BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6704
         (704 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003241_1826069 Oryza sativa (japonica cultivar-group) genom...   186   5e-46   
gb:AY846819_1630720 Triticum aestivum ribosomal protein L36 mRNA...   186   5e-46   
gb:AC117265_1739397 Oryza sativa (japonica cultivar-group) chrom...   182   7e-45   
gb:AY796052_1628495 Saccharum officinarum putative 60S ribosomal...   175   8e-43   
sp|Q9M352|R36B_ARATH|R36B_ARATH 60S ribosomal protein L36-2.>pir|T45914|T45...   172   7e-42   Arabidopsis thaliana [mouse-ear cress]
sp|O80929|R36A_ARATH|R36A_ARATH 60S ribosomal protein L36-1.>pir|T02526|T02...   169   6e-41   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LZ57|R36C_ARATH|R36C_ARATH 60S ribosomal protein L36-3.>pir|T48266|T48...   164   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AY086677_1571721 Arabidopsis thaliana clone 267357 mRNA, comp...   147   2e-34   
gb:DCU47095_1675762 Daucus carota putative ribosomal protein mRN...   145   9e-34   
pir|T14304|T14304 ribosomal protein - carrot (fragment)               145   9e-34   Daucus carota [carrots]
sp|P52866|RL36_DAUCA|RL36_DAUCA 60S ribosomal protein L36.                       143   3e-33   Daucus carota [carrots]
sp|Q9LRB8|RL36_ENTCP|RL36_ENTCP 60S ribosomal protein L36.>pir|JC7579|JC757...   134   2e-30   Ulva compressa
gb:AF548326_1281129 Branchiostoma belcheri ribosomal protein L36...   116   3e-25   
pir|T08720|T08720 ribosomal protein L36 - human>gb:AK003115_1151...   115   1e-24   Homo sapiens [man]
sp|Q9Y3U8|RL36_HUMAN|RL36_HUMAN 60S ribosomal protein L36.                       115   1e-24   Homo sapiens [man]
sp|Q92365|R36A_SCHPO|R36A_SCHPO 60S ribosomal protein L36-A.>pir|T41675|T43...   115   1e-24   Schizosaccharomyces pombe
gb:BC077033_2559770 Xenopus tropicalis MGC89873 protein, mRNA (c...   113   3e-24   
gb:BC086914_2109842 Mus musculus cDNA clone MGC:107625 IMAGE:676...   113   3e-24   
gb:AF159903_2477754 Lapemis hardwickii 60S ribosomal protein L36...   113   4e-24   
gb:AF077043_1149727 Homo sapiens 60S ribosomal protein L36 mRNA,...   113   4e-24   
pir|JN0483|JN0483 ribosomal protein L36, cytosolic [validated] -...   112   5e-24   Rattus norvegicus [brown rat]
sp|P39032|RL36_RAT|RL36_RAT 60S ribosomal protein L36.                         112   5e-24   Rattus norvegicus [brown rat]
gb:AY561518_2537708 Danio rerio ribosomal protein L36 (rpl36) mR...   111   1e-23   
gb:D88771_1675159 Fission yeast mRNA for ribosomal protein L39, ...   111   1e-23   
sp|O94658|R36B_SCHPO|R36B_SCHPO 60S ribosomal protein L36-B.>pir|T40428|T40...   111   1e-23   Schizosaccharomyces pombe
gb:AB046396_2462150 Gallus gallus RPL36 mRNA for ribosomal prote...   110   2e-23   
gb:CR382136_1668890 Debaryomyces hansenii chromosome D of strain...   110   2e-23   
gb:AF401591_2492018 Ictalurus punctatus ribosomal protein L36 mR...   109   4e-23   
pir|S41338|S41338 ribosomal protein L36, cytosolic - mouse>gb:MM...   106   3e-22   Mus musculus [mouse]
sp|P47964|RL36_MOUSE|RL36_MOUSE 60S ribosomal protein L36.                       106   3e-22   Mus musculus [mouse]
pir|T28834|T28834 hypothetical protein F37C12.4 - Caenorhabditis...   105   8e-22   Caenorhabditis elegans [roundworm]
sp|P49181|RL36_CAEEL|RL36_CAEEL 60S ribosomal protein L36.>gb:U00033_140138...   105   8e-22   Caenorhabditis elegans [roundworm]
sp|P47834|RL36_CANAL|RL36_CANAL 60S ribosomal protein L36 (L39).>gb:CAU3701...   105   1e-21   Candida albicans
gb:AF542001_1809977 Griffithsia japonica putative 60S ribosomal ...   103   2e-21   
