 cell
            division cycle 20 homolog (S. cerevisiae) mRNA, partial
            cds.
          Length = 500

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 65/271 (23%), Positives = 110/271 (40%), Gaps = 7/271 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A  +S A +++  V      + L  +  H   V  +SW       +L+S S  G +
Sbjct: 238  GNYLAVGTSSAEVQLWDVQQQ---KRLRNMTSHSARVGSLSWN----SYILSSGSRSGHI 290

Query: 420  IVWKEGNQNEWTQAHV--FNDHKSSVNSISWAPHELGLCLACGSSDGNISVY-TARSDGG 590
                  +     + HV   + H   V  + WAP   G  LA G +D  ++V+ +A  +GG
Sbjct: 291  ----HHHDVRVAEHHVATLSGHSQEVCGLRWAPD--GRHLASGGNDNLVNVWPSAPGEGG 344

Query: 591  WDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWK 770
            W   +    H   V AV+W P  +     G G             D  +++W + +G   
Sbjct: 345  WVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGT-----------SDRHIRIWNVCSGA-- 391

Query: 771  MDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS-ASEDGKVVIW---TVAKEGDQWEGKVL 938
              C  A+  H+  V  + W+P+    K  I+       ++VIW   T+AK  +      L
Sbjct: 392  --CLSAVDAHSQ-VCSILWSPHY---KELISGHGFAQNQLVIWKYPTMAKVAE------L 439

Query: 939  YDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                + V  ++ S  G  +A A+ D  + LW
Sbjct: 440  KGHTSRVLSLTMSPDGATVASAAADETLRLW 470



>gb:BC000624_1966890 Homo sapiens CDC20 cell division cycle 20 homolog
            (S. cerevisiae), mRNA (cDNA clone MGC:3076
            IMAGE:3346682), complete cds.
          Length = 499

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 65/271 (23%), Positives = 110/271 (40%), Gaps = 7/271 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A  +S A +++  V      + L  +  H   V  +SW       +L+S S  G +
Sbjct: 238  GNYLAVGTSSAEVQLWDVQQQ---KRLRNMTSHSARVGSLSWN----SYILSSGSRSGHI 290

Query: 420  IVWKEGNQNEWTQAHV--FNDHKSSVNSISWAPHELGLCLACGSSDGNISVY-TARSDGG 590
                  +     + HV   + H   V  + WAP   G  LA G +D  ++V+ +A  +GG
Sbjct: 291  ----HHHDVRVAEHHVATLSGHSQEVCGLRWAPD--GRHLASGGNDNLVNVWPSAPGEGG 344

Query: 591  WDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWK 770
            W   +    H   V AV+W P  +     G G             D  +++W + +G   
Sbjct: 345  WVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGT-----------SDRHIRIWNVCSGA-- 391

Query: 771  MDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS-ASEDGKVVIW---TVAKEGDQWEGKVL 938
              C  A+  H+  V  + W+P+    K  I+       ++VIW   T+AK  +      L
Sbjct: 392  --CLSAVDAHSQ-VCSILWSPHY---KELISGHGFAQNQLVIWKYPTMAKVAE------L 439

Query: 939  YDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                + V  ++ S  G  +A A+ D  + LW
Sbjct: 440  KGHTSRVLSLTMSPDGATVASAAADETLRLW 470



>gb:CR382137_1670331 Debaryomyces hansenii chromosome E of strain
            CBS767 of Debaryomyces hansenii.
          Length = 795

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 66/291 (22%), Positives = 121/291 (41%), Gaps = 8/291 (2%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSW---A 368
            GH+D ++ + +   G  +ATAS D   ++   ++NS  ++ A   GH G V  +S     
Sbjct: 373  GHTDLLNAIDVSLDGLWIATASKDNEARLWRWNDNSFEEY-AVFHGHAGAVTAISLPKST 431

Query: 369  HPKFGSLLASCSFDGKVIVWKEGN-----QNEWTQAHVFNDHKSSVNSISWAPHELGLCL 533
            + +F   + + S D  V  WK        Q   T  +    H+  +NSI  +P++     
Sbjct: 432  NQEFPPFIITGSSDLTVKKWKVPKPTGSVQVVKTSEYTRRAHEKDINSIDISPNDE--FF 489

