BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6739
         (1258 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY101603_1577657 Petunia x hybrida nam-like protein 1 (Nh1) m...   386   e-106   
pir|T46230|T46230 NAC2-like protein - Arabidopsis thaliana>gb:AT...   260   5e-68   Arabidopsis thaliana [mouse-ear cress]
gb:AB010068_1510841 Arabidopsis thaliana genomic DNA, chromosome...   253   8e-66   
pir|T04663|T04663 hypothetical protein F8D20.90 - Arabidopsis th...   236   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AC006424_1534195 Arabidopsis thaliana chromosome I BAC F9L11 ...   233   6e-60   
gb:AP004698_1843605 Oryza sativa (japonica cultivar-group) genom...   217   4e-55   
gb:AC118980_1739573 Oryza sativa (japonica cultivar-group) chrom...   197   3e-49   
gb:AB005238_1509431 Arabidopsis thaliana genomic DNA, chromosome...   194   4e-48   
gb:AB026646_1517181 Arabidopsis thaliana genomic DNA, chromosome...   193   5e-48   
pir|D96683|D96683 hypothetical protein F12P19.8 [imported] - Ara...   191   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AK176278_1818266 Arabidopsis thaliana mRNA for hypothetical p...   191   4e-47   
pir|H96584|H96584 hypothetical protein F20D21.15 [imported] - Ar...   191   4e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AF509874_1807078 Petunia x hybrida nam-like protein 11 (NH11)...   187   4e-46   
gb:AF509871_1807075 Petunia x hybrida nam-like protein 8 (NH8) m...   186   7e-46   
gb:AB028605_1517871 Arabidopsis thaliana genomic DNA, chromosome...   186   9e-46   
gb:AF509867_1807071 Petunia x hybrida nam-like protein 4 (NH4) m...   182   1e-44   
gb:ATAC012328_1543419 Arabidopsis thaliana chromosome III BAC T1...   182   1e-44   
pir|T05084|T05084 hypothetical protein T6K21.160 - Arabidopsis t...   181   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023922 Oryza sativa (japonica cultivar-group) chrom...   179   8e-44   
gb:AY051003_1562481 Arabidopsis thaliana unknown protein (At3g10...   178   2e-43   
gb:AC011560_1537249 Arabidopsis thaliana chromosome 3 BAC F13M14...   178   2e-43   
gb:AB028187_1517823 Oryza sativa mRNA for OsNAC8 protein, comple...   177   5e-43   
gb:AY087802_1572829 Arabidopsis thaliana clone 38529 mRNA, compl...   176   7e-43   
pir|T48437|T48437 hypothetical protein T32M21.10 - Arabidopsis t...   176   7e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AF509872_1807076 Petunia x hybrida nam-like protein 9 (NH9) m...   175   2e-42   
gb:AP004587_1841948 Oryza sativa (japonica cultivar-group) genom...   174   3e-42   
gb:AP004587_1841947 Oryza sativa (japonica cultivar-group) genom...   174   3e-42   
pir|F86450|F86450 hypothetical protein F5D14.30 [imported] - Ara...   174   3e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AC135419_1742242 Oryza sativa (japonica cultivar-group) chrom...   172   1e-41   
gb:AF201456_1776505 Arabidopsis thaliana NAC2 (NAC2) mRNA, compl...   172   1e-41   
gb:AC011560_1537250 Arabidopsis thaliana chromosome 3 BAC F13M14...   172   2e-41   
gb:AC011560_1537251 Arabidopsis thaliana chromosome 3 BAC F13M14...   171   3e-41   
gb:ATT5E8_1556128 Arabidopsis thaliana DNA chromosome 5, BAC clo...   166   9e-40   
pir|F86456|F86456 unknown protein [imported] - Arabidopsis thali...   166   9e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AF509865_1807069 Petunia x hybrida nam-like protein 2 (NH2) m...   166   1e-39   
gb:AF254124_1781074 Medicago truncatula NAC1 (NAC1) mRNA, comple...   165   2e-39   
gb:AY085102_1570184 Arabidopsis thaliana clone 12970 mRNA, compl...   164   3e-39   
gb:AB010073_1510958 Arabidopsis thaliana genomic DNA, chromosome...   164   3e-39   
gb:AC126222_1740517 Oryza sativa (japonica cultivar-group) chrom...   164   5e-39   
pir|A84746|A84746 probable NAM (no apical meristem)-like protein...   163   6e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AP004749_1844321 Oryza sativa (japonica cultivar-group) genom...   163   8e-39   
gb:AB028186_1517822 Oryza sativa mRNA for OsNAC7 protein, comple...   163   8e-39   
pir|T04050|T04050 hypothetical protein F24G24.150 - Arabidopsis ...   163   8e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AF509870_1807074 Petunia x hybrida nam-like protein 7 (NH7) m...   162   1e-38   
gb:AP004020_1836485 Oryza sativa (japonica cultivar-group) genom...   162   2e-38   
gb:OSJN00003_1693104 Oryza sativa genomic DNA, chromosome 4, BAC...   162   2e-38   
gb:ATAC011698_1543382 Arabidopsis thaliana chromosome III BAC T1...   162   2e-38   
gb:AB028181_1517817 Oryza sativa mRNA for OsNAC2 protein, comple...   162   2e-38   
gb:AF532619_1809421 Glycine max no apical meristem-like protein ...   161   3e-38   
gb:AY084635_1569723 Arabidopsis thaliana clone 113779 mRNA, comp...   161   3e-38   
gb:AB012243_1511739 Arabidopsis thaliana genomic DNA, chromosome...   161   3e-38   
gb:AB012246_1511805 Arabidopsis thaliana genomic DNA, chromosome...   160   4e-38   
gb:AP005510_1853112 Oryza sativa (japonica cultivar-group) genom...   159   1e-37   
gb:PHDNANAM_1700106 P.hybrida NAM gene.>gb:PHRNANAM_1700164 P.hy...   159   1e-37   
gb:AY062638_1565294 Arabidopsis thaliana Unknown protein (MRI12....   159   1e-37   
gb:AE005173_895479 Arabidopsis thaliana chromosome 1, bottom arm...   159   1e-37   
gb:AF509873_1807077 Petunia x hybrida nam-like protein 10 (NH10)...   159   1e-37   
gb:AY596808_1616938 Oryza sativa (japonica cultivar-group) NAC t...   159   1e-37   
gb:AP005167_1848626 Oryza sativa (japonica cultivar-group) genom...   158   3e-37   
gb:AB022218_1515098 Arabidopsis thaliana genomic DNA, chromosome...   158   3e-37   
gb:AP006161_1861106 Oryza sativa (japonica cultivar-group) genom...   157   3e-37   
gb:AF510214_1807171 Petunia x hybrida nam-like protein 17 (NH17)...   157   3e-37   
gb:OSJN00196_1696537 Oryza sativa genomic DNA, chromosome 4, BAC...   157   3e-37   
gb:AP005291_1849971 Oryza sativa (japonica cultivar-group) genom...   157   4e-37   
gb:BT000790_1635061 Arabidopsis thaliana clone RAFL09-15-E01 (R0...   157   4e-37   
pir|E86395|E86395 hypothetical protein T2P11.6 - Arabidopsis tha...   157   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC011698_1543383 Arabidopsis thaliana chromosome III BAC T1...   157   6e-37   
gb:AB028180_1517816 Oryza sativa mRNA for OsNAC1 protein, comple...   157   6e-37   
gb:AB026658_1517362 Arabidopsis thaliana genomic DNA, chromosome...   157   6e-37   
gb:AC126222_1740520 Oryza sativa (japonica cultivar-group) chrom...   156   7e-37   
gb:AY057578_1563994 Arabidopsis thaliana unknown protein (At4g27...   156   7e-37   
gb:AP002818_1822882 Oryza sativa (japonica cultivar-group) genom...   156   1e-36   
gb:AY099786_1576811 Arabidopsis thaliana NAM-like protein (At1g5...   156   1e-36   
pir|B86466|B86466 hypothetical protein F23M19.13 - Arabidopsis t...   156   1e-36   Arabidopsis thaliana [mouse-ear cress]
pir|A96570|A96570 NAM-like protein, 59502-58357 [imported] - Ara...   156   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AF011555_1761174 Lycopersicon esculentum jasmonic acid 2 (LEJ...   155   1e-36   
gb:AC154033_1745267 Solanum demissum chromosome 5 clone PGEC132D...   155   1e-36   
gb:AC151803_1745127 Solanum demissum chromosome 5 BAC PGEC979H09...   155   1e-36   
gb:AP006049_1860485 Oryza sativa (japonica cultivar-group) genom...   155   2e-36   
gb:AF402603_1796296 Phaseolus vulgaris NAC domain protein NAC2 m...   155   2e-36   
gb:AY704177_1623696 Solanum tuberosum jasmonic acid 2 mRNA, comp...   155   2e-36   
gb:AY087700_1572728 Arabidopsis thaliana clone 37792 mRNA, compl...   155   2e-36   
gb:AB019235_1514230 Arabidopsis thaliana genomic DNA, chromosome...   155   2e-36   
gb:AB010070_1510877 Arabidopsis thaliana genomic DNA, chromosome...   155   2e-36   
gb:AB008266_1510416 Arabidopsis thaliana genomic DNA, chromosome...   155   2e-36   
gb:AP004679_1843237 Oryza sativa (japonica cultivar-group) genom...   155   2e-36   
gb:AP004610_1842061 Oryza sativa (japonica cultivar-group) genom...   155   2e-36   
gb:AY245887_1592572 Brassica napus NAC-domain protein 485 (NAC48...   155   2e-36   
gb:AB028183_1517819 Oryza sativa mRNA for OsNAC4 protein, comple...   155   2e-36   
gb:AB002560_1508703 Arabidopsis thaliana DNA for CUC2, complete ...   155   2e-36   
gb:BT020413_1642808 Arabidopsis thaliana At2g46770 mRNA, complet...   154   3e-36   
gb:BT002931_1636519 Arabidopsis thaliana clone RAFL15-02-N12 (R2...   154   3e-36   
gb:AY087839_1572866 Arabidopsis thaliana clone 38858 mRNA, compl...   154   3e-36   
gb:AY084508_1569597 Arabidopsis thaliana clone 109984 mRNA, comp...   154   3e-36   
gb:A82386_1450954 Sequence 11 from Patent WO9856811.>gb:TSP01083...   154   3e-36   
pir|C84671|C84671 NAM (no apical meristem)-like protein [importe...   154   3e-36   Arabidopsis thaliana [mouse-ear cress]
pir|T02678|T02678 NAM (no apical meristem)-like protein [importe...   154   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb:BT008346_1639563 Arabidopsis thaliana At1g61110 mRNA, complet...   154   4e-36   
gb:AY086093_1571151 Arabidopsis thaliana clone 21243 mRNA, compl...   154   4e-36   
pir|H96636|H96636 hypothetical protein F11P17.16 [imported] - Ar...   154   4e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AP002842_1823084 Oryza sativa (japonica cultivar-group) genom...   154   5e-36   
gb:AB022218_1515097 Arabidopsis thaliana genomic DNA, chromosome...   154   5e-36   
pir|G84559|G84559 probable NAM (no apical meristem)-like protein...   154   5e-36   Arabidopsis thaliana [mouse-ear cress]
pir|B96742|B96742 NAM-like protein, 48543-50167 [imported] - Ara...   154   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AC092780_1735718 Oryza sativa chromosome 3 BAC OSJNBb0079B16 ...   153   6e-36   
gb:A82382_1450952 Sequence 7 from Patent WO9856811.                   153   6e-36   
pir|H96791|H96791 unknown protein F14G6.2 [imported] - Arabidops...   153   6e-36   Arabidopsis thaliana [mouse-ear cress]
pir|T04585|T04585 hypothetical protein F23E13.50 - Arabidopsis t...   153   6e-36   Arabidopsis thaliana [mouse-ear cress]
pir|B96570|B96570 NAM-like protein, 67516-66364 [imported] - Ara...   153   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AF509869_1807073 Petunia x hybrida nam-like protein 6 (NH6) m...   153   8e-36   
gb:AP004863_1846171 Oryza sativa (japonica cultivar-group) genom...   152   1e-35   
gb:AP004654_1842738 Oryza sativa (japonica cultivar-group) genom...   152   1e-35   
pir|T08933|T08933 hypothetical protein F27G19.10 - Arabidopsis t...   152   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00108_1695071 Oryza sativa genomic DNA, chromosome 4, BAC...   152   2e-35   
gb:AY672069_1621323 Hordeum vulgare subsp. vulgare NAC transcrip...   152   2e-35   
gb:AY245885_1592570 Brassica napus NAC-domain protein 18 (NAC18)...   152   2e-35   
gb:AY086124_1571181 Arabidopsis thaliana clone 21634 mRNA, compl...   152   2e-35   
pir|T52343|T52343 hypothetical protein [imported] - Arabidopsis ...   152   2e-35   Arabidopsis thaliana [mouse-ear cress]
pir|E84636|E84636 NAM (no apical meristem)-like protein [importe...   152   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AP001299_1820994 Arabidopsis thaliana genomic DNA, chromosome...   151   2e-35   
gb:AF509866_1807070 Petunia x hybrida nam-like protein 3 (NH3) m...   151   2e-35   
gb:AY245882_1592567 Brassica napus NAC-domain protein 5-7 (NAC5-...   151   2e-35   
gb:AB049069_1520759 Arabidopsis thaliana CUC1 mRNA, complete cds.     151   2e-35   
gb:AB028182_1517818 Oryza sativa mRNA for OsNAC3 protein, comple...   151   2e-35   
pir|T49145|T49145 hypothetical protein T10D17.80 - Arabidopsis t...   151   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AP003866_1834535 Oryza sativa (japonica cultivar-group) genom...   151   3e-35   
gb:AP003346_1828440 Oryza sativa (japonica cultivar-group) genom...   151   3e-35   
gb:BT000874_1635129 Arabidopsis thaliana clone C104984 putative ...   151   3e-35   
gb:AC005312_1532533 Arabidopsis thaliana chromosome 2 clone T16F...   151   3e-35   
gb:AC002304_1530210 Genomic sequence for Arabidopsis thaliana BA...   151   3e-35   
gb:AP004081_1837407 Oryza sativa (japonica cultivar-group) genom...   150   4e-35   
gb:BT005985_1638907 Arabidopsis thaliana At3g04070 gene, complet...   150   4e-35   
gb:AY084860_1569942 Arabidopsis thaliana clone 11977 mRNA, compl...   150   4e-35   
pir|D84547|D84547 NAM (no apical meristem)-like protein [importe...   150   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AC104427_1737591 Oryza sativa (japonica cultivar-group) chrom...   150   5e-35   
gb:AY498713_1609388 Lycopersicon esculentum NAC domain protein m...   150   5e-35   
gb:AY245884_1592569 Brassica napus NAC-domain protein 5-11 (NAC5...   150   5e-35   
gb:ATT2K12_1555730 Arabidopsis thaliana DNA chromosome 5, BAC cl...   150   5e-35   
gb:AB022211_1514981 Arabidopsis thaliana genomic DNA, chromosome...   150   5e-35   
pir|G86257|G86257 hypothetical protein [imported] - Arabidopsis ...   150   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AP004989_1846763 Oryza sativa (japonica cultivar-group) genom...   150   7e-35   
gb:STU401151_1723072 Solanum tuberosum mRNA for putative NAC dom...   150   7e-35   
pir|E86452|E86452 protein F6N18.15 [imported] - Arabidopsis thal...   150   7e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AF402602_1796295 Phaseolus vulgaris NAC domain protein NAC1 m...   149   9e-35   
gb:AC137623_1743699 Oryza sativa (japonica cultivar-group) chrom...   149   9e-35   
gb:AY245883_1592568 Brassica napus NAC-domain protein 5-8 (NAC5-...   149   9e-35   
gb:AY078006_1567975 Arabidopsis thaliana AT5g22290/MWD9_7 mRNA, ...   149   9e-35   
gb:AB007651_1510256 Arabidopsis thaliana genomic DNA, chromosome...   149   9e-35   
gb:AC151803_1745128 Solanum demissum chromosome 5 BAC PGEC979H09...   149   1e-34   
gb:AC149288_1744918 Solanum demissum chromosome 5 clone PGEC446J...   149   1e-34   
gb:AP004114_1837788 Oryza sativa (japonica cultivar-group) genom...   149   2e-34   
pir|T52345|T52345 OsNAC6 protein [imported] - rice>gb:AB028185_1...   149   2e-34   Oryza sativa Japonica Group [Japonica rice]
pir|T47983|T47983 NAM-like protein - Arabidopsis thaliana>gb:ATF...   148   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb:ATT19L5_1554849 Arabidopsis thaliana DNA chromosome 5, BAC cl...   148   3e-34   
gb:AE016959_1023594 Oryza sativa (japonica cultivar-group) chrom...   148   3e-34   
pir|E86148|E86148 T1N6.12 protein - Arabidopsis thaliana>gb:AE00...   148   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AP005159_1848430 Oryza sativa (japonica cultivar-group) genom...   147   3e-34   
gb:AY308828_1597850 Capsicum annuum salicylic acid-induced prote...   147   3e-34   
gb:AP002818_1822876 Oryza sativa (japonica cultivar-group) genom...   147   4e-34   
gb:AF488416_1804409 Zea mays chromosome 9 BAC 9C20 complete sequ...   147   4e-34   
gb:AF488412_1804372 Sorghum bicolor BAC 131L1, complete sequence.     147   4e-34   
pir|T07182|T07182 hypothetical protein SENU5, senescence up-regu...   147   4e-34   Solanum lycopersicum
gb:AF509877_1807081 Petunia x hybrida nam-like protein 14 (NH14)...   147   6e-34   
gb:AF488413_1804382 Oryza sativa chromosome 6 BAC 134P10, comple...   147   6e-34   
pir|G84436|G84436 NAM (no apical meristem)-like protein [importe...   147   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AY245886_1592571 Brassica napus NAC-domain protein 14 (NAC14)...   146   8e-34   
gb:AY245880_1592565 Brassica napus NAC-domain protein 3 (NAC3) m...   145   1e-33   
gb:AY084323_1569414 Arabidopsis thaliana clone 103969 mRNA, comp...   145   1e-33   
gb:AB026645_1517169 Arabidopsis thaliana genomic DNA, chromosome...   145   1e-33   
gb:AK118910_1816862 Arabidopsis thaliana At5g08790 mRNA for puta...   145   2e-33   
gb:AC124836_1740487 Oryza sativa (japonica cultivar-group) chrom...   145   2e-33   
gb:AY730866_1625466 Helianthus annuus NAC-domain protein (NAC-1)...   145   2e-33   
gb:AE016959_1023094 Oryza sativa (japonica cultivar-group) chrom...   145   2e-33   
pir|G84860|G84860 NAM (no apical meristem)-like protein [importe...   145   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AE005173_893937 Arabidopsis thaliana chromosome 1, bottom arm...   144   5e-33   
gb:AY034959_1559740 Arabidopsis thaliana putative NAM protein (A...   143   6e-33   
pir|E86453|E86453 CDS protein F9L11.7 [imported] - Arabidopsis t...   143   6e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AP004562_1841619 Oryza sativa (japonica cultivar-group) genom...   143   8e-33   
gb:BT000896_1635151 Arabidopsis thaliana clone C104908 unknown p...   143   8e-33   
gb:AB005234_1509353 Arabidopsis thaliana genomic DNA, chromosome...   143   8e-33   
pir|T52344|T52344 OsNAC5 protein [imported] - rice>gb:AB028184_1...   143   8e-33   Oryza sativa Japonica Group [Japonica rice]
pir|G96803|G96803 GRAB1-like protein, 10550-11502 [imported] - A...   142   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AY245881_1592566 Brassica napus NAC-domain protein 5-1 (NAC5-...   142   1e-32   
gb:A82384_1450953 Sequence 9 from Patent WO9856811.>gb:TSP010829...   142   1e-32   
pir|A86466|A86466 BTF3b factor protein F23M19.14 - Arabidopsis t...   142   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AY245879_1592564 Brassica napus NAC-domain protein 1-1 (NAC1-...   141   2e-32   
gb:AY087541_1572571 Arabidopsis thaliana clone 36478 mRNA, compl...   141   2e-32   
gb:AC084748_1733651 Oryza sativa chromosome 3 BAC OSJNBa0010I09 ...   141   3e-32   
gb:A82380_1450951 Sequence 5 from Patent WO9856811.                   141   3e-32   
gb:AP004589_1841983 Oryza sativa (japonica cultivar-group) genom...   140   4e-32   
gb:AY325313_1599620 Zea mays NAM-related protein 1 (NRP1) mRNA, ...   140   7e-32   
gb:AB016876_1512981 Arabidopsis thaliana genomic DNA, chromosome...   140   7e-32   
gb:AY045843_1561355 Arabidopsis thaliana unknown protein (At5g63...   137   4e-31   
pir|B85020|B85020 probable NAM-like protein [imported] - Arabido...   136   8e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AC113930_1739094 Oryza sativa (japonica cultivar-group) chrom...   135   2e-30   
gb:AP003829_1833924 Oryza sativa (japonica cultivar-group) genom...   134   3e-30   
gb:BT002462_1636065 Arabidopsis thaliana NAM / CUC2 -like protei...   134   3e-30   
gb:AF510215_1807172 Petunia x hybrida nam-like protein 18 (NH18)...   134   4e-30   
gb:AF509876_1807080 Petunia x hybrida nam-like protein 13 (NH13)...   134   4e-30   
gb:U89959_1726486 Arabidopsis thaliana BAC T7I23, complete seque...   132   2e-29   
gb:OSJN00099_1694892 Oryza sativa genomic DNA, chromosome 4, BAC...   130   4e-29   
gb:AF510213_1807170 Petunia x hybrida nam-like protein 16 (NH16)...   130   6e-29   
gb:AY087470_1572501 Arabidopsis thaliana clone 35774 mRNA, compl...   129   1e-28   
gb:AC108875_1738613 Oryza sativa (japonica cultivar-group) chrom...   128   2e-28   
pir|C96601|C96601 hypothetical protein T6H22.19 [imported] - Ara...   128   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP003685_1832027 Oryza sativa (japonica cultivar-group) genom...   127   4e-28   
gb:OSJN00174_1696188 Oryza sativa genomic DNA, chromosome 4, BAC...   127   5e-28   
pir|T01942|T01942 hypothetical protein F11O4.3 - Arabidopsis tha...   127   5e-28   Arabidopsis thaliana [mouse-ear cress]
gb:OSA243961_1692391 Oryza sativa chromosome 4 BAC l1332 genomic...   126   8e-28   
pir|T01940|T01940 hypothetical protein F11O4.4 - Arabidopsis tha...   126   8e-28   Arabidopsis thaliana [mouse-ear cress]
gb:OSB6015_1692800 Oryza sativa indica(GLA4) genomic DNA, chromo...   125   2e-27   
gb:AY102140_1577745 Arabidopsis thaliana At2g17040/At2g17040 mRN...   125   2e-27   
gb:AC137611_1743526 Oryza sativa (japonica cultivar-group) chrom...   123   9e-27   
gb:AF510212_1807169 Petunia x hybrida nam-like protein 15 (NH15)...   122   2e-26   
gb:AY060587_1564890 Arabidopsis thaliana AT3g04420/T27C4_6 mRNA,...   118   2e-25   
gb:AF360308_1791254 Arabidopsis thaliana putative NAM protein (A...   117   4e-25   
gb:AF509875_1807079 Petunia x hybrida nam-like protein 12 (NH12)...   117   6e-25   
gb:BT005873_1638795 Arabidopsis thaliana At1g56010 gene, complet...   113   7e-24   
gb:AC146506_1744594 Solanum demissum chromosome 5 BAC PGEC989P08...   113   9e-24   
gb:ATAC022287_1543757 Arabidopsis thaliana chromosome III BAC T2...   112   1e-23   
pir|T01939|T01939 hypothetical protein F11O4.5 - Arabidopsis tha...   111   4e-23   Arabidopsis thaliana [mouse-ear cress]
pir|T52342|T52342 NAC-domain protein [imported] - common tobacco...   110   5e-23   Nicotiana tabacum [American tobacco]
gb:AY730338_1625436 Solanum tuberosum strain P6/210 clone BAC BA...   110   6e-23   
gb:BT001115_1635370 Arabidopsis thaliana At1g01010/T25K16_1 mRNA...   109   1e-22   
gb:AB007651_1510266 Arabidopsis thaliana genomic DNA, chromosome...   109   1e-22   
pir|T47425|T47425 NAC domain-like protein - Arabidopsis thaliana...   106   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AF510216_1807173 Petunia x hybrida nam-like protein 19 (NH19)...   105   1e-21   
gb:AF510218_1807174 Petunia x hybrida nam-like protein 22 (NH22)...   105   2e-21   
gb:AP003611_1831333 Oryza sativa (japonica cultivar-group) genom...   103   7e-21   
pir|A86141|A86141 protein T25K16.1 [imported] - Arabidopsis thal...   101   3e-20   Arabidopsis thaliana [mouse-ear cress]
pir|S37100|S37100 ATAF2 protein - Arabidopsis thaliana                100   5e-20   Arabidopsis thaliana [mouse-ear cress]
gb:ATAATAF2_1542718 A.thaliana ATAF2 mRNA.                            100   8e-20   
gb:U89959_1726485 Arabidopsis thaliana BAC T7I23, complete seque...    98   3e-19   
gb:BT020269_1642664 Arabidopsis thaliana At1g02220 mRNA, complet...    98   3e-19   
gb:ATATAF1_1544091 A.thaliana ATAF1 mRNA.                              98   4e-19   
pir|S37101|S37101 ATAF1 protein - Arabidopsis thaliana (fragment)      98   4e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP004223_1838917 Oryza sativa (japonica cultivar-group) genom...    97   7e-19   
gb:AK118783_1816745 Arabidopsis thaliana At5g64530 mRNA for unkn...    97   7e-19   
gb:AB010076_1510995 Arabidopsis thaliana genomic DNA, chromosome...    97   7e-19   
pir|T04624|T04624 hypothetical protein F20O9.220 - Arabidopsis t...    94   6e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP004876_1846420 Oryza sativa (japonica cultivar-group) genom...    90   8e-17   
gb:AP003262_1826616 Oryza sativa (japonica cultivar-group) genom...    88   4e-16   
gb:AC137507_1743429 Oryza sativa chromosome 3 BAC OSJNBb0033J23 ...    87   5e-16   
gb:A82377_1450950 Sequence 2 from Patent WO9856811.                    87   5e-16   
gb:ATAC022287_1543758 Arabidopsis thaliana chromosome III BAC T2...    87   7e-16   
gb:AP004666_1842943 Oryza sativa (japonica cultivar-group) genom...    87   9e-16   
gb:A82376_1450949 Sequence 1 from Patent WO9856811.                    87   9e-16   
gb:OSJN00024_1693487 Oryza sativa genomic DNA, chromosome 4, BAC...    83   1e-14   
gb:AP004039_1836709 Oryza sativa (japonica cultivar-group) genom...    83   1e-14   
gb:AB039926_1519380 Arabidopsis thaliana RD26 mRNA for NAM-like ...    83   1e-14   
pir|T49054|T49054 NAM-like protein - Arabidopsis thaliana>gb:ATT...    76   1e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AB005230_1509254 Arabidopsis thaliana genomic DNA, chromosome...    75   2e-12   
gb:AY084216_1569309 Arabidopsis thaliana clone 100085 mRNA, comp...    75   3e-12   
pir|T47660|T47660 NAM (no apical meristem)-like protein - Arabid...    74   6e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AY542311_1612745 Sorghum bicolor clone SB20O07 b1-1, b1-2, pu...    73   1e-11   
gb:AF051222_1764211 Picea mariana ATAF1-like protein (Sb29) mRNA...    71   5e-11   
gb:AE016959_1021229 Oryza sativa (japonica cultivar-group) chrom...    71   5e-11   
pir|T51961|T51961 ATAF1-like protein [imported] - Picea mariana ...    71   5e-11   Picea mariana [black spruce]
gb:BT015150_1642120 Arabidopsis thaliana At5g50820 gene, complet...    69   2e-10   
gb:AB025617_1516399 Arabidopsis thaliana genomic DNA, chromosome...    69   2e-10   
gb:AP004464_1841421 Oryza sativa (japonica cultivar-group) genom...    69   3e-10   
gb:AY086476_1571524 Arabidopsis thaliana clone 25342 mRNA, compl...    67   8e-10   
gb:AF509868_1807072 Petunia x hybrida nam-like protein 5 (NH5) m...    66   2e-09   
gb:AE005172_891733 Arabidopsis thaliana chromosome 1, top arm co...    64   8e-09   
gb:AP003247_1826203 Oryza sativa (japonica cultivar-group) genom...    63   1e-08   
pir|T48622|T48622 hypothetical protein F18O22.280 - Arabidopsis ...    62   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP004023_1836515 Oryza sativa (japonica cultivar-group) genom...    60   7e-08   
pir|T04621|T04621 hypothetical protein F20O9.190 - Arabidopsis t...    60   7e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AC132486_1741156 Oryza sativa (japonica cultivar-group) chrom...    59   2e-07   
gb:AC130730_1740953 Oryza sativa (japonica cultivar-group) chrom...    59   2e-07   
gb:AY224433_1590635 Oryza sativa (japonica cultivar-group) isola...    59   2e-07   
gb:AB012246_1511808 Arabidopsis thaliana genomic DNA, chromosome...    59   2e-07   
gb:AE016959_1022478 Oryza sativa (japonica cultivar-group) chrom...    59   2e-07   
gb:AE016959_1021933 Oryza sativa (japonica cultivar-group) chrom...    59   2e-07   
gb:AP002743_1822689 Oryza sativa (japonica cultivar-group) genom...    57   6e-07   
gb:AE016959_1022567 Oryza sativa (japonica cultivar-group) chrom...    57   8e-07   
gb:AC124143_1740420 Oryza sativa (japonica cultivar-group) chrom...    56   1e-06   
gb:AE016959_1022102 Oryza sativa (japonica cultivar-group) chrom...    56   2e-06   
gb:AP003848_1834233 Oryza sativa (japonica cultivar-group) genom...    55   3e-06   
gb:AB013392_1512099 Arabidopsis thaliana genomic DNA, chromosome...    55   3e-06   
gb:AE005172_889370 Arabidopsis thaliana chromosome 1, top arm co...    55   3e-06   
gb:AP005172_1848748 Oryza sativa (japonica cultivar-group) genom...    55   4e-06   
gb:AP003223_1825547 Oryza sativa (japonica cultivar-group) genom...    55   4e-06   
gb:AE005173_894070 Arabidopsis thaliana chromosome 1, bottom arm...    54   7e-06   
gb:AP003374_1828708 Oryza sativa (japonica cultivar-group) genom...    54   9e-06   
gb:ATAC009325_1542891 Arabidopsis thaliana chromosome III BAC F4...    54   9e-06   
gb:AE016959_1022564 Oryza sativa (japonica cultivar-group) chrom...    53   1e-05   
pir|T00909|T00909 hypothetical protein F21B7.23 - Arabidopsis th...    52   2e-05   
pir|T49053|T49053 hypothetical protein T5P19.170 - Arabidopsis t...    52   2e-05   
pir|T02285|T02285 hypothetical protein T13D8.22 - Arabidopsis th...    52   2e-05   
gb:AP004379_1841007 Oryza sativa (japonica cultivar-group) genom...    52   3e-05   
gb:AP003848_1834240 Oryza sativa (japonica cultivar-group) genom...    52   3e-05   
gb:AB010072_1510925 Arabidopsis thaliana genomic DNA, chromosome...    52   3e-05   
gb:AP003754_1832918 Oryza sativa (japonica cultivar-group) genom...    51   4e-05   
gb:AC084221_1733394 Arabidopsis thaliana chromosome 1 BAC F14G11...    51   4e-05   
gb:BT010450_1640396 Arabidopsis thaliana At1g25580 mRNA, complet...    51   4e-05   
pir|C86386|C86386 hypothetical protein F2J7.1 - Arabidopsis thal...    51   4e-05   
pir|T13434|T13434 hypothetical protein T17A13.50 - Arabidopsis t...    51   4e-05   
gb:AP005641_1855286 Oryza sativa (japonica cultivar-group) genom...    50   1e-04   
pir|T02280|T02280 hypothetical protein T13D8.17 - Arabidopsis th...    50   1e-04   
gb:AC096856_1736395 Oryza sativa chromosome 3 BAC OSJNBa0075M12 ...    50   1e-04   
gb:AP005641_1855288 Oryza sativa (japonica cultivar-group) genom...    49   2e-04   
gb:AC135502_1742475 Oryza sativa chromosome 3 BAC OSJNBb0085A04 ...    48   4e-04   
gb:AE016959_1022214 Oryza sativa (japonica cultivar-group) chrom...    48   5e-04   
gb:AC134346_1741763 Oryza sativa (japonica cultivar-group) chrom...    47   6e-04   
gb:AP005839_1858839 Oryza sativa (japonica cultivar-group) genom...    47   8e-04   
gb:AB012243_1511747 Arabidopsis thaliana genomic DNA, chromosome...    46   0.001   
pir|T02281|T02281 hypothetical protein T13D8.18 - Arabidopsis th...    46   0.002   
gb:U89959_1726487 Arabidopsis thaliana BAC T7I23, complete seque...    45   0.004   
pir|T02284|T02284 hypothetical protein T13D8.21 - Arabidopsis th...    44   0.007   
pir|T49057|T49057 hypothetical protein T5P19.210 - Arabidopsis t...    43   0.015   
pir|A86324|A86324 protein F14D16.19 [imported] - Arabidopsis tha...    43   0.015   
pir|T02288|T02288 hypothetical protein T13D8.25 - Arabidopsis th...    42   0.020   
gb:AC135502_1742470 Oryza sativa chromosome 3 BAC OSJNBb0085A04 ...    42   0.034   
gb:AP003687_1832092 Oryza sativa (japonica cultivar-group) genom...    39   0.17    
gb:ATAC022287_1543756 Arabidopsis thaliana chromosome III BAC T2...    39   0.17    
gb:AP004759_1844562 Oryza sativa (japonica cultivar-group) genom...    37   0.65    
gb:AF319771_1785779 Brassica napus CUC2-like protein gene, parti...    37   0.85    
pir|T02276|T02276 hypothetical protein T13D8.13 - Arabidopsis th...    36   1.9     
gb:AX027394_1457039 Sequence 5 from Patent WO0036124.                  35   2.5     
gb:AF066072_1237812 Dictyostelium discoideum SP85 (pspB) gene, p...    35   2.5     
pir|B86411|B86411 protein F3M18.4 [imported] - Arabidopsis thali...    35   2.5     
gb:OSJN00232_1697130 Oryza sativa genomic DNA, chromosome 4, BAC...    35   3.2     
pir|T28666|T28666 protein kinase C-related kinase PRKSD - Suberi...    35   3.2     
gb:AF435807_2255344 Human calicivirus NLV/C59/99 capsid protein ...    35   4.2     
gb:AB078335_2167205 Norwalk-like virus gene for capsid protein, ...    35   4.2     
gb:AB071126_1871192 Macaca fascicularis testis cDNA clone:QtsA-1...    35   4.2     
gb:AC117075_1207757 Dictyostelium discoideum chromosome 2 map 52...    35   4.2     
gb:AP003249_1826264 Oryza sativa (japonica cultivar-group) genom...    34   5.5     
gb:CR380959_1653785 Candida glabrata strain CBS138 chromosome M ...    34   5.5     
gb:AF107264_479643 Rhizobium etli glutamate synthase large subun...    34   5.5     
gb:BC078578_2561115 Xenopus laevis MGC85488 protein, mRNA (cDNA ...    34   7.2     
gb:OYE510224_2445172 Onion yellow dwarf virus partial gene for p...    34   7.2     
gb:AE014296_1135939 Drosophila melanogaster chromosome 3L, compl...    34   7.2     
gb:AP002481_1822158 Oryza sativa (japonica cultivar-group) genom...    33   9.4     
gb:AC130603_1740784 Oryza sativa (japonica cultivar-group) chrom...    33   9.4     


>gb:AY101603_1577657 Petunia x hybrida nam-like protein 1 (Nh1) mRNA,
            Nh1-R27 allele, complete cds.
          Length = 585

 Score =  386 bits (992), Expect = e-106
 Identities = 208/343 (60%), Positives = 241/343 (70%), Gaps = 23/343 (6%)
 Frame = +1

Query: 298  MAVLKVERPTG---------LPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIR 450
            MAVL  E P           +PPL+SLPVGYRFRPTDEELV+HYL++KI G++ EVSVIR
Sbjct: 1    MAVLPGENPIAVHNNKEMGKIPPLNSLPVGYRFRPTDEELVNHYLRLKINGADNEVSVIR 60

Query: 451  EVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS 630
            EVDICK EPWDLP  S VES+DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDR I 
Sbjct: 61   EVDICKLEPWDLPIWSVVESNDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIV 120

Query: 631  SRKGAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE 810
            ++KGAK+GMKKTLVYY+GRAPEGKRTHWVIHEYR T+   DGTH GQ  F+LCRLFRK +
Sbjct: 121  TKKGAKIGMKKTLVYYIGRAPEGKRTHWVIHEYRATDKSLDGTHPGQGAFLLCRLFRKND 180

Query: 811  LKLDEGAEISNSDEVDPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSS--- 981
            LK DE  E SN D+ +    + T  K+P +DE SE  TPL     +  QPL     S   
Sbjct: 181  LKQDEHVESSNLDDAE---QNATAAKSPTDDELSEAATPL-----VAGQPLGDSDKSYAA 232

Query: 982  ----EETPGVHFPIDSNSNSCIADTTEDQVLDITSNPADPDLD-ALKFFIDPSTGP---- 1134
                 E  G   P++S+SNSCIAD TEDQ++DITS P D +L+ AL  F D S+ P    
Sbjct: 233  KFPKGEPYGKQLPLESHSNSCIADDTEDQMVDITSIPPDLELEKALGNFCDQSSQPLDWK 292

Query: 1135 IYSPTYEQMP-EFGSSYFYGDVINCISN-NNDVQFQYGTNGFD 1257
            I+SP + QM  EFGSSY    + N +S    DVQFQYGTN  D
Sbjct: 293  IFSPLHAQMQVEFGSSYLQAPMNNDMSAFQKDVQFQYGTNALD 335



>pir|T46230|T46230 NAC2-like protein - Arabidopsis
            thaliana>gb:ATT9C5_1556598 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T9C5.>gb:AY059734_1564592
            Arabidopsis thaliana putative NAC2 protein (At3g49530)
            mRNA, complete cds.>gb:BT000978_1635233 Arabidopsis
            thaliana clone U10792 putative NAC2 protein (At3g49530)
            mRNA, complete cds.
          Length = 469

 Score =  260 bits (664), Expect = 5e-68
 Identities = 149/313 (47%), Positives = 198/313 (63%), Gaps = 7/313 (2%)
 Frame = +1

Query: 340  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN 519
            + SLPVG RFRPTDEEL+ +YL+ KI G + +V  IRE+DICK EPWDLPD S +++ D+
Sbjct: 10   MDSLPVGLRFRPTDEELIRYYLRRKINGHDDDVKAIREIDICKWEPWDLPDFSVIKTKDS 69

Query: 520  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
            EW +FCP DRKY +G R NRAT  GYWKATGKDR I S K   +G+K+TLV++ GRAP G
Sbjct: 70   EWLYFCPLDRKYPSGSRQNRATVAGYWKATGKDRKIKSGKTNIIGVKRTLVFHAGRAPRG 129

Query: 700  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEV-DPIVSSP 876
             RT+W+IHEYR TE+   GT+ GQ+PFV+C+LF+K EL L  G E S SDEV +P VSSP
Sbjct: 130  TRTNWIIHEYRATEDDLSGTNPGQSPFVICKLFKKEELVL--GEEDSKSDEVEEPAVSSP 187

Query: 877  TVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTEDQ 1056
            TV  T +E  +      ++K+  +K   +   +SS    G     DS+S++C   TT   
Sbjct: 188  TVEVTKSEVSE------VIKTEDVKRHDI--AESSLVISG-----DSHSDACDEATT--- 231

Query: 1057 VLDITSNPADPDLDALKFFIDPSTGPIYSPTYEQM-PEFGSSY--FYGDVINCISNNND- 1224
              ++      P+L++L F        ++SP + Q+  E GSSY  F     N   NNN+ 
Sbjct: 232  -AELVDFKWYPELESLDF-------TLFSPLHSQVQSELGSSYNTFQPGSSNFSGNNNNS 283

Query: 1225 --VQFQYGTNGFD 1257
              +Q QYGTN  D
Sbjct: 284  FQIQTQYGTNEVD 296



>gb:AB010068_1510841 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K18P6.>gb:BT002012_1635615 Arabidopsis thaliana
            NAC2-like protein (At5g24590) mRNA, complete
            cds.>gb:BT009683_1640144 Arabidopsis thaliana At5g24590
            mRNA, complete cds.>gb:AF281062_1782908 Arabidopsis
            thaliana TIP mRNA, complete cds.
          Length = 451

 Score =  253 bits (645), Expect = 8e-66
 Identities = 149/314 (47%), Positives = 197/314 (62%), Gaps = 8/314 (2%)
 Frame = +1

Query: 340  LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN 519
            L SLPVG+RF PTDEELV +YL++KI G + +V VIRE+DICK EPWDLPD S V++ D+
Sbjct: 10   LASLPVGFRFSPTDEELVRYYLRLKINGHDNDVRVIREIDICKWEPWDLPDFSVVKTTDS 69

Query: 520  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
            EW FFCP DRKY +G R+NRAT  GYWKATGKDR I S K   +G+K+TLV+Y GRAP+G
Sbjct: 70   EWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGKTKIIGVKRTLVFYTGRAPKG 129

Query: 700  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGA---EISNSDEVDPIVS 870
             RT W++HEYR TE   DGT +GQ PFV+C+LF+K ++    GA   E S S EV+P VS
Sbjct: 130  TRTCWIMHEYRATEKDLDGTKSGQNPFVVCKLFKKQDIV--NGAAEPEESKSCEVEPAVS 187

Query: 871  SPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTE 1050
            SPTVV    E E SE      K+   +T P    +SS   P          + C +  + 
Sbjct: 188  SPTVVD---EVEMSEVSPVFPKTE--ETNPCDVAESSLVIP----------SECRSGYS- 231