sp|Q9HFR7|RL36_TRIHM|RL36_TRIHM 60S ribosomal protein L36 (TRP36).>gb:AF308...   102   5e-21   Trichoderma hamatum
gb:AY769306_1350457 Bombyx mori ribosomal protein L36 (RpL36) mR...   100   2e-20   
gb:AB180419_1202437 Plutella xylostella mRNA for Ribosomal prote...   100   2e-20   
gb:AF400198_1268297 Spodoptera frugiperda ribosomal protein L36A...   100   3e-20   
gb:AE016819_1748675 Ashbya gossypii (= Eremothecium gossypii) AT...    99   1e-19   
gb:AY752831_1179974 Culicoides sonorensis clone CsRPL36 ribosoma...    99   1e-19   
gb:AE017347_1757712 Cryptococcus neoformans var. neoformans JEC2...    98   2e-19   
gb:AY231780_1177073 Drosophila yakuba clone yak-em_RpL36 mRNA se...    97   2e-19   
gb:AF401680_1796150 Orobanche cumana putative 60S ribosomal prot...    97   4e-19   
sp|P49630|RL36_DROME|RL36_DROME 60S ribosomal protein L36 (Minute(1)1B prot...    96   6e-19   Drosophila melanogaster
pir|S72661|S72661 ribosomal protein L36.e.B, cytosolic - yeast (...    93   5e-18   Saccharomyces cerevisiae [brewer's yeast]
sp|O14455|R36B_YEAST|R36B_YEAST 60S ribosomal protein L36-B (L39B) (YL39).        93   5e-18   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382124_1656884 Kluyveromyces lactis strain NRRL Y-1140 chro...    92   7e-18   
pir|S11263|S50922 ribosomal protein L36.e.A, cytosolic - yeast (...    92   7e-18   
sp|P05745|R36A_YEAST|R36A_YEAST 60S ribosomal protein L36-A (L39A) (YL39).        92   7e-18   Saccharomyces cerevisiae [brewer's yeast]
gb:AE014186_938071 Plasmodium falciparum 3D7 chromosome 11 compl...    92   1e-17   
gb:AC117072_1207641 Dictyostelium discoideum chromosome 2 map 38...    90   3e-17   
gb:LMFL1375_1387746 Leishmania major Friedlin chromosome 21 cosm...    89   1e-16   
gb:AB083110_1524156 Allium cepa L36 mRNA for 60S ribosomal prote...    79   8e-14   
gb:AF486843_1276111 Aplysia californica ribosomal protein L36 mR...    55   9e-07   
gb:AB002792_1192808 Entamoeba histolytica mRNA for ribosomal pro...    53   5e-06   
gb:AX972459_1487768 Sequence 3262 from Patent EP1104808.               50   3e-05   
gb:AB002781_1192802 Entamoeba histolytica mRNA for ribosomal pro...    50   5e-05   
gb:AB046410_1867336 Homo sapiens RPL36 gene for ribosomal protei...    49   7e-05   
pir|G90111|G90111 60S ribosomal protein L36 [imported] - Guillar...    48   1e-04   Guillardia theta
gb:CNS07EGD_1373527 chromosome VI of strain GB-M1 of Encephalito...    44   0.002   
gb:CR382139_1671957 Debaryomyces hansenii chromosome G of strain...    35   1.3     
pir|T16554|T16554 hypothetical protein K04C2.2 - Caenorhabditis ...    35   1.3     Caenorhabditis elegans [roundworm]
gb:AF210726_2215814 Macaca mulatta rhadinovirus 26-95 long uniqu...    34   2.9     
gb:BX908808_1644523 Neurospora crassa DNA linkage group IV Cosmi...    33   3.8     
pir|S18732|S18732 autoantigen, 64K - human                             33   3.8     Homo sapiens [man]
sp|P29536|LMD1_HUMAN|LMD1_HUMAN Leiomodin 1 (Leiomodin, muscle form) (64 kD...    33   3.8     Homo sapiens [man]
gb:BA000016_673234 Clostridium perfringens str. 13 DNA, complete...    33   4.9     
gb:AE017148_391187 Helicobacter hepaticus ATCC 51449 section 5 o...    33   4.9     
gb:BC080187_1989716 Homo sapiens leiomodin 1 (smooth muscle), mR...    33   6.4     
gb:BC001755_1967831 Homo sapiens leiomodin 1 (smooth muscle), mR...    33   6.4     
gb:AL513217_1928762 Human DNA sequence from clone RP11-307B6 on ...    33   6.4     
gb:CR382139_1673149 Debaryomyces hansenii chromosome G of strain...    33   6.4     