Query: 534  ACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLA 713
            A  S D    V+   S    +T  + + H  G+  +++              +D +  +A
Sbjct: 490  ATASYDKLGKVWNLESG---ETIGVLKGHKRGLWDINFCK------------YDKL--IA 532

Query: 714  SAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVI 893
            ++  D TVK+W L +      C    + HTN V+ V +          I S+  DG V +
Sbjct: 533  TSSGDKTVKLWSLND----FTCTKTFEGHTNAVQRVRFFNK----NQQIISSGADGLVKL 584

Query: 894  WTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNEAVD 1046
            W V     +   K + + +  +W +     G  +  A  D  +++W++  D
Sbjct: 585  WDVKDLAGECL-KTIDNHDNRIWALDVKNDGLEIVTADADGQLSIWSDNTD 634



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 64/306 (20%), Positives = 119/306 (38%), Gaps = 17/306 (5%)
 Frame = +3

Query: 168  GKMPAQK---IETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATL--- 329
            GK+ AQ    ++T     + DV ++    R+    SD ++  + ++       +  +   
Sbjct: 267  GKLVAQTMTPLQTNEELMIIDV-LELENNRLMLVISDQTLAFVDMNEYDDESEIVEIRII 325

Query: 330  ---AGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSI 500
               AG+HG +  + +  P+F  L  + +     I+    N +   + ++   H   +N+I
Sbjct: 326  NRIAGNHGTIADIRYVGPEFQFLALATNSPSLRIL----NPDRPFELNICEGHTDLLNAI 381

Query: 501  SWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPS----MAPG 668
              +    GL +A  S D    ++   +D  ++   +   H   VTA+S   S      P 
Sbjct: 382  DVSLD--GLWIATASKDNEARLWRW-NDNSFEEYAVFHGHAGAVTAISLPKSTNQEFPPF 438

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQM----HTNWVRDVAWAPN 836
             + GS              D TVK WK+      +      +     H   +  +  +PN
Sbjct: 439  IITGSS-------------DLTVKKWKVPKPTGSVQVVKTSEYTRRAHEKDINSIDISPN 485

Query: 837  LGLPKSTIASASEDGKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDN 1016
                    A+AS D    +W +  E  +  G VL      +W +++     L+A +SGD 
Sbjct: 486  ----DEFFATASYDKLGKVWNL--ESGETIG-VLKGHKRGLWDINFCKYDKLIATSSGDK 538

Query: 1017 NVTLWN 1034
             V LW+
Sbjct: 539  TVKLWS 544



>gb:BT002525_1636128 Arabidopsis thaliana Unknown protein mRNA,
           complete cds.
          Length = 610

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 45/171 (26%), Positives = 79/171 (46%)
 Frame = +3

Query: 240 GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
           G  VA  ++D S++I   S+N   + + +L+   G +  ++++  K GS LA+ +  GK+
Sbjct: 457 GSFVAIGANDNSVRIYNASSNGKLEEVKSLSNPTGTISALAFS--KGGSHLAAGNSVGKI 514

Query: 420 IVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDT 599
            V+  G+      A  ++ H + V +I+W   + G   A GS D N+ ++          
Sbjct: 515 YVYSAGSWE--LVADRWSAHTARVTAIAW--DDTGAYAASGSLDTNVFIWCLEKRNQGKR 570

Query: 600 ARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKL 752
            +   AH  GV  V+W                   ++ASAG D  VK+WK+
Sbjct: 571 IKAANAHKDGVNGVAWVEG---------------GRVASAGGDANVKIWKV 606



 Score = 42.0 bits (97), Expect = 0.023
 Identities = 81/356 (22%), Positives = 127/356 (35%), Gaps = 71/356 (19%)
 Frame = +3

Query: 177  PAQKIETG-HSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVW 353
            P ++I  G HS ++  VS    GK+  TAS+D S+K+  V   S  Q      G    V 
Sbjct: 225  PTKEIGQGEHSGSIFAVSWSPDGKKFVTASADQSVKLWDVDAGSVIQ--TWKFGEDVSVG 282