Query: 1051 DQVLDITSNPADPDLDALKFFIDPSTGPIYSPTYEQM-PEFGSSY--FYGDVINCISNNN 1221
              V ++T+   D D+D L  F++  +  ++SP + Q+  E GSS+     +      N+N
Sbjct: 232  --VPEVTTTGLD-DIDWLS-FMEFDSPKLFSPLHSQVQSELGSSFNGLQSESSELFKNHN 287

Query: 1222 D--VQFQYGTNGFD 1257
            +  +Q QYGTN  D
Sbjct: 288  EDYIQTQYGTNDAD 301



>pir|T04663|T04663 hypothetical protein F8D20.90 - Arabidopsis
           thaliana>gb:ATCHRIV83_1547518 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 83.>gb:ATF8D20_1551117
           Arabidopsis thaliana DNA chromosome 4, BAC clone F8D20
           (ESSAII project).
          Length = 534

 Score =  236 bits (601), Expect = 1e-60
 Identities = 111/201 (55%), Positives = 146/201 (72%), Gaps = 5/201 (2%)
 Frame = +1

Query: 328 GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE 507
           G   + SLP+G+RFRPTDEELV+HYL++KI G  ++V VI ++D+CK EPWDLP +S ++
Sbjct: 2   GAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVIK 61

Query: 508 SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR 687
           + D EWFFFCP+DRKY NG R NRAT+ GYWKATGKDR+I S+K   +GMKKTLV+Y GR
Sbjct: 62  TDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKK-TLIGMKKTLVFYRGR 120

Query: 688 APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE-----LKLDEGAEISNSDE 852
           AP+G+RT+W++HEYR T    DGT  GQ+P+VLCRLF K +     +K DE A  +++  
Sbjct: 121 APKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKPDDRVNGVKSDEAAFTASNKY 180

Query: 853 VDPIVSSPTVVKTPAEDEQSE 915
                SS  V +TP+ D   E
Sbjct: 181 SPDDTSSDLVQETPSSDAAVE 201



>gb:AC006424_1534195 Arabidopsis thaliana chromosome I BAC F9L11
           genomic sequence, complete sequence.
          Length = 577

 Score =  233 bits (594), Expect = 6e-60
 Identities = 104/191 (54%), Positives = 143/191 (74%)
 Frame = +1

Query: 340 LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN 519
           + +LP+G+RFRPTDEEL++HYL++KI G + EV VI E+D+CK EPWDLP +S +++ D 
Sbjct: 10  MEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ 69

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           EWFFFCP+DRKY +G R NRAT+ GYWKATGKDRTI S+K   +GMKKTLV+Y GRAP G
Sbjct: 70  EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK-MIIGMKKTLVFYRGRAPRG 128

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPT 879
           +RT+W++HEYR T+ + DGT  GQ P+VLCRLF K      +  + ++ +E++ +  +PT
Sbjct: 129 ERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHKP----SDSCDPAHCEEIEKVNFTPT 184

Query: 880 VVKTPAEDEQS 912
                + D+ S
Sbjct: 185 TTTRCSPDDTS 195



>gb:AP004698_1843605 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0498E12.
          Length = 729

 Score =  217 bits (553), Expect = 4e-55
 Identities = 115/204 (56%), Positives = 140/204 (68%), Gaps = 7/204 (3%)
 Frame = +1

Query: 340 LHSLPVGYRFRPTDEELVDHYLKMKITGS-EAEVSVIREVDICKHEPWDLPDMSFVESHD 516
           L  LP+G+RF PTDEELV HYLK KITG   +E  VI E+D+CK EPWDLPD S + S D
Sbjct: 6   LKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSLIRSDD 65

Query: 517 NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLG 684
            EWFFF PKDRKY NG R NRATE GYWKATGKDR I S+   K    +GMKKTLV++ G
Sbjct: 66  PEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTLVFHRG 125

Query: 685 RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPI 864
           RAP+G+RT W++HEYRTTE +F+     Q  +VL RLFRK E K+    E  + DEVD  
Sbjct: 126 RAPKGERTGWIMHEYRTTEPEFES--GEQGGYVLYRLFRKQEEKI----ERPSPDEVDRS 179

Query: 865 VSSPTVVKTPAEDEQ--SEGGTPL 930
             SPT  ++  ++ +   +G TPL
Sbjct: 180 GYSPTPSRSTPDNMEPIEDGNTPL 203



>gb:AC118980_1739573 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1263H11, complete sequence.
          Length = 650

 Score =  197 bits (502), Expect = 3e-49
 Identities = 109/263 (41%), Positives = 147/263 (55%), Gaps = 5/263 (1%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            SLP G+RF PTDEEL+ +YLK KI G + E+ +I EVD+ K EPWDLP+ SF+ S D EW
Sbjct: 5    SLPPGFRFHPTDEELIIYYLKRKINGRQIELEIIPEVDLYKCEPWDLPEKSFLPSKDLEW 64

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            +FF P+DRKY NG R NRAT+ GYWKATGKDR ++S++ A VGMKKTLVYY GRAP G R
Sbjct: 65   YFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNSQRRA-VGMKKTLVYYRGRAPHGSR 123

Query: 706  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE--LKLDEGAEISNSDEVDPIVSSPT 879
            T WV+HEYR  E + +     Q  + LCR+F+K     K+ E   + +     P   + +
Sbjct: 124  TDWVMHEYRLDERECETDTGLQDAYALCRVFKKTAPGPKIIEHYGVVHHHVEQPQWMTSS 183

Query: 880  VVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTED-- 1053
            + ++P  D   +G     +S        TP  S     G+           +   +ED  
Sbjct: 184  IDRSPTLDVSCDGRGDDFESSSFSFPTETPMDSMHGGFGMQMSAPHEDGKWMQFLSEDAF 243

Query: 1054 -QVLDITSNPADPDLDALKFFID 1119
                   +NP   +   L   +D
Sbjct: 244  NATNPFLTNPVSANFSCLPSKVD 266



>gb:AB005238_1509431 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MKP11.
          Length = 476

 Score =  194 bits (492), Expect = 4e-48
 Identities = 93/158 (58%), Positives = 115/158 (72%), Gaps = 1/158 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+ +YLK KI G E E+ +I EVD+ K EPWDLP  S + S D EW
Sbjct: 5   SLPPGFRFHPTDEELITYYLKRKINGQEIELEIIPEVDLYKCEPWDLPGKSLIPSKDQEW 64

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           FFF P+DRKY NG R NRAT+ GYWKATGKDR +S R  A +G KKTLVYY GRAP G R
Sbjct: 65  FFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVSWRDRA-IGTKKTLVYYRGRAPHGIR 123

Query: 706 THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRKVELK 816
           T WV+HEYR  E++ + +  G Q  + LCR+F+K+ ++
Sbjct: 124 TGWVMHEYRLDESECEPSAFGMQDAYALCRVFKKIVIE 161



>gb:AB026646_1517181 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIG5.
          Length = 246

 Score =  193 bits (491), Expect = 5e-48
 Identities = 93/161 (57%), Positives = 115/161 (71%)
 Frame = +1

Query: 322 PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF 501
           P GLPP      G+RF PTDEELV++YLK KI G E E+ +I EVD+ K EPWDL + SF
Sbjct: 3   PVGLPP------GFRFHPTDEELVNYYLKRKINGQEIELDIIPEVDLYKCEPWDLAEKSF 56

Query: 502 VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL 681
           + S D EW+FF P+DRKY NG R NRAT  GYWK+TGKDR ++S+  A +GMKKTLVYY 
Sbjct: 57  LPSRDPEWYFFGPRDRKYPNGFRTNRATRGGYWKSTGKDRRVTSQSRA-IGMKKTLVYYK 115

Query: 682 GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           GRAP+G RT WV+HEYR  +   D   + Q  + LCR+F+K
Sbjct: 116 GRAPQGIRTDWVMHEYRLDDKDCDDPSSLQDSYALCRVFKK 156



>pir|D96683|D96683 hypothetical protein F12P19.8 [imported] -
            Arabidopsis thaliana>gb:AE005173_894240 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:F12P19_1677372 Sequence of BAC F12P19 from
            Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 631

 Score =  191 bits (486), Expect = 2e-47
 Identities = 105/228 (46%), Positives = 133/228 (58%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            S+P G+RF PTDEELV +YLK KI G   E+ +I E+D+ K EPWDLP  S + S D EW
Sbjct: 5    SMPPGFRFHPTDEELVIYYLKRKINGRTIELEIIPEIDLYKCEPWDLPGKSLLPSKDLEW 64

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            FFF P+DRKY NG R NRAT+ GYWKATGKDR ++S     VG KKTLVYY GRAP G R
Sbjct: 65   FFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVTSH-SRMVGTKKTLVYYRGRAPHGSR 123

Query: 706  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVV 885
            T WV+HEYR  E + D     Q  + LCR+F+K  L          +++++         
Sbjct: 124  TDWVMHEYRLEEQECDSKSGIQDAYALCRVFKKSAL----------ANKIEEQHHGTKKN 173

Query: 886  KTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNS 1029
            K     EQS   T L   G  +    +    S ET G+   + +NS+S
Sbjct: 174  KGTTNSEQSTSSTCLYSDGMYENLENSGYPVSPETGGL-TQLGNNSSS 220



>gb:AK176278_1818266 Arabidopsis thaliana mRNA for hypothetical
            protein, complete cds, clone: RAFL23-20-J17.
          Length = 301

 Score =  191 bits (484), Expect = 4e-47
 Identities = 110/245 (44%), Positives = 149/245 (60%), Gaps = 5/245 (2%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            SLP G+RF PTDEELV +YL  K+ G   E+ +I EVD+ K EPWDLP+ SF+  +D EW
Sbjct: 5    SLPPGFRFHPTDEELVAYYLDRKVNGQAIELEIIPEVDLYKCEPWDLPEKSFLPGNDMEW 64

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            +F+  +D+KY NG R NRAT  GYWKATGKDRT+ S+K  K+GMKKTLVYY GRAP G R
Sbjct: 65   YFYSTRDKKYPNGSRTNRATRAGYWKATGKDRTVESKK-MKMGMKKTLVYYRGRAPHGLR 123

Query: 706  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK-VELKLDEGAEISNSDEVDPIVSSPTV 882
            T+WV+HEYR T      + + +  + LCR+F+K +++   +G E    +E      S +V
Sbjct: 124  TNWVMHEYRLTHAP---SSSLKESYALCRVFKKNIQIPKRKGEEEEAEEE------STSV 174

Query: 883  VKTPAEDEQSEGGTPLMKSGHIKTQPL----TPGQSSEETPGVHFPIDSNSNSCIADTTE 1050
             K   E+E+ E         +I+ + L        SSE T GV    ++NS+S  A    
Sbjct: 175  GK--EEEEEKEKKWRKCDGNYIEDESLKRASAETSSSELTQGVLLD-EANSSSIFALHFS 231

Query: 1051 DQVLD 1065
              +LD
Sbjct: 232  SSLLD 236



>pir|H96584|H96584 hypothetical protein F20D21.15 [imported] -
            Arabidopsis thaliana>gb:AE005173_893331 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC005287_1532387 Arabidopsis thaliana
            chromosome I BAC F20D21 genomic sequence, complete
            sequence.>gb:BT010446_1640392 Arabidopsis thaliana
            At1g54330 mRNA, complete cds.
          Length = 298

 Score =  191 bits (484), Expect = 4e-47
 Identities = 110/245 (44%), Positives = 149/245 (60%), Gaps = 5/245 (2%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            SLP G+RF PTDEELV +YL  K+ G   E+ +I EVD+ K EPWDLP+ SF+  +D EW
Sbjct: 2    SLPPGFRFHPTDEELVAYYLDRKVNGQAIELEIIPEVDLYKCEPWDLPEKSFLPGNDMEW 61

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            +F+  +D+KY NG R NRAT  GYWKATGKDRT+ S+K  K+GMKKTLVYY GRAP G R
Sbjct: 62   YFYSTRDKKYPNGSRTNRATRAGYWKATGKDRTVESKK-MKMGMKKTLVYYRGRAPHGLR 120

Query: 706  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK-VELKLDEGAEISNSDEVDPIVSSPTV 882
            T+WV+HEYR T      + + +  + LCR+F+K +++   +G E    +E      S +V
Sbjct: 121  TNWVMHEYRLTHAP---SSSLKESYALCRVFKKNIQIPKRKGEEEEAEEE------STSV 171

Query: 883  VKTPAEDEQSEGGTPLMKSGHIKTQPL----TPGQSSEETPGVHFPIDSNSNSCIADTTE 1050
             K   E+E+ E         +I+ + L        SSE T GV    ++NS+S  A    
Sbjct: 172  GK--EEEEEKEKKWRKCDGNYIEDESLKRASAETSSSELTQGVLLD-EANSSSIFALHFS 228

Query: 1051 DQVLD 1065
              +LD
Sbjct: 229  SSLLD 233



>gb:AF509874_1807078 Petunia x hybrida nam-like protein 11 (NH11)
           mRNA, complete cds.
          Length = 337

 Score =  187 bits (475), Expect = 4e-46
 Identities = 87/158 (55%), Positives = 110/158 (69%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEELV +YLK K  G E E+ VI  +D+ K +PW+LP+ SF+   D EW
Sbjct: 5   SLPPGFRFHPTDEELVGYYLKRKTDGLEIELEVIPVIDLYKFDPWELPEKSFLPKRDLEW 64

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           FFFCP+D+KY NG R NRAT+ GYWKATGKDR +       VG +KTLV+Y GRAP G R
Sbjct: 65  FFFCPRDKKYPNGSRTNRATKSGYWKATGKDRKVVCHP-TVVGYRKTLVFYRGRAPLGDR 123

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL 819
           T WV+HEYR  ++   GT   Q PF LCR+ ++ ++ L
Sbjct: 124 TDWVMHEYRLCDDVSQGTPIFQGPFALCRVIKRNDVSL 161



>gb:AF509871_1807075 Petunia x hybrida nam-like protein 8 (NH8)
           mRNA, complete cds.
          Length = 392

 Score =  186 bits (473), Expect = 7e-46
 Identities = 98/211 (46%), Positives = 126/211 (59%), Gaps = 6/211 (2%)
 Frame = +1

Query: 304 VLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWD 483
           V+ V  P   P   SL  G+RF PTDEELV +YL+ KI G       + E+D+ K EPW+
Sbjct: 8   VVTVATPAPAPAPTSLAPGFRFHPTDEELVRYYLRRKIIGKPFRFQAVTEIDVYKSEPWE 67

Query: 484 LPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKK 663
           L   S +++ D EW+FF P D+KY NG RLNRAT +GYWKATGKDR +   K   +GMKK
Sbjct: 68  LAGYSSLKNRDLEWYFFSPVDKKYGNGSRLNRATGQGYWKATGKDRHV-RHKSQDIGMKK 126

Query: 664 TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISN 843
           TLV++ GRAP+GKRT+WV+HEYR T+ + +     Q  FVLCR+F K       G    N
Sbjct: 127 TLVFHSGRAPDGKRTNWVMHEYRLTDEELEKAGIVQDSFVLCRIFHK------SGLGPPN 180

Query: 844 SDEVDPIV------SSPTVVKTPAEDEQSEG 918
           SD   P V       +  V    AED+ + G
Sbjct: 181 SDRYAPFVEEEWDDDAAVVPGEEAEDDVANG 211



>gb:AB028605_1517871 Arabidopsis thaliana genomic DNA, chromosome 5,
            BAC clone:F10E10.>gb:BT020305_1642700 Arabidopsis
            thaliana At5g46590 gene, complete
            cds.>gb:BT020555_1642949 Arabidopsis thaliana At5g46590
            gene, complete cds.
          Length = 292

 Score =  186 bits (472), Expect = 9e-46
 Identities = 107/301 (35%), Positives = 158/301 (52%), Gaps = 1/301 (0%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            LP G+RF PTDEEL+++YLK K+ G E E+ VI  +D+   +PW+LPD SF+ + D EW+
Sbjct: 6    LPPGFRFHPTDEELIEYYLKRKVEGLEIELEVIPVIDLYSFDPWELPDKSFLPNRDMEWY 65

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
            FFC +D+KY NG R NR T+ GYWKATGKDR I+SR  + +G +KTLV+Y GRAP G R+
Sbjct: 66   FFCSRDKKYPNGFRTNRGTKAGYWKATGKDRKITSRSSSIIGYRKTLVFYKGRAPLGDRS 125

Query: 709  HWVIHEYR-TTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVV 885
            +W++HEYR   ++   G+   +  FVLCR+  K E+K                 ++  + 
Sbjct: 126  NWIMHEYRLCDDDTSQGSQNLKGAFVLCRVAMKNEIK-----------------TNTKIR 168

Query: 886  KTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTEDQVLD 1065
            K P+E     G     +S  + ++  +P  S +ET   H                     
Sbjct: 169  KIPSEQTIGSG-----ESSGLSSRVTSP--SRDETMPFH--------------------- 200

Query: 1066 ITSNPADPDLDALKFFIDPSTGPIYSPTYEQMPEFGSSYFYGDVINCISNNNDVQFQYGT 1245
              +NP   + D+   +I P      S  Y Q+ +  S  F  D    I  N +++F   T
Sbjct: 201  SFANPVSTETDSSNIWISPEFILDSSKDYPQIQDVASQCFQQDFDFPIIGNQNMEFPAST 260

Query: 1246 N 1248
            +
Sbjct: 261  S 261



>gb:AF509867_1807071 Petunia x hybrida nam-like protein 4 (NH4) mRNA,
            complete cds.
          Length = 406

 Score =  182 bits (463), Expect = 1e-44
 Identities = 110/300 (36%), Positives = 155/300 (51%), Gaps = 21/300 (7%)
 Frame = +1

Query: 328  GLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE 507
            G+ P  SL  G+RF PTDEELV +YL+ K          + E+D+ K EPW+L + + ++
Sbjct: 28   GVTPPTSLAPGFRFHPTDEELVRYYLRRKACAKPFRFQAVSEIDVYKSEPWELAEFASLK 87

Query: 508  SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR 687
            + D EW+FF P DRKY NG RLNRAT +GYWKATGKDR +   K   +GMKKTLV++ GR
Sbjct: 88   TRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRPV-RHKSQTIGMKKTLVFHSGR 146

Query: 688  APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIV 867
            AP+GKRT+WV+HEYR  + + +     Q  FVLCR+F+K       G    N D   P +
Sbjct: 147  APDGKRTNWVMHEYRLADEELERAGVVQIAFVLCRIFQK------SGLGPPNGDRYAPFI 200

Query: 868  SSPTVVKTP-------AEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSN 1026
                   TP       AED+ + G    +    +    L   ++  ++  +  P  +   
Sbjct: 201  EEEWDDDTPLLIPGGEAEDDVANGDEARVDGNDLDQDALQKAKAPCQSENLLEP-RTIPF 259

Query: 1027 SCIADTTEDQVL-----------DITSNPADPDLDALKFFIDPSTGPI---YSPTYEQMP 1164
             C  + +ED  L           D +S+ A+   D+     DP T  +   YSPT    P
Sbjct: 260  VCKRERSEDPELSLAQSKRSKHDDPSSSHANDSKDSTTSQQDPPTTMMTTNYSPTLLAFP 319



>gb:ATAC012328_1543419 Arabidopsis thaliana chromosome III BAC
           T17B22 genomic sequence, complete sequence.
          Length = 479

 Score =  182 bits (462), Expect = 1e-44
 Identities = 91/158 (57%), Positives = 111/158 (70%), Gaps = 1/158 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+ +YLK KI G E E+ VI EVD+ K EPWDLP        D EW
Sbjct: 5   SLPPGFRFHPTDEELITYYLKRKINGLEIELEVIAEVDLYKCEPWDLP--------DQEW 56

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NRAT+ GYWKATGKDR +S R  A +G KKTLVYY GRAP G R
Sbjct: 57  YFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVSWRDRA-IGTKKTLVYYRGRAPHGIR 115

Query: 706 THWVIHEYRTTENKFDGTHAG-QAPFVLCRLFRKVELK 816
           T WV+HEYR  E + + +  G Q  + LCR+F+K+ ++
Sbjct: 116 TGWVMHEYRLDETECEPSAYGMQDAYALCRVFKKIVIE 153



>pir|T05084|T05084 hypothetical protein T6K21.160 - Arabidopsis
           thaliana>gb:ATCHRIV47_1545599 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 47.>gb:ATT6K21_1556387
           Arabidopsis thaliana DNA chromosome 4, BAC clone T6K21
           (ESSA project).
          Length = 262

 Score =  181 bits (460), Expect = 2e-44
 Identities = 92/195 (47%), Positives = 124/195 (63%), Gaps = 6/195 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ +YL  KI G E E+ VI  +D+ K +PW+LP  SF+ + D EWF
Sbjct: 6   LPPGFRFHPTDEELIGYYLSRKIEGLEIELEVIPVIDLYKFDPWELPGKSFLPNRDLEWF 65

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKV-GMKKTLVYYLGRAPEGKR 705
           FFCP+D+KY NG R NRAT+ GYWKATGKDR I+ +    + G +KTLV+Y GRAP G R
Sbjct: 66  FFCPRDKKYANGSRTNRATKAGYWKATGKDRKITCKSSHVIAGYRKTLVFYEGRAPLGDR 125

Query: 706 THWVIHEYRTTENKFDGTHAGQAP-----FVLCRLFRKVELKLDEGAEISNSDEVDPIVS 870
           T+W +HEYR  +      H+ ++P     F LCR+ +K ELK      + N +E D    
Sbjct: 126 TNWFMHEYRLCD---IDDHSQKSPNFKGAFALCRVVKKNELK-KNSKSLKNKNEQDIGSC 181

Query: 871 SPTVVKTPAEDEQSE 915
             ++  +P  DE S+
Sbjct: 182 YSSLATSPCRDEASQ 196



>gb:AE016959_1023922 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC077693_1541463
           Oryza sativa chromosome 10 BAC OSJNBa0095C07 genomic
           sequence, complete sequence.>gb:AE017121_1753741 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           75 of 77 of the complete sequence.
          Length = 326

 Score =  179 bits (455), Expect = 8e-44
 Identities = 89/191 (46%), Positives = 119/191 (62%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTD+ELV +YLK K+   + E+ VI  +D+ K EPW+LP+ SF+   D EW
Sbjct: 2   TLPPGFRFHPTDDELVGYYLKRKVDSLKIELEVIPVIDLYKFEPWELPEKSFLPKRDLEW 61

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           FFFCP+DRKY NG R NRAT  GYWKATGKDR I+   G   G++KTLV+Y GRAP G+R
Sbjct: 62  FFFCPRDRKYPNGSRTNRATSTGYWKATGKDRKIAC-AGEVFGLRKTLVFYKGRAPGGER 120

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVV 885
           T WV+HEYR  ++   G       + LCR+ ++ E  L      + +  +   VSS + +
Sbjct: 121 TDWVMHEYRLCQDLAHGVSNFIGAYALCRVIKRHEAGLHGEPPAAKAKGMISKVSSSSSL 180

Query: 886 KTPAEDEQSEG 918
            T      S G
Sbjct: 181 VTVEHQLSSRG 191



>gb:AY051003_1562481 Arabidopsis thaliana unknown protein
           (At3g10500) mRNA, complete cds.>gb:AY079345_1568235
           Arabidopsis thaliana unknown protein (At3g10500) mRNA,
           complete cds.
          Length = 549

 Score =  178 bits (452), Expect = 2e-43
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SL  G+RF PTDEELV +YLK KI     +   I   D+ K EPWDLPD S ++S D EW
Sbjct: 8   SLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAISVTDVYKSEPWDLPDKSRLKSRDLEW 67

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK 702
           +FF   D+KY+NG + NRATE GYWK TGKDR I +  G+K VGMKKTLVY+ GRAP G+
Sbjct: 68  YFFSMLDKKYRNGSKTNRATEMGYWKTTGKDREILN--GSKVVGMKKTLVYHKGRAPRGE 125

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           RT+WV+HEYR  +   D T   Q  FVLCR+F+K
Sbjct: 126 RTNWVMHEYRLVDQDLDKTGVHQDAFVLCRIFQK 159



>gb:AC011560_1537249 Arabidopsis thaliana chromosome 3 BAC F13M14
           genomic sequence, complete
           sequence.>gb:ATAC013428_1543491 Arabidopsis thaliana
           chromosome III BAC F18K10 genomic sequence, complete
           sequence.
          Length = 558

 Score =  178 bits (452), Expect = 2e-43
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SL  G+RF PTDEELV +YLK KI     +   I   D+ K EPWDLPD S ++S D EW
Sbjct: 8   SLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAISVTDVYKSEPWDLPDKSRLKSRDLEW 67

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK 702
           +FF   D+KY+NG + NRATE GYWK TGKDR I +  G+K VGMKKTLVY+ GRAP G+
Sbjct: 68  YFFSMLDKKYRNGSKTNRATEMGYWKTTGKDREILN--GSKVVGMKKTLVYHKGRAPRGE 125

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           RT+WV+HEYR  +   D T   Q  FVLCR+F+K
Sbjct: 126 RTNWVMHEYRLVDQDLDKTGVHQDAFVLCRIFQK 159



>gb:AB028187_1517823 Oryza sativa mRNA for OsNAC8 protein, complete
            cds.>gb:AP001366_1821201 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0469E09.>gb:AP002817_1822859 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0699D11.
          Length = 489

 Score =  177 bits (448), Expect = 5e-43
 Identities = 103/276 (37%), Positives = 147/276 (53%), Gaps = 6/276 (2%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            LP G+ F P D EL+ HYLK KI G + E  +I EVDI KHEPWDLP    V + DN+W 
Sbjct: 9    LPPGFGFHPKDTELISHYLKKKIHGQKIEYEIIPEVDIYKHEPWDLPAKCDVPTQDNKWH 68

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
            FF  +DRKY NG R NRAT  GYWK+TGKDR I   K   +G KKTLV++ GR P G+RT
Sbjct: 69   FFAARDRKYPNGSRSNRATVAGYWKSTGKDRAIKMGK-QTIGTKKTLVFHEGRPPTGRRT 127

Query: 709  HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSD-EVDPIVSSPTVV 885
             W++HEY   E +       +  +VLCR+ ++ +     G E+ NSD   +P  + P+V+
Sbjct: 128  EWIMHEYYIDERECQACPDMKDAYVLCRITKRNDWIPGNGNELDNSDPHPEPYDAPPSVI 187

Query: 886  KTPAEDEQSEGGTPLMKSGHIKTQPLTPGQ-----SSEETPGVHFPIDSNSNSCIADTTE 1050
             T   ++ +    P++    ++  P+T  +     +S  T  +  P D  +     +   
Sbjct: 188  ST---EQLNPAAEPVV---GVEAAPVTVAEPDGVTTSAITANIPSPSDDINLDDWLNELF 241

Query: 1051 DQVLDITSNPADPDLDALKFFIDPSTGPIYSPTYEQ 1158
            D   D   + A  DL   +  ++ S     +P  EQ
Sbjct: 242  DPFFDPEQSLASADLSPDEQNVESSNVGALAPKVEQ 277



>gb:AY087802_1572829 Arabidopsis thaliana clone 38529 mRNA, complete
           sequence.
          Length = 549

 Score =  176 bits (447), Expect = 7e-43
 Identities = 87/154 (56%), Positives = 107/154 (69%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SL  G+RF PTDEELV +YLK KI     +   I   D+ K EPWDLPD S ++S D EW
Sbjct: 8   SLAPGFRFHPTDEELVRYYLKRKICNKPFKFDAISVTDVYKSEPWDLPDKSRLKSRDLEW 67

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK 702
           +FF   ++KY+NG + NRATE GYWK TGKDR I +  G+K VGMKKTLVY+ GRAP G+
Sbjct: 68  YFFSMLNKKYRNGSKTNRATEMGYWKTTGKDREILN--GSKVVGMKKTLVYHKGRAPRGE 125

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           RT+WV+HEYR  +   D T   Q  FVLCR+F+K
Sbjct: 126 RTNWVMHEYRLVDQDLDKTGVHQDAFVLCRIFQK 159



>pir|T48437|T48437 hypothetical protein T32M21.10 - Arabidopsis
           thaliana>gb:ATT32M21_1555907 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T32M21 (ESSA
           project).>gb:AY099609_1576634 Arabidopsis thaliana
           putative protein (At5g04410) mRNA, complete
           cds.>gb:AY128859_1580939 Arabidopsis thaliana putative
           protein (At5g04410) mRNA, complete cds.
          Length = 567

 Score =  176 bits (447), Expect = 7e-43
 Identities = 93/192 (48%), Positives = 119/192 (61%), Gaps = 1/192 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SL  G+RF PTDEELV +YLK K+     +   I   DI K EPWDLPD S ++S D EW
Sbjct: 8   SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEW 67

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK 702
           +FF   D+KY NG + NRATE+GYWK TGKDR I  R G++ VGMKKTLVY+ GRAP G+
Sbjct: 68  YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRVVGMKKTLVYHKGRAPRGE 125

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTV 882
           RT+WV+HEYR ++         Q  +VLCR+F+K       G E   +  ++       +
Sbjct: 126 RTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNG-EQYGAPYLEEEWEEDGM 184

Query: 883 VKTPAEDEQSEG 918
              PA+D  SEG
Sbjct: 185 TYVPAQDAFSEG 196



>gb:AF509872_1807076 Petunia x hybrida nam-like protein 9 (NH9)
           mRNA, complete cds.
          Length = 462

 Score =  175 bits (443), Expect = 2e-42
 Identities = 82/152 (53%), Positives = 104/152 (68%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           L  G+RF PTDEELV +YL+ K+ G    +  I ++DI K EPWDLP MS + + D EW+
Sbjct: 10  LAPGFRFHPTDEELVRYYLRRKVCGKPLRIDAISDIDIYKVEPWDLPGMSRLNTRDLEWY 69

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF   D+KY NG R NRATE+GYWK TGKDR I   K   V MKKTLVY+ GRAP+G+RT
Sbjct: 70  FFSMLDKKYGNGSRTNRATEQGYWKTTGKDRAI-HHKSQVVAMKKTLVYHSGRAPKGQRT 128

Query: 709 HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +WV+HEY+  + +       Q  FVLCR+F+K
Sbjct: 129 NWVMHEYKLVDEELHKAGISQDAFVLCRVFQK 160



>gb:AP004587_1841948 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0543D10.>gb:AP005544_1853842 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0604E01.
          Length = 618

 Score =  174 bits (441), Expect = 3e-42
 Identities = 102/238 (42%), Positives = 136/238 (57%), Gaps = 10/238 (4%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            SL  G+RF PTDEELV +YLK K+ G   +V  I EVD+ K EPWDLP  S + S D++W
Sbjct: 20   SLAPGFRFHPTDEELVSYYLKRKVHGRPLKVDAIAEVDLYKVEPWDLPARSRLRSRDSQW 79

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG-AKVGMKKTLVYYLGRAPEGK 702
            +FF   DRK+ N  R NRAT  GYWK TGKDR +  R G   VGMKKTLV++ GRAP+G+
Sbjct: 80   YFFSRLDRKHANRARTNRATAGGYWKTTGKDREV--RNGPTTVGMKKTLVFHAGRAPKGE 137

Query: 703  RTHWVIHEYRTTENKFDG--THAGQAPFVLCRLFRKVELKLDEGAEI------SNSDEVD 858
            RT+WV+HEYR      DG  T   Q  FV+CR+F+K       GA+          +E D
Sbjct: 138  RTNWVMHEYR-----LDGQTTIPPQDSFVVCRIFQKAGPGPQNGAQYGAPFVEEEWEEDD 192

Query: 859  PIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPG-VHFPIDSNSNS 1029
              V    V +    D+Q +  +  M+ G+++   L      +   G +  P+  NSN+
Sbjct: 193  EDVGLLPVEEKDNSDDQEKEISGAMEKGYLQMSDLVQNLVDQNENGTIALPVSDNSNN 250



>gb:AP004587_1841947 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0543D10.>gb:AP005544_1853841 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0604E01.
          Length = 656

 Score =  174 bits (441), Expect = 3e-42
 Identities = 102/238 (42%), Positives = 136/238 (57%), Gaps = 10/238 (4%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            SL  G+RF PTDEELV +YLK K+ G   +V  I EVD+ K EPWDLP  S + S D++W
Sbjct: 20   SLAPGFRFHPTDEELVSYYLKRKVHGRPLKVDAIAEVDLYKVEPWDLPARSRLRSRDSQW 79

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG-AKVGMKKTLVYYLGRAPEGK 702
            +FF   DRK+ N  R NRAT  GYWK TGKDR +  R G   VGMKKTLV++ GRAP+G+
Sbjct: 80   YFFSRLDRKHANRARTNRATAGGYWKTTGKDREV--RNGPTTVGMKKTLVFHAGRAPKGE 137

Query: 703  RTHWVIHEYRTTENKFDG--THAGQAPFVLCRLFRKVELKLDEGAEI------SNSDEVD 858
            RT+WV+HEYR      DG  T   Q  FV+CR+F+K       GA+          +E D
Sbjct: 138  RTNWVMHEYR-----LDGQTTIPPQDSFVVCRIFQKAGPGPQNGAQYGAPFVEEEWEEDD 192

Query: 859  PIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPG-VHFPIDSNSNS 1029
              V    V +    D+Q +  +  M+ G+++   L      +   G +  P+  NSN+
Sbjct: 193  EDVGLLPVEEKDNSDDQEKEISGAMEKGYLQMSDLVQNLVDQNENGTIALPVSDNSNN 250



>pir|F86450|F86450 hypothetical protein F5D14.30 [imported] -
           Arabidopsis thaliana>gb:AE005172_892091 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F5D14_1678330 Sequence of BAC F5D14 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 283

 Score =  174 bits (441), Expect = 3e-42
 Identities = 89/182 (48%), Positives = 120/182 (65%), Gaps = 7/182 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV +YL  +  G E E+ +I  +D+ K +PW+LP+ SF+ + D EWF
Sbjct: 6   LPPGFRFYPTDEELVGYYLHRRNEGLEIELEIIPLMDLYKFDPWELPEKSFLPNRDMEWF 65

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTI------SSRKGAKVGMKKTLVYYLGRA 690
           FFC +DRKYQNG R+NRAT+ GYWKATGKDR I      SS   +  G +KTLV+Y+GRA
Sbjct: 66  FFCHRDRKYQNGSRINRATKSGYWKATGKDRKIVCHSSSSSSSSSITGCRKTLVFYMGRA 125

Query: 691 PEGKRTHWVIHEYRTTEN-KFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIV 867
           P G RT WV+HEYR  +N    G+   +  F LCR+ ++ E  L +  EI + +  D  +
Sbjct: 126 PFGGRTEWVMHEYRLFDNDTSQGSLNFKGDFALCRVIKRNEHTLKK-CEIISPEVSDESL 184

Query: 868 SS 873
           S+
Sbjct: 185 SN 186



>gb:AC135419_1742242 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0044P19, complete sequence.
          Length = 449

 Score =  172 bits (437), Expect = 1e-41
 Identities = 96/255 (37%), Positives = 136/255 (53%), Gaps = 10/255 (3%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            LP G+RF PTD ELV +YLK KI G +  +  I +V++ K  PWDLP  S ++S D EWF
Sbjct: 6    LPPGFRFHPTDVELVSYYLKRKIMGKKPLIQAISDVELYKFAPWDLPAQSCLQSRDLEWF 65

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
            FFCP+D+KY NG R NR+T  GYWK +GKDRTI       VG KKTL+++ G+AP+G RT
Sbjct: 66   FFCPRDKKYPNGSRTNRSTPNGYWKTSGKDRTIELNSRI-VGSKKTLIFHEGKAPKGNRT 124

Query: 709  HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEIS---NSDEVDPIVSSPT 879
             WV++EY+  +N+       +  FVLC++F+K  L    G +     N +E +       
Sbjct: 125  DWVMYEYKMEDNQLVSAGFSKDDFVLCKIFKKSGLGPRIGEQYGAPFNEEEWE----HAD 180

Query: 880  VVKTPAEDEQSEGGTPLMKSGHI-------KTQPLTPGQSSEETPGVHFPIDSNSNSCIA 1038
                P          PL+ S  +       + QP    ++ EE P  H P     + C  
Sbjct: 181  AEMFPLLPNVETSVFPLLPSSEVVNSTDDTRVQPSVAARAIEELPVQHLP-----HVCAG 235

Query: 1039 DTTEDQVLDITSNPA 1083
            + +  Q + +T   A
Sbjct: 236  NGSTYQNITVTGESA 250



>gb:AF201456_1776505 Arabidopsis thaliana NAC2 (NAC2) mRNA, complete
           cds.
          Length = 569

 Score =  172 bits (436), Expect = 1e-41
 Identities = 89/192 (46%), Positives = 119/192 (61%), Gaps = 1/192 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SL  G+RF PTDEELV +YLK K+     +   I   DI K EPWDLPD S ++S D EW
Sbjct: 8   SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEW 67

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKV-GMKKTLVYYLGRAPEGK 702
           +FF   D+KY NG + NRATE+GYWK TGKDR I  R G+++ GMKKTLVY+ GRAP G+
Sbjct: 68  YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRILGMKKTLVYHKGRAPRGE 125

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTV 882
           +T+WV+ EYR ++         Q  +VLCR+F+K    + +  E   +  ++       +
Sbjct: 126 KTNWVMQEYRLSDEDLKKAGVPQEAYVLCRIFQK-SGTVPKNGEQYGAPYLEEEWEEDGM 184

Query: 883 VKTPAEDEQSEG 918
              PA+D  SEG
Sbjct: 185 TYVPAQDAFSEG 196



>gb:AC011560_1537250 Arabidopsis thaliana chromosome 3 BAC F13M14
           genomic sequence, complete
           sequence.>gb:ATAC013428_1543490 Arabidopsis thaliana
           chromosome III BAC F18K10 genomic sequence, complete
           sequence.
          Length = 451

 Score =  172 bits (435), Expect = 2e-41
 Identities = 85/154 (55%), Positives = 106/154 (68%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SL  G+RF PTDEELV +YLK K+ G       I EVDI KHEPWDL   S +++ D EW
Sbjct: 26  SLAPGFRFHPTDEELVSYYLKRKVLGQPVRFDAIGEVDIYKHEPWDLAVFSRLKTRDQEW 85

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +F+   D+KY NG R+NRAT RGYWKATGKDR I  R    +GMKKTLV++ GRAP+G R
Sbjct: 86  YFYSALDKKYGNGARMNRATNRGYWKATGKDREI-RRDILLLGMKKTLVFHSGRAPDGLR 144

Query: 706 THWVIHEYRTTENKFD-GTHAGQAPFVLCRLFRK 804
           T+WV+HEYR  E + +   +  Q  +VLCR+F K
Sbjct: 145 TNWVMHEYRLVEYETEKNGNLVQDAYVLCRVFHK 178



>gb:AC011560_1537251 Arabidopsis thaliana chromosome 3 BAC F13M14
           genomic sequence, complete
           sequence.>gb:ATAC013428_1543489 Arabidopsis thaliana
           chromosome III BAC F18K10 genomic sequence, complete
           sequence.>gb:AY059795_1564639 Arabidopsis thaliana
           unknown protein (At3g10480) mRNA, complete
           cds.>gb:AY091262_1574469 Arabidopsis thaliana unknown
           protein (At3g10480) mRNA, complete cds.
          Length = 447

 Score =  171 bits (433), Expect = 3e-41
 Identities = 85/154 (55%), Positives = 106/154 (68%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SL  G+RF PTDEELV +YLK K+ G       I EVDI KHEPWDL   S +++ D EW
Sbjct: 26  SLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIGEVDIYKHEPWDLAVFSKLKTRDQEW 85

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF   D+KY NG R+NRAT +GYWKATGKDR I  R    +GMKKTLV++ GRAP+G R
Sbjct: 86  YFFSALDKKYGNGARMNRATNKGYWKATGKDREI-RRDIQLLGMKKTLVFHSGRAPDGLR 144

Query: 706 THWVIHEYRTTENKFDGTHA-GQAPFVLCRLFRK 804
           T+WV+HEYR  E + +   +  Q  +VLCR+F K
Sbjct: 145 TNWVMHEYRLVEYETETNGSLLQDAYVLCRVFHK 178



>gb:ATT5E8_1556128 Arabidopsis thaliana DNA chromosome 5, BAC clone
            T5E8 (ESSA project).>gb:BT020263_1642658 Arabidopsis
            thaliana At5g09330 gene, complete cds.
          Length = 489

 Score =  166 bits (420), Expect = 9e-40
 Identities = 111/308 (36%), Positives = 146/308 (47%), Gaps = 8/308 (2%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            L  G+RF PTD ELV +YLK KI G +  V  I EVDI K EP DLPDMSF+ S D +W 
Sbjct: 6    LAPGFRFHPTDVELVRYYLKRKILGKKLLVDAIAEVDIYKFEPPDLPDMSFIRSGDLKWH 65

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
            FFCP+++KY +G R NRATE GYWK TGK+R +       VG  KTLVY+ G++P G+RT
Sbjct: 66   FFCPREKKYASGVRANRATECGYWKTTGKERPVLCNSEV-VGKIKTLVYHFGKSPRGERT 124

Query: 709  HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVVK 888
             WV+HEYR  +      +  Q  +V+C LF+K              D   P   +     
Sbjct: 125  DWVMHEYRLDDKVLTQMNVPQDTYVVCVLFKK--------------DGPGPRNGAQYGAP 170

Query: 889  TPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSN--------SNSCIADT 1044
               ED   E     + S    T  L P  S E T  +  P DSN        S SC++D 
Sbjct: 171  FKEEDWSDEEVRTDVPSTSNPTNLLEP--SKETTLALTAPDDSNKDCFGGMISESCVSDF 228

Query: 1045 TEDQVLDITSNPADPDLDALKFFIDPSTGPIYSPTYEQMPEFGSSYFYGDVINCISNNND 1224
                    +  P   D         P    + +P  + +       F  D      NNN+
Sbjct: 229  LPATTNTTSELPHPSDAATTPMSTAPLAETVQTPNNDDLYSM-LDLFDDDEEFLGFNNNE 287

Query: 1225 VQFQYGTN 1248
            V++  G +
Sbjct: 288  VRYDPGVS 295



>pir|F86456|F86456 unknown protein [imported] - Arabidopsis
           thaliana>gb:AE005172_892146 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC027035_1539797 Arabidopsis thaliana
           chromosome 1 BAC T16O9 genomic sequence, complete
           sequence.
          Length = 305