>gb:AP003241_1826069 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0408C03.
          Length = 110

 Score =  186 bits (471), Expect = 5e-46
 Identities = 90/110 (81%), Positives = 101/110 (91%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK++KR+NFV+ LIREV GFAPYEKRI
Sbjct: 1   MAPPQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVNFVRGLIREVVGFAPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK 407
           TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GV+RKMR+ G  DKKK
Sbjct: 61  TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVIRKMRSAGTTDKKK 110



>gb:AY846819_1630720 Triticum aestivum ribosomal protein L36 mRNA,
           complete cds.
          Length = 112

 Score =  186 bits (471), Expect = 5e-46
 Identities = 93/112 (83%), Positives = 103/112 (91%), Gaps = 2/112 (1%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK +KR++FV++LIREVAGFAPYEKRI
Sbjct: 1   MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKGTKRVHFVRNLIREVAGFAPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG--GDKKK 407
           TELLKVGKDKRALKVAKRKLGTHKRAK+KREEMS VLRKMR+ GG  GDKKK
Sbjct: 61  TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMSSVLRKMRSAGGGAGDKKK 112



>gb:AC117265_1739397 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1281_H05, complete sequence.
          Length = 113

 Score =  182 bits (461), Expect = 7e-45
 Identities = 91/113 (80%), Positives = 103/113 (91%), Gaps = 3/113 (2%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           MAP Q  SGLFVG+N+GHVVTK+EL PRPSDRKGK++KR+ FV++LIREVAGFAPYEKRI
Sbjct: 1   MAPSQPKSGLFVGINKGHVVTKRELPPRPSDRKGKSTKRVTFVRNLIREVAGFAPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG---GDKKK 407
           TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GVLRKMR+ GG    +KKK
Sbjct: 61  TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMRSGGGHAHTEKKK 113



>gb:AY796052_1628495 Saccharum officinarum putative 60S ribosomal
           protein L36 mRNA, complete cds.
          Length = 111

 Score =  175 bits (443), Expect = 8e-43
 Identities = 88/111 (79%), Positives = 99/111 (89%), Gaps = 1/111 (0%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           MAP Q  SGLFVG+N+GHVVTK+EL PRPS RKGK +KR++ V+ LIREVAGFAPYEKRI
Sbjct: 1   MAPPQPKSGLFVGINKGHVVTKRELPPRPSHRKGKATKRVSMVRGLIREVAGFAPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG-GGDKKK 407
           TELLKVGKDKRALKVAKRKLGTHKRAK+KREEM+GVL+KMR+ G   DKKK
Sbjct: 61  TELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLKKMRSAGTHTDKKK 111



>sp|Q9M352|R36B_ARATH 60S ribosomal protein L36-2.>pir|T45914|T45914
           60S RIBOSOMAL PROTEIN L36 homolog - Arabidopsis
           thaliana>gb:ATF5K20_1550778 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F5K20.>gb:AY062791_1565447
           Arabidopsis thaliana 60S RIBOSOMAL PROTEIN L36 homolog
           (F5K20.4) mRNA, complete cds.>gb:AY081579_1568839
           Arabidopsis thaliana 60S ribosomal protein L36-like
           protein (F5K20.4) mRNA, complete cds.
          Length = 112