Query: 354  Q----VSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHEL 521
                 V +   +   L+ S S  G +    EG         V   H  S+ ++S      
Sbjct: 283  DQQVGVVFVPGRSDGLIISLSLAGNLAYLTEGKPE---PVRVVYGHGKSITALSTGSDGK 339

Query: 522  GLCLACGSSDGNISVYT---------------------ARSDG-----GW-DTARID--- 611
            G  L  GS DG +  +                      A +DG     GW DT RI    
Sbjct: 340  GADLWSGSFDGRVCHWDVTSGIATVVDGQAHTNQVAQFATADGKVLSAGWDDTLRIVDEP 399

Query: 612  -----------QAHPIGVTAVSWAPSMA----------------------PGALVGSGLH 692
                       QA P GV+A +    +A                      P A+  SG  
Sbjct: 400  AKTFLGTSIKLQAQPKGVSAANGLVYVATYSGVSVYSGEKLVSEQSFDFTPDAIAASG-- 457

Query: 693  DPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASAS 872
                 +A    DN+V+++   +   K++   +L   T  +  +A++       S +A+ +
Sbjct: 458  ---SFVAIGANDNSVRIYNASSN-GKLEEVKSLSNPTGTISALAFSKG----GSHLAAGN 509

Query: 873  EDGKVVIWTVAK---EGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              GK+ +++        D+W           V  ++W  TG   A  S D NV +W
Sbjct: 510  SVGKIYVYSAGSWELVADRWSA-----HTARVTAIAWDDTGAYAASGSLDTNVFIW 560



 Score = 41.6 bits (96), Expect = 0.030
 Identities = 32/141 (22%), Positives = 57/141 (40%)
 Frame = +3

Query: 147 IRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLAT 326
           I ++   GK+   K  +  + T+  ++    G  +A  +S   I +   S  S       
Sbjct: 471 IYNASSNGKLEEVKSLSNPTGTISALAFSKGGSHLAAGNSVGKIYVY--SAGSWELVADR 528

Query: 327 LAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISW 506
            + H   V  ++W     G+  AS S D  V +W    +N+  +    N HK  VN ++W
Sbjct: 529 WSAHTARVTAIAWDDT--GAYAASGSLDTNVFIWCLEKRNQGKRIKAANAHKDGVNGVAW 586

Query: 507 APHELGLCLACGSSDGNISVY 569
                G  +A    D N+ ++
Sbjct: 587 VE---GGRVASAGGDANVKIW 604



 Score = 40.8 bits (94), Expect = 0.051
 Identities = 44/171 (25%), Positives = 73/171 (42%), Gaps = 1/171 (0%)
 Frame = +3

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIG-VTAVSWAPSMAPGALVGSGLHDP 698
            G  +A G++D ++ +Y A S+G  +  +   ++P G ++A++++     G+ + +G    
Sbjct: 457  GSFVAIGANDNSVRIYNASSNGKLEEVK-SLSNPTGTISALAFSKG---GSHLAAGNSVG 512

Query: 699  VQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASED 878
               + SAG       W+L    W          HT  V  +AW        +  AS S D
Sbjct: 513  KIYVYSAGS------WELVADRWSA--------HTARVTAIAWDDT----GAYAASGSLD 554

Query: 879  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
              V IW + K       K        V  V+W + G  +A A GD NV +W
Sbjct: 555  TNVFIWCLEKRNQGKRIKAANAHKDGVNGVAW-VEGGRVASAGGDANVKIW 604



>gb:PFMAL8P1_1192110 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 326

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 68/298 (22%), Positives = 119/298 (39%), Gaps = 7/298 (2%)
 Frame = +3

Query: 162  KEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHH 341
            K G      +   H   V+ ++    GK +A++S D +I +  V N   +  +  L GH 
Sbjct: 25   KTGLFSPTMLINSHKGEVYSINFSSDGKYIASSSFDMTIMVHNVYNECET--IGVLRGHK 82

Query: 342  GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHEL 521
              V Q  W      + + S S D K+ +W    +++      F  H + VN +    H L
Sbjct: 83   NAVLQAKWLQDD--NYICSASADHKLFLWDVECESKLRS---FKGHDNIVNGLDIINHNL 137