 Score =  166 bits (420), Expect = 9e-40
 Identities = 85/170 (50%), Positives = 115/170 (67%), Gaps = 4/170 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES-HDNEW 525
           +P G+RF PTDEEL+ +YLK KI+  + E+ VI+EVD+ K EPWDL D   + S   NEW
Sbjct: 8   VPPGFRFHPTDEELLHYYLKKKISYEKFEMEVIKEVDLNKIEPWDLQDRCKIGSTPQNEW 67

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KDRKY  G R NRAT  G+WKATG+D+ I +    K+GM+KTLV+Y GRAP G++
Sbjct: 68  YFFSHKDRKYPTGSRTNRATHSGFWKATGRDKCIRN-SYKKIGMRKTLVFYKGRAPHGQK 126

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL---KLDEGAEISNS 846
           T W++HEYR  + + D    G   +V+CR+F+K  L     D G+ ISN+
Sbjct: 127 TDWIMHEYRIEDTEDDPCEDG---WVVCRVFKKKNLFKVGNDVGSNISNN 173



>gb:AF509865_1807069 Petunia x hybrida nam-like protein 2 (NH2) mRNA,
            complete cds.
          Length = 487

 Score =  166 bits (419), Expect = 1e-39
 Identities = 109/299 (36%), Positives = 149/299 (49%), Gaps = 37/299 (12%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            LP G+RF PTD ELV +YLK KI G +     I E++I K  PWDLP     +S D EW+
Sbjct: 4    LPPGFRFHPTDVELVMYYLKRKIMGKKLHFDAITELNIYKVSPWDLPGKCCYKSKDLEWY 63

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
            FFCP++RKY +G R+NRATE GYWK TGKDR++   +   VG  KTL+++ G  P+G+RT
Sbjct: 64   FFCPRERKYASGARMNRATETGYWKTTGKDRSVIYDEKV-VGSVKTLIFHRGHPPKGQRT 122

Query: 709  HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEIS--------NSDEV--- 855
             WVIHEYR  +         Q  +VLCR+F+K  L    GA+            DEV   
Sbjct: 123  DWVIHEYRFEDKGLADAGFVQDAYVLCRVFQKNGLGPKNGAQYGAPFKEDDWEDDEVPAA 182

Query: 856  -----DPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPG----QSSEETPGVHFP 1008
                 D   + P + +  +    S    P   SG    +P  P      S E  PG   P
Sbjct: 183  EPFTLDVFSAPPGLPENQSYSIVSSLVDPGSTSGWHSGEPSQPSIQRIPSDERDPG-ELP 241

Query: 1009 ID------SNSNSCIADTTEDQVLDITSNPAD--------PDLDALKF---FIDPSTGP 1134
             +      S+ N   +D  +D+ +   SNP++        PD ++       I+P  GP
Sbjct: 242  AEPNPSNVSSMNWMPSDKLDDEEVPGESNPSNILSALLVLPDKESYSIGSSMINPGPGP 300



>gb:AF254124_1781074 Medicago truncatula NAC1 (NAC1) mRNA, complete
           cds.
          Length = 409

 Score =  165 bits (418), Expect = 2e-39
 Identities = 73/149 (48%), Positives = 104/149 (69%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PT  EL+ ++LK K+ G +    VI E+DI K+ PWDLPD+S++++ D EW+FFC
Sbjct: 9   GFRFSPTGVELIKYFLKRKVMGKKVLNDVIAELDIYKYAPWDLPDLSYLQNGDLEWYFFC 68

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P ++KY NG R+NRATE G+WKATGKDR +  +    VGM KTL+++ G+AP G RT WV
Sbjct: 69  PIEKKYGNGSRMNRATEIGFWKATGKDRAV-QQNNQTVGMIKTLIFHTGKAPRGDRTDWV 127

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +HEYR  +         Q  +V+C++F+K
Sbjct: 128 MHEYRLEDKDLADKGIVQDSYVICKVFQK 156



>gb:AY085102_1570184 Arabidopsis thaliana clone 12970 mRNA, complete
           sequence.
          Length = 323

 Score =  164 bits (416), Expect = 3e-39
 Identities = 82/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+  +      I EVD+ K EPW+LP M+  +  + EW+
Sbjct: 3   LPPGFRFHPTDEELITHYLHKKVLDTSFSAKAIGEVDLNKSEPWELPWMA--KMGEKEWY 60

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRATE GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G++T
Sbjct: 61  FFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYRGK-SLVGMKKTLVFYRGRAPKGQKT 119

Query: 709 HWVIHEYRTTENKFDGTH---AGQAPFVLCRLFRK 804
           +WV+HEYR  E KF   +     +  +V+CR+F+K
Sbjct: 120 NWVMHEYR-LEGKFSAHNLPKTAKNEWVICRVFQK 153



>gb:AB010073_1510958 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFB13.>gb:AY054644_1563298 Arabidopsis thaliana
           NAM (no apical meristem)-like protein (MFB13.22) mRNA,
           complete cds.>gb:AY081496_1568756 Arabidopsis thaliana
           NAM (no apical meristem)-like protein (MFB13.22) mRNA,
           complete cds.
          Length = 336

 Score =  164 bits (416), Expect = 3e-39
 Identities = 82/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+  +      I EVD+ K EPW+LP M+  +  + EW+
Sbjct: 16  LPPGFRFHPTDEELITHYLHKKVLDTSFSAKAIGEVDLNKSEPWELPWMA--KMGEKEWY 73

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRATE GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G++T
Sbjct: 74  FFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYRGK-SLVGMKKTLVFYRGRAPKGQKT 132

Query: 709 HWVIHEYRTTENKFDGTH---AGQAPFVLCRLFRK 804
           +WV+HEYR  E KF   +     +  +V+CR+F+K
Sbjct: 133 NWVMHEYR-LEGKFSAHNLPKTAKNEWVICRVFQK 166



>gb:AC126222_1740517 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBb0014I10, complete sequence.
          Length = 358

 Score =  164 bits (414), Expect = 5e-39
 Identities = 86/173 (49%), Positives = 111/173 (64%), Gaps = 3/173 (1%)
 Frame = +1

Query: 295 EMAVL-KVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKH 471
           E++V+ +VE      PL  LP G+RF PTDEE+V HYL  K         VI +VD+ K 
Sbjct: 3   EVSVMAEVEETAAAAPL-DLPPGFRFHPTDEEIVSHYLTPKALNHRFSSGVIGDVDLNKC 61

Query: 472 EPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKV 651
           EPW LP M+  +  + EW+FFC KDRKY  G R NRATE GYWKATGKD+ I   +G  V
Sbjct: 62  EPWHLPAMA--KMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIFRGRGILV 119

Query: 652 GMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDG--THAGQAPFVLCRLFRK 804
           GMKKTLV+YLGRAP G++T WV+HE+R  E K       + +  + +C++F K
Sbjct: 120 GMKKTLVFYLGRAPRGEKTGWVMHEFR-LEGKLPSQLPRSAKDQWAVCKVFNK 171



>pir|A84746|A84746 probable NAM (no apical meristem)-like protein
           [imported] - Arabidopsis thaliana>gb:AC002332_1530320
           Arabidopsis thaliana chromosome 2 clone F4P9 map ve015,
           complete sequence.>gb:AY093730_1575390 Arabidopsis
           thaliana At2g33480/F4P9.25 mRNA, complete
           cds.>gb:AF325080_1786534 Arabidopsis thaliana putative
           NAM (no apical meristem)-like protein (At2g33480) mRNA,
           complete cds.>gb:AF410299_1797113 Arabidopsis thaliana
           At2g33480/F4P9.25 mRNA, complete cds.
          Length = 268

 Score =  163 bits (413), Expect = 6e-39
 Identities = 83/176 (47%), Positives = 109/176 (61%), Gaps = 6/176 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV  YL+ K+TG     SVI E D+CK +PWDLP        ++E +
Sbjct: 15  LPPGFRFHPTDEELVVQYLRRKVTGLPLPASVIPETDVCKSDPWDLPG-----DCESEMY 69

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF  ++ KY NG R NR+T  GYWKATG D+ I  +K   VGMKKTLV+Y G+ P G RT
Sbjct: 70  FFSTREAKYPNGNRSNRSTGSGYWKATGLDKQIGKKK-LVVGMKKTLVFYKGKPPNGTRT 128

Query: 709 HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK------VELKLDEGAEISNSDEVD 858
           +WV+HEYR  +++ D  +     +VLCR+F K       + K DE  E+ N  E +
Sbjct: 129 NWVLHEYRLVDSQQDSLYGQNMNWVLCRVFLKKRSNSNSKRKEDEKEEVENEKETE 184



>gb:AP004749_1844321 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0410C01.>gb:AP005450_1852004 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0438E12.
          Length = 276

 Score =  163 bits (412), Expect = 8e-39
 Identities = 75/154 (48%), Positives = 105/154 (68%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESH-DNE 522
           S+P G+RF PTDEEL+ +YL+ K+     ++ VIRE+D+ K EPWDL D   + +   NE
Sbjct: 9   SVPPGFRFHPTDEELLYYYLRKKVAYEAIDLDVIREIDLNKLEPWDLKDRCRIGTGPQNE 68

Query: 523 WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
           W+FF  KD+KY  G R NRAT  G+WKATG+D+ I      ++GM+KTLV+Y+GRAP GK
Sbjct: 69  WYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIFLANACRIGMRKTLVFYVGRAPHGK 128

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +T W++HEYR  ++  D    G   +V+CR+F K
Sbjct: 129 KTDWIMHEYRLDQDNVDVQEDG---WVVCRVFMK 159



>gb:AB028186_1517822 Oryza sativa mRNA for OsNAC7 protein, complete
           cds.
          Length = 276

 Score =  163 bits (412), Expect = 8e-39
 Identities = 75/154 (48%), Positives = 105/154 (68%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESH-DNE 522
           S+P G+RF PTDEEL+ +YL+ K+     ++ VIRE+D+ K EPWDL D   + +   NE
Sbjct: 9   SVPPGFRFHPTDEELLYYYLRKKVAYEAIDLDVIREIDLNKLEPWDLKDRCRIGTGPQNE 68

Query: 523 WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
           W+FF  KD+KY  G R NRAT  G+WKATG+D+ I      ++GM+KTLV+Y+GRAP GK
Sbjct: 69  WYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIFLANACRIGMRKTLVFYVGRAPHGK 128

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +T W++HEYR  ++  D    G   +V+CR+F K
Sbjct: 129 KTDWIMHEYRLDQDNVDVQEDG---WVVCRVFMK 159



>pir|T04050|T04050 hypothetical protein F24G24.150 - Arabidopsis
           thaliana>gb:ATCHRIV29_1544749 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           29.>gb:ATF24G24_1549884 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F24G24 (ESSA
           project).>gb:AY133681_1581501 Arabidopsis thaliana clone
           C103095 putative NAM/NAP (At4g10350) mRNA, complete cds.
          Length = 341

 Score =  163 bits (412), Expect = 8e-39
 Identities = 82/169 (48%), Positives = 113/169 (66%), Gaps = 3/169 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES-HDNEW 525
           +P G+RF PTDEEL+ +YLK KI+  + E+ VIREVD+ K EPWDL +   + S   NEW
Sbjct: 9   VPPGFRFHPTDEELLHYYLKKKISYQKFEMEVIREVDLNKLEPWDLQERCKIGSTPQNEW 68

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KDRKY  G R NRAT  G+WKATG+D+ I +    K+GM+KTLV+Y GRAP G++
Sbjct: 69  YFFSHKDRKYPTGSRTNRATHAGFWKATGRDKCIRN-SYKKIGMRKTLVFYKGRAPHGQK 127

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL--KLDEGAEISNS 846
           T W++HEYR  +      +  +  +V+CR+F K  L   ++EG+   NS
Sbjct: 128 TDWIMHEYRLEDADDPQANPSEDGWVVCRVFMKKNLFKVVNEGSSSINS 176



>gb:AF509870_1807074 Petunia x hybrida nam-like protein 7 (NH7)
           mRNA, complete cds.
          Length = 603

 Score =  162 bits (411), Expect = 1e-38
 Identities = 80/151 (52%), Positives = 102/151 (67%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFF 531
           P G+RF PTDEELV +YLK KI      +  I E D+ K +P DLPD+S +++ D +WF 
Sbjct: 20  PPGFRFHPTDEELVLYYLKRKICRRRILLDAIAETDVYKWDPEDLPDLSKLKTGDRQWFS 79

Query: 532 FCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTH 711
           F P+DRKY NG R NRAT+ GYWKATGKDRTI     A VG+KKTLV+Y GRAP G+RT 
Sbjct: 80  FSPRDRKYPNGARSNRATKHGYWKATGKDRTIMCNSRA-VGVKKTLVFYKGRAPVGERTD 138

Query: 712 WVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           WV+HEY   E++       Q  + L ++F+K
Sbjct: 139 WVMHEYTMDEDELKRCENAQDYYALYKVFKK 169



>gb:AP004020_1836485 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1119_A01.>gb:AP004878_1846480 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0474F11.
          Length = 632

 Score =  162 bits (409), Expect = 2e-38
 Identities = 107/279 (38%), Positives = 143/279 (51%), Gaps = 33/279 (11%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            L  G+RF PTDEELV +YL+ +I G    +  I EVD+ + EPWDLP +S + S D +W+
Sbjct: 16   LAPGFRFHPTDEELVSYYLRRRILGRRLRIDAIAEVDLYRLEPWDLPSLSRIRSRDAQWY 75

Query: 529  FFCPKDRKYQN---------GQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL 681
            FF   DRK            G R NRAT RGYWK TGKDR +  R G  VGMKKTLV++ 
Sbjct: 76   FFARLDRKVTGAGAGGRGGPGNRTNRATPRGYWKTTGKDRDVHHR-GKLVGMKKTLVFHS 134

Query: 682  GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISN------ 843
            GRAP+G+RT+WV+HEYR  +   DGT   Q   V+CR+F+K       GA+         
Sbjct: 135  GRAPKGQRTNWVMHEYRLLD--ADGT---QDLHVVCRIFQKNGSGPQNGAQYGAPYLEED 189

Query: 844  -SDEVDPIVSSP--------TVVKTPAEDEQSEGGTPLMKSGH--IKTQ-------PLTP 969
              +E D I + P          V   A++   E G   +K+    ++TQ       P+  
Sbjct: 190  WEEEDDAIENMPASGAFAEMAAVTDTADESTEEDGNFSLKTNDEPLQTQEYQPEITPVKA 249

Query: 970  GQSSEETPGVHFPIDSNSNSCIADTTEDQVLDITSNPAD 1086
              S+EET G  +  D  S   I    E+   +   N  D
Sbjct: 250  QGSNEETNGGGYSCDVFSLDEILQEPENVCKNEEQNAID 288



>gb:OSJN00003_1693104 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0072F16, complete sequence.
          Length = 343

 Score =  162 bits (409), Expect = 2e-38
 Identities = 83/161 (51%), Positives = 103/161 (63%), Gaps = 9/161 (5%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+  +      + E D+ K EPWDLP  S  +  + EW+
Sbjct: 12  LPPGFRFHPTDEELITHYLAKKVADARFAALAVAEADLNKCEPWDLP--SLAKMGEKEWY 69

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC KDRKY  G R NRATE GYWKATGKD+ I  RK A VGMKKTLV+Y GRAP+G+++
Sbjct: 70  FFCLKDRKYPTGLRTNRATESGYWKATGKDKDIFRRK-ALVGMKKTLVFYTGRAPKGEKS 128

Query: 709 HWVIHEYRTTENKFDGTHAG---------QAPFVLCRLFRK 804
            WV+HEYR    K      G         +  +VLCR+F+K
Sbjct: 129 GWVMHEYR-LHGKLHAAALGFLHGKPASSKNEWVLCRVFKK 168



>gb:ATAC011698_1543382 Arabidopsis thaliana chromosome III BAC
           T11I18 genomic sequence, complete
           sequence.>gb:AY081834_1569014 Arabidopsis thaliana
           AT3g04060/T11I18_17 mRNA, complete
           cds.>gb:AY084852_1569935 Arabidopsis thaliana clone
           119460 mRNA, complete sequence.>gb:AF361623_1791369
           Arabidopsis thaliana AT3g04060/T11I18_17 mRNA, complete
           cds.
          Length = 338

 Score =  162 bits (409), Expect = 2e-38
 Identities = 82/181 (45%), Positives = 114/181 (62%), Gaps = 9/181 (4%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEE++ HYLK K+       + I + D+ K+EPWDLP ++  +  + E++
Sbjct: 20  LPPGFRFHPTDEEIITHYLKEKVFNIRFTAAAIGQADLNKNEPWDLPKIA--KMGEKEFY 77

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRAT  GYWKATGKD+ I   KG  VGMKKTLV+Y GRAP+G++T
Sbjct: 78  FFCQRDRKYPTGMRTNRATVSGYWKATGKDKEIFRGKGCLVGMKKTLVFYTGRAPKGEKT 137

Query: 709 HWVIHEYRTTENKFDGTHA-------GQAPFVLCRLFRK--VELKLDEGAEISNSDEVDP 861
           +WV+HEYR      DG ++        +  +V+CR+F K      +    ++S  D +D 
Sbjct: 138 NWVMHEYR-----LDGKYSYHNLPKTARDEWVVCRVFHKNAPSTTITTTKQLSRIDSLDN 192

Query: 862 I 864
           I
Sbjct: 193 I 193



>gb:AB028181_1517817 Oryza sativa mRNA for OsNAC2 protein, complete
           cds.
          Length = 334

 Score =  162 bits (409), Expect = 2e-38
 Identities = 83/161 (51%), Positives = 103/161 (63%), Gaps = 9/161 (5%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+  +      + E D+ K EPWDLP  S  +  + EW+
Sbjct: 3   LPPGFRFHPTDEELITHYLAKKVADARFAALAVAEADLNKCEPWDLP--SLAKMGEKEWY 60

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC KDRKY  G R NRATE GYWKATGKD+ I  RK A VGMKKTLV+Y GRAP+G+++
Sbjct: 61  FFCLKDRKYPTGLRTNRATESGYWKATGKDKDIFRRK-ALVGMKKTLVFYTGRAPKGEKS 119

Query: 709 HWVIHEYRTTENKFDGTHAG---------QAPFVLCRLFRK 804
            WV+HEYR    K      G         +  +VLCR+F+K
Sbjct: 120 GWVMHEYR-LHGKLHAAALGFLHGKPASSKNEWVLCRVFKK 159



>gb:AF532619_1809421 Glycine max no apical meristem-like protein
           mRNA, complete cds.
          Length = 357

 Score =  161 bits (407), Expect = 3e-38
 Identities = 81/155 (52%), Positives = 105/155 (67%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+T +      I EVD+ + EPWDLP  +  +  + EW+
Sbjct: 18  LPPGFRFHPTDEELISHYLYRKVTDTNFSARAIGEVDLNRSEPWDLPWKA--KMGEKEWY 75

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRATE GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G++T
Sbjct: 76  FFCVRDRKYPTGLRTNRATESGYWKATGKDKEIFRGK-SLVGMKKTLVFYKGRAPKGEKT 134

Query: 709 HWVIHEYRTTENKFDG---THAGQAPFVLCRLFRK 804
            WV+HEYR  + KF         +  +V+CR+F+K
Sbjct: 135 DWVMHEYR-LDGKFSFHTLPKTAKNEWVICRVFQK 168



>gb:AY084635_1569723 Arabidopsis thaliana clone 113779 mRNA,
           complete sequence.
          Length = 275

 Score =  161 bits (407), Expect = 3e-38
 Identities = 82/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYLK K+  +    + I EVD+ K EPWDLP  +  +  + EW+
Sbjct: 10  LPPGFRFHPTDEELITHYLKPKVFNTFFSATAIGEVDLNKIEPWDLPWKA--KMGEKEWY 67

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRATE GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G +T
Sbjct: 68  FFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFKGK-SLVGMKKTLVFYKGRAPKGVKT 126

Query: 709 HWVIHEYRTTENKF---DGTHAGQAPFVLCRLFRK 804
           +WV+HEYR  E K+   +     +  +V+CR+F+K
Sbjct: 127 NWVMHEYR-LEGKYCIENLPQTAKNEWVICRVFQK 160



>gb:AB012243_1511739 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIJ24.>gb:AY056327_1563637 Arabidopsis thaliana
           putative NAM / CUC2 protein (At5g39610) mRNA, complete
           cds.>gb:AY091191_1574400 Arabidopsis thaliana putative
           NAM/CUC2 protein (At5g39610) mRNA, complete
           cds.>gb:AY174163_1586880 Arabidopsis thaliana ecotype
           Columbia no apical meristem-like protein mRNA, complete
           cds.
          Length = 285

 Score =  161 bits (407), Expect = 3e-38
 Identities = 82/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYLK K+  +    + I EVD+ K EPWDLP  +  +  + EW+
Sbjct: 20  LPPGFRFHPTDEELITHYLKPKVFNTFFSATAIGEVDLNKIEPWDLPWKA--KMGEKEWY 77

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRATE GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G +T
Sbjct: 78  FFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFKGK-SLVGMKKTLVFYKGRAPKGVKT 136

Query: 709 HWVIHEYRTTENKF---DGTHAGQAPFVLCRLFRK 804
           +WV+HEYR  E K+   +     +  +V+CR+F+K
Sbjct: 137 NWVMHEYR-LEGKYCIENLPQTAKNEWVICRVFQK 170



>gb:AB012246_1511805 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRG7.>gb:BT005713_1638653 Arabidopsis thaliana
           clone RAFL14-80-C22 (R20123) putative NAM (no apical
           meristem) protein (At5g18270) mRNA, complete
           cds.>gb:BT006070_1638964 Arabidopsis thaliana clone
           U20123 putative NAM (no apical meristem) protein
           (At5g18270) mRNA, complete cds.
          Length = 335

 Score =  160 bits (406), Expect = 4e-38
 Identities = 80/158 (50%), Positives = 106/158 (67%), Gaps = 3/158 (1%)
 Frame = +1

Query: 340 LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN 519
           L  LP G+RF PTDEE++  YLK K+  S      + E D+ K EPWDLP  +  +  + 
Sbjct: 18  LVDLPPGFRFHPTDEEIITCYLKEKVLNSRFTAVAMGEADLNKCEPWDLPKRA--KMGEK 75

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           E++FFC +DRKY  G R NRATE GYWKATGKD+ I   KG  VGMKKTLV+Y GRAP+G
Sbjct: 76  EFYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIFKGKGCLVGMKKTLVFYRGRAPKG 135

Query: 700 KRTHWVIHEYRTTENKFDGTH---AGQAPFVLCRLFRK 804
           ++T+WV+HEYR  E K+   +   + +  +V+CR+F K
Sbjct: 136 EKTNWVMHEYR-LEGKYSYYNLPKSARDEWVVCRVFHK 172



>gb:AP005510_1853112 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0009N02.
          Length = 359

 Score =  159 bits (402), Expect = 1e-37
 Identities = 77/164 (46%), Positives = 108/164 (65%), Gaps = 3/164 (1%)
 Frame = +1

Query: 322 PTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSF 501
           P G P   ++P G+RF PTDEEL+ +YL+ K+     ++ VIRE+D+ K EPWDL D   
Sbjct: 3   PNGAPL--AVPPGFRFHPTDEELLYYYLRKKVAYEAIDLDVIREIDLNKLEPWDLKDRCR 60

Query: 502 V-ESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI--SSRKGAKVGMKKTLV 672
           +      EW+FF  KD+KY  G R NRAT  G+WKATG+D+ I   S  G ++G++KTLV
Sbjct: 61  IGTGAQEEWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKAIFLGSGGGTRIGLRKTLV 120

Query: 673 YYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +Y GRAP GK+T W++HEYR  ++  D    G   +V+CR+F+K
Sbjct: 121 FYTGRAPHGKKTDWIMHEYRLDDDNVDVPEEG---WVVCRVFKK 161



>gb:PHDNANAM_1700106 P.hybrida NAM gene.>gb:PHRNANAM_1700164 P.hybrida
            mRNA encoding NAM protein.
          Length = 327

 Score =  159 bits (402), Expect = 1e-37
 Identities = 102/251 (40%), Positives = 141/251 (56%), Gaps = 23/251 (9%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            +LP G+RF PTDEEL+ +YL  K+  S      I EVD+ K EPW+LP+ +  +  + EW
Sbjct: 13   NLPPGFRFHPTDEELITYYLLKKVLDSNFTGRAIAEVDLNKCEPWELPEKA--KMGEKEW 70

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGK 702
            +FF  +DRKY  G R NRATE GYWKATGKDR I SS+  A VGMKKTLV+Y GRAP+G+
Sbjct: 71   YFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSKTSALVGMKKTLVFYRGRAPKGE 130

Query: 703  RTHWVIHEYRTTENKFDG---THAGQAPFVLCRLFRK----VELKLDEGAEISNS--DEV 855
            +++WV+HEYR  + KF     + + +  +V+ R+F+K    V    + G +  NS  + +
Sbjct: 131  KSNWVMHEYR-LDGKFAYHYISRSSKDEWVISRVFQKSCSTVGTTSNGGKKRLNSSFNNM 189

Query: 856  DPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEE-------------TPG 996
               VSSP+ V  P          PL++S        +   S +E              P 
Sbjct: 190  YQEVSSPSSVSLP----------PLLESSPYNNTATSAAASKKEHVSCFSTISTPSFDPS 239

Query: 997  VHFPIDSNSNS 1029
              F I SNSN+
Sbjct: 240  SVFDISSNSNT 250



>gb:AY062638_1565294 Arabidopsis thaliana Unknown protein (MRI12.1)
           mRNA, complete cds.>gb:BT008716_1639912 Arabidopsis
           thaliana At3g29035 gene, complete cds.
          Length = 318

 Score =  159 bits (402), Expect = 1e-37
 Identities = 90/194 (46%), Positives = 119/194 (61%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL+ K+  S      I EVD+ K EPWDLP  +  +  + EW+
Sbjct: 24  LPPGFRFHPTDEELITHYLRPKVVNSFFSAIAIGEVDLNKVEPWDLPWKA--KLGEKEWY 81

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRAT+ GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G +T
Sbjct: 82  FFCVRDRKYPTGLRTNRATKAGYWKATGKDKEIFKGK-SLVGMKKTLVFYKGRAPKGVKT 140

Query: 709 HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVVK 888
           +WV+HEYR  E KF   +  +     C + R    + D G +   S  + P++ S   +K
Sbjct: 141 NWVMHEYR-LEGKFAIDNLSKTAKNECVISRVFHTRTD-GTKEHMSVGLPPLMDSSPYLK 198

Query: 889 TPAEDEQSEGGTPL 930
           +  +D  S  GT L
Sbjct: 199 SRGQD--SLAGTTL 210



>gb:AE005173_895479 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC010793_1537057 Genomic sequence
           for Arabidopsis thaliana BAC F20B17 from chromosome I,
           complete sequence.
          Length = 371

 Score =  159 bits (402), Expect = 1e-37
 Identities = 73/154 (47%), Positives = 108/154 (70%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESH-DNE 522
           S+P G+RF PT+EEL+ +YLK K++    ++ VIREVD+ K EPW+L +   + S   NE
Sbjct: 16  SVPPGFRFHPTEEELLYYYLKKKVSYEPIDLDVIREVDLNKLEPWELKEKCRIGSGPQNE 75

Query: 523 WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
           W+FF  KD+KY  G R NRAT  G+WKATG+D++I      K+G++KTLV+Y GRAP G+
Sbjct: 76  WYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKSIHLNSSKKIGLRKTLVFYTGRAPHGQ 135

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +T W++HEYR  +++ +    G   +V+CR+F+K
Sbjct: 136 KTEWIMHEYRLDDSENEIQEDG---WVVCRVFKK 166



>gb:AF509873_1807077 Petunia x hybrida nam-like protein 10 (NH10)
           mRNA, complete cds.
          Length = 304

 Score =  159 bits (401), Expect = 1e-37
 Identities = 81/182 (44%), Positives = 112/182 (61%), Gaps = 7/182 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYL  K       V +I E+D+ K++PWDLPD++     + EW+
Sbjct: 8   LPPGFRFHPTDEELVMHYLCRKCASQPIAVPIIAEIDLYKYDPWDLPDLALY--GEKEWY 65

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ I   K   VG+KK LV+Y G+AP+G++T
Sbjct: 66  FFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGHPKA--VGIKKALVFYAGKAPKGEKT 123

Query: 709 HWVIHEYRTTE----NKFDGTHAGQAPFVLCRLFRK---VELKLDEGAEISNSDEVDPIV 867
           +W++HEYR  +     + +        +VLCR++ K   +E       +I N+  +D  V
Sbjct: 124 NWIMHEYRLADVDRSARKNNNSLRLDDWVLCRIYNKKGSIEKNQLNNKKIMNTSYMDMTV 183

Query: 868 SS 873
           SS
Sbjct: 184 SS 185



>gb:AY596808_1616938 Oryza sativa (japonica cultivar-group) NAC
           transcription factor (NAC) mRNA, complete
           cds.>gb:AC135594_1742612 Oryza sativa chromosome 3 BAC
           OSJNBa0024F18 genomic sequence, complete sequence.
          Length = 316

 Score =  159 bits (401), Expect = 1e-37
 Identities = 82/183 (44%), Positives = 113/183 (61%), Gaps = 7/183 (3%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTD+ELV+HYL  K  G    V +I EVD+ K +PWDLP+ +   +   EW
Sbjct: 16  NLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPIIAEVDLYKFDPWDLPERALFGA--REW 73

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NRA   GYWKATG D+ ++ R G  +G+KK LV+Y G+AP G +
Sbjct: 74  YFFTPRDRKYPNGSRPNRAAGNGYWKATGADKPVAPR-GRTLGIKKALVFYAGKAPRGVK 132

Query: 706 THWVIHEYRTTE--NKFDGTHAGQA---PFVLCRLFRKVE--LKLDEGAEISNSDEVDPI 864
           T W++HEYR  +      G   G      +VLCRL+ K     K+ +G E+   +E   +
Sbjct: 133 TDWIMHEYRLADAGRAAAGAKKGSLRLDDWVLCRLYNKKNEWEKMQQGKEV--KEEASDM 190

Query: 865 VSS 873
           V+S
Sbjct: 191 VTS 193



>gb:AP005167_1848626 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0060O17.
          Length = 301

 Score =  158 bits (399), Expect = 3e-37
 Identities = 80/158 (50%), Positives = 99/158 (62%), Gaps = 6/158 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEE+V HYL  K         VI +V++   EPWDLP  S  +  + EWF
Sbjct: 21  LPPGFRFHPTDEEVVTHYLTRKAQDRSFSCVVIADVNLNNCEPWDLP--SKAKMGEKEWF 78

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC KDRKY  G R NRAT  GYWKATGKD+ I   +G  VGMKKTLV+Y+GRAP G++T
Sbjct: 79  FFCHKDRKYPTGMRTNRATASGYWKATGKDKEIFRGRGLLVGMKKTLVFYMGRAPRGEKT 138

Query: 709 HWVIHEYRTTENKFDG------THAGQAPFVLCRLFRK 804
            WV+HEYR      DG        + +  + +CR+F K
Sbjct: 139 PWVMHEYR-----LDGKLPPNLPRSAKEEWAVCRVFNK 171



>gb:AB022218_1515098 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJK13.>gb:AB049071_1520761 Arabidopsis
           thaliana AtNAC2 mRNA, complete cds.>gb:AC024081_1539277
           Arabidopsis thaliana chromosome III P1 MJK13 genomic
           sequence, complete sequence.>gb:BT004079_1637184
           Arabidopsis thaliana clone RAFL15-22-L08 (R20756)
           putative jasmonic acid regulatory protein (At3g15510)
           mRNA, complete cds.>gb:BT005044_1637990 Arabidopsis
           thaliana clone U20756 putative jasmonic acid regulatory
           protein (At3g15510) mRNA, complete cds.
          Length = 364

 Score =  158 bits (399), Expect = 3e-37
 Identities = 81/170 (47%), Positives = 107/170 (62%), Gaps = 13/170 (7%)
 Frame = +1

Query: 334 PPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLP-DMSFVES 510
           PP  +LP G+RF PTDEELV HYLK K   +   V++I EVD+ K +PW+LP   SF E 
Sbjct: 12  PPQPNLPPGFRFHPTDEELVVHYLKRKAASAPLPVAIIAEVDLYKFDPWELPAKASFGE- 70

Query: 511 HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG-AKVGMKKTLVYYLGR 687
              EW+FF P+DRKY NG R NRA   GYWKATG D+ + +  G  KVG+KK LV+Y G+
Sbjct: 71  --QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLASDGNQKVGVKKALVFYSGK 128

Query: 688 APEGKRTHWVIHEYRTTENKFDGTHAG-----------QAPFVLCRLFRK 804
            P+G ++ W++HEYR  ENK +    G              +VLCR+++K
Sbjct: 129 PPKGVKSDWIMHEYRLIENKPNNRPPGCDFGNKKNSLRLDDWVLCRIYKK 178



>gb:AP006161_1861106 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1267B06.
          Length = 360

 Score =  157 bits (398), Expect = 3e-37
 Identities = 82/153 (53%), Positives = 99/153 (64%), Gaps = 1/153 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVS-VIREVDICKHEPWDLPDMSFVESHDNEW 525
           LP G+RF PTDEEL+ HYL  K        +  + E D+ K EPWDLP  + +   + EW
Sbjct: 37  LPPGFRFHPTDEELITHYLLRKAADPAGFAARAVGEADLNKCEPWDLPSRATMG--EKEW 94

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FFC KDRKY  G R NRATE GYWKATGKDR I   K A VGMKKTLV+Y GRAP G +
Sbjct: 95  YFFCVKDRKYPTGLRTNRATESGYWKATGKDREIFRGK-ALVGMKKTLVFYTGRAPRGGK 153

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           T WV+HEYR    K    ++    +VLCR+F+K
Sbjct: 154 TGWVMHEYR-IHGKHAAANSKDQEWVLCRVFKK 185



>gb:AF510214_1807171 Petunia x hybrida nam-like protein 17 (NH17)
           mRNA, partial cds.
          Length = 362

 Score =  157 bits (398), Expect = 3e-37
 Identities = 86/188 (45%), Positives = 113/188 (60%), Gaps = 9/188 (4%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEE++  YL+ K+           EVD+ K EPWDLP  +  +  + EW+FFC
Sbjct: 1   GFRFHPTDEEIITCYLQEKVMDKRFTAIAFAEVDLNKSEPWDLPAKA--KMGEKEWYFFC 58

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
            +DRKY  G R NRATE GYWKATGKD+ I   K   VGMKKTLV+Y GRAP+G++T+WV
Sbjct: 59  QRDRKYPAGMRTNRATESGYWKATGKDKEIYKGKDCLVGMKKTLVFYKGRAPKGEKTNWV 118

Query: 718 IHEYRTTENKFDGT---HAGQAPFVLCRLF------RKVELKLDEGAEISNSDEVDPIVS 870
           +HEYR  E K        A    +V+CR+F      R+  L LD   E    D +D   S
Sbjct: 119 MHEYR-LEGKLSYNCFHKASMEEWVICRVFNKSIGARRSPLLLDSFVE----DLLDSPSS 173

Query: 871 SPTVVKTP 894
            P++++ P
Sbjct: 174 LPSLMEMP 181



>gb:OSJN00196_1696537 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0020O11, complete sequence.
          Length = 376

 Score =  157 bits (398), Expect = 3e-37
 Identities = 72/153 (47%), Positives = 107/153 (69%), Gaps = 1/153 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD-NEW 525
           +P G+RF PTDEELVD+YL+ K+   + ++ VI+++D+ K EPWDL +   + + + NEW
Sbjct: 52  VPPGFRFHPTDEELVDYYLRKKVALKKIDLDVIKDIDLYKIEPWDLQEQCKIGNEEQNEW 111

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I   K   VGM+KTLV+Y GRAP G++
Sbjct: 112 YFFSHKDKKYPTGTRTNRATTAGFWKATGRDKPIYV-KNCLVGMRKTLVFYRGRAPNGQK 170

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           + W++HEYR   N++      +  +V+CR+F+K
Sbjct: 171 SDWIMHEYRLETNEYGAPQ--EEGWVVCRVFKK 201



>gb:AP005291_1849971 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1282_H11.
          Length = 370

 Score =  157 bits (397), Expect = 4e-37
 Identities = 74/153 (48%), Positives = 109/153 (71%), Gaps = 1/153 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD-NEW 525
           +P G+RF PTDEELVD+YL+ K+   + ++ VI++VD+ K EPWDL +   +   + N+W
Sbjct: 7   VPPGFRFHPTDEELVDYYLRKKVASKKIDLDVIKDVDLYKIEPWDLQEKCKIGMEEQNDW 66

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I +R    VGM+KTLV+Y GRAP G++
Sbjct: 67  YFFSHKDKKYPTGTRTNRATGAGFWKATGRDKPIYAR-SCLVGMRKTLVFYKGRAPNGQK 125

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           + W++HEYR   N+ +GT   +  +V+CR+F+K
Sbjct: 126 SDWIMHEYRLETNE-NGT-TPEEGWVVCRVFKK 156



>gb:BT000790_1635061 Arabidopsis thaliana clone RAFL09-15-E01
           (R09228) unknown protein (At4g27410) mRNA, partial cds.
          Length = 292

 Score =  157 bits (397), Expect = 4e-37
 Identities = 79/196 (40%), Positives = 116/196 (59%), Gaps = 15/196 (7%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K+ G    + VI ++D+ K +PWDLP  +     + EW
Sbjct: 8   SLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQVIGDIDLYKFDPWDLPSKALFG--EKEW 65

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ I++  G +VG+KK LV+Y G+AP+G +
Sbjct: 66  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITA-DGRRVGIKKALVFYAGKAPKGTK 124

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKV---------------ELKLDEGAEIS 840
           T+W++HEYR  E+      +    +VLCR+++K                E     G+  S
Sbjct: 125 TNWIMHEYRLIEHSRSHGSSKLGDWVLCRIYKKTSGSQRQAVTPVQACREEHSTNGSSSS 184

Query: 841 NSDEVDPIVSSPTVVK 888
           +S ++D ++ S   +K
Sbjct: 185 SSSQLDDVLDSFPEIK 200



>pir|E86395|E86395 hypothetical protein T2P11.6 - Arabidopsis
           thaliana>gb:AE005172_891564 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC005508_1532794 Arabidopsis thaliana
           chromosome I BAC T2P11 genomic sequence, complete
           sequence.
          Length = 418

 Score =  157 bits (397), Expect = 4e-37
 Identities = 85/228 (37%), Positives = 126/228 (55%), Gaps = 14/228 (6%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YLK K+  +   + +IR++DI K++PWDLP   F  + + EW+F+C
Sbjct: 19  GFRFHPTDEELVSFYLKRKVQHNPLSIELIRQLDIYKYDPWDLP--KFAMTGEKEWYFYC 76

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKRTHW 714
           P+DRKY+N  R NR T  G+WKATG DR I S +G K +G+KK+LV+Y GRA +G +T W
Sbjct: 77  PRDRKYRNSSRPNRVTGAGFWKATGTDRPIYSSEGNKCIGLKKSLVFYKGRAAKGVKTDW 136

Query: 715 VIHEYR---------TTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIV 867
           ++HE+R          ++  FD   +    + +CR+F+K           S    + P  
Sbjct: 137 MMHEFRLPSLSEPSPPSKRFFDSPVSPNDSWAICRIFKKTNTTTLRALSHSFVSSLPPET 196

Query: 868 SSPTVVKTPAEDEQSEGGTPLMK-SGHIK---TQPLTPGQSSEETPGV 999
           S+ T+      +        ++K S H +       TP  S+  TP V
Sbjct: 197 STDTMSNQKQSNTYHFSSDKILKPSSHFQFHHENMNTPKTSNSTTPSV 244



>gb:ATAC011698_1543383 Arabidopsis thaliana chromosome III BAC
           T11I18 genomic sequence, complete sequence.
          Length = 343

 Score =  157 bits (396), Expect = 6e-37
 Identities = 76/172 (44%), Positives = 111/172 (64%), Gaps = 11/172 (6%)
 Frame = +1

Query: 337 PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD 516
           P  SLP G+RF PTDEEL+ HYL+ K++ S   +S+I +VDI K +PWDLP  +     +
Sbjct: 6   PRSSLPPGFRFHPTDEELILHYLRKKVSSSPVPLSIIADVDIYKSDPWDLP--AKAPFGE 63

Query: 517 NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG----AKVGMKKTLVYYLG 684
            EW+FF P+DRKY NG R NRA   GYWKATG D+ I+   G      +G+KK LV+Y G
Sbjct: 64  KEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKLIAVPNGEGFHENIGIKKALVFYRG 123

Query: 685 RAPEGKRTHWVIHEYRTTEN----KFDGTHAGQA---PFVLCRLFRKVELKL 819
           + P+G +T+W++HEYR  ++    + + + +G +    +VLCR+++K    L
Sbjct: 124 KPPKGVKTNWIMHEYRLADSLSPKRINSSRSGGSELDDWVLCRIYKKSHASL 175



>gb:AB028180_1517816 Oryza sativa mRNA for OsNAC1 protein, complete
            cds.
          Length = 347

 Score =  157 bits (396), Expect = 6e-37
 Identities = 103/266 (38%), Positives = 129/266 (48%), Gaps = 20/266 (7%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVS-VIREVDICKHEPWDLPDMSFVESHDNEW 525
            LP G+RF PTDEEL+ HYL  K        +  + E D+ K EPWDLP  + +   + EW
Sbjct: 3    LPPGFRFHPTDEELITHYLLRKAADPAGFAARAVGEADLNKCEPWDLPSRATMG--EKEW 60

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            +FFC KDRKY  G R NRATE GYWKATGKDR I   K A VGMKKTLV+Y GRAP G +
Sbjct: 61   YFFCVKDRKYPTGLRTNRATESGYWKATGKDREIFRGK-ALVGMKKTLVFYTGRAPRGGK 119

Query: 706  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK-VELKLDEGAEI-------------SN 843
            T WV+HEYR               +VLCR+F+K +EL     A +             S+
Sbjct: 120  TGWVMHEYRIHGKHAAANSKQDQEWVLCRVFKKSLELAPAAAAAVGRRGAGAGTDVGPSS 179