 Score =  172 bits (435), Expect = 7e-42
 Identities = 88/112 (78%), Positives = 98/112 (87%), Gaps = 2/112 (1%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F+++LI+EVAG APYEKRI
Sbjct: 1   MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGQAPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG--DKKK 407
           TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG  +KKK
Sbjct: 61  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGATEKKK 112



>sp|O80929|R36A_ARATH 60S ribosomal protein L36-1.>pir|T02526|T02526
           60S ribosomal protein L36 [imported] - Arabidopsis
           thaliana>gb:AC004684_1532071 Arabidopsis thaliana
           chromosome 2 clone F13M22 map ve018, complete
           sequence.>gb:AY052221_1562594 Arabidopsis thaliana
           At2g37600/F13M22.10 mRNA, complete
           cds.>gb:AY060496_1564805 Arabidopsis thaliana
           At2g37600/F13M22.10 mRNA, complete
           cds.>gb:AY086261_1571314 Arabidopsis thaliana clone
           23114 mRNA, complete sequence.
          Length = 113

 Score =  169 bits (427), Expect = 6e-41
 Identities = 84/105 (80%), Positives = 92/105 (87%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           M      +GLFVGLN+GHVVT++ELAPRP+ RKGKTSKR  F++ LIREVAG APYEKRI
Sbjct: 1   MTTPAVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTIFIRKLIREVAGMAPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGG 392
           TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ GG
Sbjct: 61  TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSLGG 105



>sp|Q9LZ57|R36C_ARATH 60S ribosomal protein L36-3.>pir|T48266|T48266
           60S ribosomal protein-like - Arabidopsis
           thaliana>gb:ATT22P11_1555318 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T22P11 (ESSA
           project).>gb:AY057706_1564118 Arabidopsis thaliana
           AT5g02450/T22P11_40 mRNA, complete
           cds.>gb:AY087041_1572077 Arabidopsis thaliana clone
           30903 mRNA, complete sequence.>gb:AY133624_1581447
           Arabidopsis thaliana AT5g02450/T22P11_40 mRNA, complete
           cds.>gb:AF324687_1786399 Arabidopsis thaliana AT5g02450
           (AT5g02450/T22P11_40) mRNA, complete
           cds.>gb:AF326882_1786742 Arabidopsis thaliana putative
           60S ribosomal protein (At5g02450) mRNA, complete
           cds.>gb:AF339702_1787746 Arabidopsis thaliana putative
           60S ribosomal protein (At5g02450) mRNA, complete cds.
          Length = 108

 Score =  164 bits (416), Expect = 1e-39
 Identities = 82/103 (79%), Positives = 93/103 (90%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           +GLFVGLN+GHVVTK+E  PRP++RKGKTSKR  F+++LI+EVAG APYEKRITELLKVG
Sbjct: 4   TGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVG 63

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK 407
           KDKRALKVAKRKLGTHKRAKRKREEMS VLRKMR+ G G  +K
Sbjct: 64  KDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGAGASEK 106



>gb:AY086677_1571721 Arabidopsis thaliana clone 267357 mRNA,
           complete sequence.
          Length = 103

 Score =  147 bits (371), Expect = 2e-34
 Identities = 79/112 (70%), Positives = 89/112 (79%), Gaps = 2/112 (1%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           M   Q  +GLFVGLN+GHVVT++ELAPRP  RKGKTSKR  F+++LI+EVAG APYEKRI
Sbjct: 1   MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGQAPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGG--DKKK 407
           TEL         LKVAKRKLGTHKRAKRKREEMS VLRKMR+ GGG  +KKK
Sbjct: 61  TEL---------LKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGATEKKK 103



>gb:DCU47095_1675762 Daucus carota putative ribosomal protein mRNA,
           somatic embryo clone Gea42, partial cds.
          Length = 111

 Score =  145 bits (365), Expect = 9e-34
 Identities = 70/91 (76%), Positives = 81/91 (89%)
 Frame = +3

Query: 72  RGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEK 251
           R MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR +FV++LIREVAGF PYEK
Sbjct: 4   RNMAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRTHFVRNLIREVAGFXPYEK 63

Query: 252 RITELLKVGKDKRALKVAKRKLGTHKRAKRK 344
           RITELLKVGKDKRALKV + K+G  + +K +
Sbjct: 64  RITELLKVGKDKRALKVRQEKVGHSQESKEE 94