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV 701
               ++C S D  +  +  RS   W    I    P+                  S   D  
Sbjct: 138  --FVSC-SDDNTLKFWDIRSK--WAVHIIKHDFPLL-----------------SVCSDKK 175

Query: 702  QKLASAGC-DNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASED 878
             +     C DNT+K +   N   K D F     H +++  +    ++   ++ +AS S D
Sbjct: 176  GEFLFTSCVDNTIKKYDCKNYKLK-DTFIG---HKDYITGL----DINKDETMLASISAD 227

Query: 879  GKVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSL------TGNLLAVASGDNNVTLWN 1034
              +  W +  +    E K+L+  N+P + + ++L        NLLA  SGDN + +++
Sbjct: 228  ESICFWDI--QPFSCEEKLLFQLNSPKYNIDYNLIKLSFNNDNLLACGSGDNYLYIYD 283



>pir|A56021|A56021 probable cell division control protein p55CDC -
            human>gb:HSU05340_2021608 Human p55CDC mRNA, complete
            cds.
          Length = 499

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 65/271 (23%), Positives = 110/271 (40%), Gaps = 7/271 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A  +S A +++  V      + L  +  H   V  +SW       +L+S S  G +
Sbjct: 238  GNYLAVGTSSAEVQLWDVQQQ---KRLRNMTSHSARVGSLSWN----SYILSSGSRSGHI 290

Query: 420  IVWKEGNQNEWTQAHV--FNDHKSSVNSISWAPHELGLCLACGSSDGNISVY-TARSDGG 590
                  +     + HV   + H   V  + WAP   G  LA G +D  ++V+ +A  +GG
Sbjct: 291  ----HHHDVRVAEHHVATLSGHSQEVCGLRWAPD--GRHLASGGNDNLVNVWPSAPGEGG 344

Query: 591  WDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWK 770
            W   +    H   V AV+W P  +     G G             D  +++W + +G   
Sbjct: 345  WVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGT-----------SDRHIRIWNVCSGA-- 391

Query: 771  MDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS-ASEDGKVVIW---TVAKEGDQWEGKVL 938
              C  A+  H+  V  + W+P+    K  I+       ++VIW   T+AK  +      L
Sbjct: 392  --CLSAVDAHSQ-VCSILWSPHY---KELISGHGFAQNQLVIWKYPTMAKVAE------L 439

Query: 939  YDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                + V  ++ S  G  +A A+ D  + LW
Sbjct: 440  KGHTSRVLSLTMSPDGATVASAAADETLRLW 470



>pir|T46032|T46032 WD-40 repeat regulatory protein tup1 homolog -
           Arabidopsis thaliana>gb:ATT16K5_1554579 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T16K5.
          Length = 317

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 69/270 (25%), Positives = 109/270 (40%), Gaps = 8/270 (2%)
 Frame = +3

Query: 126 FQGDHTFIRSSDKEGKMPAQKIETG--------HSDTVHDVSMDYYGKRVATASSDASIK 281
           F  D  FI S+  +  +    +ETG        H++    V+ +     + + S D +++
Sbjct: 79  FSSDARFIVSASDDKTLKLWDVETGSLIKTLIGHTNYAFCVNFNPQSNMIVSGSFDETVR 138

Query: 282 IIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQA 461
           I  V+   T + L  L  H  PV  V +     GSL+ S S+DG   +W  G  +     
Sbjct: 139 IWDVT---TGKCLKVLPAHSDPVTAVDFNRD--GSLIVSSSYDGLCRIWDSGTGH--CVK 191

Query: 462 HVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAV 641
            + +D    V+ + ++P+  G  +  G+ D  + ++   S     T      H      +
Sbjct: 192 TLIDDENPPVSFVRFSPN--GKFILVGTLDNTLRLWNISSAKFLKTYT---GHVNAQYCI 246

Query: 642 SWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDV 821
           S A S+  G  + SG  D           N V +W+L +          L+ HT  V +V
Sbjct: 247 SSAFSVTNGKRIVSGSED-----------NCVHMWELNS----KKLLQKLEGHTETVMNV 291

Query: 822 AWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
           A  P   L    IAS S D  V IWT  KE
Sbjct: 292 ACHPTENL----IASGSLDKTVRIWTQKKE 317