Query: 844  SDEVDPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNS 1023
                D +V        P  D    GG      G   T       ++   P  H       
Sbjct: 180  MPMADDVVGLAPCALPPLMDVSGGGG------GAGTTSLSATAGAAAAPPAAHV------ 227

Query: 1024 NSCIADTTEDQVLDI-----TSNPAD 1086
             +C ++  E Q LD       ++PAD
Sbjct: 228  -TCFSNALEGQFLDTPYLLPAADPAD 252



>gb:AB026658_1517362 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MYF24.
          Length = 314

 Score =  157 bits (396), Expect = 6e-37
 Identities = 110/305 (36%), Positives = 147/305 (48%), Gaps = 15/305 (4%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            +LP G+RF PTDEEL+ HYL  K++        + +VD+ K EPWDLP  + +   + EW
Sbjct: 4    NLPPGFRFHPTDEELITHYLCRKVSDIGFTGKAVVDVDLNKCEPWDLPAKASMG--EKEW 61

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            +FF  +DRKY  G R NRATE GYWK TGKD+ I  R G  VGMKKTLV+Y GRAP+G++
Sbjct: 62   YFFSQRDRKYPTGLRTNRATEAGYWKTTGKDKEI-YRSGVLVGMKKTLVFYKGRAPKGEK 120

Query: 706  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVV 885
            ++WV+HEYR  E+K       +  +V+CR+F K             + E  P  S P+  
Sbjct: 121  SNWVMHEYR-LESKQPFNPTNKEEWVVCRVFEK-------STAAKKAQEQQPQSSQPS-F 171

Query: 886  KTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIAD-TTEDQVL 1062
             +P +   S       +   I   P     SS      H    S  N    D TT    L
Sbjct: 172  GSPCDANSSMAN----EFEDIDELPNLNSNSSTIDYNNHIHQYSQRNVYSEDNTTSTAGL 227

Query: 1063 DITSNPADPDLDA-LKFFIDPSTGPI-------------YSPTYEQMPEFGSSYFYGDVI 1200
            ++  N A  +L +     + P   PI             YS   E +P F  S     V 
Sbjct: 228  NMNMNMASTNLQSWTTSLLGPPLSPINSLLLKAFQIRNSYSFPKEMIPSFNHSSLQQGVS 287

Query: 1201 NCISN 1215
            N I N
Sbjct: 288  NMIQN 292



>gb:AC126222_1740520 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBb0014I10, complete sequence.
          Length = 392

 Score =  156 bits (395), Expect = 7e-37
 Identities = 80/167 (47%), Positives = 101/167 (60%), Gaps = 15/167 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL+ +   S   VS+I +VDI K +PWDLP        D EW+
Sbjct: 9   LPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADVDIYKFDPWDLPSKE--NYGDREWY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA----KVGMKKTLVYYLGRAPE 696
           FF P+DRKY NG R NRA   GYWKATG D+ I S  GA     VG+KK LV+Y GR P+
Sbjct: 67  FFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSSGGAATNESVGVKKALVFYKGRPPK 126

Query: 697 GKRTHWVIHEYRTT-----------ENKFDGTHAGQAPFVLCRLFRK 804
           G +T+W++HEYR               KF  T      +VLCR+++K
Sbjct: 127 GTKTNWIMHEYRLAAADAHAANTYRPMKFRNTSMRLDDWVLCRIYKK 173



>gb:AY057578_1563994 Arabidopsis thaliana unknown protein
           (At4g27410) mRNA, complete cds.>gb:AY087772_1572799
           Arabidopsis thaliana clone 38344 mRNA, complete
           sequence.>gb:AY091428_1574628 Arabidopsis thaliana
           unknown protein (At4g27410) mRNA, complete
           cds.>gb:AF083738_1766968 Arabidopsis thaliana clone
           sps433 unknown mRNA.>gb:AF428375_1799305 Arabidopsis
           thaliana AT4g27410/F27G19_10 mRNA, complete cds.
          Length = 297

 Score =  156 bits (395), Expect = 7e-37
 Identities = 79/196 (40%), Positives = 116/196 (59%), Gaps = 15/196 (7%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K+ G    + VI ++D+ K +PWDLP  +     + EW
Sbjct: 13  SLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQVIGDIDLYKFDPWDLPSKALFG--EKEW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ I++  G +VG+KK LV+Y G+AP+G +
Sbjct: 71  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITA-DGRRVGIKKALVFYAGKAPKGTK 129

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKV---------------ELKLDEGAEIS 840
           T+W++HEYR  E+      +    +VLCR+++K                E     G+  S
Sbjct: 130 TNWIMHEYRLIEHSRSHGSSKLDDWVLCRIYKKTSGSQRQAVTPVQACREEHSTNGSSSS 189

Query: 841 NSDEVDPIVSSPTVVK 888
           +S ++D ++ S   +K
Sbjct: 190 SSSQLDDVLDSFPEIK 205



>gb:AP002818_1822882 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0436E04.
          Length = 320

 Score =  156 bits (394), Expect = 1e-36
 Identities = 81/171 (47%), Positives = 105/171 (61%), Gaps = 6/171 (3%)
 Frame = +1

Query: 310 KVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAE-VSVIREVDICKHEPWDL 486
           +VER   LPP      G+RF PTDEE++  YL  K+  S    V+ I EVD+ K EPWDL
Sbjct: 7   QVERQPDLPP------GFRFHPTDEEIITFYLAPKVVDSRGFCVAAIGEVDLNKCEPWDL 60

Query: 487 PDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKT 666
           P  + +   + EW+F+C KDRKY  G R NRATE GYWKATGKD+ I       +GMKKT
Sbjct: 61  PGKAKMNG-EKEWYFYCQKDRKYPTGMRTNRATEAGYWKATGKDKEIFRDHHMLIGMKKT 119

Query: 667 LVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAP-----FVLCRLFRK 804
           LV+Y GRAP+G +T+WV+HEYR  +       +   P     + +CR+F K
Sbjct: 120 LVFYKGRAPKGDKTNWVMHEYRLADASPPPPPSSAEPPRQDDWAVCRIFHK 170



>gb:AY099786_1576811 Arabidopsis thaliana NAM-like protein
           (At1g52880) mRNA, complete cds.>gb:BT000292_1634570
           Arabidopsis thaliana NAM-like protein (At1g52880) mRNA,
           complete cds.
          Length = 320

 Score =  156 bits (394), Expect = 1e-36
 Identities = 82/171 (47%), Positives = 107/171 (62%), Gaps = 14/171 (8%)
 Frame = +1

Query: 334 PPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLP-DMSFVES 510
           PP  +LP G+RF PTDEELV HYLK K       V++I +VD+ K +PW+LP   SF E 
Sbjct: 12  PPQPNLPPGFRFHPTDEELVIHYLKRKADSVPLPVAIIADVDLYKFDPWELPAKASFGE- 70

Query: 511 HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA---KVGMKKTLVYYL 681
              EW+FF P+DRKY NG R NRA   GYWKATG D+ + S  G    KVG+KK LV+Y 
Sbjct: 71  --QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTGGGGSKKVGVKKALVFYS 128

Query: 682 GRAPEGKRTHWVIHEYRTTENKFDGTHAGQ----------APFVLCRLFRK 804
           G+ P+G ++ W++HEYR T+NK   TH               +VLCR+++K
Sbjct: 129 GKPPKGVKSDWIMHEYRLTDNK--PTHICDFGNKKNSLRLDDWVLCRIYKK 177



>pir|B86466|B86466 hypothetical protein F23M19.13 - Arabidopsis
           thaliana>gb:AE005172_892222 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY133552_1581375 Arabidopsis thaliana
           At1g34190/F23M19.13 mRNA, complete
           cds.>gb:BT000730_1635003 Arabidopsis thaliana clone
           RAFL09-58-M22 (R18947) putative NAM (no apical meristem)
           protein (At1g34190) mRNA, complete
           cds.>gb:F23M19_1677954 Arabidopsis thaliana chromosome 1
           BAC F23M19 sequence, complete
           sequence.>gb:AF361813_1791405 Arabidopsis thaliana
           F23M19.13/F23M19.13 mRNA, complete cds.
          Length = 557

 Score =  156 bits (394), Expect = 1e-36
 Identities = 76/149 (51%), Positives = 97/149 (65%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV +YLK KI      V+VI  VD+ K +P +LP  S +++ D +WF+F 
Sbjct: 19  GFRFHPTDEELVMYYLKRKICRKRLRVNVIGVVDVYKMDPEELPGQSMLKTGDRQWFYFT 78

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P+ RKY N  R NR TE GYWKATGKDR I       VG+KKTLV+Y GRAP G+RT WV
Sbjct: 79  PRSRKYPNAARSNRGTENGYWKATGKDRVI-EYNSRSVGLKKTLVFYRGRAPSGERTDWV 137

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +HEY   E++       Q  + L +LF+K
Sbjct: 138 MHEYTMDEDELGRCKNPQEYYALYKLFKK 166



>pir|A96570|A96570 NAM-like protein, 59502-58357 [imported] -
           Arabidopsis thaliana>gb:AE005173_893198 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC019018_1538494 Arabidopsis thaliana
           chromosome 1 BAC F14G24 genomic sequence, complete
           sequence.>gb:AF123310_1769886 Arabidopsis thaliana NAC
           domain protein NAM gene, complete
           cds.>gb:AF123311_1769887 Arabidopsis thaliana NAC domain
           protein NAM mRNA, complete cds.
          Length = 320

 Score =  156 bits (394), Expect = 1e-36
 Identities = 82/171 (47%), Positives = 107/171 (62%), Gaps = 14/171 (8%)
 Frame = +1

Query: 334 PPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLP-DMSFVES 510
           PP  +LP G+RF PTDEELV HYLK K       V++I +VD+ K +PW+LP   SF E 
Sbjct: 12  PPQPNLPPGFRFHPTDEELVIHYLKRKADSVPLPVAIIADVDLYKFDPWELPAKASFGE- 70

Query: 511 HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA---KVGMKKTLVYYL 681
              EW+FF P+DRKY NG R NRA   GYWKATG D+ + S  G    KVG+KK LV+Y 
Sbjct: 71  --QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTGGGGSKKVGVKKALVFYS 128

Query: 682 GRAPEGKRTHWVIHEYRTTENKFDGTHAGQ----------APFVLCRLFRK 804
           G+ P+G ++ W++HEYR T+NK   TH               +VLCR+++K
Sbjct: 129 GKPPKGVKSDWIMHEYRLTDNK--PTHICDFGNKKNSLRLDDWVLCRIYKK 177



>gb:AF011555_1761174 Lycopersicon esculentum jasmonic acid 2 (LEJA2)
           mRNA, complete cds.
          Length = 349

 Score =  155 bits (393), Expect = 1e-36
 Identities = 74/154 (48%), Positives = 105/154 (68%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K+ G +  + +I E+D+ K +PW LP  S     + EW
Sbjct: 13  SLPPGFRFYPTDEELLVQYLCKKVAGHDFPLQIIGEIDLYKFDPWVLP--SKATFGEKEW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ I+S +G KVG+KK LV+Y+G+AP+G +
Sbjct: 71  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITS-QGRKVGIKKALVFYVGKAPKGSK 129

Query: 706 THWVIHEYRTTENKFDGTHAGQA-PFVLCRLFRK 804
           T+W++HEYR  E+      + +   +VLCR+++K
Sbjct: 130 TNWIMHEYRLFESSRKNNGSSKLDEWVLCRIYKK 163



>gb:AC154033_1745267 Solanum demissum chromosome 5 clone PGEC132D05
           map MAP_LOC, complete sequence.
          Length = 282

 Score =  155 bits (393), Expect = 1e-36
 Identities = 76/161 (47%), Positives = 109/161 (67%), Gaps = 6/161 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ +YL+ + T     VS+I E+D+ K +PW+LP+ +  E  +NEW+
Sbjct: 9   LPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDPWELPEKA--EFGENEWY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ I S     VG+KK LV+Y G+ P+G +T
Sbjct: 67  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-ANKYVGIKKALVFYKGKPPKGVKT 125

Query: 709 HWVIHEYRTTENKFDGTHAGQA------PFVLCRLFRKVEL 813
            W++HEYR +++K   T++ Q+       +VLCR+++K  L
Sbjct: 126 DWIMHEYRLSDSK-SQTYSKQSGSMRLDDWVLCRIYKKKNL 165



>gb:AC151803_1745127 Solanum demissum chromosome 5 BAC PGEC979H09
           genomic sequence, complete sequence.
          Length = 281

 Score =  155 bits (393), Expect = 1e-36
 Identities = 76/161 (47%), Positives = 109/161 (67%), Gaps = 6/161 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ +YL+ + T     VS+I E+D+ K +PW+LP+ +  E  +NEW+
Sbjct: 9   LPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDPWELPEKA--EFGENEWY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ I S     VG+KK LV+Y G+ P+G +T
Sbjct: 67  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-ANKYVGIKKALVFYKGKPPKGVKT 125

Query: 709 HWVIHEYRTTENKFDGTHAGQA------PFVLCRLFRKVEL 813
            W++HEYR +++K   T++ Q+       +VLCR+++K  L
Sbjct: 126 DWIMHEYRLSDSK-SQTYSKQSGSMRLDDWVLCRIYKKKNL 165



>gb:AP006049_1860485 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0016N23.
          Length = 340

 Score =  155 bits (392), Expect = 2e-36
 Identities = 84/183 (45%), Positives = 110/183 (60%), Gaps = 4/183 (2%)
 Frame = +1

Query: 271 SLCELCGVEMAVLKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSV-I 447
           +L E+ G EMA             H LP G+RF PTDEELV  YL  K+        V I
Sbjct: 4   ALWEMLGEEMAAAAAAAGE-----HGLPPGFRFHPTDEELVTFYLAAKVFNGACCGGVDI 58

Query: 448 REVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI 627
            EVD+ + EPW+LP+ +     + EW+FF  +DRKY  G R NRAT  GYWKATGKDR +
Sbjct: 59  AEVDLNRCEPWELPEAA--RMGEKEWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDREV 116

Query: 628 ---SSRKGAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLF 798
              ++  GA +GMKKTLV+Y GRAP G++T WV+HEYR   +      + +  +V+CR+F
Sbjct: 117 VAAAAAGGALIGMKKTLVFYKGRAPRGEKTKWVLHEYRLDGDFAAARRSTKEEWVICRIF 176

Query: 799 RKV 807
            KV
Sbjct: 177 HKV 179



>gb:AF402603_1796296 Phaseolus vulgaris NAC domain protein NAC2
           mRNA, complete cds.
          Length = 256

 Score =  155 bits (392), Expect = 2e-36
 Identities = 79/157 (50%), Positives = 106/157 (67%), Gaps = 5/157 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ +YL  + T      S+I EVD+ K +PW+LPD +  E  +NEW+
Sbjct: 9   LPPGFRFHPTDEELIVYYLCNQATSKPCPASIIPEVDLYKFDPWELPDKT--EFGENEWY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKR 705
           FF P+DRKY NG R NRAT  GYWKATG D+ I S  G+K VG+KK+LV+Y GR P+G +
Sbjct: 67  FFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYS--GSKLVGVKKSLVFYKGRPPKGDK 124

Query: 706 THWVIHEYRTTENKFDGTHAGQA----PFVLCRLFRK 804
           T W++HEYR  E+K        +     +VLCR+++K
Sbjct: 125 TDWIMHEYRLAESKQPVNRKIGSMRLDDWVLCRIYKK 161



>gb:AY704177_1623696 Solanum tuberosum jasmonic acid 2 mRNA,
           complete cds.
          Length = 349

 Score =  155 bits (392), Expect = 2e-36
 Identities = 75/154 (48%), Positives = 106/154 (68%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K+ G +  + +I E+D+ K +PW LP  S     + EW
Sbjct: 13  SLPPGFRFYPTDEELLVQYLCKKVAGHDFPLQIIGEIDLYKFDPWVLP--SKATFGEKEW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ I+S +G KVG+KK LV+Y+G+AP+G +
Sbjct: 71  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITS-QGRKVGIKKALVFYVGKAPKGSK 129

Query: 706 THWVIHEYRTTE-NKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR  E +K +   +    +VLCR+++K
Sbjct: 130 TNWIMHEYRLFESSKKNNGSSKLDEWVLCRIYKK 163



>gb:AY087700_1572728 Arabidopsis thaliana clone 37792 mRNA, complete
           sequence.
          Length = 315

 Score =  155 bits (392), Expect = 2e-36
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+         I EVD+ K EPW+LP  + +   + EW+
Sbjct: 3   LPPGFRFHPTDEELITHYLHKKVLDLGFSAKAIGEVDLNKAEPWELPYKAKIG--EKEWY 60

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRAT+ GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G++T
Sbjct: 61  FFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIFRGK-SLVGMKKTLVFYRGRAPKGQKT 119

Query: 709 HWVIHEYRTTENKFDGTH---AGQAPFVLCRLFRK 804
           +WV+HEYR  + K    +     +  +V+CR+F K
Sbjct: 120 NWVMHEYR-LDGKLSAHNLPKTAKNEWVICRVFHK 153



>gb:AB019235_1514230 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMI9.
          Length = 348

 Score =  155 bits (392), Expect = 2e-36
 Identities = 76/156 (48%), Positives = 105/156 (67%), Gaps = 1/156 (0%)
 Frame = +1

Query: 340 LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDM-SFVESHD 516
           L  +P GYRF PTDEELVD+YLK K+     +V VI++VD+ K EPWD+ ++       +
Sbjct: 4   LAHIPPGYRFHPTDEELVDYYLKNKVAFPGMQVDVIKDVDLYKIEPWDIQELCGRGTGEE 63

Query: 517 NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPE 696
            EW+FF  KD+KY  G R NRAT  G+WKATG+D+ I S K   VGM+KTLV+Y GRAP 
Sbjct: 64  REWYFFSHKDKKYPTGTRTNRATGSGFWKATGRDKAIYS-KQELVGMRKTLVFYKGRAPN 122

Query: 697 GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           G+++ W++HEYR   ++    H  +  +V+CR F+K
Sbjct: 123 GQKSDWIMHEYRLETDENGPPH--EEGWVVCRAFKK 156



>gb:AB010070_1510877 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBK20.>gb:BT006419_1639306 Arabidopsis thaliana
           At5g07680 gene, complete cds.
          Length = 329

 Score =  155 bits (392), Expect = 2e-36
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+         I EVD+ K EPW+LP  + +   + EW+
Sbjct: 17  LPPGFRFHPTDEELITHYLHKKVLDLGFSAKAIGEVDLNKAEPWELPYKAKIG--EKEWY 74

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FFC +DRKY  G R NRAT+ GYWKATGKD+ I   K + VGMKKTLV+Y GRAP+G++T
Sbjct: 75  FFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIFRGK-SLVGMKKTLVFYRGRAPKGQKT 133

Query: 709 HWVIHEYRTTENKFDGTH---AGQAPFVLCRLFRK 804
           +WV+HEYR  + K    +     +  +V+CR+F K
Sbjct: 134 NWVMHEYR-LDGKLSAHNLPKTAKNEWVICRVFHK 167



>gb:AB008266_1510416 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MHJ24.
          Length = 356

 Score =  155 bits (392), Expect = 2e-36
 Identities = 76/163 (46%), Positives = 103/163 (63%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +L  G+RF PTD ELV +YLK K+ G + +V  I EVDI K EP DLPD S + + D +W
Sbjct: 5   NLAPGFRFHPTDVELVRYYLKRKVMGKKFQVDAIAEVDIYKFEPPDLPDKSCLGTGDLKW 64

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FFCP+++KY  G + NR+TE GYWK TG+DR +S       G  +TL+Y+ G+ P G R
Sbjct: 65  YFFCPREKKYPKGGKANRSTECGYWKTTGRDRDVSYNDEV-TGKIRTLIYHYGKIPRGDR 123

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAE 834
           T WVIHEYR  +      +  Q  +VLC LF+K  L    G++
Sbjct: 124 TDWVIHEYRLEDKVLAQKNVPQDTYVLCVLFKKNGLGPRHGSQ 166



>gb:AP004679_1843237 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0021N09.
          Length = 373

 Score =  155 bits (391), Expect = 2e-36
 Identities = 80/160 (50%), Positives = 105/160 (65%), Gaps = 8/160 (5%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ +YL  K+         I E+D+ K EPW+LP+ +  +  + EW+
Sbjct: 23  LPPGFRFHPTDEELITYYLLRKVVDGSFNGRAIAEIDLNKCEPWELPEKA--KMGEKEWY 80

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGKR 705
           F+  +DRKY  G R NRAT  GYWKATGKDR I S+R GA VGMKKTLV+Y GRAP+G++
Sbjct: 81  FYSLRDRKYPTGLRTNRATGAGYWKATGKDREIRSARTGALVGMKKTLVFYRGRAPKGQK 140

Query: 706 THWVIHEYRTTENKFDGTHA-------GQAPFVLCRLFRK 804
           T WV+HEYR      DGT+A        +  +V+ R+F K
Sbjct: 141 TQWVMHEYR-----LDGTYAYHFLSSSTRDEWVIARIFTK 175



>gb:AP004610_1842061 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1109A06.
          Length = 328

 Score =  155 bits (391), Expect = 2e-36
 Identities = 81/174 (46%), Positives = 104/174 (59%), Gaps = 9/174 (5%)
 Frame = +1

Query: 310 KVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAE-VSVIREVDICKHEPWDL 486
           +VER   LPP      G+RF PTDEE++  YL  K+  S    V+ I EVD+ K EPWDL
Sbjct: 7   QVERQPDLPP------GFRFHPTDEEIITFYLAPKVVDSRGFCVAAIGEVDLNKCEPWDL 60

Query: 487 PDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKT 666
           P  + +   + EW+F+C KDRKY  G R NRATE GYWKATGKD+ I       +GMKKT
Sbjct: 61  PGKAKMNG-EKEWYFYCQKDRKYPTGMRTNRATEAGYWKATGKDKEIFRNHHMLIGMKKT 119

Query: 667 LVYYLGRAPEGKRTHWVIHEYRTTENK--------FDGTHAGQAPFVLCRLFRK 804
           LV+Y GRAP+G +T+WV+HEYR  +                 Q  + +CR+F K
Sbjct: 120 LVFYKGRAPKGDKTNWVMHEYRLADASPPQPPPPPSSAEPPRQDDWAVCRIFHK 173



>gb:AY245887_1592572 Brassica napus NAC-domain protein 485 (NAC485)
           mRNA, complete cds.
          Length = 300

 Score =  155 bits (391), Expect = 2e-36
 Identities = 72/153 (47%), Positives = 101/153 (66%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K+ G    + +I ++D+ K +PWDLP  +     + EW
Sbjct: 13  SLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQIIGDIDLYKFDPWDLPSKALFG--EKEW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ I S  G +VG+KK LV+Y G+AP+G +
Sbjct: 71  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIMS-DGHRVGIKKALVFYAGKAPKGTK 129

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR  E+      +    +VLCR+++K
Sbjct: 130 TNWIMHEYRLIEHSRSHGSSKLDDWVLCRIYKK 162



>gb:AB028183_1517819 Oryza sativa mRNA for OsNAC4 protein, complete
           cds.>gb:AP003411_1829034 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1148D12.>gb:AP004331_1840324 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0085D07.
          Length = 316

 Score =  155 bits (391), Expect = 2e-36
 Identities = 77/158 (48%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV HYL  K+      V +I EVD+ K +PWDLP+ +       EW
Sbjct: 18  NLPPGFRFHPTDEELVVHYLCRKVARQPLPVPIIAEVDLYKLDPWDLPEKALFGR--KEW 75

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGK 702
           +FF P+DRKY NG R NRA  RGYWKATG D+ ++ +  A+ VG+KK LV+Y G+AP G 
Sbjct: 76  YFFTPRDRKYPNGSRPNRAAGRGYWKATGADKPVAPKGSARTVGIKKALVFYSGKAPRGV 135

Query: 703 RTHWVIHEYRTTE-NKFDGTHAGQA---PFVLCRLFRK 804
           +T W++HEYR  + ++  G   G      +VLCRL+ K
Sbjct: 136 KTDWIMHEYRLADADRAPGGKKGSQKLDEWVLCRLYNK 173



>gb:AB002560_1508703 Arabidopsis thaliana DNA for CUC2, complete
           cds.>gb:AB007644_1510134 Arabidopsis thaliana genomic
           DNA, chromosome 5, TAC clone:K19P17.
          Length = 375

 Score =  155 bits (391), Expect = 2e-36
 Identities = 82/159 (51%), Positives = 106/159 (66%), Gaps = 4/159 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+         I EVD+ K EPW LP  +  +  + EW+
Sbjct: 17  LPPGFRFHPTDEELITHYLLRKVLDGCFSSRAIAEVDLNKCEPWQLPGRA--KMGEKEWY 74

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGKR 705
           FF  +DRKY  G R NRATE GYWKATGKDR I SS+  A VGMKKTLV+Y GRAP+G++
Sbjct: 75  FFSLRDRKYPTGLRTNRATEAGYWKATGKDREIFSSKTCALVGMKKTLVFYKGRAPKGEK 134

Query: 706 THWVIHEYRTTENKFDG---THAGQAPFVLCRLFRKVEL 813
           ++WV+HEYR  E KF     + + +  +V+ R+F+K  L
Sbjct: 135 SNWVMHEYR-LEGKFSYHFISRSSKDEWVISRVFQKTTL 172



>gb:BT020413_1642808 Arabidopsis thaliana At2g46770 mRNA, complete
           cds.
          Length = 365

 Score =  154 bits (390), Expect = 3e-36
 Identities = 73/169 (43%), Positives = 109/169 (64%), Gaps = 14/169 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNEW 525
           +P G+RF PT+EEL+ +YL+ K+   E ++ VIR+VD+ K EPWD+ +M  +  +  N+W
Sbjct: 16  VPPGFRFHPTEEELLQYYLRKKVNSIEIDLDVIRDVDLNKLEPWDIQEMCKIGTTPQNDW 75

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I S  G ++GM+KTLV+Y GRAP G++
Sbjct: 76  YFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS-NGRRIGMRKTLVFYKGRAPHGQK 134

Query: 706 THWVIHEYRTTEN-------------KFDGTHAGQAPFVLCRLFRKVEL 813
           + W++HEYR  +N                G  +    +V+CR+F+K  L
Sbjct: 135 SDWIMHEYRLDDNIISPEDVTVHEVVSIIGEASQDEGWVVCRIFKKKNL 183



>gb:BT002931_1636519 Arabidopsis thaliana clone RAFL15-02-N12
           (R20259) putative NAM (no apical meristem) protein
           (At2g46770) mRNA, complete cds.
          Length = 365

 Score =  154 bits (390), Expect = 3e-36
 Identities = 73/169 (43%), Positives = 109/169 (64%), Gaps = 14/169 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNEW 525
           +P G+RF PT+EEL+ +YL+ K+   E ++ VIR+VD+ K EPWD+ +M  +  +  N+W
Sbjct: 16  VPPGFRFHPTEEELLQYYLRKKVNSIEIDLDVIRDVDLNKLEPWDIQEMCKIGTTPQNDW 75

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I S  G ++GM+KTLV+Y GRAP G++
Sbjct: 76  YFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS-NGRRIGMRKTLVFYKGRAPHGQK 134

Query: 706 THWVIHEYRTTEN-------------KFDGTHAGQAPFVLCRLFRKVEL 813
           + W++HEYR  +N                G  +    +V+CR+F+K  L
Sbjct: 135 SDWIMHEYRLDDNIISPEDVTVHEVVSIIGEASQDEGWVVCRIFKKKNL 183



>gb:AY087839_1572866 Arabidopsis thaliana clone 38858 mRNA, complete
           sequence.
          Length = 323

 Score =  154 bits (390), Expect = 3e-36
 Identities = 77/166 (46%), Positives = 102/166 (61%), Gaps = 14/166 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYLK K       VS+I E+D+ K +PW+LP  +    H  EW+
Sbjct: 16  LPPGFRFHPTDEELVVHYLKKKAASVPLPVSIIAEIDLYKFDPWELPSKASFGEH--EWY 73

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ I +    KVG+KK LV+Y G+ P+G +T
Sbjct: 74  FFSPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKT 133

Query: 709 HWVIHEYRTTENKFDGTHAGQAP--------------FVLCRLFRK 804
            W++HEYR T+     + A + P              +VLCR+++K
Sbjct: 134 DWIMHEYRLTDGNL--STAAKPPDLTTTRKNSLRLDDWVLCRIYKK 177



>gb:AY084508_1569597 Arabidopsis thaliana clone 109984 mRNA,
           complete sequence.
          Length = 317

 Score =  154 bits (390), Expect = 3e-36
 Identities = 72/153 (47%), Positives = 101/153 (66%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K  G +  + +I E+D+ K +PW LP  +     + EW
Sbjct: 13  SLPPGFRFYPTDEELMVEYLCRKAAGHDFSLQLIAEIDLYKFDPWVLPSKALFG--EKEW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ IS+ +G +VG+KK LV+Y+G+AP+G +
Sbjct: 71  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIST-EGRRVGIKKALVFYIGKAPKGTK 129

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR  E            +VLCR+++K
Sbjct: 130 TNWIMHEYRLIEPSRRNGSTNLDDWVLCRIYKK 162



>gb:A82386_1450954 Sequence 11 from Patent
           WO9856811.>gb:TSP010830_1725899 Triticum sp. mRNA for
           GRAB2 protein.
          Length = 351

 Score =  154 bits (390), Expect = 3e-36
 Identities = 79/160 (49%), Positives = 101/160 (63%), Gaps = 4/160 (2%)
 Frame = +1

Query: 337 PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD 516
           P  +LP G+RF PTDEE+V HYL  K+        VI +VD+ K+EPW+LP ++  +  +
Sbjct: 15  PQLALPPGFRFHPTDEEVVTHYLTRKVLRESFSCQVITDVDLNKNEPWELPGLA--KMGE 72

Query: 517 NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AKVGMKKTLVYYLGR 687
            EWFFF  K RKY  G R NRAT++GYWKATGKD+ I   KG     VGMKKTLV+Y GR
Sbjct: 73  KEWFFFAHKGRKYPTGTRTNRATKKGYWKATGKDKEIFRGKGRDAVLVGMKKTLVFYTGR 132

Query: 688 APEGKRTHWVIHEYRTT-ENKFDGTHAGQAPFVLCRLFRK 804
           AP G +T WV+HEYR   E         +  + +CR+F K
Sbjct: 133 APSGGKTPWVMHEYRLEGELPHRLPRTAKDDWAVCRVFNK 172



>pir|C84671|C84671 NAM (no apical meristem)-like protein [imported] -
            Arabidopsis thaliana>gb:AC006233_1533780 Arabidopsis
            thaliana chromosome 2 clone F12K2 map B68, complete
            sequence.
          Length = 335

 Score =  154 bits (390), Expect = 3e-36
 Identities = 87/237 (36%), Positives = 127/237 (53%)
 Frame = +1

Query: 358  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
            G+RF PTD EL+ +YL+ KI G E  V+VI EV+I K EPWDLP+ S ++S +NEWF+FC
Sbjct: 17   GFRFSPTDVELISYYLRRKIDGDENSVAVIAEVEIYKFEPWDLPEESKLKS-ENEWFYFC 75

Query: 538  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
             + RKY +G +  RAT+ GYWKATGK+R++ S     VG K+TLV+++GRAP G+RT W+
Sbjct: 76   ARGRKYPHGSQSRRATQLGYWKATGKERSVKSGNQV-VGTKRTLVFHIGRAPRGERTEWI 134

Query: 718  IHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVVKTPA 897
            +HEY           A Q   V+CRL +  + +       S     D +V     V    
Sbjct: 135  MHEYCI-------HGAPQDALVVCRLRKNADFRAS-----STQKMEDGVVQDDGYV---- 178

Query: 898  EDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTEDQVLDI 1068
                  GG       + +++   P     E+  V        + C A+   D ++ +
Sbjct: 179  ---GQRGGLEKEDKSYYESEHQIPNGDIAESSNVVEDQADTDDDCYAEILNDDIIKL 232



>pir|T02678|T02678 NAM (no apical meristem)-like protein [imported]
           - Arabidopsis thaliana>gb:AC005310_1532481 Arabidopsis
           thaliana chromosome 2 clone F19D11 map CIC06C03,
           complete sequence.
          Length = 399

 Score =  154 bits (390), Expect = 3e-36
 Identities = 73/169 (43%), Positives = 109/169 (64%), Gaps = 14/169 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNEW 525
           +P G+RF PT+EEL+ +YL+ K+   E ++ VIR+VD+ K EPWD+ +M  +  +  N+W
Sbjct: 15  VPPGFRFHPTEEELLQYYLRKKVNSIEIDLDVIRDVDLNKLEPWDIQEMCKIGTTPQNDW 74

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I S  G ++GM+KTLV+Y GRAP G++
Sbjct: 75  YFFSHKDKKYPTGTRTNRATAAGFWKATGRDKIIYS-NGRRIGMRKTLVFYKGRAPHGQK 133

Query: 706 THWVIHEYRTTEN-------------KFDGTHAGQAPFVLCRLFRKVEL 813
           + W++HEYR  +N                G  +    +V+CR+F+K  L
Sbjct: 134 SDWIMHEYRLDDNIISPEDVTVHEVVSIIGEASQDEGWVVCRIFKKKNL 182



>gb:BT008346_1639563 Arabidopsis thaliana At1g61110 mRNA, complete
           cds.>gb:AK117878_1815887 Arabidopsis thaliana At1g61110
           mRNA for unknown protein, complete cds, clone:
           RAFL19-05-K20.
          Length = 323

 Score =  154 bits (389), Expect = 4e-36
 Identities = 77/166 (46%), Positives = 102/166 (61%), Gaps = 14/166 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYLK K       VS+I E+D+ K +PW+LP  +    H  EW+
Sbjct: 16  LPPGFRFHPTDEELVVHYLKKKADSVPLPVSIIAEIDLYKFDPWELPSKASFGEH--EWY 73

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ I +    KVG+KK LV+Y G+ P+G +T
Sbjct: 74  FFSPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKT 133

Query: 709 HWVIHEYRTTENKFDGTHAGQAP--------------FVLCRLFRK 804
            W++HEYR T+     + A + P              +VLCR+++K
Sbjct: 134 DWIMHEYRLTDGNL--STAAKPPDLTTTRKNSLRLDDWVLCRIYKK 177



>gb:AY086093_1571151 Arabidopsis thaliana clone 21243 mRNA, complete
           sequence.
          Length = 320

 Score =  154 bits (389), Expect = 4e-36
 Identities = 75/142 (52%), Positives = 96/142 (67%), Gaps = 4/142 (2%)
 Frame = +1

Query: 334 PPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLP-DMSFVES 510
           PP  +LP G+RF PTDEELV HYLK K       V++I +VD+ K +PW+LP   SF E 
Sbjct: 12  PPQPNLPPGFRFHPTDEELVIHYLKRKADSVPLPVAIIADVDLYKFDPWELPAKASFGE- 70

Query: 511 HDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA---KVGMKKTLVYYL 681
              EW+FF P+DRKY NG R NRA   GYWKATG D+ + S  G    KVG+KK LV+Y 
Sbjct: 71  --QEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTGGGGSKKVGVKKALVFYS 128

Query: 682 GRAPEGKRTHWVIHEYRTTENK 747
           G+ P+G ++ W++HEYR T+NK
Sbjct: 129 GKPPKGVKSDWIMHEYRLTDNK 150



>pir|H96636|H96636 hypothetical protein F11P17.16 [imported] -
           Arabidopsis thaliana>gb:AE005173_893782 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC002294_1530176 Arabidopsis thaliana
           chromosome I BAC F11P17 genomic sequence, complete
           sequence.
          Length = 300

 Score =  154 bits (389), Expect = 4e-36
 Identities = 77/166 (46%), Positives = 102/166 (61%), Gaps = 14/166 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYLK K       VS+I E+D+ K +PW+LP  +    H  EW+
Sbjct: 13  LPPGFRFHPTDEELVVHYLKKKADSVPLPVSIIAEIDLYKFDPWELPSKASFGEH--EWY 70

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ I +    KVG+KK LV+Y G+ P+G +T
Sbjct: 71  FFSPRDRKYPNGVRPNRAATSGYWKATGTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKT 130

Query: 709 HWVIHEYRTTENKFDGTHAGQAP--------------FVLCRLFRK 804
            W++HEYR T+     + A + P              +VLCR+++K
Sbjct: 131 DWIMHEYRLTDGNL--STAAKPPDLTTTRKNSLRLDDWVLCRIYKK 174



>gb:AP002842_1823084 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0075G19.
          Length = 364

 Score =  154 bits (388), Expect = 5e-36
 Identities = 76/161 (47%), Positives = 105/161 (65%), Gaps = 9/161 (5%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVE-----SH 513
           +P G+RF PTDEELVD+YL+ K+     +++VI++VD+ K EPWDL +   +        
Sbjct: 17  VPPGFRFHPTDEELVDYYLRKKVAARRIDLNVIKDVDLYKIEPWDLQERCRINGGSAAEE 76

Query: 514 DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK--GAKVGMKKTLVYYLGR 687
            NEW+FF  KD+KY  G R NRAT  G+WKATG+D+ I + K     VGM+KTLVYY GR
Sbjct: 77  QNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIYATKQHSLLVGMRKTLVYYRGR 136

Query: 688 APEGKRTHWVIHEYR--TTENKFDGTHAGQAPFVLCRLFRK 804
           AP G ++ W++HEYR  TTE         +  +V+CR+F+K
Sbjct: 137 APNGHKSDWIMHEYRLETTET----APPQEEGWVVCRVFKK 173



>gb:AB022218_1515097 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJK13.>gb:AB049070_1520760 Arabidopsis
           thaliana AtNAC3 mRNA, complete cds.>gb:AC024081_1539276
           Arabidopsis thaliana chromosome III P1 MJK13 genomic
           sequence, complete sequence.
          Length = 317

 Score =  154 bits (388), Expect = 5e-36
 Identities = 72/153 (47%), Positives = 101/153 (66%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K  G +  + +I E+D+ K +PW LP  +     + EW
Sbjct: 13  SLPPGFRFYPTDEELMVEYLCRKAAGHDFSLQLIAEIDLYKFDPWVLPSKALFG--EKEW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ IS+ +G +VG+KK LV+Y+G+AP+G +
Sbjct: 71  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIST-EGRRVGIKKALVFYIGKAPKGTK 129

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR  E            +VLCR+++K
Sbjct: 130 TNWIMHEYRLIEPSRRNGSTKLDDWVLCRIYKK 162



>pir|G84559|G84559 probable NAM (no apical meristem)-like protein
           [imported] - Arabidopsis thaliana>gb:AC006201_1533588
           Arabidopsis thaliana chromosome 2 clone T27K22 map c245,
           complete sequence.
          Length = 365

 Score =  154 bits (388), Expect = 5e-36
 Identities = 77/177 (43%), Positives = 111/177 (62%), Gaps = 5/177 (2%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNE 522
           S+P G+RF PTDEELV +YL+ KI   + ++ VIR++D+ + EPWDL +   +     NE
Sbjct: 8   SVPPGFRFHPTDEELVGYYLRKKIASQKIDLDVIRDIDLYRIEPWDLQEQCRIGYEEQNE 67

Query: 523 WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
           W+FF  KD+KY  G R NRAT  G+WKATG+D+ +   K   +GM+KTLV+Y GRAP GK
Sbjct: 68  WYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD-KTKLIGMRKTLVFYKGRAPNGK 126

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNS----DEVDP 861
           ++ W++HEYR   +  +     +  +V+CR F+K      +  E  +S    DEV P
Sbjct: 127 KSDWIMHEYRLESD--ENAPPQEEGWVVCRAFKKRATGQAKNTETWSSSYFYDEVAP 181



>pir|B96742|B96742 NAM-like protein, 48543-50167 [imported] -
            Arabidopsis thaliana>gb:AE005173_894740 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC021665_1538736 Arabidopsis thaliana
            chromosome 1 BAC F17M19 genomic sequence, complete
            sequence.>gb:AY085424_1570493 Arabidopsis thaliana clone
            151034 mRNA, complete sequence.
          Length = 324

 Score =  154 bits (388), Expect = 5e-36
 Identities = 91/248 (36%), Positives = 132/248 (53%), Gaps = 11/248 (4%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD-NE 522
            S+P G+RF PT+EELV +YL  KI   ++ + VI E+D+ K EPWD+     +   + NE
Sbjct: 8    SMPPGFRFHPTEEELVGYYLDRKINSMKSALDVIVEIDLYKMEPWDIQARCKLGYEEQNE 67

Query: 523  WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
            W+FF  KDRKY  G R NRAT  G+WKATG+D+ + S K + +GM+KTLVYY GRAP G+
Sbjct: 68   WYFFSHKDRKYPTGTRTNRATAAGFWKATGRDKAVLS-KNSVIGMRKTLVYYKGRAPNGR 126

Query: 703  RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK---------VELKLDEGAEISNSDEV 855
            ++ W++HEYR   ++       +  +V+CR FRK          E   ++   + +S+  
Sbjct: 127  KSDWIMHEYRLQNSEL--APVQEEGWVVCRAFRKPIPNQRPLGYEPWQNQLYHVESSNNY 184

Query: 856  DPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFP-IDSNSNSC 1032
               V+  T     A          LM + H    P     S  +   +  P +DS S S 
Sbjct: 185  SSSVTMNTSHHIGASSSSHNLNQMLMSNNHY--NPNNTSSSMHQYGNIELPQLDSPSLSP 242

Query: 1033 IADTTEDQ 1056
               T +DQ
Sbjct: 243  SLGTNKDQ 250



>gb:AC092780_1735718 Oryza sativa chromosome 3 BAC OSJNBb0079B16
           genomic sequence, complete sequence.
          Length = 323

 Score =  153 bits (387), Expect = 6e-36
 Identities = 85/176 (48%), Positives = 112/176 (63%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV +YL  K++        I +VD+ K EPWDLP  S     + EW+
Sbjct: 5   LPPGFRFHPTDEELVTYYLARKVSDFGFATRAIADVDLNKCEPWDLP--SKASMGEKEWY 62

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF  +DRKY  G R NRAT+ GYWK TGKD+ I    GA  GMKKTLV+Y GRAP+G +T
Sbjct: 63  FFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEI-FHGGALAGMKKTLVFYRGRAPKGAKT 121