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = +2

Query: 278 KGQACFEGSQAKVGYSQEG*KEERGDVWCSPKDEGYW 388
           K +   +  Q KVG+SQE  +EERGDV CSP DEG+W
Sbjct: 73  KDKRALKVRQEKVGHSQESKEEERGDVQCSPPDEGWW 109



>pir|T14304|T14304 ribosomal protein - carrot (fragment)
          Length = 111

 Score =  145 bits (365), Expect = 9e-34
 Identities = 70/91 (76%), Positives = 81/91 (89%)
 Frame = +3

Query: 72  RGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEK 251
           R MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR +FV++LIREVAGF PYEK
Sbjct: 4   RNMAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRTHFVRNLIREVAGFXPYEK 63

Query: 252 RITELLKVGKDKRALKVAKRKLGTHKRAKRK 344
           RITELLKVGKDKRALKV + K+G  + +K +
Sbjct: 64  RITELLKVGKDKRALKVRQEKVGHSQESKEE 94



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = +2

Query: 278 KGQACFEGSQAKVGYSQEG*KEERGDVWCSPKDEGYW 388
           K +   +  Q KVG+SQE  +EERGDV CSP DEG+W
Sbjct: 73  KDKRALKVRQEKVGHSQESKEEERGDVQCSPPDEGWW 109



>sp|P52866|RL36_DAUCA 60S ribosomal protein L36.
          Length = 106

 Score =  143 bits (360), Expect = 3e-33
 Identities = 69/89 (77%), Positives = 80/89 (89%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           MAPKQ N+GLFVGLN+GH+VTKKELAPRPSDRKGKTSKR +FV++LIREVAGF PYEKRI
Sbjct: 1   MAPKQPNTGLFVGLNKGHIVTKKELAPRPSDRKGKTSKRTHFVRNLIREVAGFXPYEKRI 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRK 344
           TELLKVGKDKRALKV + K+G  + +K +
Sbjct: 61  TELLKVGKDKRALKVRQEKVGHSQESKEE 89



 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 21/37 (56%), Positives = 26/37 (70%)
 Frame = +2

Query: 278 KGQACFEGSQAKVGYSQEG*KEERGDVWCSPKDEGYW 388
           K +   +  Q KVG+SQE  +EERGDV CSP DEG+W
Sbjct: 68  KDKRALKVRQEKVGHSQESKEEERGDVQCSPPDEGWW 104



>sp|Q9LRB8|RL36_ENTCP 60S ribosomal protein L36.>pir|JC7579|JC7579
           ribosomal protein L36 - green alga (Enteromorpha
           prolifera)>gb:AB045113_1520331 Enteromorpha compressa
           EcRL36 mRNA for ribosomal protein L36, complete cds.
          Length = 101

 Score =  134 bits (337), Expect = 2e-30
 Identities = 65/96 (67%), Positives = 80/96 (83%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTKK   PRPS RKG  S+R+  V++++REVAG+APYE+R+ ELLKVGKDKR
Sbjct: 6   VGLNKGHQVTKKAGTPRPSRRKGFLSQRVKKVRAVVREVAGWAPYERRVMELLKVGKDKR 65

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGD 398
           ALK+ KRKLGTH R K+KREEM+GVLRKM+A   G+
Sbjct: 66  ALKMCKRKLGTHMRGKKKREEMAGVLRKMQAASKGE 101



>gb:AF548326_1281129 Branchiostoma belcheri ribosomal protein L36
           mRNA, complete cds.
          Length = 103

 Score =  116 bits (291), Expect = 3e-25
 Identities = 56/90 (62%), Positives = 68/90 (75%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH +TK    PRPS RKGK +K + FV+ L+REV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHKITKNVQKPRPSRRKGKLTKHVKFVRDLVREVTGFAPYERRTMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GT +RAKRKREEM  V+   R
Sbjct: 69  ALKFLKKRVGTLQRAKRKREEMQNVIAAQR 98