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 59/246 (23%), Positives = 95/246 (38%), Gaps = 6/246 (2%)
 Frame = +3

Query: 315  HLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHV--FNDHKSS 488
            H  TL  H+  V  V ++    G LLAS S D  +  +     N+     V  F  H++ 
Sbjct: 16   HSQTLTSHNRAVSSVKFSSD--GRLLASASADKTIRTYTINTINDPIAEPVQEFTGHENG 73

Query: 489  VNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPG 668
            ++ ++++     +  A  S D  + ++   +     T        IG T  ++  +  P 
Sbjct: 74   ISDVAFSSDARFIVSA--SDDKTLKLWDVETGSLIKTL-------IGHTNYAFCVNFNPQ 124

Query: 669  ALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLP 848
            +            + S   D TV++W +  G     C   L  H+    D   A +    
Sbjct: 125  S----------NMIVSGSFDETVRIWDVTTG----KCLKVLPAHS----DPVTAVDFNRD 166

Query: 849  KSTIASASEDGKVVIWTVAKEGDQWEGK----VLYDFNTPVWRVSWSLTGNLLAVASGDN 1016
             S I S+S DG   IW      D   G     ++ D N PV  V +S  G  + V + DN
Sbjct: 167  GSLIVSSSYDGLCRIW------DSGTGHCVKTLIDDENPPVSFVRFSPNGKFILVGTLDN 220

Query: 1017 NVTLWN 1034
             + LWN
Sbjct: 221  TLRLWN 226



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 76/319 (23%), Positives = 134/319 (42%), Gaps = 6/319 (1%)
 Frame = +3

Query: 99   SADPRLHSLFQGDHTF----IRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASS 266
            S+D RL +    D T     I + +     P Q+  TGH + + DV+     + + +AS 
Sbjct: 33   SSDGRLLASASADKTIRTYTINTINDPIAEPVQEF-TGHENGISDVAFSSDARFIVSASD 91

Query: 267  DASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQN 446
            D ++K+  V   S    + TL GH    + V++ +P+  +++ S SFD  V +W   +  
Sbjct: 92   DKTLKLWDVETGSL---IKTLIGHTNYAFCVNF-NPQ-SNMIVSGSFDETVRIW---DVT 143

Query: 447  EWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARSDGGWDTARIDQAHPI 626
                  V   H   V ++ +  +  G  +   S DG   ++ + + G      ID  +P 
Sbjct: 144  TGKCLKVLPAHSDPVTAVDF--NRDGSLIVSSSYDGLCRIWDSGT-GHCVKTLIDDENP- 199

Query: 627  GVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTN 806
             V+ V ++P+     LVG+              DNT+++W + +  +          H N
Sbjct: 200  PVSFVRFSPN-GKFILVGT-------------LDNTLRLWNISSAKF----LKTYTGHVN 241

Query: 807  WVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKEG--DQWEGKVLYDFNTPVWRVSWSL 980
                ++ A ++   K  I S SED  V +W +  +    + EG         V  V+   
Sbjct: 242  AQYCISSAFSVTNGKR-IVSGSEDNCVHMWELNSKKLLQKLEGHT-----ETVMNVACHP 295

Query: 981  TGNLLAVASGDNNVTLWNE 1037
            T NL+A  S D  V +W +
Sbjct: 296  TENLIASGSLDKTVRIWTQ 314



>sp|Q55563|Y163_SYNY3 Hypothetical WD-repeat protein
            sll0163.>pir|S76086|S76086 beta transducin-like protein,
            190K - Synechocystis sp.  (strain PCC
            6803)>gb:BA000022_689453 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 1693

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 71/290 (24%), Positives = 111/290 (38%), Gaps = 10/290 (3%)
 Frame = +3

Query: 198  GHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWA-HP 374
            GH + +  +     G+  ATAS+D ++K+         + +ATL GH   V  V ++ H 
Sbjct: 1053 GHQEAITALDWSADGQYFATASADHTVKLW----QRHGEEVATLRGHEDWVRSVHFSPHH 1108

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
            +F   L +   D    +W    +    Q  +   H   V +  +  H  G  L   S DG
Sbjct: 1109 QF---LVTSGQDNTARIWNFAGE----QLTLCQGHADWVRNAEFNCH--GQILLTASRDG 1159