Query: 709 HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSP 876
            WV+HEYR  ++KF    A +  +V+CR+F+K++  L +       D+VD   +SP
Sbjct: 122 SWVMHEYR-LQSKFPYKPA-KDEWVVCRVFKKLQCHLAKPR--PPHDDVDGDGASP 173



>gb:A82382_1450952 Sequence 7 from Patent WO9856811.
          Length = 154

 Score =  153 bits (387), Expect = 6e-36
 Identities = 78/156 (50%), Positives = 99/156 (63%), Gaps = 4/156 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEE+V HYL  K+        VI +VD+ K+EPW+LP ++  +  + EWF
Sbjct: 1   LPPGFRFHPTDEEVVTHYLTRKVLRESFSCQVITDVDLNKNEPWELPGLA--KMGEKEWF 58

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AKVGMKKTLVYYLGRAPEG 699
           FF  K RKY  G R NRAT++GYWKATGKD+ I   KG     VGMKKTLV+Y GRAP G
Sbjct: 59  FFAHKGRKYPTGTRTNRATKKGYWKATGKDKEIFRGKGRDAVLVGMKKTLVFYTGRAPSG 118

Query: 700 KRTHWVIHEYRTT-ENKFDGTHAGQAPFVLCRLFRK 804
            +T WV+HEYR   E         +  + +CR+F K
Sbjct: 119 GKTPWVMHEYRLEGELPHRLPRTAKDDWAVCRVFNK 154



>pir|H96791|H96791 unknown protein F14G6.2 [imported] - Arabidopsis
           thaliana>gb:AE005173_895173 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC012394_1537622 Arabidopsis thaliana
           chromosome 1 BAC F15M4 genomic sequence, complete
           sequence.>gb:AC015450_1538034 Arabidopsis thaliana
           chromosome 1 BAC F14G6 genomic sequence, complete
           sequence.>gb:AF543194_1810238 Arabidopsis thaliana
           cup-shaped cotyledon 3 (CUC3) gene, complete cds.
          Length = 334

 Score =  153 bits (387), Expect = 6e-36
 Identities = 78/153 (50%), Positives = 100/153 (65%), Gaps = 1/153 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+  YL  KI         I EVD+ + EPW+LP+M+  +  + EW+
Sbjct: 22  LPPGFRFHPTDEELITFYLASKIFHGGLSGIHISEVDLNRCEPWELPEMA--KMGEREWY 79

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKR 705
           F+  +DRKY  G R NRAT  GYWKATGKD+ + S  G + VGMKKTLV+Y GRAP G +
Sbjct: 80  FYSLRDRKYPTGLRTNRATTAGYWKATGKDKEVFSGGGGQLVGMKKTLVFYKGRAPRGLK 139

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           T WV+HEYR  EN     H  +  +V+CR+F K
Sbjct: 140 TKWVMHEYR-LENDHSHRHTCKEEWVICRVFNK 171



>pir|T04585|T04585 hypothetical protein F23E13.50 - Arabidopsis
           thaliana>gb:ATCHRIV84_1547576 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           84.>gb:ATF23E13_1549744 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII project).
          Length = 377

 Score =  153 bits (387), Expect = 6e-36
 Identities = 70/154 (45%), Positives = 104/154 (67%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD-NE 522
           S+P G+RF PTDEELV +YL+ K+   + ++ VIR++D+ + EPWDL +   +   + NE
Sbjct: 9   SVPPGFRFHPTDEELVGYYLRKKVASQKIDLDVIRDIDLYRIEPWDLQESCRIGYEERNE 68

Query: 523 WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
           W+FF  KD+KY  G R NRAT  G+WKATG+D+ +   K   +GM+KTLV+Y GRAP G+
Sbjct: 69  WYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD-KSKLIGMRKTLVFYKGRAPNGQ 127

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +T W++HEYR   +  +     +  +V+CR F+K
Sbjct: 128 KTDWIMHEYRLESD--ENAPPQEEGWVVCRAFKK 159



>pir|B96570|B96570 NAM-like protein, 67516-66364 [imported] -
           Arabidopsis thaliana>gb:AE005173_893199 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC019018_1538495 Arabidopsis thaliana
           chromosome 1 BAC F14G24 genomic sequence, complete
           sequence.>gb:AY065268_1566418 Arabidopsis thaliana
           putative NAM protein (At1g52890) mRNA, complete
           cds.>gb:AY117224_1579265 Arabidopsis thaliana putative
           NAM protein (At1g52890) mRNA, complete cds.
          Length = 317

 Score =  153 bits (387), Expect = 6e-36
 Identities = 72/153 (47%), Positives = 102/153 (66%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           SLP G+RF PTDEEL+  YL  K  G +  + +I E+D+ K +PW LP+ +     + EW
Sbjct: 13  SLPPGFRFYPTDEELMVQYLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKALFG--EKEW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR    GYWKATG D+ IS+ +G +VG+KK LV+Y+G+AP+G +
Sbjct: 71  YFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST-EGQRVGIKKALVFYIGKAPKGTK 129

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR  E            +VLCR+++K
Sbjct: 130 TNWIMHEYRLIEPSRRNGSTKLDDWVLCRIYKK 162



>gb:AF509869_1807073 Petunia x hybrida nam-like protein 6 (NH6)
           mRNA, complete cds.
          Length = 591

 Score =  153 bits (386), Expect = 8e-36
 Identities = 76/151 (50%), Positives = 97/151 (64%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFF 531
           P G+RF PTDEELV +YLK KI      + VI   D+ K +P DLPD+S +++ D +WF 
Sbjct: 13  PPGFRFHPTDEELVLYYLKKKICRKRILLDVIAVTDVYKWDPQDLPDLSKLKTGDRQWFS 72

Query: 532 FCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTH 711
           F P+DRKY NG R NR T  G+WK TGK RTIS    A VG+KKTLV+Y GRAP G+RT 
Sbjct: 73  FSPRDRKYPNGARSNRGTRHGHWKVTGKVRTISCNSRA-VGVKKTLVFYKGRAPLGERTD 131

Query: 712 WVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           WV+HEY   E +          + L ++F+K
Sbjct: 132 WVMHEYTMNEEELKRCQDAHDYYALYKVFKK 162



>gb:AP004863_1846171 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBa0023I17.>gb:AP005804_1858120 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0085K21.
          Length = 313

 Score =  152 bits (385), Expect = 1e-35
 Identities = 80/165 (48%), Positives = 106/165 (64%), Gaps = 13/165 (7%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKI-------------TGSEAEVSVIREVDICKHEPWDLP 489
           LP G+RF P D+ELV  YL  K+              G+      + +VD+ K EPWDLP
Sbjct: 6   LPPGFRFHPRDDELVVDYLSGKLRSGDGGAASGGGAAGAGCPTPTLIDVDLNKCEPWDLP 65

Query: 490 DMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTL 669
           +++ +     EW+F+  KDRKY  GQR NRATE GYWKATGKDR I+ RKG+ VGM+KTL
Sbjct: 66  EIACIGG--KEWYFYNLKDRKYARGQRTNRATESGYWKATGKDREIT-RKGSLVGMRKTL 122

Query: 670 VYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           V+Y GRAP+G+RT WV+HE+R   +  +  H  +  +VLCR+F K
Sbjct: 123 VFYRGRAPKGERTDWVMHEFRQELDHANHHHHLKEGWVLCRVFYK 167



>gb:AP004654_1842738 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0015C07.
          Length = 324

 Score =  152 bits (385), Expect = 1e-35
 Identities = 72/157 (45%), Positives = 103/157 (65%), Gaps = 5/157 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESH----D 516
           +P G+RF PT+EELV +YL  K+   + ++ +I+E+D+ + EPWDL +      H     
Sbjct: 14  VPPGFRFHPTEEELVGYYLARKVASQKIDLDIIQELDLYRIEPWDLQERCKYGGHGGDEQ 73

Query: 517 NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKV-GMKKTLVYYLGRAP 693
            EW+FF  KDRKY +G R NRAT  G+WKATG+D+ + S    +V GM+KTLV+Y GRAP
Sbjct: 74  TEWYFFSYKDRKYPSGTRTNRATAAGFWKATGRDKPVLSSPSTRVIGMRKTLVFYKGRAP 133

Query: 694 EGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
            G++T W+IHEYR   N+   T   +  +V+CR F+K
Sbjct: 134 NGRKTDWIIHEYRLQSNEHAPTQ--EEGWVVCRAFQK 168



>pir|T08933|T08933 hypothetical protein F27G19.10 - Arabidopsis
           thaliana>gb:ATCHRIV67_1546622 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           67.>gb:ATF27G19_1550204 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F27G19 (ESSA project).
          Length = 314

 Score =  152 bits (385), Expect = 1e-35
 Identities = 81/211 (38%), Positives = 119/211 (56%), Gaps = 30/211 (14%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPD----MSFVESH 513
           SLP G+RF PTDEEL+  YL  K+ G    + VI ++D+ K +PWDLP      +FV  +
Sbjct: 13  SLPPGFRFYPTDEELLVQYLCRKVAGYHFSLQVIGDIDLYKFDPWDLPSKQTCFTFVGEY 72

Query: 514 -----------DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMK 660
                      + EW+FF P+DRKY NG R NR    GYWKATG D+ I++  G +VG+K
Sbjct: 73  NCNYLGKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITA-DGRRVGIK 131

Query: 661 KTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKV----------- 807
           K LV+Y G+AP+G +T+W++HEYR  E+      +    +VLCR+++K            
Sbjct: 132 KALVFYAGKAPKGTKTNWIMHEYRLIEHSRSHGSSKLDDWVLCRIYKKTSGSQRQAVTPV 191

Query: 808 ----ELKLDEGAEISNSDEVDPIVSSPTVVK 888
               E     G+  S+S ++D ++ S   +K
Sbjct: 192 QACREEHSTNGSSSSSSSQLDDVLDSFPEIK 222



>gb:OSJN00108_1695071 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0070J16, complete
           sequence.>gb:OSJN00273_1697765 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0072M01, complete
           sequence.
          Length = 278

 Score =  152 bits (383), Expect = 2e-35
 Identities = 77/155 (49%), Positives = 105/155 (67%), Gaps = 2/155 (1%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF P+DEELV HYL  K++   A    + EVD+   EPW+LPD++ + +  +EW
Sbjct: 9   TLPPGFRFYPSDEELVCHYLYKKVSNERASQGTLVEVDLHAREPWELPDVAKLTA--SEW 66

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGK 702
           +FF  +DRKY  G R NRAT+ GYWKATGKDR + S    A VGM+KTLV+Y GRAP G 
Sbjct: 67  YFFSFRDRKYATGSRTNRATKTGYWKATGKDREVRSPATRAVVGMRKTLVFYQGRAPNGV 126

Query: 703 RTHWVIHEYRTTENKFDGTHA-GQAPFVLCRLFRK 804
           ++ WV+HE+R      D  H+  +  +VLCR+F+K
Sbjct: 127 KSGWVMHEFR-----LDSPHSPPKEDWVLCRVFQK 156



>gb:AY672069_1621323 Hordeum vulgare subsp. vulgare NAC
           transcription factor mRNA, complete cds.
          Length = 391

 Score =  152 bits (383), Expect = 2e-35
 Identities = 67/150 (44%), Positives = 103/150 (68%), Gaps = 1/150 (0%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PT+EEL++ YL+ K+ G    + +I  VD+ +++PWDLP ++ +   D EWFF+ 
Sbjct: 46  GFRFHPTEEELIEFYLRRKVDGKRFNIDLIASVDLYRYDPWDLPALASIG--DKEWFFYV 103

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKRTHW 714
           P+DRKY+NG R NR T  GYWKATG DR +   +G + +G+KKTLV+Y+G+AP+G R+ W
Sbjct: 104 PRDRKYRNGDRPNRVTPSGYWKATGADRMVKVVEGNRSIGLKKTLVFYVGKAPKGLRSSW 163

Query: 715 VIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           +++EYR    +   T   Q    LCR++++
Sbjct: 164 IMNEYRLPHGE---TERYQKEISLCRVYKR 190



>gb:AY245885_1592570 Brassica napus NAC-domain protein 18 (NAC18)
            mRNA, complete cds.
          Length = 285

 Score =  152 bits (383), Expect = 2e-35
 Identities = 89/246 (36%), Positives = 130/246 (52%), Gaps = 9/246 (3%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            LP G+RF PTDEELV HYL  K       V +I E+D+ K++PW+LP ++     + EW+
Sbjct: 6    LPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDLYKYDPWELPGLALY--GEKEWY 63

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
            FF P+DRKY NG R NR+   GYWKATG D+ I   K   VG+KK LV+Y G+AP+G++T
Sbjct: 64   FFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPK--PVGIKKALVFYAGKAPKGEKT 121

Query: 709  HWVIHEYRTTENKFDGTHAGQA--------PFVLCRLFRKVELKLDEGAEISNSDEVDPI 864
            +W++HEYR  +   D + A +          +VLCR++ K      +GA         P+
Sbjct: 122  NWIMHEYRLAD--VDRSSAARKKKNSLRLDDWVLCRIYNK------KGAIEKRGPPPTPV 173

Query: 865  VSSPTVV-KTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIAD 1041
            V    VV + P   E      P+M +  +         +S+  P +H    S S   ++ 
Sbjct: 174  VYGDEVVEEKPRLSEMGMPPPPVMPNDFVYF------DTSDSVPKLHTTESSCSEQVVSP 227

Query: 1042 TTEDQV 1059
                +V
Sbjct: 228  EFTSEV 233



>gb:AY086124_1571181 Arabidopsis thaliana clone 21634 mRNA, complete
           sequence.
          Length = 268

 Score =  152 bits (383), Expect = 2e-35
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 4/157 (2%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEEL+ +YL+ +       VS+I EVDI K +PW LP+ +  E  +NEW
Sbjct: 8   TLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKT--EFGENEW 65

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P++RKY NG R NRA   GYWKATG D+ I S   + VG+KK LV+Y GR P+G +
Sbjct: 66  YFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHS-GSSNVGVKKALVFYKGRPPKGIK 124

Query: 706 THWVIHEYRTTENKFDGTHAGQA----PFVLCRLFRK 804
           T W++HEYR  +++   T    +     +VLCR+++K
Sbjct: 125 TDWIMHEYRLHDSRKASTKRSGSMRLDEWVLCRIYKK 161



>pir|T52343|T52343 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AC073178_1541003 Arabidopsis thaliana
           chromosome 1 BAC F10D13 genomic sequence, complete
           sequence.>gb:ART222713_1542067 Arabidopsis thaliana nap
           gene.>gb:AY051015_1562491 Arabidopsis thaliana unknown
           protein (At1g69490) mRNA, complete
           cds.>gb:AF360201_1791155 Arabidopsis thaliana unknown
           protein (At1g69490) mRNA, complete cds.
          Length = 268

 Score =  152 bits (383), Expect = 2e-35
 Identities = 74/157 (47%), Positives = 104/157 (66%), Gaps = 4/157 (2%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEEL+ +YL+ +       VS+I EVDI K +PW LP+ +  E  +NEW
Sbjct: 8   TLPPGFRFHPTDEELIVYYLRNQTMSKPCPVSIIPEVDIYKFDPWQLPEKT--EFGENEW 65

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P++RKY NG R NRA   GYWKATG D+ I S   + VG+KK LV+Y GR P+G +
Sbjct: 66  YFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHS-GSSNVGVKKALVFYKGRPPKGIK 124

Query: 706 THWVIHEYRTTENKFDGTHAGQA----PFVLCRLFRK 804
           T W++HEYR  +++   T    +     +VLCR+++K
Sbjct: 125 TDWIMHEYRLHDSRKASTKRNGSMRLDEWVLCRIYKK 161



>pir|E84636|E84636 NAM (no apical meristem)-like protein [imported]
           - Arabidopsis thaliana>gb:AC006403_1534094 Arabidopsis
           thaliana chromosome 2 clone T28I24 map mi238, complete
           sequence.
          Length = 316

 Score =  152 bits (383), Expect = 2e-35
 Identities = 77/156 (49%), Positives = 101/156 (64%), Gaps = 1/156 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEEL+ +YL  KI         I +VD+ K EPW+LP+ +  +    EW
Sbjct: 15  ALPPGFRFHPTDEELISYYLVNKIADQNFTGKAIADVDLNKSEPWELPEKA--KMGGKEW 72

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGK 702
           +FF  +DRKY  G R NRAT  GYWK TGKD+ I +S     VGMKKTLV+Y GRAP G+
Sbjct: 73  YFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNSTTSELVGMKKTLVFYRGRAPRGE 132

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE 810
           +T WV+HEYR   +K     + Q  +V+CR+F+K E
Sbjct: 133 KTCWVMHEYR-LHSKSSYRTSKQDEWVVCRVFKKTE 167



>gb:AP001299_1820994 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:F4B12.
          Length = 337

 Score =  151 bits (382), Expect = 2e-35
 Identities = 80/170 (47%), Positives = 113/170 (66%), Gaps = 4/170 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           +P G+RF PTDEEL+ +YL  K+  S    + I +VD+ K EPW+LP+ +  +  + EW+
Sbjct: 20  MPPGFRFHPTDEELITYYLLKKVLDSNFSCAAISQVDLNKSEPWELPEKA--KMGEKEWY 77

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGKR 705
           FF  +DRKY  G R NRATE GYWKATGKDR I SS+  + +GMKKTLV+Y GRAP+G++
Sbjct: 78  FFTLRDRKYPTGLRTNRATEAGYWKATGKDREIKSSKTKSLLGMKKTLVFYKGRAPKGEK 137

Query: 706 THWVIHEYRTTENKFDG---THAGQAPFVLCRLFRKVELKLDEGAEISNS 846
           + WV+HEYR  + KF     + + +  +VLC++  K  +   E   IS+S
Sbjct: 138 SCWVMHEYR-LDGKFSYHYISSSAKDEWVLCKVCLKSGVVSRETNLISSS 186



>gb:AF509866_1807070 Petunia x hybrida nam-like protein 3 (NH3)
           mRNA, complete cds.
          Length = 312

 Score =  151 bits (382), Expect = 2e-35
 Identities = 75/172 (43%), Positives = 106/172 (61%), Gaps = 3/172 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYL  K  G    VS+I E+D+ K +PW LP+ +     + EW+
Sbjct: 13  LPAGFRFHPTDEELVQHYLCQKCAGQPICVSIIAEIDLYKFDPWQLPEKALY--GEKEWY 70

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ +   K   +G+KK LV+Y G+AP G +T
Sbjct: 71  FFSPRDRKYPNGSRPNRAAGTGYWKATGADKPVG--KPRTLGIKKALVFYAGKAPRGIKT 128

Query: 709 HWVIHEYR---TTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEV 855
           +W++HEYR      +     +     +VLCR++ K +  L++   + N ++V
Sbjct: 129 NWIMHEYRLANVDRSAGKSNNLRLDDWVLCRIYNK-KGTLEKHYNVDNKEDV 179



>gb:AY245882_1592567 Brassica napus NAC-domain protein 5-7 (NAC5-7)
           mRNA, complete cds.
          Length = 280

 Score =  151 bits (382), Expect = 2e-35
 Identities = 83/202 (41%), Positives = 112/202 (55%), Gaps = 10/202 (4%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  K    +    VI E+D+ K  PW+LP+MS     D EW
Sbjct: 6   NLPAGFRFHPTDEELVRFYLIRKCASEQISAPVIAEIDLYKFNPWELPEMSLYG--DKEW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 64  YFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 121

Query: 706 THWVIHEYRTTENKFDGTHAGQ-----APFVLCRLFRK-----VELKLDEGAEISNSDEV 855
           T+W++HEYR        + + +       +VLCR++ K          DE   I      
Sbjct: 122 TNWIMHEYRLANVDRSASVSKKNNLRLDDWVLCRIYNKKGTMEKYYPADEKPRIMTDQSS 181

Query: 856 DPIVSSPTVVKTPAEDEQSEGG 921
            P  +S + ++   ED  S GG
Sbjct: 182 SPFDTSVSTLQ--EEDSSSSGG 201



>gb:AB049069_1520759 Arabidopsis thaliana CUC1 mRNA, complete cds.
          Length = 310

 Score =  151 bits (382), Expect = 2e-35
 Identities = 80/170 (47%), Positives = 113/170 (66%), Gaps = 4/170 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           +P G+RF PTDEEL+ +YL  K+  S    + I +VD+ K EPW+LP+ +  +  + EW+
Sbjct: 20  MPPGFRFHPTDEELITYYLLKKVLDSNFSCAAISQVDLNKSEPWELPEKA--KMGEKEWY 77

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGKR 705
           FF  +DRKY  G R NRATE GYWKATGKDR I SS+  + +GMKKTLV+Y GRAP+G++
Sbjct: 78  FFTLRDRKYPTGLRTNRATEAGYWKATGKDREIKSSKTKSLLGMKKTLVFYKGRAPKGEK 137

Query: 706 THWVIHEYRTTENKFDG---THAGQAPFVLCRLFRKVELKLDEGAEISNS 846
           + WV+HEYR  + KF     + + +  +VLC++  K  +   E   IS+S
Sbjct: 138 SCWVMHEYR-LDGKFSYHYISSSAKDEWVLCKVCLKSGVVSRETNLISSS 186



>gb:AB028182_1517818 Oryza sativa mRNA for OsNAC3 protein, complete
           cds.>gb:AP004572_1841804 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0668C05.>gb:AP005516_1853282 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0066H10.
          Length = 276

 Score =  151 bits (382), Expect = 2e-35
 Identities = 74/158 (46%), Positives = 96/158 (60%), Gaps = 5/158 (3%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV HYL  +  G  A V +I E+D+ +H+PWDLP  +       EW
Sbjct: 16  NLPPGFRFHPTDEELVAHYLCPRAAGRAAPVPIIAELDLYRHDPWDLPHRALFGR--REW 73

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NRA   GYWKATG D+ +    G   G+KK LV+Y G+ P G +
Sbjct: 74  YFFTPRDRKYPNGSRPNRAAASGYWKATGADKPV-LHNGRTAGIKKALVFYHGKPPRGVK 132

Query: 706 THWVIHEYRTTENKFDGTHAGQA-----PFVLCRLFRK 804
           T W++HEYR  +       AG        +VLCRL+ K
Sbjct: 133 TEWIMHEYRLAKKGGAAAAAGAGALRLDDWVLCRLYNK 170



>pir|T49145|T49145 hypothetical protein T10D17.80 - Arabidopsis
           thaliana>gb:ATT10D17_1554220 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T10D17.
          Length = 335

 Score =  151 bits (382), Expect = 2e-35
 Identities = 74/153 (48%), Positives = 100/153 (65%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G++F PTD EL+ +YLK K+ G E  V +I EV+I   EPWDLPD S V+S D+EWFFFC
Sbjct: 17  GFKFSPTDIELISYYLKRKMDGLERSVEIIPEVEIYNFEPWDLPDKSIVKS-DSEWFFFC 75

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
            + +KY +G +  RAT+ GYWKATGK+R + S     +G K+TLV+++GRAP+G RT W+
Sbjct: 76  ARGKKYPHGSQNRRATKIGYWKATGKERNVKSGSEV-IGTKRTLVFHIGRAPKGGRTEWL 134

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRKVELK 816
           +HEY       D         V+CRL R  E +
Sbjct: 135 MHEYCMIGVSLDA-------LVICRLRRNTEFQ 160



>gb:AP003866_1834535 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1092_A07.>gb:AP003932_1835447 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1773_H01.
          Length = 425

 Score =  151 bits (381), Expect = 3e-35
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 2/133 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYLK K       V++I EVD+ K +PWDLP+ +     + EW+
Sbjct: 29  LPPGFRFHPTDEELVVHYLKKKAASVPLPVTIIAEVDLYKFDPWDLPEKA--NFGEQEWY 86

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA--KVGMKKTLVYYLGRAPEGK 702
           FF P+DRKY NG R NRA   GYWKATG D+ I S      KVG+KK LV+Y G+ P+G 
Sbjct: 87  FFSPRDRKYPNGARPNRAATSGYWKATGTDKPIMSSGSTREKVGVKKALVFYRGKPPKGV 146

Query: 703 RTHWVIHEYRTTE 741
           +T+W++HEYR T+
Sbjct: 147 KTNWIMHEYRLTD 159



>gb:AP003346_1828440 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0434C04.>gb:AP003431_1829236 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1099D03.
          Length = 432

 Score =  151 bits (381), Expect = 3e-35
 Identities = 73/197 (37%), Positives = 115/197 (58%), Gaps = 16/197 (8%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PT+EEL++ YL+ K+ G    V +I  +D+ +++PW+LP M+ +   + EWFF+ 
Sbjct: 45  GFRFHPTEEELIEFYLRRKVEGKRFNVELITFLDLYRYDPWELPAMAAIG--EKEWFFYV 102

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P+DRKY+NG R NR T  GYWKATG DR I +     +G+KKTLV+Y G+AP+G R+ W+
Sbjct: 103 PRDRKYRNGDRPNRVTASGYWKATGADRMIRAENNRPIGLKKTLVFYSGKAPKGVRSSWI 162

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEG----------------AEISNSD 849
           ++EYR      D  H  +    LCR++++  +    G                A + ++ 
Sbjct: 163 MNEYRLPPADTDRYH--KTEISLCRVYKRTGIDDGHGQVSTARSSAHSRGGGAAPVQDNK 220

Query: 850 EVDPIVSSPTVVKTPAE 900
           +     S+PT   TP++
Sbjct: 221 QGSSSTSTPTPPPTPSK 237



>gb:BT000874_1635129 Arabidopsis thaliana clone C104984 putative NAM
           (no apical meristem) protein (At2g02450) mRNA, complete
           cds.
          Length = 379

 Score =  151 bits (381), Expect = 3e-35
 Identities = 66/149 (44%), Positives = 102/149 (68%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PT+EEL++ YL+ K+ G    V +I  +D+ +++PW+LP M+ +   + EW+F+ 
Sbjct: 54  GFRFHPTEEELIEFYLRRKVEGKRFNVELITFLDLYRYDPWELPAMAAIG--EKEWYFYV 111

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P+DRKY+NG R NR T  GYWKATG DR I S     +G+KKTLV+Y G+AP+G RT W+
Sbjct: 112 PRDRKYRNGDRPNRVTTSGYWKATGADRMIRSETSRPIGLKKTLVFYSGKAPKGTRTSWI 171

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           ++EYR   ++ +     +A   LCR++++
Sbjct: 172 MNEYRLPHHETEKYQ--KAEISLCRVYKR 198



>gb:AC005312_1532533 Arabidopsis thaliana chromosome 2 clone T16F16
           map CIC11A04, complete sequence.
          Length = 414

 Score =  151 bits (381), Expect = 3e-35
 Identities = 66/149 (44%), Positives = 102/149 (68%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PT+EEL++ YL+ K+ G    V +I  +D+ +++PW+LP M+ +   + EW+F+ 
Sbjct: 54  GFRFHPTEEELIEFYLRRKVEGKRFNVELITFLDLYRYDPWELPAMAAIG--EKEWYFYV 111

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P+DRKY+NG R NR T  GYWKATG DR I S     +G+KKTLV+Y G+AP+G RT W+
Sbjct: 112 PRDRKYRNGDRPNRVTTSGYWKATGADRMIRSETSRPIGLKKTLVFYSGKAPKGTRTSWI 171

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           ++EYR   ++ +     +A   LCR++++
Sbjct: 172 MNEYRLPHHETEKYQ--KAEISLCRVYKR 198



>gb:AC002304_1530210 Genomic sequence for Arabidopsis thaliana BAC
           F14J16 from chromosome I, complete
           sequence.>gb:AY085996_1571057 Arabidopsis thaliana clone
           205648 mRNA, complete sequence.>gb:AF198054_1776386
           Arabidopsis thaliana NAC1 (NAC1) mRNA, complete cds.
          Length = 324

 Score =  151 bits (381), Expect = 3e-35
 Identities = 77/156 (49%), Positives = 103/156 (66%), Gaps = 4/156 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELV-DHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           LP G+RF P D+ELV D+ ++  +  +     V+ +VD+ K EPWD+P M+ V   D  W
Sbjct: 19  LPPGFRFHPKDDELVCDYLMRRSLHNNHRPPLVLIQVDLNKCEPWDIPKMACVGGKD--W 76

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +F+  +DRKY  G R NRAT  GYWKATGKDRTI  RKG  VGM+KTLV+Y GRAP G++
Sbjct: 77  YFYSQRDRKYATGLRTNRATATGYWKATGKDRTI-LRKGKLVGMRKTLVFYQGRAPRGRK 135

Query: 706 THWVIHEYRTTENKFDGTHAGQAP---FVLCRLFRK 804
           T WV+HE+R   +     H+  +P   +VLCR+F K
Sbjct: 136 TDWVMHEFRLQGSHHPPNHSLSSPKEDWVLCRVFHK 171



>gb:AP004081_1837407 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1116_E04.>gb:AP005303_1850194 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0016F11.
          Length = 331

 Score =  150 bits (380), Expect = 4e-35
 Identities = 87/227 (38%), Positives = 125/227 (55%), Gaps = 22/227 (9%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSV----------IREVDICKHEPWDLPDM 495
           +LP G+RF P+DEELV HYL  K+        V          + EVD+  HEPW+LPD+
Sbjct: 9   TLPPGFRFYPSDEELVCHYLHNKVVNQHRFAGVGGAAAAGGGTMVEVDLHTHEPWELPDV 68

Query: 496 SFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI--------SSRKGAKV 651
           + + +  NEW+FF  +DRKY  G R NRAT+ GYWKATGKDR I        + R+ + V
Sbjct: 69  AKLST--NEWYFFSFRDRKYATGLRTNRATKSGYWKATGKDRVIHNPKLHAAAHRRASIV 126

Query: 652 GMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHA-GQAPFVLCRLFRKVELKLDEG 828
           GM+KTLV+Y GRAP G +T+WV+HE+R      +  H   +  +VLCR+F K + + +  
Sbjct: 127 GMRKTLVFYRGRAPNGVKTNWVMHEFR-----MENPHTPPKEDWVLCRVFYKKKAETETE 181

Query: 829 AEISNSDEVDPIVS---SPTVVKTPAEDEQSEGGTPLMKSGHIKTQP 960
           +  S  +E + +++   S   +K       S        +GH    P
Sbjct: 182 SSYSMENEQEAVIAMARSAAAIKAGGCYSNSSSSHDPAAAGHHSPPP 228



>gb:BT005985_1638907 Arabidopsis thaliana At3g04070 gene, complete
           cds.
          Length = 359

 Score =  150 bits (380), Expect = 4e-35
 Identities = 69/140 (49%), Positives = 95/140 (67%), Gaps = 4/140 (2%)
 Frame = +1

Query: 337 PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD 516
           P  SLP G+RF PTDEEL+ HYL+ K++ S   +S+I +VDI K +PWDLP  +     +
Sbjct: 6   PRSSLPPGFRFHPTDEELILHYLRKKVSSSPVPLSIIADVDIYKSDPWDLP--AKAPFGE 63

Query: 517 NEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG----AKVGMKKTLVYYLG 684
            EW+FF P+DRKY NG R NRA   GYWKATG D+ I+   G      +G+KK LV+Y G
Sbjct: 64  KEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKLIAVPNGEGFHENIGIKKALVFYRG 123

Query: 685 RAPEGKRTHWVIHEYRTTEN 744
           + P+G +T+W++HEYR  ++
Sbjct: 124 KPPKGVKTNWIMHEYRLADS 143



>gb:AY084860_1569942 Arabidopsis thaliana clone 11977 mRNA, complete
           sequence.
          Length = 564

 Score =  150 bits (380), Expect = 4e-35
 Identities = 78/185 (42%), Positives = 108/185 (58%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV +YLK KI   +  ++ I  VD+ K +P +LP +S +++ D +WFFF 
Sbjct: 19  GFRFHPTDEELVVYYLKRKICCKKLRINAIGVVDVYKVDPSELPGLSMLKTGDRQWFFFT 78

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P++RKY N  R +R T  GYWKATGKDR I       VG+KKTLV+Y GRAP G+RT WV
Sbjct: 79  PRNRKYPNAARSSRGTATGYWKATGKDRVI-EYNSRSVGLKKTLVFYRGRAPNGERTDWV 137

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVVKTPA 897
           +HEY   E +       +  + L +L++K       GA   N ++          V + +
Sbjct: 138 MHEYTMDEEELGRCKNAKEYYALYKLYKK------SGAGPKNGEQYGAPFQEEEWVDSDS 191

Query: 898 EDEQS 912
           ED  S
Sbjct: 192 EDADS 196



>pir|D84547|D84547 NAM (no apical meristem)-like protein [imported]
           - Arabidopsis thaliana>gb:AC002354_1530565 Arabidopsis
           thaliana chromosome II section 98 of 255 of the complete
           sequence. Sequence from clones F12A24, F6P23.
          Length = 276

 Score =  150 bits (380), Expect = 4e-35
 Identities = 78/183 (42%), Positives = 117/183 (63%), Gaps = 8/183 (4%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PT+EEL+D YLK  + G  + V VI  ++I +H+PWDLP +S +   + EW+FF 
Sbjct: 9   GFRFHPTEEELLDFYLKNMVYGKRSSVEVIGFLNIYRHDPWDLPGLSRIG--EREWYFFV 66

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPEGKRTH 711
           P++RK+ NG R +R TE+GYWKATG DR I S    K  +G+KKTLV+Y GRAP G +T 
Sbjct: 67  PRERKHGNGGRPSRTTEKGYWKATGSDRKIISLSEPKRVIGLKKTLVFYRGRAPGGSKTD 126

Query: 712 WVIHEYRTTENKFDGTHAGQAPFVLCRLFRK------VELKLDEGAEISNSDEVDPIVSS 873
           WV++E+R  +N      +     VLC+++RK      +E + +  A+++ +    P+ SS
Sbjct: 127 WVMNEFRMPDN-----CSLPKDVVLCKIYRKATSLKVLEQRAEMEAKMNQTCPNSPLSSS 181

Query: 874 PTV 882
            T+
Sbjct: 182 ETI 184



>gb:AC104427_1737591 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1015F07, complete sequence.
          Length = 366

 Score =  150 bits (379), Expect = 5e-35
 Identities = 69/153 (45%), Positives = 102/153 (66%), Gaps = 1/153 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNEW 525
           +P G+RF PTDEELV +YL+ K+   + ++ VIR++D+ + EPWDL +   +     +EW
Sbjct: 5   VPPGFRFHPTDEELVGYYLRKKVASQKIDLDVIRDIDLYRIEPWDLQEHCGIGYDEQSEW 64

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KDRKY  G R NRAT  G+WKATG+D+ +   K   +GM+KTLV+Y GRAP G++
Sbjct: 65  YFFSYKDRKYPTGTRTNRATMAGFWKATGRDKAVHD-KSRLIGMRKTLVFYKGRAPNGQK 123

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           T W++HEYR   +  +     +  +V+CR F+K
Sbjct: 124 TDWIMHEYRLETD--ENAPPQEEGWVVCRAFKK 154



>gb:AY498713_1609388 Lycopersicon esculentum NAC domain protein
           mRNA, complete cds.
          Length = 301

 Score =  150 bits (379), Expect = 5e-35
 Identities = 71/155 (45%), Positives = 97/155 (62%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTD+ELV HYL  K  G    VS+I E+D+ K +PW LP+ +     + EW+
Sbjct: 13  LPAGFRFHPTDDELVQHYLCRKCAGQSIAVSIIAEIDLYKFDPWQLPEKALY--GEKEWY 70

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ +   K   +G+KK LV+Y G+AP G +T
Sbjct: 71  FFSPRDRKYPNGSRPNRAAGTGYWKATGADKPVGKPK--TLGIKKALVFYAGKAPRGIKT 128

Query: 709 HWVIHEYR---TTENKFDGTHAGQAPFVLCRLFRK 804
           +W++HEYR      +     +     +VLCR++ K
Sbjct: 129 NWIMHEYRLANVDRSAGKNNNLRLDDWVLCRIYNK 163



>gb:AY245884_1592569 Brassica napus NAC-domain protein 5-11 (NAC5-11)
            mRNA, complete cds.
          Length = 286

 Score =  150 bits (379), Expect = 5e-35
 Identities = 87/243 (35%), Positives = 126/243 (51%), Gaps = 6/243 (2%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            LP G+RF PTDEELV HYL  K       V +I E+D+ K+ PW+LP ++     + EW+
Sbjct: 6    LPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDLYKYNPWELPGLALY--GEKEWY 63

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
            FF P+DRKY NG R NR+   GYWKATG D+ I   K   VG+KK LV+Y G+AP+G++T
Sbjct: 64   FFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPK--PVGIKKALVFYAGKAPKGEKT 121

Query: 709  HWVIHEYRTTENKFDGTHAGQ-----APFVLCRLFRKVELKLDEGAEISNSDEVDPIVSS 873
            +W++HEYR  +         +       +VLCR++ K      +GA         P+V  
Sbjct: 122  NWIMHEYRLADVDRSAARKKKNSLRLDDWVLCRIYNK------KGAIEKRGPPPTPVVYG 175

Query: 874  PTVV-KTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTE 1050
              VV + P   E      P+M +  +         +S+  P +H    S S   ++    
Sbjct: 176  DEVVEEKPRLSEMGMPPPPVMPNDFVYF------DTSDSVPKLHTTESSCSEQVVSPEFT 229

Query: 1051 DQV 1059
             +V
Sbjct: 230  SEV 232



>gb:ATT2K12_1555730 Arabidopsis thaliana DNA chromosome 5, BAC clone
            T2K12 (ESSA project).>gb:AY080862_1568551 Arabidopsis
            thaliana unknown protein (At5g08790) mRNA, complete
            cds.>gb:AY133762_1581582 Arabidopsis thaliana clone
            U18877 unknown protein (At5g08980) mRNA, complete cds.
          Length = 283

 Score =  150 bits (379), Expect = 5e-35
 Identities = 90/249 (36%), Positives = 128/249 (51%), Gaps = 14/249 (5%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            +LP G+RF PTDEELV  YL  K    +    VI E+D+ K  PW+LP+MS     + EW
Sbjct: 6    NLPAGFRFHPTDEELVKFYLCRKCASEQISAPVIAEIDLYKFNPWELPEMSLYG--EKEW 63

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            +FF P+DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 64   YFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 121

Query: 706  THWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK-----VELKLDEGAEISNSD 849
            T+W++HEYR        + NK +        +VLCR++ K          DE    +   
Sbjct: 122  TNWIMHEYRLANVDRSASVNKKNNLRLDD--WVLCRIYNKKGTMEKYFPADEKPRTTTMA 179

Query: 850  E--VDPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNS 1023
            E    P  +S +   T  ED+ S  G      GH+ +  +   QS  +   +   +++  
Sbjct: 180  EQSSSPFDTSDSTYPTLQEDDSSSSG----GHGHVVSPDVLEVQSEPKWGELEDALEAFD 235

Query: 1024 NSCIADTTE 1050
             S    + E
Sbjct: 236  TSMFGSSME 244



>gb:AB022211_1514981 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1L20.>gb:BT015824_1642442 Arabidopsis
           thaliana At5g66300 gene, complete
           cds.>gb:BT020216_1642611 Arabidopsis thaliana At5g66300
           mRNA, complete cds.
          Length = 292

 Score =  150 bits (379), Expect = 5e-35
 Identities = 71/154 (46%), Positives = 101/154 (65%), Gaps = 1/154 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNE 522
           S+P G+RF PTDEELV +YLK KI     ++ VIRE+D+ K EPWDL +   +      E
Sbjct: 11  SIPPGFRFHPTDEELVGYYLKKKIASQRIDLDVIREIDLYKIEPWDLQERCRIGYEEQTE 70

Query: 523 WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
           W+FF  +D+KY  G R NRAT  G+WKATG+D+ +       +GM+KTLV+Y GRAP G+
Sbjct: 71  WYFFSHRDKKYPTGTRTNRATVAGFWKATGRDKAV-YLNSKLIGMRKTLVFYRGRAPNGQ 129

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           ++ W+IHEY + E+    +   +  +V+CR F+K
Sbjct: 130 KSDWIIHEYYSLES-HQNSPPQEEGWVVCRAFKK 162



>pir|G86257|G86257 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890237 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC022522_1539097 Arabidopsis thaliana
           chromosome I BAC T28K15 genomic sequence, complete
           sequence.
          Length = 409

 Score =  150 bits (379), Expect = 5e-35
 Identities = 75/167 (44%), Positives = 108/167 (64%), Gaps = 15/167 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPD-------MSFVE 507
           +P G+RF PTDEELVD+YL+ K+     E+  I+++D+ K EPWDL          SFVE
Sbjct: 7   VPPGFRFHPTDEELVDYYLRKKVASKRIEIDFIKDIDLYKIEPWDLQGKILKVFFYSFVE 66

Query: 508 --------SHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKK 663
                      ++W+FF  KD+KY  G R NRAT+ G+WKATG+D+ I  R  + +GM+K
Sbjct: 67  IELCKIGHEEQSDWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYLRH-SLIGMRK 125

Query: 664 TLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           TLV+Y GRAP G+++ W++HEYR  E   +GT   +  +V+CR+F+K
Sbjct: 126 TLVFYKGRAPNGQKSDWIMHEYR-LETDENGTPQEEG-WVVCRVFKK 170



>gb:AP004989_1846763 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1153E06.
          Length = 304

 Score =  150 bits (378), Expect = 7e-35
 Identities = 90/211 (42%), Positives = 118/211 (55%), Gaps = 21/211 (9%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKIT-----GSEAEVSVIR--------EVDICKHEPWDLP 489
           LP G+RF P D+ELV  YL+ K+      G+ A  + +         +VD+ K EPWDLP
Sbjct: 14  LPPGFRFHPRDDELVLDYLERKLLDGGVGGAAAAAAAVTIYGCPVMVDVDLNKCEPWDLP 73

Query: 490 DMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTL 669
           +++ V     EW+F+  +DRKY  GQR NRATE GYWKATGKDR I SRKG  VGM+KTL
Sbjct: 74  EIACVGG--KEWYFYSLRDRKYATGQRTNRATESGYWKATGKDRPI-SRKGLLVGMRKTL 130

Query: 670 VYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLF---RKVELKLDEGAEIS 840
           V+Y GRAP+GK+T WV+HE+R            +  +VLCR+F   R    KL      +
Sbjct: 131 VFYKGRAPKGKKTEWVMHEFRKEGQGDPMKLPLKEDWVLCRVFYKSRTTIAKLPTEGSYN 190