>pir|T08720|T08720 ribosomal protein L36 - human>gb:AK003115_1151654
           Mus musculus adult male heart cDNA, RIKEN full-length
           enriched library, clone:1010001F03 product:60S RIBOSOMAL
           PROTEIN L36 homolog [Mus musculus], full insert
           sequence.>gb:CR858862_1183006 Pongo pygmaeus mRNA; cDNA
           DKFZp469C084 (from clone
           DKFZp469C084).>gb:HSM800130_1185743 Homo sapiens mRNA;
           cDNA DKFZp566B023 (from clone
           DKFZp566B023).>gb:AX888076_1483529 Sequence 3939 from
           Patent EP1033401.>gb:AB061833_1868809 Homo sapiens RPL36
           gene for ribosomal protein L36, complete cds and
           sequence.>gb:BC003052_1968646 Homo sapiens ribosomal
           protein L36, transcript variant 2, mRNA (cDNA clone
           MGC:781 IMAGE:3546966), complete
           cds.>gb:BC004971_1969486 Homo sapiens ribosomal protein
           L36, transcript variant 1, mRNA (cDNA clone MGC:3585
           IMAGE:2957859), complete cds.>gb:CR533465_1993670 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834A0417D for gene RPL36, ribosomal protein L36;
           complete cds, incl. stopcodon.>gb:BC021595_2093550 Mus
           musculus ribosomal protein L36, mRNA (cDNA clone
           MGC:35943 IMAGE:5100307), complete
           cds.>gb:BC058475_2103257 Rattus norvegicus ribosomal
           protein L36, mRNA (cDNA clone MGC:72835 IMAGE:6888196),
           complete cds.
          Length = 105

 Score =  115 bits (287), Expect = 1e-24
 Identities = 57/90 (63%), Positives = 68/90 (75%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNVLAAMR 98



>sp|Q9Y3U8|RL36_HUMAN 60S ribosomal protein L36.
          Length = 104

 Score =  115 bits (287), Expect = 1e-24
 Identities = 57/90 (63%), Positives = 68/90 (75%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 8   VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR 67

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 68  ALKFIKKRVGTHIRAKRKREELSNVLAAMR 97



>sp|Q92365|R36A_SCHPO 60S ribosomal protein L36-A.>pir|T41675|T43238
           ribosomal protein L36 homolog SPCC970.05 - fission yeast
            (Schizosaccharomyces pombe)>gb:SPCC970_1721699 S.pombe
           chromosome III cosmid c970.
          Length = 99

 Score =  115 bits (287), Expect = 1e-24
 Identities = 55/93 (59%), Positives = 76/93 (81%)
 Frame = +3

Query: 102 GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK 281
           GL VGLN+G V+TK++L  RPS RKG+ SKR +FV+S++REVAGFAPYE+R+ EL++  +
Sbjct: 4   GLVVGLNKGKVLTKRQLPERPSRRKGQLSKRTSFVRSIVREVAGFAPYERRVMELIRNSQ 63

Query: 282 DKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           DKRA K+AK++LGT KRAK K EE++ V++  R
Sbjct: 64  DKRARKLAKKRLGTLKRAKGKIEELTSVIQSSR 96



>gb:BC077033_2559770 Xenopus tropicalis MGC89873 protein, mRNA (cDNA
           clone MGC:89873 IMAGE:7029247), complete
           cds.>gb:BC078556_2561094 Xenopus laevis MGC85430
           protein, mRNA (cDNA clone MGC:85430 IMAGE:6934613),
           complete cds.
          Length = 105

 Score =  113 bits (283), Expect = 3e-24
 Identities = 56/90 (62%), Positives = 67/90 (74%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR   R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHRVTKNVTKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 69  ALKFIKKRIGTHIRAKRKREELSNVLAAMR 98



>gb:BC086914_2109842 Mus musculus cDNA clone MGC:107625
           IMAGE:6768133, complete cds.
          Length = 105

 Score =  113 bits (283), Expect = 3e-24
 Identities = 56/90 (62%), Positives = 67/90 (74%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
            LK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 69  VLKFIKKRVGTHIRAKRKREELSNVLAAMR 98



>gb:AF159903_2477754 Lapemis hardwickii 60S ribosomal protein L36
           mRNA, complete cds.
          Length = 105