Query: 555  NISVYTARSDGGWDTARID----QAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAG 722
                 TAR    WD    +    Q H   V    ++P                Q + +  
Sbjct: 1160 -----TARL---WDLEGREIGLCQGHTSWVRNAQFSPDG--------------QWIVTCS 1197

Query: 723  CDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV 902
             D T ++W L +      CF  L+ H NWV +  W+P+       I ++S DG   +W+ 
Sbjct: 1198 ADGTARLWDLSS-----QCFAVLKGHQNWVNNALWSPD----GQHIITSSSDGTARVWS- 1247

Query: 903  AKEGDQWEGKVL-----YDFNTPVWRVSWSLTGNLLAVASGDNNVTLWNE 1037
                    GK L     +D N  +    +SL G  +   S DN   LW +
Sbjct: 1248 ------RHGKCLGTLRGHDHN--IHGARFSLDGQKIVTYSTDNTARLWTK 1289



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 67/288 (23%), Positives = 110/288 (38%), Gaps = 15/288 (5%)
 Frame = +3

Query: 105  DPRLHSLFQGDHTFIRSSDKEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIK- 281
            D  L+  F  D  +I ++ K+G        TG    V    + +Y K +  A   A  + 
Sbjct: 1425 DAVLNVRFSPDSQYIVTASKDGTARVWN-NTGRELAV----LRHYEKNIFAAEFSADGQF 1479

Query: 282  IIGVSNNSTS-------QHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGN 440
            I+  S+++T+       + +    GH GPV+   ++       + + S D    +W    
Sbjct: 1480 IVTASDDNTAGIWEIVGREVGICRGHEGPVYFAQFSADS--RYILTASVDNTARIWDFLG 1537

Query: 441  QNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDGNISVYTARS-DGGWDTARIDQA 617
            +   T A     H+S V    ++P   G  +A  S+D     +TAR  D    T  +   
Sbjct: 1538 RPLLTLA----GHQSIVYQARFSPE--GNLIATVSAD-----HTARLWDRSGKTVAVLYG 1586

Query: 618  HPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWKMDCFPALQM 797
            H   V  V W+P                Q L +A  D T ++W L            L+ 
Sbjct: 1587 HQGLVGTVDWSPDG--------------QMLVTASNDGTARLWDLSGRE-----LLTLEG 1627

Query: 798  HTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTV------AKEGDQW 923
            H NWVR   ++P+       + ++S DG   +W V        +G QW
Sbjct: 1628 HGNWVRSAEFSPD----GRWVLTSSADGTAKLWPVKTLPQLLSQGGQW 1671



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 64/291 (21%), Positives = 106/291 (36%)
 Frame = +3

Query: 162  KEGKMPAQKIETGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHH 341
            KEG +    I  GH   V+D      G+ V T S+D + +   +S   T     TL GH 
Sbjct: 1289 KEGTLLT--ILRGHQKEVYDADFSADGRFVFTVSADQTARQWDISQKDT----ITLTGHS 1342

Query: 342  GPVWQVSWAHPKFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHEL 521
              V    + +PK G  L + S D    +W      E     V  DH+  V    ++P   
Sbjct: 1343 HWVRNAHF-NPK-GDRLLTVSRDKTARLW----TTEGECVAVLADHQGWVREGQFSPD-- 1394

Query: 522  GLCLACGSSDGNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPV 701
            G  +  GS+D    ++            + + H   V  V ++P                
Sbjct: 1395 GQWIVTGSADKTAQLWNVLG----KKLTVLRGHQDAVLNVRFSPDS-------------- 1436

Query: 702  QKLASAGCDNTVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDG 881
            Q + +A  D T +VW         +    L +  ++ +++ +A         I +AS+D 
Sbjct: 1437 QYIVTASKDGTARVWN--------NTGRELAVLRHYEKNI-FAAEFSADGQFIVTASDDN 1487

Query: 882  KVVIWTVAKEGDQWEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
               IW +       E  +      PV+   +S     +  AS DN   +W+
Sbjct: 1488 TAGIWEIVGR----EVGICRGHEGPVYFAQFSADSRYILTASVDNTARIWD 1534