Query: 841 NSDEV-----DPIVSSPTVVKTPAEDEQSEG 918
           N D V      P+  +      P   +  EG
Sbjct: 191 NIDSVATTSLPPLTDNYIAFDQPGSMQNLEG 221



>gb:STU401151_1723072 Solanum tuberosum mRNA for putative NAC domain
           protein (nac gene).
          Length = 301

 Score =  150 bits (378), Expect = 7e-35
 Identities = 71/155 (45%), Positives = 97/155 (62%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTD+ELV HYL  K  G    VS+I E+D+ K +PW LP+ +     + EW+
Sbjct: 13  LPAGFRFHPTDDELVQHYLCRKCAGQPIAVSIITEIDLYKFDPWQLPEKALY--GEKEWY 70

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ +   K   +G+KK LV+Y G+AP G +T
Sbjct: 71  FFSPRDRKYPNGSRPNRAAGTGYWKATGADKPVGKPK--TLGIKKALVFYAGKAPRGIKT 128

Query: 709 HWVIHEYR---TTENKFDGTHAGQAPFVLCRLFRK 804
           +W++HEYR      +     +     +VLCR++ K
Sbjct: 129 NWIMHEYRLANVDRSAGKNNNLRLDDWVLCRIYNK 163



>pir|E86452|E86452 protein F6N18.15 [imported] - Arabidopsis
           thaliana>gb:AE005172_892112 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC017118_1538318 Genomic sequence for
           Arabidopsis thaliana BAC F6N18 from chromosome I,
           complete sequence.
          Length = 358

 Score =  150 bits (378), Expect = 7e-35
 Identities = 75/182 (41%), Positives = 115/182 (63%), Gaps = 12/182 (6%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES-HDNEW 525
           +P G+RF PT+EEL+ +YL+ K+   + ++ VIREVD+ K EPWD+ +   + S   N+W
Sbjct: 16  VPPGFRFHPTEEELLHYYLRKKVNSQKIDLDVIREVDLNKLEPWDIQEECRIGSTPQNDW 75

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I S    ++G++KTLV+Y GRAP G++
Sbjct: 76  YFFSHKDKKYPTGTRTNRATVAGFWKATGRDKIICSCV-RRIGLRKTLVFYKGRAPHGQK 134

Query: 706 THWVIHEYRTTENKFDGTHA----------GQAPFVLCRLFRKVEL-KLDEGAEISNSDE 852
           + W++HEYR  +      +A           +  +V+CR+FRK    K+D+  +I+ S  
Sbjct: 135 SDWIMHEYRLDDTPMSNGYADVVTEDPMSYNEEGWVVCRVFRKKNYQKIDDCPKITLSSL 194

Query: 853 VD 858
            D
Sbjct: 195 PD 196



>gb:AF402602_1796295 Phaseolus vulgaris NAC domain protein NAC1
           mRNA, complete cds.
          Length = 299

 Score =  149 bits (377), Expect = 9e-35
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 6/158 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF P DEELV  YL  K+T +++ + +  +VD+ K EPWD+P+ + V   D  W+
Sbjct: 11  LPPGFRFHPRDEELVCDYLMKKLTHNDSLLMI--DVDLNKCEPWDIPETACVGGKD--WY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           F+  +DRKY  G R NRAT  GYWKATGKDR I  RKG  VGM+KTLV+Y GRAP+G++T
Sbjct: 67  FYTQRDRKYATGLRTNRATASGYWKATGKDRPI-LRKGTLVGMRKTLVFYQGRAPKGRKT 125

Query: 709 HWVIHEYRTTENKFDGTH------AGQAPFVLCRLFRK 804
            WV+HE+R      +G H      + +  +VLCR+F K
Sbjct: 126 EWVMHEFR-----IEGPHGPPKVSSSKEDWVLCRVFYK 158



>gb:AC137623_1743699 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0426G01, complete sequence.
          Length = 476

 Score =  149 bits (377), Expect = 9e-35
 Identities = 79/215 (36%), Positives = 119/215 (55%)
 Frame = +1

Query: 358  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
            G+RF PT+EEL++ YL+ K+ G    V +I  +D+ + +PW+LP M+ +   + EWFF+ 
Sbjct: 103  GFRFHPTEEELIEFYLRRKVEGRRFNVELITFLDLYRFDPWELPAMAVIG--EKEWFFYV 160

Query: 538  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
            P+DRKY+NG R NR T  GYWKATG DR I       +G+KKTLV+Y G+AP+G R+ W+
Sbjct: 161  PRDRKYRNGDRPNRVTASGYWKATGADRMIRGENSRPIGLKKTLVFYSGKAPKGVRSSWI 220

Query: 718  IHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVVKTPA 897
            ++EYR      D     ++   LCR++++    +D+G         +   SS +    P 
Sbjct: 221  MNEYRLPPPAADADLFYKSEISLCRVYKR--SGIDDGHGHHQRPAGNVQASSSSAAARP- 277

Query: 898  EDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVH 1002
              EQ  G          + +P +P  SS  T   H
Sbjct: 278  -PEQHSGNNTAAGLPACRHRP-SPSSSSTTTAQQH 310



>gb:AY245883_1592568 Brassica napus NAC-domain protein 5-8 (NAC5-8)
           mRNA, complete cds.
          Length = 278

 Score =  149 bits (377), Expect = 9e-35
 Identities = 75/160 (46%), Positives = 99/160 (61%), Gaps = 7/160 (4%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  K    E    VI E+D+ K  PW+LP+MS     + EW
Sbjct: 6   NLPAGFRFHPTDEELVQFYLCRKCASEEISAPVIAEIDLYKFNPWELPEMSLY--GEKEW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 64  YFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 121

Query: 706 THWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR        + NK +        +VLCR++ K
Sbjct: 122 TNWIMHEYRLANVDRSASVNKKNNLRLDD--WVLCRIYNK 159



>gb:AY078006_1567975 Arabidopsis thaliana AT5g22290/MWD9_7 mRNA,
           complete cds.>gb:AF385685_1794579 Arabidopsis thaliana
           AT5g22290/MWD9_7 mRNA, complete cds.
          Length = 340

 Score =  149 bits (377), Expect = 9e-35
 Identities = 72/151 (47%), Positives = 100/151 (66%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G++F PTD EL+ +YLK K+ G E  V VI +++I   EPWDLPD S V+S D+EWFFFC
Sbjct: 24  GFKFSPTDVELISYYLKRKMDGLERSVEVIPDLEIYNFEPWDLPDKSIVKS-DSEWFFFC 82

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
            + +KY +G +  RAT+ GYWKATGK+R + S     +G K+TLV+++GRAP+G+RT W+
Sbjct: 83  ARGKKYPHGSQNRRATKMGYWKATGKERDVKSGSEV-IGTKRTLVFHIGRAPKGERTDWI 141

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRKVE 810
           +HEY       D         V+CR+ R  E
Sbjct: 142 MHEYCVKGVSLDDA------MVVCRVRRNKE 166



>gb:AB007651_1510256 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MWD9.
          Length = 325

 Score =  149 bits (377), Expect = 9e-35
 Identities = 72/151 (47%), Positives = 100/151 (66%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G++F PTD EL+ +YLK K+ G E  V VI +++I   EPWDLPD S V+S D+EWFFFC
Sbjct: 9   GFKFSPTDVELISYYLKRKMDGLERSVEVIPDLEIYNFEPWDLPDKSIVKS-DSEWFFFC 67

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
            + +KY +G +  RAT+ GYWKATGK+R + S     +G K+TLV+++GRAP+G+RT W+
Sbjct: 68  ARGKKYPHGSQNRRATKMGYWKATGKERDVKSGSEV-IGTKRTLVFHIGRAPKGERTDWI 126

Query: 718 IHEYRTTENKFDGTHAGQAPFVLCRLFRKVE 810
           +HEY       D         V+CR+ R  E
Sbjct: 127 MHEYCVKGVSLDDA------MVVCRVRRNKE 151



>gb:AC151803_1745128 Solanum demissum chromosome 5 BAC PGEC979H09
           genomic sequence, complete sequence.
          Length = 163

 Score =  149 bits (376), Expect = 1e-34
 Identities = 68/133 (51%), Positives = 94/133 (70%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ +YL+ + T     VS+I E+D+ K +PW+LP+ +  E  +NEW+
Sbjct: 9   LPPGFRFHPTDEELIMYYLRYQATSRPCPVSIIPEIDVYKFDPWELPEKA--EFGENEWY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ I S     VG+KK LV+Y G+ P+G +T
Sbjct: 67  FFTPRDRKYPNGVRPNRAAVSGYWKATGTDKAIYS-ANKYVGIKKALVFYKGKPPKGVKT 125

Query: 709 HWVIHEYRTTENK 747
            W++HEYR +++K
Sbjct: 126 DWIMHEYRLSDSK 138



>gb:AC149288_1744918 Solanum demissum chromosome 5 clone PGEC446J10
           map MAP_LOC, complete sequence.
          Length = 388

 Score =  149 bits (376), Expect = 1e-34
 Identities = 71/158 (44%), Positives = 105/158 (66%), Gaps = 9/158 (5%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YL+ K+      + +I+++DI K++PWDLP ++ V   + EW+F+C
Sbjct: 8   GFRFHPTDEELVGFYLRRKVQQKPISIELIKQLDIYKYDPWDLPKLAAVG--EKEWYFYC 65

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKRTHW 714
           P+DRKY+N  R NR T  G+WKATG DR I S +G+K +G+KK+LV+Y GRA +G +T W
Sbjct: 66  PRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSEGSKCIGLKKSLVFYKGRAAKGIKTDW 125

Query: 715 VIHEYR-------TTENKFDGTH-AGQAPFVLCRLFRK 804
           ++HE+R       T   +F   H      + +CR+F+K
Sbjct: 126 MMHEFRLPSITDSTAPKRFLDKHIPPNDSWAICRIFKK 163



>gb:AP004114_1837788 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1118_G04.
          Length = 383

 Score =  149 bits (375), Expect = 2e-34
 Identities = 88/242 (36%), Positives = 128/242 (52%), Gaps = 20/242 (8%)
 Frame = +1

Query: 358  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
            G+RF PTDEELV  YL+ KI      + +IR++DI K++PWDLP ++   + + EW+F+C
Sbjct: 16   GFRFHPTDEELVRFYLRRKIQQKSLPIELIRQLDIYKYDPWDLPKLA--STGEKEWYFYC 73

Query: 538  PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKRTHW 714
            P+DRKY+N  R NR T  G+WKATG DR I S  G+K +G+KK+LV+Y GRA +G +T W
Sbjct: 74   PRDRKYRNSTRPNRVTGAGFWKATGTDRPIYSSDGSKCIGLKKSLVFYKGRAAKGVKTDW 133

Query: 715  VIHEYR---------TTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIV 867
            ++HE+R           +   +        + +CR+F+K          +S+S    P+ 
Sbjct: 134  MMHEFRLPSLTDPSLPQKKPLEKIIPPNDSWAICRIFKKTNSTAQRA--LSHSWVSPPLS 191

Query: 868  S------SPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEET-PGVHFP---IDS 1017
            S      +P    T      S+  + +M      T   T       T P  H P   IDS
Sbjct: 192  STNEAYTAPVSQTTQRSQHTSDNTSSVMTDAISSTIQFTGSSYLPSTVPSCHNPLSMIDS 251

Query: 1018 NS 1023
            NS
Sbjct: 252  NS 253



>pir|T52345|T52345 OsNAC6 protein [imported] -
           rice>gb:AB028185_1517821 Oryza sativa mRNA for OsNAC6
           protein, complete cds.>gb:AF254558_1781143 Oryza sativa
           NAC6 (NAC6) gene, complete cds.>gb:AP003561_1830807
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, BAC clone:B1065E10.
          Length = 303

 Score =  149 bits (375), Expect = 2e-34
 Identities = 72/155 (46%), Positives = 97/155 (62%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYL  +  G    V +I E+D+ K +PW LP M+     + EW+
Sbjct: 9   LPPGFRFHPTDEELVMHYLCRRCAGLPIAVPIIAEIDLYKFDPWQLPRMALYG--EKEWY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ + S K   V +KK LV+Y G+AP+G++T
Sbjct: 67  FFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGSPK--PVAIKKALVFYAGKAPKGEKT 124

Query: 709 HWVIHEYRTTENKFDGTHAGQA---PFVLCRLFRK 804
           +W++HEYR  +               +VLCR++ K
Sbjct: 125 NWIMHEYRLADVDRSARKKNSLRLDDWVLCRIYNK 159



>pir|T47983|T47983 NAM-like protein - Arabidopsis
           thaliana>gb:ATF21F14_1549600 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F21F14.
          Length = 334

 Score =  148 bits (374), Expect = 2e-34
 Identities = 80/203 (39%), Positives = 126/203 (62%), Gaps = 15/203 (7%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNEW 525
           +P G+RF PT+EEL+ +YL+ KI+  + ++ VI ++D+ K EPWD+ +M  +  +  N+W
Sbjct: 11  VPPGFRFHPTEEELLKYYLRKKISNIKIDLDVIPDIDLNKLEPWDIQEMCKIGTTPQNDW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +F+  KD+KY  G R NRAT  G+WKATG+D+TI +  G ++GM+KTLV+Y GRAP G++
Sbjct: 71  YFYSHKDKKYPTGTRTNRATTVGFWKATGRDKTIYT-NGDRIGMRKTLVFYKGRAPHGQK 129

Query: 706 THWVIHEYRTTEN---KFDGTH----------AGQAPFVLCRLFRKVELKLDEGAEISNS 846
           + W++HEYR  E+      G H               +V+CR+F+K            N+
Sbjct: 130 SDWIMHEYRLDESVLISSCGDHDVNVETCDVIGSDEGWVVCRVFKK------------NN 177

Query: 847 DEVDPIVSSP-TVVKTPAEDEQS 912
              + I SSP + VKTP+ +E++
Sbjct: 178 LCKNMISSSPASSVKTPSFNEET 200



>gb:ATT19L5_1554849 Arabidopsis thaliana DNA chromosome 5, BAC clone
            T19L5 (ESSA project).>gb:AY143964_1583421 Arabidopsis
            thaliana At5g13180/T19L5_140 mRNA, complete
            cds.>gb:AF385734_1794625 Arabidopsis thaliana
            AT5g13180/T19L5_140 mRNA, complete cds.
          Length = 252

 Score =  148 bits (373), Expect = 3e-34
 Identities = 92/244 (37%), Positives = 128/244 (52%), Gaps = 16/244 (6%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
            LP G+RF PTDEELV  YLK K+  S    S+I E D+C+ +PWDLP      + + E +
Sbjct: 14   LPPGFRFHPTDEELVVQYLKRKVCSSPLPASIIPEFDVCRADPWDLPG-----NLEKERY 68

Query: 529  FFCPKDRKYQNGQRLNRATERGYWKATGKD-RTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
            FF  ++ KY NG R NRAT  GYWKATG D R ++SR    VG+KKTLV+Y G+ P G R
Sbjct: 69   FFSTREAKYPNGNRSNRATGSGYWKATGIDKRVVTSRGNQIVGLKKTLVFYKGKPPHGSR 128

Query: 706  THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVEL------------KLDEGAEISNSD 849
            T W++HEYR + +        Q  +VLCR+F K                L      ++SD
Sbjct: 129  TDWIMHEYRLSSSPPSSMGPTQ-NWVLCRIFLKKRAGNKNDDDDGDSRNLRHNNNNNSSD 187

Query: 850  EVDPIVSSPTVVKTPA---EDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSN 1020
            +++ I +  T  KT     +  + E  T L     + + P +   SS  T  +    D  
Sbjct: 188  QIEIITTDQTDDKTKPIFFDFMRKERTTDL---NLLPSSPSSDHASSGVTTEIFSSSDEE 244

Query: 1021 SNSC 1032
            ++SC
Sbjct: 245  TSSC 248



>gb:AE016959_1023594 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092389_1735347
           Oryza sativa chromosome 10 BAC OSJNBa0053C23 genomic
           sequence, complete sequence.>gb:AC113948_1739099 Oryza
           sativa chromosome 10 BAC OSJNBb0038A07 genomic sequence,
           complete sequence.>gb:AE017114_1753413 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 68 of
           77 of the complete sequence.
          Length = 164

 Score =  148 bits (373), Expect = 3e-34
 Identities = 71/160 (44%), Positives = 105/160 (65%), Gaps = 1/160 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNEW 525
           +P G+RF PTDEELV +YL+ K+   + ++ VIR+VD+ + EPWDL +   +     +EW
Sbjct: 5   VPPGFRFHPTDEELVGYYLRKKVASQKIDLDVIRDVDLYRIEPWDLQEHCRIGYEEQSEW 64

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KDRKY  G R NRAT  G+WKATG+D+ +  R    +GM+KTLV+Y GRAP G +
Sbjct: 65  YFFSYKDRKYPTGTRTNRATMTGFWKATGRDKAVRER-SRLIGMRKTLVFYKGRAPNGHK 123

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDE 825
           T W++HEYR  E+  +     ++PF+   +  K++L+  E
Sbjct: 124 TDWIVHEYR-LESDENAPPQARSPFISLSI-NKIDLQFLE 161



>pir|E86148|E86148 T1N6.12 protein - Arabidopsis
           thaliana>gb:AE005172_889222 Arabidopsis thaliana
           chromosome 1, top arm complete sequence.>gb:T1N6_1723682
           Sequence of BAC T1N6 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AF370617_1792400
           Arabidopsis thaliana OsNAC6 protein-like protein
           (T1N6.12) mRNA, complete cds.
          Length = 289

 Score =  148 bits (373), Expect = 3e-34
 Identities = 72/159 (45%), Positives = 100/159 (62%), Gaps = 4/159 (2%)
 Frame = +1

Query: 340 LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN 519
           L  LP G+RF PTDEELV HYL  K       V +I E+D+ K++PW+LP ++     + 
Sbjct: 4   LLQLPPGFRFHPTDEELVMHYLCRKCASQSIAVPIIAEIDLYKYDPWELPGLALY--GEK 61

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           EW+FF P+DRKY NG R NR+   GYWKATG D+ I   K   VG+KK LV+Y G+AP+G
Sbjct: 62  EWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPK--PVGIKKALVFYAGKAPKG 119

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQA----PFVLCRLFRK 804
           ++T+W++HEYR  +          +     +VLCR++ K
Sbjct: 120 EKTNWIMHEYRLADVDRSVRKKKNSLRLDDWVLCRIYNK 158



>gb:AP005159_1848430 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0016C11.
          Length = 385

 Score =  147 bits (372), Expect = 3e-34
 Identities = 71/158 (44%), Positives = 100/158 (63%), Gaps = 9/158 (5%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YLK KI      + +IR++DI K +PWDLP ++   + + EW+F+C
Sbjct: 19  GFRFHPTDEELVSFYLKRKIQQKPISIELIRQLDIYKFDPWDLPKLA--STGEKEWYFYC 76

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKRTHW 714
           P+DRKY+N  R NR T  G+WKATG DR I S +G K +G+KK+LV+Y GRA  G +T W
Sbjct: 77  PRDRKYRNSVRPNRVTTAGFWKATGTDRPIYSTEGTKCIGLKKSLVFYKGRAARGIKTDW 136

Query: 715 VIHEYR--------TTENKFDGTHAGQAPFVLCRLFRK 804
           ++HE+R          +   D        + +CR+F+K
Sbjct: 137 MMHEFRLPTLTDPSLPKKPIDKNIPLNDSWTICRIFKK 174



>gb:AY308828_1597850 Capsicum annuum salicylic acid-induced protein
           19 gene, complete cds.
          Length = 356

 Score =  147 bits (372), Expect = 3e-34
 Identities = 82/187 (43%), Positives = 115/187 (61%), Gaps = 9/187 (4%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGS---EAEVSVIREVDICKHEPWDLPDMSFVESHDN 519
           LP G+RF P DEEL+  YL  KI  S   + +   + EVD+ K EPW++P+++ V     
Sbjct: 14  LPPGFRFHPRDEELICDYLMKKIDQSPDQQQQYPFLIEVDLNKSEPWEIPEVACVGG--K 71

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           EW+F+  +DRKY  G R NRAT  GYWKATGKDR +  RKG+ VGM+KTLV+Y GRAP+G
Sbjct: 72  EWYFYSQRDRKYATGLRTNRATVSGYWKATGKDRAV-VRKGSLVGMRKTLVFYQGRAPKG 130

Query: 700 KRTHWVIHEYR----TTENKFDGTHAGQAPFVLCRLFRKVE--LKLDEGAEISNSDEVDP 861
           +++ WV+HE+R       N      + +  +VLCR+F K +  L   +G   +N    D 
Sbjct: 131 RKSDWVMHEFRLEGPLNNNIRPQISSPREDWVLCRVFHKNKELLAAKQGTSSNNIYYDDG 190

Query: 862 IVSSPTV 882
            +SS +V
Sbjct: 191 TISSSSV 197



>gb:AP002818_1822876 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0436E04.
          Length = 377

 Score =  147 bits (371), Expect = 4e-34
 Identities = 68/131 (51%), Positives = 88/131 (67%), Gaps = 3/131 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  +   +     VI EVDI K+ PW+LP M+     D EW+
Sbjct: 23  LPPGFRFHPTDEELLLHYLGKRAAAAPCPAPVIAEVDIYKYNPWELPAMAVFGESDGEWY 82

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTIS---SRKGAKVGMKKTLVYYLGRAPEG 699
           FF P+DRKY NG R NRA   GYWKATG D+ IS   +++   +G+KK LV+Y GR P+G
Sbjct: 83  FFSPRDRKYPNGVRPNRAAGSGYWKATGTDKPISISETQQTVLLGVKKALVFYRGRPPKG 142

Query: 700 KRTHWVIHEYR 732
            +T W++HEYR
Sbjct: 143 TKTSWIMHEYR 153



>gb:AF488416_1804409 Zea mays chromosome 9 BAC 9C20 complete
           sequence.
          Length = 435

 Score =  147 bits (371), Expect = 4e-34
 Identities = 65/130 (50%), Positives = 94/130 (72%), Gaps = 2/130 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESH-DNEW 525
           +P G+RF PT+EEL+ +YLK K+     ++ VIR+VD+ K EPWD+ +   + S   N+W
Sbjct: 11  VPPGFRFHPTEEELLTYYLKKKVASERIDLDVIRDVDLNKLEPWDIQEKCRIGSGPQNDW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA-KVGMKKTLVYYLGRAPEGK 702
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I +  GA ++GM+KTLV+Y GRAP G+
Sbjct: 71  YFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYASPGARRIGMRKTLVFYKGRAPHGQ 130

Query: 703 RTHWVIHEYR 732
           ++ W++HEYR
Sbjct: 131 KSDWIMHEYR 140



>gb:AF488412_1804372 Sorghum bicolor BAC 131L1, complete sequence.
          Length = 428

 Score =  147 bits (371), Expect = 4e-34
 Identities = 63/129 (48%), Positives = 92/129 (71%), Gaps = 1/129 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESH-DNEW 525
           +P G+RF PT+EEL+ +YLK K+     ++ VIR+VD+ K EPWD+ +   + S   N+W
Sbjct: 11  VPPGFRFHPTEEELLTYYLKKKVASERIDLDVIRDVDLNKLEPWDIQEKCRIGSGPQNDW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I +    ++GM+KTLV+Y GRAP G++
Sbjct: 71  YFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYASGARRIGMRKTLVFYKGRAPHGQK 130

Query: 706 THWVIHEYR 732
           + W++HEYR
Sbjct: 131 SDWIMHEYR 139



>pir|T07182|T07182 hypothetical protein SENU5, senescence up-regulated
            - tomato>gb:LESENU5_1684640 L.esculentum partial mRNA
            (clone SENU5).
          Length = 272

 Score =  147 bits (371), Expect = 4e-34
 Identities = 99/264 (37%), Positives = 135/264 (51%), Gaps = 16/264 (6%)
 Frame = +1

Query: 349  LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLP-DMSFVESHDNEW 525
            LP G+RFRPTDEELV  YLK K+       S+I EV++ K +PWDLP DM      + E 
Sbjct: 14   LPPGFRFRPTDEELVVQYLKRKVFSFPLPASIIPEVEVYKSDPWDLPGDM------EQEK 67

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSR----KGAKVGMKKTLVYYLGRAP 693
            +FF  K+ KY NG R NRAT  GYWKATG D+ I  R    +   +G+KKTLV+Y G++P
Sbjct: 68   YFFSTKEVKYPNGNRSNRATNSGYWKATGIDKQIILRGRQQQQQLIGLKKTLVFYRGKSP 127

Query: 694  EGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK-------VELKLDEGAEISNS-- 846
             G RT+W++HEYR   N     H  Q  +V+CR+F K        E  +    E+ N   
Sbjct: 128  HGCRTNWIMHEYRLA-NLESNYHPIQGNWVICRIFLKKRGNTKNKEENMTTHDEVRNREI 186

Query: 847  DEVDPIVSSPTVVKTPAEDEQ--SEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSN 1020
            D+  P+VS    VK  + D +  +   + L K   I                  F   +N
Sbjct: 187  DKNSPVVS----VKMSSRDSEALASANSELKKKASIIF--------------YDFMGRNN 228

Query: 1021 SNSCIADTTEDQVLDITSNPADPD 1092
            SN   A T+   + D+T+   + D
Sbjct: 229  SNGVAASTSSSGITDLTTTNEESD 252



>gb:AF509877_1807081 Petunia x hybrida nam-like protein 14 (NH14)
           mRNA, partial cds.
          Length = 288

 Score =  147 bits (370), Expect = 6e-34
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 3/146 (2%)
 Frame = +1

Query: 376 TDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKY 555
           TDEEL+ HYL  K+  S      I EVD+ K EPWDLP  +  +  + EW+FFC +DRKY
Sbjct: 1   TDEELITHYLCPKVLDSNFCAKAIGEVDLNKIEPWDLPWKA--KMGEKEWYFFCVRDRKY 58

Query: 556 QNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRT 735
             G R NRATE GYWKATGKD+ I   K   VGMKKTLV+Y GRAP+G++++WV+HEYR 
Sbjct: 59  PTGLRTNRATEAGYWKATGKDKEIFKLK-TLVGMKKTLVFYQGRAPKGQKSNWVMHEYR- 116

Query: 736 TENKFDGTHAGQA---PFVLCRLFRK 804
            E K+   +  Q     +V+CR+F+K
Sbjct: 117 LEGKYSAHNLPQTAKNEWVICRIFKK 142



>gb:AF488413_1804382 Oryza sativa chromosome 6 BAC 134P10, complete
           sequence.>gb:AP000559_1820321 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6,
           clone:P0493C11.>gb:AP002542_1822613 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0679C08.
          Length = 395

 Score =  147 bits (370), Expect = 6e-34
 Identities = 80/240 (33%), Positives = 129/240 (53%), Gaps = 28/240 (11%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES-HDNEW 525
           +P G+RF PT+EEL+ +YLK K+     ++ VIR+VD+ K EPWD+ +   + S   N+W
Sbjct: 11  VPPGFRFHPTEEELLTYYLKKKVASERIDLDVIRDVDLNKLEPWDIQERCRIGSGPQNDW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I S    ++GM+KTLV+Y GRAP G++
Sbjct: 71  YFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYSSSN-RIGMRKTLVFYKGRAPHGQK 129

Query: 706 THWVIHEYRTTE-------------NKFDGTHAGQAP--------------FVLCRLFRK 804
           + W++HEYR  +             + +  + +  +P              +V+CR+F+K
Sbjct: 130 SDWIMHEYRLDDPSSASASVSVNLPSYYSSSSSSSSPMHGVAGDQGAQEEGWVICRVFKK 189

Query: 805 VELKLDEGAEISNSDEVDPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSE 984
             L    G   + S      +++  +  +P+        + +  S H+K Q L    S +
Sbjct: 190 KNLVHHGGGAAAASHHAAAKLAAAAMEGSPS------NCSTVTVSDHVKAQMLHSSASDD 243



>pir|G84436|G84436 NAM (no apical meristem)-like protein [imported]
           - Arabidopsis thaliana
          Length = 176

 Score =  147 bits (370), Expect = 6e-34
 Identities = 62/125 (49%), Positives = 90/125 (72%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PT+EEL++ YL+ K+ G    V +I  +D+ +++PW+LP M+ +   + EW+F+ 
Sbjct: 42  GFRFHPTEEELIEFYLRRKVEGKRFNVELITFLDLYRYDPWELPAMAAIG--EKEWYFYV 99

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P+DRKY+NG R NR T  GYWKATG DR I S     +G+KKTLV+Y G+AP+G RT W+
Sbjct: 100 PRDRKYRNGDRPNRVTTSGYWKATGADRMIRSETSRPIGLKKTLVFYSGKAPKGTRTSWI 159

Query: 718 IHEYR 732
           ++EYR
Sbjct: 160 MNEYR 164



>gb:AY245886_1592571 Brassica napus NAC-domain protein 14 (NAC14)
           mRNA, complete cds.
          Length = 260

 Score =  146 bits (369), Expect = 8e-34
 Identities = 73/175 (41%), Positives = 105/175 (60%), Gaps = 3/175 (1%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFF 531
           P G+RF PTDEELV  YL  K         +I E+D+ +++ WDLPDM+     + EW+F
Sbjct: 11  PPGFRFHPTDEELVLMYLCRKCASQPIAAPIITELDLYRYDAWDLPDMALYG--EKEWYF 68

Query: 532 FCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTH 711
           F P+DRKY NG R NRA   GYWKATG D+ I   K   VG+KK LV+Y G+ P G++T+
Sbjct: 69  FSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGRPK--PVGIKKALVFYSGKPPRGEKTN 126

Query: 712 WVIHEYRTTE---NKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIV 867
           W++HEYR  +   +   G       +VLCR++ K  +     +E++N   + P++
Sbjct: 127 WIMHEYRLADVDRSVRKGNSLRLDDWVLCRIYNKKGVIEKRRSEVANGHVMAPVM 181



>gb:AY245880_1592565 Brassica napus NAC-domain protein 3 (NAC3)
           mRNA, complete cds.
          Length = 278

 Score =  145 bits (367), Expect = 1e-33
 Identities = 74/160 (46%), Positives = 97/160 (60%), Gaps = 7/160 (4%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  K    E    VI E+D+ K  PW+LP+MS     + EW
Sbjct: 6   NLPAGFRFHPTDEELVKFYLCRKCASEEISAPVIAEIDLYKFNPWELPEMSLY--GEKEW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  +DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 64  YFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 121

Query: 706 THWVIHEYRTTE-------NKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR          NK +        +VLCR++ K
Sbjct: 122 TNWIMHEYRLANVDRSASLNKKNNLRLDD--WVLCRIYNK 159



>gb:AY084323_1569414 Arabidopsis thaliana clone 103969 mRNA,
           complete sequence.
          Length = 334

 Score =  145 bits (367), Expect = 1e-33
 Identities = 78/203 (38%), Positives = 124/203 (61%), Gaps = 15/203 (7%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFV-ESHDNEW 525
           +P G+RF PT+EEL+ +YL+ KI+  + ++ VI ++D+ K EPWD+ +M  +  +  N+W
Sbjct: 11  VPPGFRFHPTEEELLKYYLRKKISNIKIDLDVIPDIDLNKLEPWDIQEMCKIGTTPQNDW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+TI +    ++GM+KTLV+Y GRAP G++
Sbjct: 71  YFFSHKDKKYPTGTRTNRATTVGFWKATGRDKTIYTNDD-RIGMRKTLVFYKGRAPHGQK 129

Query: 706 THWVIHEYRTTENKFDGT-------------HAGQAPFVLCRLFRKVELKLDEGAEISNS 846
           + W++HEYR  E+    +                   +V+CR+F+K            N+
Sbjct: 130 SDWIMHEYRLDESVLISSCGDDDVNVETCDVIGSDEGWVVCRVFKK------------NN 177

Query: 847 DEVDPIVSSP-TVVKTPAEDEQS 912
              + I SSP + VKTP+ +E++
Sbjct: 178 LCKNMISSSPASSVKTPSFNEET 200



>gb:AB026645_1517169 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MGH6.
          Length = 279

 Score =  145 bits (367), Expect = 1e-33
 Identities = 79/177 (44%), Positives = 106/177 (59%), Gaps = 1/177 (0%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF P D+ELV  YL  +   S  +  V+ +VD+ K EPWD+P  + V     EW
Sbjct: 17  NLPPGFRFHPRDDELVCDYLMRRTVRSLYQPVVLIDVDLNKCEPWDIPQTARVGG--KEW 74

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +F+  KDRKY  G R NRAT  GYWKATGKDR I  R G  VGM+KTLV+Y GR+P+G++
Sbjct: 75  YFYSQKDRKYATGYRTNRATATGYWKATGKDRAI-QRNGGLVGMRKTLVFYRGRSPKGRK 133

Query: 706 THWVIHEYRTTENKF-DGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSS 873
           T WV+HE+R          ++ +  +VLCR+F K           SN  ++D I  S
Sbjct: 134 TDWVMHEFRLQGKLLHHSPNSLEEEWVLCRVFHK----------NSNGADIDDITRS 180



>gb:AK118910_1816862 Arabidopsis thaliana At5g08790 mRNA for
           putative ATAF2 protein, complete cds, clone:
           RAFL21-25-G05.
          Length = 153

 Score =  145 bits (366), Expect = 2e-33
 Identities = 67/129 (51%), Positives = 87/129 (67%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  K    +    VI E+D+ K  PW+LP+MS     + EW
Sbjct: 6   NLPAGFRFHPTDEELVKFYLCRKCASEQISAPVIAEIDLYKFNPWELPEMSLYG--EKEW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 64  YFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 121

Query: 706 THWVIHEYR 732
           T+W++HEYR
Sbjct: 122 TNWIMHEYR 130



>gb:AC124836_1740487 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0092E21, complete sequence.
          Length = 322

 Score =  145 bits (366), Expect = 2e-33
 Identities = 71/155 (45%), Positives = 96/155 (61%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV HYL  +  G    V +I EVD+ K +PW LP M+     + EW+
Sbjct: 18  LPPGFRFHPTDEELVMHYLCRRCAGLPIAVPIIAEVDLYKFDPWHLPRMALYG--EKEWY 75

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG D+ + + +   V +KK LV+Y G+AP+G +T
Sbjct: 76  FFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGTPR--PVAIKKALVFYAGKAPKGDKT 133

Query: 709 HWVIHEYRTTENKFDGTHAGQA---PFVLCRLFRK 804
           +W++HEYR  +               +VLCR++ K
Sbjct: 134 NWIMHEYRLADVDRSARKKNTLRLDDWVLCRIYNK 168



>gb:AY730866_1625466 Helianthus annuus NAC-domain protein (NAC-1)
           mRNA, complete cds.
          Length = 205

 Score =  145 bits (366), Expect = 2e-33
 Identities = 75/156 (48%), Positives = 95/156 (60%), Gaps = 1/156 (0%)
 Frame = +1

Query: 340 LHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDN 519
           L  LP G+R  PTDEELV  YLK ++  S    S+I EVD+CK +PWDLP  S       
Sbjct: 11  LRRLPPGFRLHPTDEELVVQYLKRRVHSSPLPASIIPEVDVCKSDPWDLPGDS---DQQE 67

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPE 696
           E FFF  ++ KY NG R NRAT+ GYWKATG  R I  + +   VG+KKTLV+Y G+ P 
Sbjct: 68  ERFFFSTREIKYPNGNRSNRATQSGYWKATGLSRQIMGANQVGLVGIKKTLVFYKGKPPT 127

Query: 697 GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           G RT W++HEYR    +      G   +VLC++F K
Sbjct: 128 GSRTDWIMHEYRLATTQ---PTQGLEKWVLCKIFLK 160



>gb:AE016959_1023094 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC078829_1541472 Oryza sativa
            chromosome 10 BAC OSJNBa0026O12 genomic sequence,
            complete sequence.>gb:AE017105_1752913 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 59 of 77
            of the complete sequence.
          Length = 324

 Score =  145 bits (365), Expect = 2e-33
 Identities = 93/253 (36%), Positives = 130/253 (51%), Gaps = 22/253 (8%)
 Frame = +1

Query: 346  SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
            +LP G+RF P+DEEL+  YL+ K+         + +VD+   EPW+LP+++ + +   EW
Sbjct: 10   TLPPGFRFCPSDEELICFYLRNKVANHRVASGTLVDVDLHAREPWELPEVAKLTAE--EW 67

Query: 526  FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGK 702
            +FF  +DRKY  G R NRAT+ GYWKATGKDR +      A VGM+KTLV+YLGRAP G+
Sbjct: 68   YFFSFRDRKYATGSRTNRATKTGYWKATGKDRIVHEGTTRAVVGMRKTLVFYLGRAPNGQ 127

Query: 703  RTHWVIHEYR-TTENKFDGTHAGQAPFVLCRLFRKVELKLDE--------------GAEI 837
            +T WV+HE+R  T N        +  +VLCR+F K +    E              GA  
Sbjct: 128  KTTWVMHEFRLETPNS-----QPKEDWVLCRVFDKKKPSTIEAEGGGSSGSDLFIPGATD 182

Query: 838  SNSDEVDPIVSSPTVVKTPAE------DEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGV 999
             ++D   P   +P +  +P        D +S    PLM         +  G       GV
Sbjct: 183  GSTDPSSPTTMAPLLGSSPDPTVVDRFDHRSAAVPPLMVLMQGGGDQMISGS------GV 236

Query: 1000 HFPIDSNSNSCIA 1038
            H   + NS S  A
Sbjct: 237  HCSNNDNSGSSSA 249



>pir|G84860|G84860 NAM (no apical meristem)-like protein [imported]
           - Arabidopsis thaliana>gb:AC006580_1534486 Arabidopsis
           thaliana chromosome 2 clone F23E6 map m551, complete
           sequence.
          Length = 275

 Score =  145 bits (365), Expect = 2e-33
 Identities = 69/151 (45%), Positives = 102/151 (67%), Gaps = 1/151 (0%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEEL+ +YL+ K+     ++ +I+++DI K++PWDLP +S V   + EW+FFC
Sbjct: 21  GFRFHPTDEELLGYYLRRKVENKTIKLELIKQIDIYKYDPWDLPRVSSV--GEKEWYFFC 78

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
            + RKY+N  R NR T  G+WKATG D+ + S     VG+KK+LVYYLG A +G +T W+
Sbjct: 79  MRGRKYRNSVRPNRVTGSGFWKATGIDKPVYSNLDC-VGLKKSLVYYLGSAGKGTKTDWM 137

Query: 718 IHEYRTTENKFDGTHAGQAP-FVLCRLFRKV 807
           +HE+R        + A QA  + LCR+F++V
Sbjct: 138 MHEFRLPSTTKTDSPAQQAEVWTLCRIFKRV 168



>gb:AE005173_893937 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007190_1535506 Genomic sequence
           for Arabidopsis thaliana BAC F23N19 from chromosome I,
           complete sequence.
          Length = 418

 Score =  144 bits (362), Expect = 5e-33
 Identities = 73/177 (41%), Positives = 107/177 (60%), Gaps = 25/177 (14%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESH----- 513
           +P G+RF PTDEELVD+YL+ K+     E+ +I++VD+ K EP DL  ++    H     
Sbjct: 7   VPPGFRFHPTDEELVDYYLRKKVASKRIEIDIIKDVDLYKIEPCDLQGLAGKSYHLSLVV 66

Query: 514 --------------------DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISS 633
                                +EW+FF  KD+KY  G R NRAT+ G+WKATG+D+ I  
Sbjct: 67  ISLFWYKLRLTILCKIGNEEQSEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYI 126

Query: 634 RKGAKVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           R  + +GM+KTLV+Y GRAP G+++ W++HEYR  E   +GT   +  +V+CR+F+K
Sbjct: 127 RH-SLIGMRKTLVFYKGRAPNGQKSDWIMHEYR-LETSENGTPQEEG-WVVCRVFKK 180



>gb:AY034959_1559740 Arabidopsis thaliana putative NAM protein
           (At1g32870) mRNA, complete cds.
          Length = 528

 Score =  143 bits (361), Expect = 6e-33
 Identities = 82/195 (42%), Positives = 115/195 (58%), Gaps = 2/195 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           L  G+RF PTDEELV +YLK KI   +  V  I E D+ K +P +LP+ +  ++ D +WF
Sbjct: 10  LAPGFRFHPTDEELVVYYLKRKIRRKKLRVEAIGETDVYKFDPEELPEKALYKTRDRQWF 69

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF  +DRK+  G R +RATERGYWKATGKDR I       VG KKTLV++ GRAP G+RT
Sbjct: 70  FFSLRDRKH--GSRSSRATERGYWKATGKDRVIHC-DSRPVGEKKTLVFHRGRAPNGERT 126

Query: 709 HWVIHEY--RTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTV 882
           +WV+HEY     E K  G    +  +VL ++++K       G+   N ++      +P +
Sbjct: 127 NWVMHEYTLHKEELKRCGGEDVKDAYVLYKIYKK------SGSGPKNGEQ----YGAPFI 176

Query: 883 VKTPAEDEQSEGGTP 927
            +  AED+  +   P
Sbjct: 177 EEEWAEDDDDDVDEP 191



>pir|E86453|E86453 CDS protein F9L11.7 [imported] - Arabidopsis
           thaliana>gb:AE005172_892121 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006424_1534181 Arabidopsis thaliana
           chromosome I BAC F9L11 genomic sequence, complete
           sequence.
          Length = 522

 Score =  143 bits (361), Expect = 6e-33
 Identities = 82/195 (42%), Positives = 115/195 (58%), Gaps = 2/195 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           L  G+RF PTDEELV +YLK KI   +  V  I E D+ K +P +LP+ +  ++ D +WF
Sbjct: 10  LAPGFRFHPTDEELVVYYLKRKIRRKKLRVEAIGETDVYKFDPEELPEKALYKTRDRQWF 69

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF  +DRK+  G R +RATERGYWKATGKDR I       VG KKTLV++ GRAP G+RT
Sbjct: 70  FFSLRDRKH--GSRSSRATERGYWKATGKDRVIHC-DSRPVGEKKTLVFHRGRAPNGERT 126

Query: 709 HWVIHEY--RTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTV 882
           +WV+HEY     E K  G    +  +VL ++++K       G+   N ++      +P +
Sbjct: 127 NWVMHEYTLHKEELKRCGGEDVKDAYVLYKIYKK------SGSGPKNGEQ----YGAPFI 176