 Score = 41.2 bits (95), Expect = 0.039
 Identities = 76/318 (23%), Positives = 113/318 (35%), Gaps = 38/318 (11%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            TGHS  V +   +  G R+ T S D + ++      +  + +A LA H G  W       
Sbjct: 1339 TGHSHWVRNAHFNPKGDRLLTVSRDKTARLW----TTEGECVAVLADHQG--WVREGQFS 1392

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLACGSSDG 554
              G  + + S D    +W    +    +  V   H+ +V ++ ++P    +  A  S DG
Sbjct: 1393 PDGQWIVTGSADKTAQLWNVLGK----KLTVLRGHQDAVLNVRFSPDSQYIVTA--SKDG 1446

Query: 555  NISVY--TAR------------------SDGGWDTARIDQAHPIGVTAVSWAPSMAPGAL 674
               V+  T R                  +DG +     D       TA  W      G  
Sbjct: 1447 TARVWNNTGRELAVLRHYEKNIFAAEFSADGQFIVTASDDN-----TAGIWE---IVGRE 1498

Query: 675  VG--SGLHDPV---------QKLASAGCDNTVKVWKLYNGVWKMDCFPALQM--HTNWVR 815
            VG   G   PV         + + +A  DNT ++W            P L +  H + V 
Sbjct: 1499 VGICRGHEGPVYFAQFSADSRYILTASVDNTARIWDFLGR-------PLLTLAGHQSIVY 1551

Query: 816  DVAWAPNLGLPKSTIASASEDGKVVIW-----TVAKEGDQWEGKVLYDFNTPVWRVSWSL 980
               ++P   L    IA+ S D    +W     TVA         VLY     V  V WS 
Sbjct: 1552 QARFSPEGNL----IATVSADHTARLWDRSGKTVA---------VLYGHQGLVGTVDWSP 1598

Query: 981  TGNLLAVASGDNNVTLWN 1034
             G +L  AS D    LW+
Sbjct: 1599 DGQMLVTASNDGTARLWD 1616



>sp|Q12834|CC20_HUMAN Cell division cycle protein 20 homolog
            (p55CDC).>gb:AF099644_1882990 Homo sapiens cell cycle
            protein CDC20 mRNA, complete cds.>gb:AL139289_1920548
            Human DNA sequence from clone RP1-92O14 on chromosome
            1p33-34.2 Contains the 3' end of the TIE gene for
            tyrosine kinase with immunoglobulin and epidermal growth
            factor homology domains, the MPL gene for
            myeloproliferative leukemia virus oncogene, two novel
            genes, the CDC20 gene for CDC20 cell division cycle 20
            homolog (S. cerevisiae), the ELOVL1 gene for elongation
            of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3,
            yeast)-like 1, the MED8 gene for mediator of RNA
            polymerase II transcription subunit 8 homolog (yeast) and
            the 5' end of the gene for a novel protein (LOC149469),
            complete sequence.>gb:BC001088_1967281 Homo sapiens CDC20
            cell division cycle 20 homolog (S. cerevisiae), mRNA
            (cDNA clone MGC:2830 IMAGE:2964686), complete
            cds.>gb:BC006272_1970153 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:10620 IMAGE:3948819), complete
            cds.>gb:BC009425_1971993 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:15275 IMAGE:2959460), complete
            cds.>gb:BC009426_1971994 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:15276 IMAGE:2959596), complete
            cds.>gb:BC010044_1972448 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:19761 IMAGE:3634656), complete
            cds.>gb:BC012803_1973774 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:2777 IMAGE:2959588), complete
            cds.>gb:BC012827_1973795 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:4503 IMAGE:2964686), complete
            cds.>gb:BC013303_1974033 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:4441 IMAGE:2959588), complete
            cds.>gb:BC015998_1975434 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:27217 IMAGE:4306426), complete
            cds.>gb:BC024257_1978309 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:15441 IMAGE:2959460), complete
            cds.>gb:BC031294_1980119 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae), mRNA (cDNA clone
            MGC:15304 IMAGE:2959487), complete
            cds.>gb:BT007388_1990826 Homo sapiens CDC20 cell division
            cycle 20 homolog (S. cerevisiae) mRNA, complete cds.
          Length = 499

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 65/271 (23%), Positives = 110/271 (40%), Gaps = 7/271 (2%)
 Frame = +3

Query: 240  GKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHPKFGSLLASCSFDGKV 419
            G  +A  +S A +++  V      + L  +  H   V  +SW       +L+S S  G +
Sbjct: 238  GNYLAVGTSSAEVQLWDVQQQ---KRLRNMTSHSARVGSLSWN----SYILSSGSRSGHI 290

Query: 420  IVWKEGNQNEWTQAHV--FNDHKSSVNSISWAPHELGLCLACGSSDGNISVY-TARSDGG 590
                  +     + HV   + H   V  + WAP   G  LA G +D  ++V+ +A  +GG
Sbjct: 291  ----HHHDVRVAEHHVATLSGHSQEVCGLRWAPD--GRHLASGGNDNLVNVWPSAPGEGG 344

Query: 591  WDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDNTVKVWKLYNGVWK 770
            W   +    H   V AV+W P  +     G G             D  +++W + +G   
Sbjct: 345  WVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGT-----------SDRHIRIWNVCSGA-- 391

Query: 771  MDCFPALQMHTNWVRDVAWAPNLGLPKSTIAS-ASEDGKVVIW---TVAKEGDQWEGKVL 938
              C  A+  H+  V  + W+P+    K  I+       ++VIW   T+AK  +      L
Sbjct: 392  --CLSAVDAHSQ-VCSILWSPHY---KELISGHGFAQNQLVIWKYPTMAKVAE------L 439

Query: 939  YDFNTPVWRVSWSLTGNLLAVASGDNNVTLW 1031
                + V  ++ S  G  +A A+ D  + LW
Sbjct: 440  KGHTSRVLSLTMSPDGATVASAAADETLRLW 470



>gb:BC054992_2551194 Xenopus laevis hypothetical protein MGC64565,
            mRNA (cDNA clone MGC:64565 IMAGE:6880272), complete cds.
          Length = 337

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 72/287 (25%), Positives = 112/287 (39%), Gaps = 7/287 (2%)
 Frame = +3

Query: 195  TGHSDTVHDVSMDYYGKRVATASSDASIKIIGVSNNSTSQHLATLAGHHGPVWQVSWAHP 374
            +GH   V+       G  +++A  D  I +  V  +    + ATL GH G V ++ +   
Sbjct: 43   SGHEGEVYCCKFHPNGVTLSSAGFDRLILLWNVYGDC--DNYATLKGHSGAVMELHYNTD 100

Query: 375  KFGSLLASCSFDGKVIVWKEGNQNEWTQAHVFNDHKSSVNSISWAPHELGLCLAC-GSSD 551
              GSLL S S D  V +W   +     +      H S VNS    P   G  L C GS D
Sbjct: 101  --GSLLFSASTDRTVAIW---DCETGERVKRLKGHTSFVNSCY--PARRGPQLICTGSDD 153

Query: 552  GNISVYTARSDGGWDTARIDQAHPIGVTAVSWAPSMAPGALVGSGLHDPVQKLASAGCDN 731
            G + ++  R      T +    +   V +V++              +D   ++ S G DN
Sbjct: 154  GTVKLWDFRKKAAVQTFQ----NTYQVLSVTF--------------NDTSDQIISGGIDN 195

Query: 732  TVKVWKLYNGVWKMDCFPALQMHTNWVRDVAWAPNLGLPKSTIASASEDGKVVIWTVAKE 911
             +KVW L            L        D     +L    S + S + D  V +W V   
Sbjct: 196  DIKVWDLRQN--------KLMYTMRGHGDSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPF 247

Query: 912  GDQ------WEGKVLYDFNTPVWRVSWSLTGNLLAVASGDNNVTLWN 1034
              +      ++G V ++F   + R SWS  G+ +A  S D  V +W+
Sbjct: 248  APKERCVKIFQGNV-HNFEKNLLRSSWSADGSKIAAGSADRFVYVWD 293


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,393,003,637
Number of Sequences: 1806583
Number of extensions: 33818443
Number of successful extensions: 95279
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 79458
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 90306
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 89280706284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)