Query: 883 VKTPAEDEQSEGGTP 927
            +  AED+  +   P
Sbjct: 177 EEEWAEDDDDDVDEP 191



>gb:AP004562_1841619 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0470F10.>gb:AP005657_1855616 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0427G12.
          Length = 253

 Score =  143 bits (360), Expect = 8e-33
 Identities = 63/136 (46%), Positives = 96/136 (70%), Gaps = 1/136 (0%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVES-HDNEW 525
           +P G+RF PT+EEL+++YL+ K+   + ++ VIR+VD+ K EPWD+ +   + S   N+W
Sbjct: 11  VPPGFRFHPTEEELLNYYLRKKVASEQIDLDVIRDVDLNKLEPWDIQERCKIGSGPQNDW 70

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  KD+KY  G R NRAT  G+WKATG+D+ I +    ++GM+KTLV+Y GRAP G++
Sbjct: 71  YFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYNAV-HRIGMRKTLVFYKGRAPHGQK 129

Query: 706 THWVIHEYRTTENKFD 753
           + W++HEYR  +   D
Sbjct: 130 SDWIMHEYRLDDPATD 145



>gb:BT000896_1635151 Arabidopsis thaliana clone C104908 unknown
           protein (At5g63790) mRNA, complete cds.
          Length = 312

 Score =  143 bits (360), Expect = 8e-33
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 7/160 (4%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  +       V VI E+D+ K  PW+LP+M+     + EW
Sbjct: 49  NLPAGFRFHPTDEELVKFYLCRRCASEPINVPVIAEIDLYKFNPWELPEMALY--GEKEW 106

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  +DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 107 YFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 164

Query: 706 THWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR        + NK +        +VLCR++ K
Sbjct: 165 TNWIMHEYRLANVDRSASTNKKNNLRLDD--WVLCRIYNK 202



>gb:AB005234_1509353 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBK5.>gb:AY088431_1573450 Arabidopsis thaliana
           clone 6637 mRNA, complete sequence.
          Length = 269

 Score =  143 bits (360), Expect = 8e-33
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 7/160 (4%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  +       V VI E+D+ K  PW+LP+M+     + EW
Sbjct: 6   NLPAGFRFHPTDEELVKFYLCRRCASEPINVPVIAEIDLYKFNPWELPEMALY--GEKEW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  +DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 64  YFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 121

Query: 706 THWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR        + NK +        +VLCR++ K
Sbjct: 122 TNWIMHEYRLANVDRSASTNKKNNLRLDD--WVLCRIYNK 159



>pir|T52344|T52344 OsNAC5 protein [imported] -
           rice>gb:AB028184_1517820 Oryza sativa mRNA for OsNAC5
           protein, complete cds.
          Length = 329

 Score =  143 bits (360), Expect = 8e-33
 Identities = 72/162 (44%), Positives = 97/162 (59%), Gaps = 10/162 (6%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTD+ELV +YL  K  G      VI EVD+ K  PWDLP+ +     + EW+
Sbjct: 9   LPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEVDLYKFNPWDLPERAM--GGEKEWY 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NGQR NRA   GYWKATG D+ + S +   V +KK LV+Y G+ P+G +T
Sbjct: 67  FFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSPRA--VAIKKALVFYAGKPPKGVKT 124

Query: 709 HWVIHEYRTTE----------NKFDGTHAGQAPFVLCRLFRK 804
           +W++HEYR  +          +K          +VLCR++ K
Sbjct: 125 NWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVLCRIYNK 166



>pir|G96803|G96803 GRAB1-like protein, 10550-11502 [imported] -
           Arabidopsis thaliana>gb:AE005173_895268 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010704_1537014 Arabidopsis thaliana
           chromosome 1 BAC T5M16 genomic sequence, complete
           sequence.>gb:BT008538_1639755 Arabidopsis thaliana clone
           U51069 putative GRAB1 protein (At1g77450) mRNA, complete
           cds.>gb:AK118985_1816930 Arabidopsis thaliana At1g77450
           mRNA for GRAB1-like protein, complete cds, clone:
           RAFL21-32-D18.
          Length = 253

 Score =  142 bits (359), Expect = 1e-32
 Identities = 70/154 (45%), Positives = 94/154 (61%), Gaps = 3/154 (1%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFF 531
           P G+RF PTDEELV  YL  K         +I E+D+ +++PWDLPDM+     + EW+F
Sbjct: 11  PPGFRFHPTDEELVLMYLCRKCASQPIPAPIITELDLYRYDPWDLPDMALYG--EKEWYF 68

Query: 532 FCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTH 711
           F P+DRKY NG R NRA   GYWKATG D+ I   K   VG+KK LV+Y G+ P G++T+
Sbjct: 69  FSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGRPK--PVGIKKALVFYSGKPPNGEKTN 126

Query: 712 WVIHEYRTTENKFDGTHAGQA---PFVLCRLFRK 804
           W++HEYR  +               +VLCR++ K
Sbjct: 127 WIMHEYRLADVDRSVRKKNSLRLDDWVLCRIYNK 160



>gb:AY245881_1592566 Brassica napus NAC-domain protein 5-1 (NAC5-1)
           mRNA, complete cds.
          Length = 265

 Score =  142 bits (358), Expect = 1e-32
 Identities = 72/160 (45%), Positives = 96/160 (60%), Gaps = 7/160 (4%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  +       V VI E+D+ K  PW+LPD +     + EW
Sbjct: 6   NLPAGFRFHPTDEELVKFYLCRRCASEPITVPVIAEIDLYKFNPWELPDKALYG--EKEW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  +DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP G +
Sbjct: 64  YFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPRGVK 121

Query: 706 THWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR        + NK +        +VLCR++ K
Sbjct: 122 TNWIMHEYRLANVDRSASSNKKNNLRLDD--WVLCRIYNK 159



>gb:A82384_1450953 Sequence 9 from Patent
           WO9856811.>gb:TSP010829_1725898 Triticum sp. mRNA for
           GRAB1 protein.
          Length = 287

 Score =  142 bits (358), Expect = 1e-32
 Identities = 74/159 (46%), Positives = 97/159 (61%), Gaps = 6/159 (3%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  +  G    V +I E+D+ + +PW+LP+ +   +   EW
Sbjct: 16  NLPPGFRFHPTDEELVADYLCARAAGRAPPVPIIAELDLYRFDPWELPERALFGAR--EW 73

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NRA   GYWKATG DR + +R G  VG+KK LV+Y GR   G +
Sbjct: 74  YFFTPRDRKYPNGSRPNRAAGGGYWKATGADRPV-ARAGRTVGIKKALVFYHGRPSAGVK 132

Query: 706 THWVIHEYRTTENKFDGTHAGQA------PFVLCRLFRK 804
           T W++HEYR      DG  A          +VLCRL+ K
Sbjct: 133 TDWIMHEYRLA--GADGRAAKNGGTLRLDEWVLCRLYNK 169



>pir|A86466|A86466 BTF3b factor protein F23M19.14 - Arabidopsis
           thaliana>gb:AE005172_892221 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F23M19_1677955 Arabidopsis thaliana
           chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 576

 Score =  142 bits (358), Expect = 1e-32
 Identities = 79/197 (40%), Positives = 108/197 (54%), Gaps = 12/197 (6%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPD------------MSF 501
           G+RF PTDEELV +YLK KI   +  V+ I  VD+ K +P +LP             +S 
Sbjct: 19  GFRFHPTDEELVVYYLKRKICCKKLRVNAIGVVDVYKVDPSELPGNFQHLLIDFDSCLSM 78

Query: 502 VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYL 681
           +++ D +WFFF P++RKY N  R +R T  GYWKATGKDR I       VG+KKTLV+Y 
Sbjct: 79  LKTGDRQWFFFTPRNRKYPNAARSSRGTATGYWKATGKDRVI-EYNSRSVGLKKTLVFYR 137

Query: 682 GRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDP 861
           GRAP G+RT WV+HEY   E +       +  + L +L++K       GA   N ++   
Sbjct: 138 GRAPNGERTDWVMHEYTMDEEELGRCKNAKEYYALYKLYKK------SGAGPKNGEQYGA 191

Query: 862 IVSSPTVVKTPAEDEQS 912
                  V + +ED  S
Sbjct: 192 PFQEEEWVDSDSEDADS 208



>gb:AY245879_1592564 Brassica napus NAC-domain protein 1-1 (NAC1-1)
           mRNA, complete cds.
          Length = 252

 Score =  141 bits (356), Expect = 2e-32
 Identities = 65/129 (50%), Positives = 86/129 (66%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  +       V VI E+D+ K  PW+LP+M+     + EW
Sbjct: 6   NLPEGFRFHPTDEELVKFYLCRRCASEPISVPVIAEIDLYKFNPWELPEMALYG--EKEW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF P+DRKY NG R NR+   GYWKATG D+ I   K   +G+KK LV+Y G+AP G +
Sbjct: 64  YFFSPRDRKYPNGSRPNRSAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPRGVK 121

Query: 706 THWVIHEYR 732
           T+W++HEYR
Sbjct: 122 TNWIMHEYR 130



>gb:AY087541_1572571 Arabidopsis thaliana clone 36478 mRNA, complete
           sequence.
          Length = 252

 Score =  141 bits (356), Expect = 2e-32
 Identities = 69/154 (44%), Positives = 94/154 (61%), Gaps = 3/154 (1%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFF 531
           P G+RF PTDEELV  YL            +I E+D+ +++PWDLPDM+     + EW+F
Sbjct: 10  PPGFRFHPTDEELVLMYLCRNCASQPIPAPIITELDLYRYDPWDLPDMALYG--EKEWYF 67

Query: 532 FCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTH 711
           F P+DRKY NG R NRA   GYWKATG D+ I   K   VG+KK LV+Y G+ P G++T+
Sbjct: 68  FSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGRPK--PVGIKKALVFYSGKPPNGEKTN 125

Query: 712 WVIHEYRTTE---NKFDGTHAGQAPFVLCRLFRK 804
           W++HEYR  +   +           +VLCR++ K
Sbjct: 126 WIMHEYRLADVDRSVLKKNSLRLDDWVLCRIYNK 159



>gb:AC084748_1733651 Oryza sativa chromosome 3 BAC OSJNBa0010I09
           genomic sequence, complete sequence.>gb:AC091494_1734797
           Oryza sativa chromosome 3 BAC OSJNBa0070N04 genomic
           sequence, complete sequence.
          Length = 362

 Score =  141 bits (355), Expect = 3e-32
 Identities = 64/130 (49%), Positives = 88/130 (67%), Gaps = 5/130 (3%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YL+ K+      + +I+E+DI KH+PWDLP+ S V   + EW+FFC
Sbjct: 41  GFRFHPTDEELVTFYLRRKVARKSLSIEIIKEMDIYKHDPWDLPNASTV-GGEKEWYFFC 99

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDR-----TISSRKGAKVGMKKTLVYYLGRAPEGK 702
            + RKY+N  R NR T  G+WKATG DR      ++S  G  +G+KK+LVYY G A +G 
Sbjct: 100 LRGRKYRNSIRPNRVTGSGFWKATGIDRPIYSAAVNSNSGESIGLKKSLVYYRGSAGKGT 159

Query: 703 RTHWVIHEYR 732
           +T W++HE+R
Sbjct: 160 KTDWMMHEFR 169



>gb:A82380_1450951 Sequence 5 from Patent WO9856811.
          Length = 153

 Score =  141 bits (355), Expect = 3e-32
 Identities = 73/158 (46%), Positives = 96/158 (60%), Gaps = 6/158 (3%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           +P G+RF PTDEELV  YL  +  G    V +I E+D+ + +PW+LP+ +   +   EW+
Sbjct: 1   MPPGFRFHPTDEELVADYLCARAAGRAPPVPIIAELDLYRFDPWELPERALFGAR--EWY 58

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+DRKY NG R NRA   GYWKATG DR + +R G  VG+KK LV+Y GR   G +T
Sbjct: 59  FFTPRDRKYPNGSRPNRAAGGGYWKATGADRPV-ARAGRTVGIKKALVFYHGRPSAGVKT 117

Query: 709 HWVIHEYRTTENKFDGTHAGQA------PFVLCRLFRK 804
            W++HEYR      DG  A          +VLCRL+ K
Sbjct: 118 DWIMHEYRLA--GADGRAAKNGGTLRLDEWVLCRLYNK 153



>gb:AP004589_1841983 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0556A11.>gb:AP005442_1851827 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0073I05.
          Length = 293

 Score =  140 bits (354), Expect = 4e-32
 Identities = 86/221 (38%), Positives = 118/221 (53%), Gaps = 26/221 (11%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKIT---------GSEAEVSVIREVDICKHEPWDLPDMSF 501
           +P G+RF P D+ELV  YL  K+          G    V+++ +VD+ K EPWDLPD + 
Sbjct: 11  MPPGFRFHPRDDELVLDYLLHKLAAGGRGGGVYGGGGGVAIV-DVDLNKCEPWDLPDAAC 69

Query: 502 VESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI------------SSRKGA 645
           V     EW+FF  +DRKY  G R NRAT  GYWKATGKDR+I            SS   A
Sbjct: 70  VGG--KEWYFFSLRDRKYATGHRTNRATRSGYWKATGKDRSITRRSSISSGEPSSSAAAA 127

Query: 646 KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKL-- 819
            VGM+KTLV+Y GRAP+G++T WV+HE+R         H  +  +VLCR+F K    +  
Sbjct: 128 AVGMRKTLVFYRGRAPKGRKTEWVMHEFRLEPQPL---HL-KEDWVLCRVFYKTRQTIPS 183

Query: 820 ---DEGAEISNSDEVDPIVSSPTVVKTPAEDEQSEGGTPLM 933
              +E   + N  ++    S P ++      + +   TP M
Sbjct: 184 PSSEEAVTLPNELDLPATPSLPPLIDAYIAFDSAPTTTPSM 224



>gb:AY325313_1599620 Zea mays NAM-related protein 1 (NRP1) mRNA,
           complete cds.
          Length = 391

 Score =  140 bits (352), Expect = 7e-32
 Identities = 71/146 (48%), Positives = 94/146 (64%), Gaps = 4/146 (2%)
 Frame = +1

Query: 307 LKVERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDL 486
           + V+R  GL     LP G+RF P+D E+++ YL  K+   +     I + D+ K EPWDL
Sbjct: 14  MDVDRTGGL----ELPPGFRFHPSDFEIINDYLTKKVHDRDYSCIAIADADLNKTEPWDL 69

Query: 487 PDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VG 654
           P ++  +  + EW FF  KDRKY  G R NRATE GYWKATGKD+ + +   A+    VG
Sbjct: 70  PKVA--KMGEKEWCFFYQKDRKYPTGLRANRATEAGYWKATGKDKEVYNPFAAEGLLLVG 127

Query: 655 MKKTLVYYLGRAPEGKRTHWVIHEYR 732
           MKKTLV+Y GRAP G +T+WV+HEYR
Sbjct: 128 MKKTLVFYKGRAPRGDKTNWVMHEYR 153



>gb:AB016876_1512981 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MKM21.
          Length = 337

 Score =  140 bits (352), Expect = 7e-32
 Identities = 63/126 (50%), Positives = 89/126 (70%), Gaps = 1/126 (0%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YLK K+        +I++VDI K++PWDLP ++ +   + EW+F+C
Sbjct: 23  GFRFHPTDEELVSFYLKRKVLHKSLPFDLIKKVDIYKYDPWDLPKLAAMG--EKEWYFYC 80

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK-VGMKKTLVYYLGRAPEGKRTHW 714
           P+DRKY+N  R NR T  G+WKATG DR I S    + +G+KK+LV+Y GRA +G +T W
Sbjct: 81  PRDRKYRNSTRPNRVTGGGFWKATGTDRPIYSLDSTRCIGLKKSLVFYRGRAAKGVKTDW 140

Query: 715 VIHEYR 732
           ++HE+R
Sbjct: 141 MMHEFR 146



>gb:AY045843_1561355 Arabidopsis thaliana unknown protein
           (At5g63790) mRNA, partial cds.
          Length = 306

 Score =  137 bits (346), Expect = 4e-31
 Identities = 71/160 (44%), Positives = 97/160 (60%), Gaps = 7/160 (4%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV  YL  +       V VI E+D+ K  P +LP+M+     + EW
Sbjct: 43  NLPAGFRFHPTDEELVKFYLCRRCASEPINVPVIAEIDLYKFNPRELPEMALYG--EKEW 100

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF  +DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G +
Sbjct: 101 YFFSHRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKGIK 158

Query: 706 THWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK 804
           T+W++HEYR        + NK +        +VLCR++ K
Sbjct: 159 TNWIMHEYRLANVDRSASTNKKNNLRLDD--WVLCRIYNK 196



>pir|B85020|B85020 probable NAM-like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV4_1545255 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 4.
          Length = 457

 Score =  136 bits (343), Expect = 8e-31
 Identities = 72/155 (46%), Positives = 95/155 (61%), Gaps = 3/155 (1%)
 Frame = +1

Query: 355 VGYRFRPTDEELVDHYLKMKITGSEAEVS-VIREVDICKHEPWDLPDMSFVESHDNEWFF 531
           VGYRF PT EEL++HYLK KI G    V   I E++IC ++P  LP +S ++S D  W+F
Sbjct: 6   VGYRFYPTGEELINHYLKNKILGKTWLVDEAISEINICSYDPIYLPSLSKIKSDDPVWYF 65

Query: 532 FCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG--AKVGMKKTLVYYLGRAPEGKR 705
           FCPK+      +   R T  GYWKATG DR I  ++G   ++G+KKTLVYY GR P+G  
Sbjct: 66  FCPKEYTSAKKKVTKRTTSSGYWKATGVDRKIKDKRGNRGEIGIKKTLVYYEGRVPKGVW 125

Query: 706 THWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE 810
           T WV+HEY  T    D     Q  +V+C++  K E
Sbjct: 126 TPWVMHEYHITCLPQD-----QRNYVICQVMYKGE 155



>gb:AC113930_1739094 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1384D03, complete sequence.
          Length = 331

 Score =  135 bits (340), Expect = 2e-30
 Identities = 75/162 (46%), Positives = 103/162 (63%), Gaps = 10/162 (6%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSE---AEVSVIREVDICKHEPWDLPDMSFVESHDN 519
           LP G+RF P+DEELV +YL+ K    +   A  S++ EVD+   EPWDLP+++ V S  +
Sbjct: 57  LPPGFRFHPSDEELVGYYLRNKQQQQQQQTAATSMLVEVDLHACEPWDLPEVAKVGS--D 114

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           EW+FF  ++RKY  G R NRA+++GYWKATGKD+ I     A  G +KTLV+Y GRAP G
Sbjct: 115 EWYFFSWRERKYATGWRRNRASKQGYWKATGKDKPILHPTVA--GARKTLVFYSGRAPNG 172

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQ-------APFVLCRLFRK 804
           ++T WV+HE+R   +        Q         +VLCR+FRK
Sbjct: 173 RKTAWVMHEFRLLHHHHHPNPNIQNMQQQEGDDWVLCRVFRK 214



>gb:AP003829_1833924 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1417_E01.>gb:AP004314_1840058 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0495H05.
          Length = 343

 Score =  134 bits (338), Expect = 3e-30
 Identities = 70/163 (42%), Positives = 97/163 (59%), Gaps = 14/163 (8%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YL+ KI      + +I+E+DI KH+P D    S V S + EW+FFC
Sbjct: 34  GFRFHPTDEELVTFYLRRKIAEKRLSIEIIKEMDIYKHDPSDFLKTSTVGS-EKEWYFFC 92

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAK----VGMKKTLVYYLGRAPEGKR 705
            + RKY+N  R NR T  G+WKATG DR I S  G      +G+KK+LVYY G A +G +
Sbjct: 93  LRGRKYRNSIRPNRVTGSGFWKATGIDRPICSAAGGGGGDCIGLKKSLVYYRGSAGKGTK 152

Query: 706 THWVIHEYRTTENKFDGTHAGQAP----------FVLCRLFRK 804
           T W++HE+R      D   AG++           + +CR+F++
Sbjct: 153 TDWMMHEFRLPPPPADDLAAGRSSPPPSLQEAEVWTICRIFQR 195



>gb:BT002462_1636065 Arabidopsis thaliana NAM / CUC2 -like protein
           (At4g28530) mRNA, complete cds.>gb:BT008741_1639937
           Arabidopsis thaliana At4g28530 gene, complete cds.
          Length = 352

 Score =  134 bits (338), Expect = 3e-30
 Identities = 79/211 (37%), Positives = 114/211 (54%), Gaps = 35/211 (16%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSV----------------IREVDICKHEPW 480
           LP G+RF P+DEELV HYL  KI        V                + E+D+   EPW
Sbjct: 10  LPPGFRFHPSDEELVCHYLCNKIRAKSDHGDVDDDDDDVDEALKGSTDLVEIDLHICEPW 69

Query: 481 DLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGM 657
           +LPD++ + +   EW+FF  +DRKY  G R NRAT  GYWKATGKDRT+   R    VGM
Sbjct: 70  ELPDVAKLNA--KEWYFFSFRDRKYATGYRTNRATVSGYWKATGKDRTVMDPRTRQLVGM 127

Query: 658 KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK----------- 804
           +KTLV+Y  RAP G +T W++HE+R            +  +VLCR+F K           
Sbjct: 128 RKTLVFYRNRAPNGIKTTWIMHEFRLECPNI----PPKEDWVLCRVFNKGRDSSLQDNNY 183

Query: 805 -------VELKLDEGAEISNSDEVDPIVSSP 876
                    L++++  +++ ++++ P++SSP
Sbjct: 184 YNNDNQTQRLEVNDAPDLNYNNQLPPLLSSP 214



>gb:AF510215_1807172 Petunia x hybrida nam-like protein 18 (NH18)
           mRNA, complete cds.
          Length = 331

 Score =  134 bits (337), Expect = 4e-30
 Identities = 74/155 (47%), Positives = 98/155 (63%), Gaps = 3/155 (1%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEEL+ HYL  K+  +      I +VD+ K EPWDLP  + +    N +F
Sbjct: 18  LPPGFRFHPTDEELITHYLSKKVADNNFFAIAIGDVDMNKVEPWDLPWKAKMGGKGNGYF 77

Query: 529 FFCPKDRKY-QNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           F   +D+KY Q   R NRAT  GYWKATGKD+ I   K   VGMKKTLV+Y GRAP+G++
Sbjct: 78  FGV-RDKKYPQLDLRTNRATTAGYWKATGKDKEIFRGK-TLVGMKKTLVFYRGRAPKGEK 135

Query: 706 THWVIHEYRTTENKF--DGTHAGQAPFVLCRLFRK 804
           T+WVIHE+R        + +   +  +V+CR+F K
Sbjct: 136 TNWVIHEFRLEGRAALQNLSKTSKDDWVICRVFHK 170



>gb:AF509876_1807080 Petunia x hybrida nam-like protein 13 (NH13)
           mRNA, partial cds.
          Length = 113

 Score =  134 bits (337), Expect = 4e-30
 Identities = 66/112 (58%), Positives = 81/112 (72%), Gaps = 1/112 (0%)
 Frame = +1

Query: 379 DEELVDHYLKMKITGSEAEVSV-IREVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKY 555
           DEELV +YL+ KI+G   +V   I E+DI K EPWDLP MS + + D EW+FF   D+KY
Sbjct: 2   DEELVRYYLRRKISGRPFKVEPPISEIDIYKVEPWDLPGMSRLRTRDLEWYFFSFLDKKY 61

Query: 556 QNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTH 711
            NG R NRATE+GYWK TGKDR +   K   VGMKKTLVY+ GRAP+G+RT+
Sbjct: 62  GNGARTNRATEKGYWKTTGKDRAVFRSKSQVVGMKKTLVYHSGRAPKGQRTN 113



>gb:U89959_1726486 Arabidopsis thaliana BAC T7I23, complete
           sequence.
          Length = 345

 Score =  132 bits (331), Expect = 2e-29
 Identities = 75/186 (40%), Positives = 103/186 (55%), Gaps = 12/186 (6%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEV--SVIREVDICKHEPWDLPDMSFVESHDNEW 525
           PVG+RFRP DEE+VDHYL+ K   S+      VI  VDIC  EPWDLP  S ++S D  W
Sbjct: 4   PVGFRFRPNDEEIVDHYLRPKNLDSDTSHVDEVISTVDICSFEPWDLPSKSMIKSRDGVW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG--AKVGMKKTLVYYLGRAPEG 699
           +FF  K+ KY  G +  R T  G+WK TGK  T+  ++G   K+G K+ LV+   +  +G
Sbjct: 64  YFFSVKEMKYNRGDQQRRRTNSGFWKKTGKTMTVMRKRGNREKIGEKRVLVF---KNRDG 120

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDE--------GAEISNSDEV 855
            +T WV+HEY  T + F         + +C    KVE K +E        G+EI     +
Sbjct: 121 SKTDWVMHEYHAT-SLFPNQ---MMTYTVC----KVEFKGEETEISSSSTGSEIEQIHSL 172

Query: 856 DPIVSS 873
            P+V+S
Sbjct: 173 IPLVNS 178



>gb:OSJN00099_1694892 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0020J19, complete sequence.
          Length = 285

 Score =  130 bits (328), Expect = 4e-29
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 11/160 (6%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF--F 531
           G+RF PT+EELV +YL  K+ G + +  +I+EVD+   EPWDL      + HD E++  F
Sbjct: 11  GFRFHPTEEELVGYYLARKVVGQQDD-GIIQEVDLNSIEPWDLLQ---AQQHDQEYYCYF 66

Query: 532 FCPKDRKYQN----GQRLNRATERGYWKATGKDRTI-----SSRKGAKVGMKKTLVYYLG 684
           F  KDRKY +    G R NRAT  G+WKATG+D+ +     SS   A +GM+KTLV+Y G
Sbjct: 67  FSYKDRKYPSARGTGTRTNRATAAGFWKATGRDKPVLSSSRSSSSPAVIGMRKTLVFYRG 126

Query: 685 RAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           RAP G +T W+IHEYR   +         + +V+CR F K
Sbjct: 127 RAPNGCKTDWIIHEYRLVAHH---QQPDGSCWVVCRAFHK 163



>gb:AF510213_1807170 Petunia x hybrida nam-like protein 16 (NH16)
           mRNA, partial cds.
          Length = 349

 Score =  130 bits (327), Expect = 6e-29
 Identities = 64/143 (44%), Positives = 90/143 (62%), Gaps = 2/143 (1%)
 Frame = +1

Query: 385 ELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNG 564
           +L+  YL  K+  +      I EVD+ + EPW+LPD +  +  + EW+FF  +DRKY  G
Sbjct: 1   KLITFYLASKVFNATFSGIHIAEVDLNRCEPWELPDAA--KMGEREWYFFSLRDRKYPTG 58

Query: 565 QRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPEGKRTHWVIHEYRTT 738
            R NRAT  GYWKATGKDR + S       +GMKKTLV+Y GRAP G++T WV+HEYR  
Sbjct: 59  LRTNRATGAGYWKATGKDREVYSATNGSLLIGMKKTLVFYKGRAPRGEKTKWVMHEYRLG 118

Query: 739 ENKFDGTHAGQAPFVLCRLFRKV 807
            +     ++ +  +V+CR+F K+
Sbjct: 119 GDFSYRNYSSKEEWVICRIFHKI 141



>gb:AY087470_1572501 Arabidopsis thaliana clone 35774 mRNA, complete
           sequence.
          Length = 352

 Score =  129 bits (324), Expect = 1e-28
 Identities = 78/211 (36%), Positives = 113/211 (53%), Gaps = 35/211 (16%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSV----------------IREVDICKHEPW 480
           LP G+RF P+DEELV HYL  KI        V                + E+D+   EPW
Sbjct: 10  LPPGFRFHPSDEELVCHYLCNKIRAKSDHGDVDDDDDDVDEALKGSTDLVEIDLHICEPW 69

Query: 481 DLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGM 657
           +LPD++ + +   E +FF  +DRKY  G R NRAT  GYWKATGKDRT+   R    VGM
Sbjct: 70  ELPDVAKLNA--KERYFFSFRDRKYATGYRTNRATVSGYWKATGKDRTVMDPRTRQLVGM 127

Query: 658 KKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK----------- 804
           +KTLV+Y  RAP G +T W++HE+R            +  +VLCR+F K           
Sbjct: 128 RKTLVFYRNRAPNGIKTTWIMHEFRLECPNI----PPKEDWVLCRVFNKGRDSSLQDNNY 183

Query: 805 -------VELKLDEGAEISNSDEVDPIVSSP 876
                    L++++  +++ ++++ P++SSP
Sbjct: 184 YNNDNQTQRLEVNDAPDLNYNNQLPPLLSSP 214



>gb:AC108875_1738613 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1123_C08, complete
           sequence.>gb:AC137617_1743614 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0084P24,
           complete sequence.
          Length = 310

 Score =  128 bits (322), Expect = 2e-28
 Identities = 65/168 (38%), Positives = 95/168 (56%), Gaps = 16/168 (9%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEELV +YL+ + TG    + +I +V+I    PW+LP M+    H  EW+
Sbjct: 10  LPTGFRFHPTDEELVINYLQRRATGLSCPIPIIADVEIYNFNPWELPSMALFGEH--EWY 67

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDR--TISSRKGAKVGMKKTLVYYLGRAPEGK 702
           FF  +D +Y N  R +R+   G+WKATG D+   +++ +   V MKK LV+Y+GR P   
Sbjct: 68  FFTLRDHRYPNSVRPSRSAASGFWKATGTDKPVQVANMQSTPVAMKKALVFYVGRPPMET 127

Query: 703 RTHWVIHEYRTTENKFDGTHAGQA--------------PFVLCRLFRK 804
           +T W++HEYR T     G+ A                  +VLC++F K
Sbjct: 128 KTTWIMHEYRLTNT--GGSTASHPSLSSSTAHPSVKLDEWVLCKIFNK 173



>pir|C96601|C96601 hypothetical protein T6H22.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_893484 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC009894_1536882 Arabidopsis thaliana
           chromosome I BAC T6H22 genomic sequence, complete
           sequence.
          Length = 309

 Score =  128 bits (321), Expect = 3e-28
 Identities = 75/179 (41%), Positives = 103/179 (57%), Gaps = 5/179 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELV-DHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           LP G+RF P D+ELV D+ ++  +  +     V+ +VD+ K EPWD+P  +  +      
Sbjct: 19  LPPGFRFHPKDDELVCDYLMRRSLHNNHRPPLVLIQVDLNKCEPWDIPMYNTTKR----- 73

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
                +DRKY  G R NRAT  GYWKATGKDRTI  RKG  VGM+KTLV+Y GRAP G++
Sbjct: 74  -VCVQRDRKYATGLRTNRATATGYWKATGKDRTIL-RKGKLVGMRKTLVFYQGRAPRGRK 131

Query: 706 THWVIHEYRTTENKFDGTHAGQAP----FVLCRLFRKVELKLDEGAEISNSDEVDPIVS 870
           T WV+HE+R   +     H+  +P     V+CR    +    DE A  S    +DP ++
Sbjct: 132 TDWVMHEFRLQGSHHPPNHSLSSPKNTEGVICR--DNMGSCFDETASASLPPLMDPYIN 188



>gb:AP003685_1832027 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0548E04.>gb:AP004685_1843353 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0017G10.
          Length = 292

 Score =  127 bits (320), Expect = 4e-28
 Identities = 89/293 (30%), Positives = 140/293 (47%), Gaps = 11/293 (3%)
 Frame = +1

Query: 358  GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
            G+RF PT+EEL++ YLK  + G + +  +I  V + +H+P +LP ++ +   + EW+FF 
Sbjct: 22   GFRFHPTEEELLEFYLKQVVQGKKLKFDIIPTVHLYRHDPRELPGLARIG--EREWYFFV 79

Query: 538  PKDRKYQNGQ----RLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPEG 699
            P+DRK   G     R +R TERG+WKATG DR I      K  +G+KKTLVYY GRAP G
Sbjct: 80   PRDRKQATGGGGGGRPSRTTERGFWKATGSDRAIRCAADPKRLIGLKKTLVYYEGRAPRG 139

Query: 700  KRTHWVIHEYRTTE-NKFDGTHAGQA---PFVLCRLFRK-VELKLDEGAEISNSDEVDPI 864
             +T WV++EYR  +      T   Q      VLC+++RK V LK           E++  
Sbjct: 140  TKTDWVMNEYRLPDAAAIPDTMQLQMQHDDMVLCKVYRKAVSLK-----------ELEQR 188

Query: 865  VSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADT 1044
            V+   + ++         G+PL +     +   +     +E  GV       +++   + 
Sbjct: 189  VAMEELARSTTSSGTHNTGSPLQQDSSSISISSSSDAMKKEVVGV-----DEASAAAHEL 243

Query: 1045 TEDQVLDITSNPADPDLDALKFFIDPSTGPIYSPTYEQMPEFGSSYFYGDVIN 1203
                 L +           L++  +P    + SP  E       S +Y  V+N
Sbjct: 244  VRPATLSLPQLEVARPQSGLEWMQEPFLTQLRSPWMETW-----SPYYASVLN 291



>gb:OSJN00174_1696188 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0058K23, complete sequence.
          Length = 326

 Score =  127 bits (319), Expect = 5e-28
 Identities = 78/200 (39%), Positives = 103/200 (51%), Gaps = 47/200 (23%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIR--EVDICKHEPWDLP---------- 489
           +LP G+RF P DEELV  YL  K++G       +   +VD+ K EPW+LP          
Sbjct: 4   NLPPGFRFHPRDEELVVDYLYHKLSGGGEFYGGVAMVDVDLNKCEPWELPAYFLHNLIIF 63

Query: 490 ---------------DMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRT 624
                          D + V +   EW+FF   DRKY  GQR NRAT  GYWKATGKDR 
Sbjct: 64  PARARARAAGRRRREDAARVGA--TEWYFFSLHDRKYATGQRTNRATRSGYWKATGKDRA 121

Query: 625 ISSRK----------GAKVGMKKTLVYYLGRAPEGKRTHWVIHEYR----------TTEN 744
           I +R+          G  VGM+KTLV+Y GRAP G +T WV+HE+R          ++  
Sbjct: 122 IVTRRRAAAGEAVAGGEVVGMRKTLVFYQGRAPRGSKTEWVMHEFRVDGHAVADHPSSST 181

Query: 745 KFDGTHAGQAPFVLCRLFRK 804
               ++  +  +VLCR+F K
Sbjct: 182 SSSSSNLLKEDWVLCRVFYK 201



>pir|T01942|T01942 hypothetical protein F11O4.3 - Arabidopsis
           thaliana>gb:ATCHRIV4_1545252 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 4.>gb:F11O4_1677324
           Arabidopsis thaliana BAC F11O4.
          Length = 302

 Score =  127 bits (319), Expect = 5e-28
 Identities = 74/189 (39%), Positives = 105/189 (55%), Gaps = 4/189 (2%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVS-VIREVDICKHEPW-DLPDMSFVESHDNEW 525
           P GYRF PT EE+++HYLK KI G    V   I E++I  H+P  DLP ++ ++S D EW
Sbjct: 5   PTGYRFSPTGEEVINHYLKNKILGKTWLVDEAISEINILNHKPSKDLPKLARIQSEDLEW 64

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK--GAKVGMKKTLVYYLGRAPEG 699
           +FF P +    N  ++ R T  G+WK +G DR I  ++  G  +G+KKTLVY+ G++P G
Sbjct: 65  YFFSPIEYTNPNKMKMKRTTGSGFWKPSGVDRKIRDKRGNGVVIGIKKTLVYHEGKSPHG 124

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPT 879
            RT WV+HEY  T          +  +V+C++  K      E AEIS       +  S T
Sbjct: 125 VRTPWVMHEYHIT-----CLPHHKRKYVVCQVKYK-----GEAAEISYEPSPSLVSDSHT 174

Query: 880 VVKTPAEDE 906
           V+    E E
Sbjct: 175 VIAINGEPE 183



>gb:OSA243961_1692391 Oryza sativa chromosome 4 BAC l1332 genomic
           sequences.
          Length = 331

 Score =  126 bits (317), Expect = 8e-28
 Identities = 84/239 (35%), Positives = 115/239 (48%), Gaps = 54/239 (22%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAE---------VSVIREVDICKHEPWDLP--- 489
           +LP G+RF P DEEL+  YL  K++G +           V+++ +VD+ K EPW+LP   
Sbjct: 4   NLPPGFRFHPRDEELIVDYLYHKLSGGDGGGGAGEFYGGVAMV-DVDLNKCEPWELPAYF 62

Query: 490 ----------------------DMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWK 603
                                 D + V +   EW+FF   DRKY  GQR NRAT  GYWK
Sbjct: 63  LHNLIIFPARARARAAGRRRRADAARVGA--TEWYFFSLHDRKYATGQRTNRATRSGYWK 120

Query: 604 ATGKDRTISSRK----------GAKVGMKKTLVYYLGRAPEGKRTHWVIHEYR------- 732
           ATGKDR I +R+          G  VGM+KTLV+Y GRAP G +T WV+HE+R       
Sbjct: 121 ATGKDRAIVTRRRAAGGEAVAGGEVVGMRKTLVFYQGRAPRGSKTEWVMHEFRVDGHAVA 180

Query: 733 ---TTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVVKTPAE 900
              ++      ++  +  +VLCR+F K           S +    P+VS    V    E
Sbjct: 181 DHPSSSTSSSSSNLLKEDWVLCRVFYK-----------SRTANPRPVVSGEAAVSLSGE 228



>pir|T01940|T01940 hypothetical protein F11O4.4 - Arabidopsis
           thaliana>gb:ATCHRIV4_1545254 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 4.>gb:F11O4_1677322
           Arabidopsis thaliana BAC F11O4.
          Length = 423

 Score =  126 bits (317), Expect = 8e-28
 Identities = 73/188 (38%), Positives = 105/188 (55%), Gaps = 4/188 (2%)
 Frame = +1

Query: 355 VGYRFRPTDEELVDHYLKMKITGSEAEVS-VIREVDICKHEPW-DLPDMSFVESHDNEWF 528
           +GYRF PT EE+++HYLK K+ G    V   I E++I  H+P  DLP ++ ++S D EW+
Sbjct: 6   IGYRFSPTGEEVINHYLKNKLLGKYWLVDEAISEINILSHKPSKDLPKLARIQSEDLEWY 65

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRK--GAKVGMKKTLVYYLGRAPEGK 702
           FF P +    N  ++ R T  G+WK TG DR I  ++  G  +G+KKTLVY+ G++P G 
Sbjct: 66  FFSPIEYTNPNKMKMKRTTGSGFWKPTGVDREIRDKRGNGVVIGIKKTLVYHEGKSPHGV 125

Query: 703 RTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTV 882
           RT WV+HEY  T          +  +V+C++  K      E AEIS       +  S TV
Sbjct: 126 RTPWVMHEYHIT-----CLPHHKRKYVVCQVKYK-----GEAAEISYEPSPSLVSDSHTV 175

Query: 883 VKTPAEDE 906
           +    E E
Sbjct: 176 IAITGEPE 183



>gb:OSB6015_1692800 Oryza sativa indica(GLA4) genomic DNA,
           chromosome 4, BAC clone: b6015.
          Length = 331

 Score =  125 bits (313), Expect = 2e-27
 Identities = 84/239 (35%), Positives = 114/239 (47%), Gaps = 54/239 (22%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAE---------VSVIREVDICKHEPWDLP--- 489
           +LP G+RF P DEEL+  YL  K++G             V+++ +VD+ K EPW+LP   
Sbjct: 4   NLPPGFRFHPRDEELIVDYLYHKLSGGGGGGGAGEFYGGVAMV-DVDLNKCEPWELPAYF 62

Query: 490 ----------------------DMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWK 603
                                 D + V +   EW+FF   DRKY  GQR NRAT  GYWK
Sbjct: 63  LHNLIIFPARARARAAGRRRRADAARVGA--TEWYFFSLHDRKYATGQRTNRATRSGYWK 120

Query: 604 ATGKDRTISSRK----------GAKVGMKKTLVYYLGRAPEGKRTHWVIHEYR------- 732
           ATGKDR I +R+          G  VGM+KTLV+Y GRAP G +T WV+HE+R       
Sbjct: 121 ATGKDRAIVTRRRAAGGEAVAGGEVVGMRKTLVFYQGRAPRGSKTEWVMHEFRVDGHAVA 180

Query: 733 ---TTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSSPTVVKTPAE 900
              ++      ++  +  +VLCR+F K           S +    P+VS    V    E
Sbjct: 181 DHPSSSTSSSSSNLLKEDWVLCRVFYK-----------SRTANPRPVVSGEAAVSLSGE 228



>gb:AY102140_1577745 Arabidopsis thaliana At2g17040/At2g17040 mRNA,
           complete cds.>gb:AF361804_1791396 Arabidopsis thaliana
           At2g17040 mRNA, complete cds.
          Length = 250

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/164 (40%), Positives = 102/164 (62%), Gaps = 8/164 (4%)
 Frame = +1

Query: 415 ITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERG 594
           + G  + V VI  ++I +H+PWDLP +S +   + EW+FF P++RK+ NG R +R TE+G
Sbjct: 2   VYGKRSSVEVIGFLNIYRHDPWDLPGLSRIG--EREWYFFVPRERKHGNGGRPSRTTEKG 59

Query: 595 YWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAG 768
           YWKATG DR I S    K  +G+KKTLV+Y GRAP G +T WV++E+R  +N      + 
Sbjct: 60  YWKATGSDRKIISLSEPKRVIGLKKTLVFYRGRAPGGSKTDWVMNEFRMPDN-----CSL 114

Query: 769 QAPFVLCRLFRK------VELKLDEGAEISNSDEVDPIVSSPTV 882
               VLC+++RK      +E + +  A+++ +    P+ SS T+
Sbjct: 115 PKDVVLCKIYRKATSLKVLEQRAEMEAKMNQTCPNSPLSSSETI 158



>gb:AC137611_1743526 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0020H14, complete
           sequence.>gb:AC147462_1744722 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone B1110B01, complete
           sequence.
          Length = 274

 Score =  123 bits (308), Expect = 9e-27
 Identities = 66/167 (39%), Positives = 90/167 (53%), Gaps = 15/167 (8%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREV---DICKHEPWDLPDM-SFVESHD 516
           LP GYRF PT+EELV  YL+ K+ G      + R +   D+C  +PW LP+      + D
Sbjct: 4   LPPGYRFYPTEEELVCFYLRHKLDGGRRVPDIERVIPVADVCSLDPWQLPEAHQGAWTGD 63

Query: 517 NE-WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAP 693
            E WF+FCP+  +   G R +R T  GYWKA G    + S  G  +G KKT+V+Y GRAP
Sbjct: 64  GEPWFYFCPRQEREARGGRPSRTTPSGYWKAAGTPGWVYSSDGRPIGTKKTMVFYRGRAP 123

Query: 694 EGKRTHWVIHEYRTTENKFDGTHAG----------QAPFVLCRLFRK 804
            G +T W ++EYR  E   D   A           ++ F LCRL+ +
Sbjct: 124 AGAKTKWKMNEYRAFEEDDDNAAAAAPAQNHYLQTRSDFSLCRLYTR 170



>gb:AF510212_1807169 Petunia x hybrida nam-like protein 15 (NH15)
           mRNA, partial cds.
          Length = 306

 Score =  122 bits (306), Expect = 2e-26
 Identities = 64/132 (48%), Positives = 85/132 (64%), Gaps = 1/132 (0%)
 Frame = +1

Query: 412 KITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATER 591
           K++          +VD+ K EPWDLP  + +     EW+FF  +DRKY  G R NRATE 
Sbjct: 5   KVSDVSFSARAFADVDLNKCEPWDLPAKASMGK--KEWYFFNLRDRKYPTGLRTNRATEA 62

Query: 592 GYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWVIHEYR-TTENKFDGTHAG 768
           GYWK TGKD+ I    G  VGMKKTLV+Y GRAP+G++T+WV+HEYR  TE+   G    
Sbjct: 63  GYWKTTGKDKEI-FHGGVLVGMKKTLVFYRGRAPKGQKTNWVMHEYRLETEH---GLKPS 118

Query: 769 QAPFVLCRLFRK 804
           +  +V+CR+F+K
Sbjct: 119 KEEWVVCRVFQK 130



>gb:AY060587_1564890 Arabidopsis thaliana AT3g04420/T27C4_6 mRNA,
            complete cds.>gb:BT000846_1635101 Arabidopsis thaliana
            At3g04420/T27C4_6 mRNA, complete cds.
          Length = 342

 Score =  118 bits (296), Expect = 2e-25
 Identities = 90/298 (30%), Positives = 142/298 (47%), Gaps = 6/298 (2%)
 Frame = +1

Query: 352  PVGYRFRPTDEELVDHYLKMKITGSEAEVS----VIREVDICKHEPWDLPDMSFVESHDN 519
            PVG RFRPTD+E+V  YL+ K   S+ + S    VI  V I   +PW+LP  S ++  D 
Sbjct: 4    PVGLRFRPTDKEIVVDYLRPK--NSDRDTSHVDRVISTVTIRSFDPWELPCQSRIKLKDE 61

Query: 520  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
             W FF PK+ KY  G +  R T+ GYWK TGK + I  R   ++G KK L++Y+ +   G
Sbjct: 62   SWCFFSPKENKYGRGDQQIRKTKSGYWKITGKPKPI-LRNRQEIGEKKVLMFYMSKELGG 120

Query: 700  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSS-- 873
             ++ WV+HEY    + F  T      + +C++  K +++    +  S   E++    S  
Sbjct: 121  SKSDWVMHEY----HAFSPTQM-MMTYTICKVMFKGDVREISSSSASYGSEIEQSRDSLI 175

Query: 874  PTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTED 1053
            P +V    E+ Q E   P+ +    +T     G   +    ++   D N++      T  
Sbjct: 176  PLLVNDSEEEAQIEDAIPIEE---WETWLTDDGVDEQVNHIMNMKDDRNNHRPQKPLTGV 232

Query: 1054 QVLDITSNPADPDLDALKFFIDPSTGPIYSPTYEQMPEFGSSYFYGDVINCISNNNDV 1227
             + D + +  D DL      + P+T  I + +      FGSS    D IN +S   +V
Sbjct: 233  LIDDSSDDDDDSDL------LSPTTNSIENSS--TCDSFGSS----DQINLVSLTQEV 278



>gb:AF360308_1791254 Arabidopsis thaliana putative NAM protein
           (At2g02450) mRNA, partial cds.
          Length = 292

 Score =  117 bits (294), Expect = 4e-25
 Identities = 51/113 (45%), Positives = 78/113 (69%)
 Frame = +1

Query: 466 KHEPWDLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGA 645
           +++PW+LP M+ +   + EW+F+ P+DRKY+NG R NR T  GYWKATG DR I S    
Sbjct: 3   RYDPWELPAMAAIG--EKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSETSR 60

Query: 646 KVGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
            +G+KKTLV+Y G+AP+G RT W+++EYR   ++ +     +A   LCR++++
Sbjct: 61  PIGLKKTLVFYSGKAPKGTRTSWIMNEYRLPHHETEKYQ--KAEISLCRVYKR 111



>gb:AF509875_1807079 Petunia x hybrida nam-like protein 12 (NH12)
           mRNA, partial cds.
          Length = 111

 Score =  117 bits (292), Expect = 6e-25
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 1/113 (0%)
 Frame = +1

Query: 376 TDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKY 555
           TDEELV HYLK K   +   V++I EVD+ K +PW+LP  S     + EW+FF P+DRKY
Sbjct: 1   TDEELVVHYLKKKAASAPLPVNIIAEVDLYKFDPWELP--SKANFGEQEWYFFSPRDRKY 58

Query: 556 QNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGKRTH 711
            NG R NRA   GYWKATG D+ I +     KVG+KK LV+Y G+ P+G +T+
Sbjct: 59  PNGARPNRAATSGYWKATGTDKPIFTCNVTRKVGVKKALVFYRGKPPKGIKTN 111



>gb:BT005873_1638795 Arabidopsis thaliana At1g56010 gene, complete
           cds.
          Length = 257

 Score =  113 bits (283), Expect = 7e-24
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 3/98 (3%)
 Frame = +1

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           +W+F+  +DRKY  G R NRAT  GYWKATGKDRTI  RKG  VGM+KTLV+Y GRAP G
Sbjct: 8   DWYFYSQRDRKYATGLRTNRATATGYWKATGKDRTI-LRKGKLVGMRKTLVFYQGRAPRG 66

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQAP---FVLCRLFRK 804
           ++T WV+HE+R   +     H+  +P   +VLCR+F K
Sbjct: 67  RKTDWVMHEFRLQGSHHPPNHSLSSPKEDWVLCRVFHK 104



>gb:AC146506_1744594 Solanum demissum chromosome 5 BAC PGEC989P08
           genomic sequence, complete sequence.
          Length = 363

 Score =  113 bits (282), Expect = 9e-24
 Identities = 58/157 (36%), Positives = 86/157 (54%), Gaps = 8/157 (5%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YL+ K+      + +I+++DI K++PWDLP ++ V   + EW+F+C
Sbjct: 8   GFRFHPTDEELVGFYLRRKVQQKPISIELIKQLDIYKYDPWDLPKLAAV--GEKEWYFYC 65

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P+DRKY+N  R NR T  G+WKAT                        GRA +G +T W+
Sbjct: 66  PRDRKYRNSARPNRVTGAGFWKAT------------------------GRAAKGIKTDWM 101

Query: 718 IHEYR-------TTENKFDGTH-AGQAPFVLCRLFRK 804
           +HE+R       T   +F   H      + +CR+F+K
Sbjct: 102 MHEFRLPSITDSTAPKRFLDKHIPPNDSWAICRIFKK 138



>gb:ATAC022287_1543757 Arabidopsis thaliana chromosome III BAC T27C4
            genomic sequence, complete sequence.
          Length = 340

 Score =  112 bits (281), Expect = 1e-23
 Identities = 89/298 (29%), Positives = 141/298 (47%), Gaps = 6/298 (2%)
 Frame = +1

Query: 352  PVGYRFRPTDEELVDHYLKMKITGSEAEVS----VIREVDICKHEPWDLPDMSFVESHDN 519
            PVG RFRPTD+E+V  YL+ K   S+ + S    VI  V I   +PW+LP    ++  D 
Sbjct: 4    PVGLRFRPTDKEIVVDYLRPK--NSDRDTSHVDRVISTVTIRSFDPWELPCK--IKLKDE 59

Query: 520  EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
             W FF PK+ KY  G +  R T+ GYWK TGK + I  R   ++G KK L++Y+ +   G
Sbjct: 60   SWCFFSPKENKYGRGDQQIRKTKSGYWKITGKPKPI-LRNRQEIGEKKVLMFYMSKELGG 118

Query: 700  KRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDPIVSS-- 873
             ++ WV+HEY    + F  T      + +C++  K +++    +  S   E++    S  
Sbjct: 119  SKSDWVMHEY----HAFSPTQM-MMTYTICKVMFKGDVREISSSSASYGSEIEQSRDSLI 173

Query: 874  PTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQSSEETPGVHFPIDSNSNSCIADTTED 1053
            P +V    E+ Q E   P+ +    +T     G   +    ++   D N++      T  
Sbjct: 174  PLLVNDSEEEAQIEDAIPIEE---WETWLTDDGVDEQVNHIMNMKDDRNNHRPQKPLTGV 230

Query: 1054 QVLDITSNPADPDLDALKFFIDPSTGPIYSPTYEQMPEFGSSYFYGDVINCISNNNDV 1227
             + D + +  D DL      + P+T  I + +      FGSS    D IN +S   +V
Sbjct: 231  LIDDSSDDDDDSDL------LSPTTNSIENSS--TCDSFGSS----DQINLVSLTQEV 276



>pir|T01939|T01939 hypothetical protein F11O4.5 - Arabidopsis
           thaliana>gb:F11O4_1677321 Arabidopsis thaliana BAC
           F11O4.
          Length = 310

 Score =  111 bits (277), Expect = 4e-23
 Identities = 63/154 (40%), Positives = 82/154 (53%), Gaps = 2/154 (1%)
 Frame = +1

Query: 355 VGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFF 534
           VGYRF PT EEL++HYLK KI                         +S ++S D  W+FF
Sbjct: 6   VGYRFYPTGEELINHYLKNKILA-----------------------LSKIKSDDPVWYFF 42

Query: 535 CPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG--AKVGMKKTLVYYLGRAPEGKRT 708
           CPK+      +   R T  GYWKATG DR I  ++G   ++G+KKTLVYY GR P+G  T
Sbjct: 43  CPKEYTSAKKKVTKRTTSSGYWKATGVDRKIKDKRGNRGEIGIKKTLVYYEGRVPKGVWT 102

Query: 709 HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVE 810
            WV+HEY  T    D     Q  +V+C++  K E
Sbjct: 103 PWVMHEYHITCLPQD-----QRNYVICQVMYKGE 131



>pir|T52342|T52342 NAC-domain protein [imported] - common
           tobacco>gb:AB021178_1514869 Nicotiana tabacum TERN mRNA
           for NAC-domain protein, complete cds.
          Length = 229

 Score =  110 bits (276), Expect = 5e-23
 Identities = 57/155 (36%), Positives = 85/155 (54%), Gaps = 8/155 (5%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVS-VIREVDICKHEPWDLPDM--SFVESHDNEWF 528
           G+RF PT+EEL+  YL  K+ G   E+  VI  V I   +PW LP++          +WF
Sbjct: 7   GFRFYPTEEELISFYLLNKLEGKRPELDRVIPVVTIYNLDPWHLPNLPGELCMGDTEQWF 66

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF P+  +   G R  R T  GYWKATG    + S +   +G+KK++V+Y G+AP G++T
Sbjct: 67  FFVPRQEREARGGRPCRTTTSGYWKATGSPTYVYSSESKVIGVKKSMVFYKGKAPTGRKT 126

Query: 709 HWVIHEYRTTENKFDGTHAGQAP-----FVLCRLF 798
            W ++EYR  E +   + +   P       LCR++
Sbjct: 127 KWKMNEYRAIEQETSTSSSFSIPKLRHEMSLCRVY 161



>gb:AY730338_1625436 Solanum tuberosum strain P6/210 clone BAC
           BA47f2, complete sequence.
          Length = 378

 Score =  110 bits (275), Expect = 6e-23
 Identities = 57/157 (36%), Positives = 83/157 (52%), Gaps = 8/157 (5%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFC 537
           G+RF PTDEELV  YL+ K+      + +I+++DI K++PWDLP        + EW+F+C
Sbjct: 22  GFRFHPTDEELVGFYLRRKVQQKPISIELIKQLDIYKYDPWDLPT-ELAAVGEKEWYFYC 80

Query: 538 PKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTHWV 717
           P+DRKY+N  R NR T  G+WKAT                        GRA +G +T W+
Sbjct: 81  PRDRKYRNSARPNRVTGAGFWKAT------------------------GRAAKGIKTDWM 116

Query: 718 IHEYR-------TTENKFDGTH-AGQAPFVLCRLFRK 804
           +HE+R       T   +F   H      + +CR+F+K
Sbjct: 117 MHEFRLPSITDSTAPKRFLDKHIPPNDSWAICRIFKK 153



>gb:BT001115_1635370 Arabidopsis thaliana At1g01010/T25K16_1 mRNA,
           complete cds.>gb:AF439834_1800009 Arabidopsis thaliana
           At1g01010/T25K16_1 mRNA, complete cds.
          Length = 429

 Score =  109 bits (273), Expect = 1e-22
 Identities = 69/178 (38%), Positives = 100/178 (56%), Gaps = 9/178 (5%)
 Frame = +1

Query: 355 VGYRFRPTDEELVDHYLKMKITGSEA-EVSV-IREVDICKHEPWDLPDMSFVESHDNEWF 528
           VG+ FRP DEELV HYL+ KI G+ + +V V I EV+IC ++PW+L   S  +S D  W+
Sbjct: 5   VGFGFRPNDEELVGHYLRNKIEGNTSRDVEVAISEVNICSYDPWNLRFQSKYKSRDAMWY 64

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG-------AKVGMKKTLVYYLGR 687
           FF    R+   G R +R T  G WK TG+   +  + G        K+G K+ LV+  GR
Sbjct: 65  FF--SRRENNKGNRQSRTTVSGKWKLTGESVEVKDQWGFCSEGFRGKIGHKRVLVFLDGR 122

Query: 688 APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKVELKLDEGAEISNSDEVDP 861
            P+  ++ WVIHE+      +D     Q  +V+CRL    E K D+ A+I ++  +DP
Sbjct: 123 YPDKTKSDWVIHEFH-----YDLLPEHQRTYVICRL----EYKGDD-ADILSAYAIDP 170



>gb:AB007651_1510266 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MWD9.>gb:AY086944_1571982 Arabidopsis thaliana
           clone 29829 mRNA, complete sequence.>gb:AK175806_1817794
           Arabidopsis thaliana mRNA for NAC-domain protein-like,
           complete cds, clone: RAFL22-40-G20.
          Length = 235

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/154 (35%), Positives = 90/154 (58%), Gaps = 6/154 (3%)
 Frame = +1

Query: 355 VGYRFRPTDEELVDHYLKMKITG--SEAEVSVIREVDICKHEPWDLPDMSFVESHDN--E 522
           +G+RF PT+EELV  YL+ ++ G   ++   VI  +D+ + EP  LP+++ V    +  +
Sbjct: 7   IGFRFYPTEEELVSFYLRNQLEGRSDDSMHRVIPVLDVFEVEPSHLPNVAGVRCRGDAEQ 66

Query: 523 WFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGK 702
           WFFF P+  +   G R +R T  GYWKATG    + S+    +G KKT+V+Y G+AP G+
Sbjct: 67  WFFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFSKDNKMIGAKKTMVFYTGKAPTGR 126

Query: 703 RTHWVIHEYRTTENKFDGTHAG--QAPFVLCRLF 798
           +T W ++EY   +   + +     +  F LCR++
Sbjct: 127 KTKWKMNEYHAVDETVNASTIPKLRREFSLCRVY 160



>pir|T47425|T47425 NAC domain-like protein - Arabidopsis
           thaliana>gb:ATT22K7_1555292 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T22K7.
          Length = 228

 Score =  106 bits (265), Expect = 9e-22
 Identities = 51/134 (38%), Positives = 82/134 (61%), Gaps = 3/134 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEV-SVIREVDICKHEPWDLPDMSFVESHDN-- 519
           L VG+RF PT+ EL+ +YL++++ G  A + S+I  +D+   EP  LP+++      +  
Sbjct: 5   LSVGFRFYPTEVELLTYYLRIQLGGGNATIHSLIPILDVFSVEPTQLPNLAGERCRGDAE 64

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           +W FF P+  +   G R +R T  GYWKATG    + S     +G+KKT+V+Y G+AP G
Sbjct: 65  QWIFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFSPDNRVIGVKKTMVFYTGKAPTG 124

Query: 700 KRTHWVIHEYRTTE 741
           ++T W ++EY+  E
Sbjct: 125 RKTKWKMNEYKAVE 138



>gb:AF510216_1807173 Petunia x hybrida nam-like protein 19 (NH19)
           mRNA, partial cds.
          Length = 154

 Score =  105 bits (263), Expect = 1e-21
 Identities = 51/96 (53%), Positives = 67/96 (69%), Gaps = 1/96 (1%)
 Frame = +1

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPE 696
           EW+FF  +DRKY  G R NRAT  GYWK TGKD+ I +S+    VGMKKTLV+Y GRAP 
Sbjct: 8   EWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNSKTSELVGMKKTLVFYKGRAPR 67

Query: 697 GKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
           G++++WV+HEYR   +K       Q  +V+CR+F+K
Sbjct: 68  GEKSNWVMHEYR-IRSKSTYRTTKQDEWVVCRIFQK 102



>gb:AF510218_1807174 Petunia x hybrida nam-like protein 22 (NH22)
           mRNA, partial cds.
          Length = 108

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/113 (49%), Positives = 70/113 (61%), Gaps = 2/113 (1%)
 Frame = +1

Query: 376 TDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWFFFCPKDRKY 555
           TDEELV  YLK K+       S+I ++D+ K +PWDLP        + E +FF  K+ KY
Sbjct: 1   TDEELVVQYLKRKVFSCPLPASIIPDIDVHKSDPWDLPG-----DLEQERYFFSTKEVKY 55

Query: 556 QNGQRLNRATERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGRAPEGKRT 708
            NG R NRAT  GYWKATG D+ I S +G +  VGMKKTLV+Y G+   G RT
Sbjct: 56  ANGSRSNRATNSGYWKATGLDKQIVSSRGQQQLVGMKKTLVFYKGKPLHGCRT 108



>gb:AP003611_1831333 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0423B08.
          Length = 256

 Score =  103 bits (257), Expect = 7e-21
 Identities = 66/223 (29%), Positives = 105/223 (47%), Gaps = 23/223 (10%)
 Frame = +1

Query: 358 GYRFRPTDEELVDHYLKMKITGSEAEVS-VIREVDICKHEPWDLPDMSFVE-----SHDN 519
           G+RF PT+EEL+  YL+ K+ G   ++  VI   D+   +P  L ++             
Sbjct: 11  GFRFYPTEEELICFYLRNKLDGLRDDIERVIPVFDVYSVDPLQLSEIHHEMLGGGGEEGE 70

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
            WF+FCP+  +   G R +R T  GYWKA G    + S     +GMKKT+V+Y GRAP G
Sbjct: 71  PWFYFCPRQEREARGGRPSRTTPSGYWKAAGTPGVVYSADRRPIGMKKTMVFYRGRAPSG 130

Query: 700 KRTHWVIHEYRT----TENKFDGTHAGQA------------PFVLCRLF-RKVELKLDEG 828
            +T W ++EYR       +    + AG A             F LCRL+ R   ++  + 
Sbjct: 131 TKTAWKMNEYRAFHYPDASSASASSAGAAAPPNHLPPQLRSEFSLCRLYTRSGGIRQFDR 190

Query: 829 AEISNSDEVDPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQ 957
             ++   + +P    P++    A  E+++G    M+   +  Q
Sbjct: 191 RPLAGGGDENP---GPSMAAAAASPEENDGSGSSMQQLELMDQ 230



>pir|A86141|A86141 protein T25K16.1 [imported] - Arabidopsis
           thaliana>gb:AE005172_889153 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007323_1535783 Genomic sequence for
           Arabidopsis thaliana BAC T25K16 from chromosome I,
           complete sequence.
          Length = 466

 Score =  101 bits (252), Expect = 3e-20
 Identities = 56/134 (41%), Positives = 79/134 (58%), Gaps = 9/134 (6%)
 Frame = +1

Query: 355 VGYRFRPTDEELVDHYLKMKITGSEA-EVSV-IREVDICKHEPWDLPDMSFVESHDNEWF 528
           VG+ FRP DEELV HYL+ KI G+ + +V V I EV+IC ++PW+L   S  +S D  W+
Sbjct: 5   VGFGFRPNDEELVGHYLRNKIEGNTSRDVEVAISEVNICSYDPWNLRFQSKYKSRDAMWY 64

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG-------AKVGMKKTLVYYLGR 687
           FF    R+   G R +R T  G WK TG+   +  + G        K+G K+ LV+  GR
Sbjct: 65  FF--SRRENNKGNRQSRTTVSGKWKLTGESVEVKDQWGFCSEGFRGKIGHKRVLVFLDGR 122

Query: 688 APEGKRTHWVIHEY 729
            P+  ++ WVIHE+
Sbjct: 123 YPDKTKSDWVIHEF 136



>pir|S37100|S37100 ATAF2 protein - Arabidopsis thaliana
          Length = 220

 Score =  100 bits (250), Expect = 5e-20
 Identities = 62/169 (36%), Positives = 87/169 (51%), Gaps = 14/169 (8%)
 Frame = +1

Query: 514 DNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAP 693
           + EW+FF P+DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP
Sbjct: 6   EKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAP 63

Query: 694 EGKRTHWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK-----VELKLDEGAEI 837
           +G +T+W++HEYR        + NK +        +VLCR++ K          DE    
Sbjct: 64  KGIKTNWIMHEYRLANVDRSASVNKKNNLRLDD--WVLCRIYNKKGTMEKYFPADEKPRT 121

Query: 838 SNSDE--VDPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQS 978
           +   E    P  +S +   T  ED+ S  G      GH+ +  +   QS
Sbjct: 122 TTMAEQSSSPFDTSDSTYPTLQEDDSSSSG----GHGHVVSPDVLEVQS 166



>gb:ATAATAF2_1542718 A.thaliana ATAF2 mRNA.
          Length = 214

 Score =  100 bits (248), Expect = 8e-20
 Identities = 62/167 (37%), Positives = 86/167 (51%), Gaps = 14/167 (8%)
 Frame = +1

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           EW+FF P+DRKY NG R NRA   GYWKATG D+ I   K   +G+KK LV+Y G+AP+G
Sbjct: 2   EWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGKPK--TLGIKKALVFYAGKAPKG 59

Query: 700 KRTHWVIHEYR-------TTENKFDGTHAGQAPFVLCRLFRK-----VELKLDEGAEISN 843
            +T+W++HEYR        + NK +        +VLCR++ K          DE    + 
Sbjct: 60  IKTNWIMHEYRLANVDRSASVNKKNNLRLDD--WVLCRIYNKKGTMEKYFPADEKPRTTT 117

Query: 844 SDE--VDPIVSSPTVVKTPAEDEQSEGGTPLMKSGHIKTQPLTPGQS 978
             E    P  +S +   T  ED+ S  G      GH+ +  +   QS
Sbjct: 118 MAEQSSSPFDTSDSTYPTLQEDDSSSSG----GHGHVVSPDVLEVQS 160



>gb:U89959_1726485 Arabidopsis thaliana BAC T7I23, complete
           sequence.
          Length = 313

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVS----VIREVDICKHEPWDLPDMSFVESHDN 519
           PVG RF PTDEE+V  YL  K   S+ + S     I  V +C+ +PW+LP  S ++  D 
Sbjct: 4   PVGLRFCPTDEEIVVDYLWPK--NSDRDTSHVDRFINTVPVCRLDPWELPCQSRIKLKDV 61

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
            W FF PK+ KY  G +  R T+ G+WK+TG+ + I  R   ++G KK L++Y  +    
Sbjct: 62  AWCFFRPKENKYGRGDQQMRKTKSGFWKSTGRPKPI-MRNRQQIGEKKILMFYTSKE--- 117

Query: 700 KRTHWVIHEY 729
            ++ WVIHEY
Sbjct: 118 SKSDWVIHEY 127



>gb:BT020269_1642664 Arabidopsis thaliana At1g02220 mRNA, complete
           cds.
          Length = 394

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = +1

Query: 352 PVGYRFRPTDEELVDHYLKMKITGSEAEVS----VIREVDICKHEPWDLPDMSFVESHDN 519
           PVG RF PTDEE+V  YL  K   S+ + S     I  V +C+ +PW+LP  S ++  D 
Sbjct: 4   PVGLRFCPTDEEIVVDYLWPK--NSDRDTSHVDRFINTVPVCRLDPWELPCQSRIKLKDV 61

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
            W FF PK+ KY  G +  R T+ G+WK+TG+ + I  R   ++G KK L++Y  +    
Sbjct: 62  AWCFFRPKENKYGRGDQQMRKTKSGFWKSTGRPKPI-MRNRQQIGEKKILMFYTSKE--- 117

Query: 700 KRTHWVIHEY 729
            ++ WVIHEY
Sbjct: 118 SKSDWVIHEY 127



>gb:ATATAF1_1544091 A.thaliana ATAF1 mRNA.
          Length = 229

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 46/99 (46%), Positives = 64/99 (64%), Gaps = 4/99 (4%)
 Frame = +1

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           EW+FF P+DRKY NG R NR+   GYWKATG D+ I   K   VG+KK LV+Y G+AP+G
Sbjct: 2   EWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPK--PVGIKKALVFYAGKAPKG 59

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQA----PFVLCRLFRK 804
           ++T+W++HEYR  +          +     +VLCR++ K
Sbjct: 60  EKTNWIMHEYRLADVDRSVRKKKNSLRLDDWVLCRIYNK 98



>pir|S37101|S37101 ATAF1 protein - Arabidopsis thaliana (fragment)
          Length = 229

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 46/99 (46%), Positives = 64/99 (64%), Gaps = 4/99 (4%)
 Frame = +1

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEG 699
           EW+FF P+DRKY NG R NR+   GYWKATG D+ I   K   VG+KK LV+Y G+AP+G
Sbjct: 2   EWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGLPK--PVGIKKALVFYAGKAPKG 59

Query: 700 KRTHWVIHEYRTTENKFDGTHAGQA----PFVLCRLFRK 804
           ++T+W++HEYR  +          +     +VLCR++ K
Sbjct: 60  EKTNWIMHEYRLADVDRSVRKKKNSLRLDDWVLCRIYNK 98



>gb:AP004223_1838917 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1033B05.>gb:AP004332_1840328 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0093F16.
          Length = 228

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 58/159 (36%), Positives = 84/159 (52%), Gaps = 3/159 (1%)
 Frame = +1

Query: 337 PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHD 516
           P   LP+G+RFRPTDEEL+ HYL+ K+        VI   D+ +  PWDLP     E   
Sbjct: 17  PQAGLPIGFRFRPTDEELLLHYLRRKVMSRPLPADVIPVADLARLHPWDLPG----EGDG 72

Query: 517 NEWFFFCPKDRKYQNGQRLNRA-TERGYWKATGKDRTISSRKGAK--VGMKKTLVYYLGR 687
             +FF  P    ++ G   +RA    G W+A+GK++ + + +  K  VG K+TLV++   
Sbjct: 73  ERYFFHLPATSCWRRGGGGSRAGGGGGAWRASGKEKLVVAPRCGKRPVGAKRTLVFF--- 129

Query: 688 APEGKRTHWVIHEYRTTENKFDGTHAGQAPFVLCRLFRK 804
              G RT W +HEYR          A    +V+CR+F+K
Sbjct: 130 RRGGARTDWAMHEYRLLPADDHPPEANDV-WVVCRVFKK 167



>gb:AK118783_1816745 Arabidopsis thaliana At5g64530 mRNA for unknown
           protein, complete cds, clone: RAFL21-11-N14.
          Length = 187

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 60/187 (32%), Positives = 97/187 (51%), Gaps = 17/187 (9%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV H+L  K +       VI ++D+  ++PWDLP  +  E    +W
Sbjct: 2   NLPPGFRFFPTDEELVVHFLHRKASLLPCHPDVIPDLDLYHYDPWDLPGKALGEG--RQW 59

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGK 702
           +F+  K ++        R T  GYW + G D  I +S    KVG+KK L +YLG      
Sbjct: 60  YFYSRKTQE--------RVTSNGYWGSMGMDEPIYTSSTHKKVGIKKYLTFYLG----DS 107

Query: 703 RTHWVIHEYRTTENKFDGTHAGQ--------------APFVLCRLFRK--VELKLDEGAE 834
           +T+W++ EY   ++    + + +              + +V+CR++ +   E + D+G E
Sbjct: 108 QTNWIMQEYSLPDSSSSSSRSSKRSSRASSSSHKPDYSKWVICRVYEQNCSEEEDDDGTE 167

Query: 835 ISNSDEV 855
           +S  DEV
Sbjct: 168 LSCLDEV 174



>gb:AB010076_1510995 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUB3.
          Length = 192

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 60/187 (32%), Positives = 97/187 (51%), Gaps = 17/187 (9%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+RF PTDEELV H+L  K +       VI ++D+  ++PWDLP  +  E    +W
Sbjct: 2   NLPPGFRFFPTDEELVVHFLHRKASLLPCHPDVIPDLDLYHYDPWDLPGKALGEG--RQW 59

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI-SSRKGAKVGMKKTLVYYLGRAPEGK 702
           +F+  K ++        R T  GYW + G D  I +S    KVG+KK L +YLG      
Sbjct: 60  YFYSRKTQE--------RVTSNGYWGSMGMDEPIYTSSTHKKVGIKKYLTFYLG----DS 107

Query: 703 RTHWVIHEYRTTENKFDGTHAGQ--------------APFVLCRLFRK--VELKLDEGAE 834
           +T+W++ EY   ++    + + +              + +V+CR++ +   E + D+G E
Sbjct: 108 QTNWIMQEYSLPDSSSSSSRSSKRSSRASSSSHKPDYSKWVICRVYEQNCSEEEDDDGTE 167

Query: 835 ISNSDEV 855
           +S  DEV
Sbjct: 168 LSCLDEV 174



>pir|T04624|T04624 hypothetical protein F20O9.220 - Arabidopsis
           thaliana>gb:ATCHRIV69_1546733 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 69.>gb:ATF20O9_1549552
           Arabidopsis thaliana DNA chromosome 4, BAC clone F20O9
           (ESSA project).
          Length = 315

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 50/109 (45%), Positives = 63/109 (57%), Gaps = 16/109 (14%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSV----------------IREVDICKHEPW 480
           LP G+RF P+DEELV HYL  KI        V                + E+D+   EPW
Sbjct: 10  LPPGFRFHPSDEELVCHYLCNKIRAKSDHGDVDDDDDDVDEALKGSTDLVEIDLHICEPW 69

Query: 481 DLPDMSFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI 627
           +LPD++ + +   EW+FF  +DRKY  G R NRAT  GYWKATGKDRT+
Sbjct: 70  ELPDVAKLNA--KEWYFFSFRDRKYATGYRTNRATVSGYWKATGKDRTV 116



>gb:AP004876_1846420 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0470G10.
          Length = 204

 Score = 90.1 bits (222), Expect = 8e-17
 Identities = 60/196 (30%), Positives = 93/196 (47%), Gaps = 26/196 (13%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+ F P+DEELV H+L+ K++       +I  +   ++ PW+L   +      N+W
Sbjct: 6   NLPPGFHFFPSDEELVVHFLRRKVSLLPCHPDIIPTLLPHRYNPWELNGKALQAG--NQW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FFC   +        +R +  G+W   G D T+ S  G  VG+KKTL++ +G   EG R
Sbjct: 64  YFFCHLTQ--------SRTSSNGHWSPIGVDETVRSG-GRNVGLKKTLLFSIGEPSEGIR 114

Query: 706 THWVIHEY---------------------RTTENKFDGTHAGQAPFVLCRLFR-----KV 807
           T+W++HEY                     R +  K   +      +VLCR+F      +V
Sbjct: 115 TNWIMHEYHLLDGDCVAGGSSNLTSSSSNRRSHRKRGHSSMESNNWVLCRVFESSCGSQV 174

Query: 808 ELKLDEGAEISNSDEV 855
                EG E+S  DEV
Sbjct: 175 SFH-GEGTELSCLDEV 189



>gb:AP003262_1826616 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0482D04.
          Length = 259

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 60/186 (32%), Positives = 87/186 (46%), Gaps = 30/186 (16%)
 Frame = +1

Query: 337 PLHSLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPD-------- 492
           P   LP+G+RFRPTDEEL+ HYL+ K+        VI   D+ +  PWDLP         
Sbjct: 17  PQAGLPIGFRFRPTDEELLLHYLRRKVMSRPLPADVIPVADLARLHPWDLPGTRAATIMA 76

Query: 493 --MSFV-----------------ESHDNEWFFFCPKDRKYQNGQRLNRA-TERGYWKATG 612
              SF+                 E     +FF  P    ++ G   +RA    G W+A+G
Sbjct: 77  LASSFLGGFGIALTSIGGGLFTGEGDGERYFFHLPATSCWRRGGGGSRAGGGGGAWRASG 136

Query: 613 KDRTISSRKGAK--VGMKKTLVYYLGRAPEGKRTHWVIHEYRTTENKFDGTHAGQAPFVL 786
           K++ + + +  K  VG K+TLV++      G RT W +HEYR          A    +V+
Sbjct: 137 KEKLVVAPRCGKRPVGAKRTLVFF---RRGGARTDWAMHEYRLLPADDHPPEANDV-WVV 192

Query: 787 CRLFRK 804
           CR+F+K
Sbjct: 193 CRVFKK 198



>gb:AC137507_1743429 Oryza sativa chromosome 3 BAC OSJNBb0033J23
           genomic sequence, complete sequence.
          Length = 496

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 52/146 (35%), Positives = 75/146 (51%), Gaps = 7/146 (4%)
 Frame = +1

Query: 316 ERPTGLPPLHSLPVGYRFRPTDEELVDHYLKMKITGSEA---EVSVIREVDICKHEPWDL 486
           +RP    P   +P G RF PTD+EL+ H+LK K    +A    + VI+++D+CK    +L
Sbjct: 266 DRPVS--PYSDIP-GVRFTPTDQELIIHFLKPKYNLRDAMPTNIIVIKQLDVCKLNLDEL 322

Query: 487 P-DMSFVESHDNEWFFFCPKDRKYQNGQRLNRA---TERGYWKATGKDRTISSRKGAKVG 654
             D+   +S D  W+ F P+ R  + G R  R    T  GYWK+   +  +    G  +G
Sbjct: 323 HGDLGLGKSLDGAWYVFSPRSRYKERGVRPARGIKTTAVGYWKSNSAEADVVDDDGEVIG 382

Query: 655 MKKTLVYYLGRAPEGKRTHWVIHEYR 732
              +L   LG  P GK THW + EYR
Sbjct: 383 RVNSLTLALGHQPRGKATHWRMKEYR 408



>gb:A82377_1450950 Sequence 2 from Patent WO9856811.
          Length = 154

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 49/131 (37%), Positives = 52/131 (39%), Gaps = 3/131 (2%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           LP G+RF PTDEE    YL             I         PW LP          EWF
Sbjct: 1   LPXGFRFHPTDEEXXXXYLXXXXXXXXXXXXXIXXXXXXXXXPWXLPXXXXXXXX--EWF 58

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKD---RTISSRKGAKVGMKKTLVYYLGRAPEG 699
           FF     KY  G R NR    GYWKATG D              G KK LV+Y G    G
Sbjct: 59  FFXXXXXKYPXGXRXNRXXXXGYWKATGXDXXXXXXXXXXXXXXGXKKXLVFYXGXXXXG 118

Query: 700 KRTHWVIHEYR 732
               W +HEYR
Sbjct: 119 XXXXWXMHEYR 129



>gb:ATAC022287_1543758 Arabidopsis thaliana chromosome III BAC T27C4
           genomic sequence, complete sequence.
          Length = 198

 Score = 87.0 bits (214), Expect = 7e-16
 Identities = 52/147 (35%), Positives = 79/147 (53%), Gaps = 20/147 (13%)
 Frame = +1

Query: 367 FRPTDEELVDHYLKMKITGSEAEVSV-IREVDICKHEPWDLPDMSFVESHDNEWFFFCPK 543
           F P +EEL+++YL  KIT ++  V   I EV+I  HEP DLP ++ +ES  + W+F  P 
Sbjct: 6   FNPPEEELINYYLNNKITENDDLVGKQIAEVNILHHEPADLPGLAKIES-SHTWYFISPV 64

Query: 544 DRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGR----------AP 693
           + K+    R  R +  G+WK TG  RTI    G  +G+KK LV+   +            
Sbjct: 65  E-KFGKLNRTKRVSRSGHWKITGNSRTIKDVDGNPIGLKKFLVFQENKRSSSSSLSTTTT 123

Query: 694 EGKRTHWVIHEYRT---------TENK 747
           + ++T+W+IHE+ +         TENK
Sbjct: 124 QQQKTNWIIHEFHSFLPHPNKMLTENK 150



>gb:AP004666_1842943 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0431A03.
          Length = 136

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 39/72 (54%), Positives = 51/72 (70%), Gaps = 2/72 (2%)
 Frame = +1

Query: 520 EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRTI--SSRKGAKVGMKKTLVYYLGRAP 693
           E +FFC +  KY +G R+ RAT  GYWK+TGKD+ +  +   G  VG KKTLV+Y GRAP
Sbjct: 40  ECYFFCRRSSKYPSGARVRRATAGGYWKSTGKDKGVYAAGGGGGLVGTKKTLVFYEGRAP 99

Query: 694 EGKRTHWVIHEY 729
            G++T WV+HEY
Sbjct: 100 RGEKTSWVMHEY 111



>gb:A82376_1450949 Sequence 1 from Patent WO9856811.
          Length = 153

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 47/128 (36%), Positives = 52/128 (40%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           +P G+RF PTDEE    YL             I         PW LP          EW+
Sbjct: 1   MPXGFRFHPTDEEXXXXYLXXXXXXXXXXXXXIXXXXXXXXXPWXLPXXXXXXXX--EWY 58

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           FF     KY  G R NR    GYWKATG D           G KK LV+Y G    G   
Sbjct: 59  FFXXXXXKYPXGXRXNRXXXXGYWKATGXD-XXXXXXXXXXGXKKXLVFYXGXXXXGXXX 117

Query: 709 HWVIHEYR 732
            W +HEYR
Sbjct: 118 XWXMHEYR 125



>gb:OSJN00024_1693487 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0006B20, complete sequence.
          Length = 200

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 53/194 (27%), Positives = 92/194 (47%), Gaps = 24/194 (12%)
 Frame = +1

Query: 346 SLPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEW 525
           +LP G+ F P+DEEL+ H+L+ K +    +  ++  + +  ++PW+L   +      N+W
Sbjct: 6   NLPPGFHFFPSDEELIIHFLRRKASLLPCQPDIVPTLILNLYDPWELNGKAL--QSGNQW 63

Query: 526 FFFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKR 705
           +FF    +         R +  G+WK    +  IS   G  VG+KKTL++++G   E  +
Sbjct: 64  YFFSHATQ--------TRTSPNGHWKPIADETVISG--GCNVGLKKTLIFFIGEPFEAIK 113

Query: 706 THWVIHEY-------------------RTTENKFDGTHAGQAPFVLCRLFR-----KVEL 813
           T+WV+HEY                   + +  K   +      +V+CR+F      +V  
Sbjct: 114 TNWVMHEYHLMDGSTNCSSSSTSSSSSKRSHKKKGHSDTESKNWVICRVFESSYDSQVSF 173

Query: 814 KLDEGAEISNSDEV 855
             +EG E+S  DEV
Sbjct: 174 H-EEGTELSCLDEV 186



>gb:AP004039_1836709 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1006_D05.
          Length = 252

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/136 (35%), Positives = 71/136 (52%), Gaps = 8/136 (5%)
 Frame = +1

Query: 349 LPVGYRFRPTDEELVDHYLKMKITGSEAEVSVIREVDICKHEPWDLPDMSFVESHDNEWF 528
           +P G+RF+PTDE+LV  YL+ +          I ++D+   +PW LP M+   S D++ +
Sbjct: 12  MPPGFRFQPTDEQLVVDYLQRRTAAQPCVTPDITDIDVYNVDPWQLPAMAMYGS-DHDRY 70

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKG---AKVGMKKTLVYYLG-RAPE 696
           FF    R+ Q      R T  G+WK TG  +TI    G       +K+  V+YLG   P 
Sbjct: 71  FFTMAAREAQ----ARRTTPSGFWKPTGTKKTIFVVAGGHEVPTAVKRRFVFYLGHHQPS 126

Query: 697 G----KRTHWVIHEYR 732
           G     +T W++HEYR
Sbjct: 127 GSNNNNKTSWIMHEYR 142



>gb:AB039926_1519380 Arabidopsis thaliana RD26 mRNA for NAM-like
           protein, complete cds.
          Length = 228

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 45/135 (33%), Positives = 71/135 (52%), Gaps = 15/135 (11%)
 Frame = +1

Query: 529 FFCPKDRKYQNGQRLNRATERGYWKATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRT 708
           F  PK  +     R NR    GYWKA G D+ I++  G +VG+KK LV+Y G+AP+G +T
Sbjct: 3   FLKPKRSEISERSRPNRVAGSGYWKARGTDKIITA-DGRRVGIKKALVFYAGKAPKGTKT 61

Query: 709 HWVIHEYRTTENKFDGTHAGQAPFVLCRLFRKV---------------ELKLDEGAEISN 843
           +W++HEYR  E+      +    +VLCR+++K                E     G+  S+
Sbjct: 62  NWIMHEYRLIEHSRSHGSSKLDDWVLCRIYKKTSGSQRQAVTPVQACREEHSTNGSSSSS 121

Query: 844 SDEVDPIVSSPTVVK 888
           S ++D ++ S   +K
Sbjct: 122 SSQLDDVLDSFPEIK 136


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,228,650,017
Number of Sequences: 1806583
Number of extensions: 26779149
Number of successful extensions: 73358
Number of sequences better than 10.0: 336
Number of HSP's better than 10.0 without gapping: 68274
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 72732
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 102572242794
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)