 Score =  113 bits (282), Expect = 4e-24
 Identities = 56/90 (62%), Positives = 67/90 (74%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR   R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHKVTKNVSKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNVLAAMR 98



>gb:AF077043_1149727 Homo sapiens 60S ribosomal protein L36 mRNA,
           complete cds.
          Length = 105

 Score =  113 bits (282), Expect = 4e-24
 Identities = 56/90 (62%), Positives = 67/90 (74%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S  +G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHKVTKNVSKPRHSRHRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNVLAAMR 98



>pir|JN0483|JN0483 ribosomal protein L36, cytosolic [validated] -
           rat>gb:RNRPL36_2136373 R.norvegicus mRNA for ribosomal
           protein L36.
          Length = 105

 Score =  112 bits (281), Expect = 5e-24
 Identities = 56/90 (62%), Positives = 67/90 (74%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV  FAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCAFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNVLAAMR 98



>sp|P39032|RL36_RAT 60S ribosomal protein L36.
          Length = 104

 Score =  112 bits (281), Expect = 5e-24
 Identities = 56/90 (62%), Positives = 67/90 (74%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S R+G+ +K   FV+ +IREV  FAPYE+R  ELLKV KDKR
Sbjct: 8   VGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCAFAPYERRAMELLKVSKDKR 67

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 68  ALKFIKKRVGTHIRAKRKREELSNVLAAMR 97



>gb:AY561518_2537708 Danio rerio ribosomal protein L36 (rpl36) mRNA,
           complete cds.>gb:BC071384_2556125 Danio rerio ribosomal
           protein L36, mRNA (cDNA clone MGC:86707 IMAGE:6896632),
           complete cds.
          Length = 105

 Score =  111 bits (278), Expect = 1e-23
 Identities = 55/90 (61%), Positives = 66/90 (73%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    P+ S R+G+ +K   F + LIREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGHKVTKNVSKPKHSRRRGRLTKHAKFARDLIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S  L  MR
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNTLAAMR 98



>gb:D88771_1675159 Fission yeast mRNA for ribosomal protein L39,
           partial cds.
          Length = 93

 Score =  111 bits (278), Expect = 1e-23
 Identities = 53/90 (58%), Positives = 74/90 (82%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+G V+TK++L  RPS RKG+ SKR +FV+S++REVAGFAPYE+R+ EL++  +DKR
Sbjct: 1   VGLNKGKVLTKRQLPERPSRRKGQLSKRTSFVRSIVREVAGFAPYERRVMELIRNSQDKR 60

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           A K+AK++LGT KRAK K EE++ V++  R
Sbjct: 61  ARKLAKKRLGTLKRAKGKIEELTSVIQSSR 90



>sp|O94658|R36B_SCHPO 60S ribosomal protein L36-B.>pir|T40428|T40428
           60s ribosomal protein l36 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC405_1720126 S.pombe
           chromosome II cosmid c405.
          Length = 99

 Score =  111 bits (278), Expect = 1e-23
 Identities = 54/93 (58%), Positives = 73/93 (78%)
 Frame = +3

Query: 102 GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK 281
           GL VGLN+G  +TK++L  RPS RKG  SKR  FV+S++REVAGFAPYE+R+ EL++  +
Sbjct: 4   GLVVGLNKGKTLTKRQLPERPSRRKGHLSKRTAFVRSIVREVAGFAPYERRVMELIRNSQ 63

Query: 282 DKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           DKRA K+AK++LGT KRAK K EE++ V++  R
Sbjct: 64  DKRARKLAKKRLGTLKRAKGKIEELTSVIQSSR 96



>gb:AB046396_2462150 Gallus gallus RPL36 mRNA for ribosomal protein
           L36, complete cds.
          Length = 105

 Score =  110 bits (276), Expect = 2e-23
 Identities = 55/90 (61%), Positives = 67/90 (74%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+G+ VTK    PR   R+G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLNKGYKVTKNVSKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S VL  MR
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNVLAAMR 98



>gb:CR382136_1668890 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 99

 Score =  110 bits (275), Expect = 2e-23
 Identities = 53/96 (55%), Positives = 74/96 (77%)
 Frame = +3

Query: 93  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK 272
           A SG+ VGLN+GH V  KE+AP+ S RKG  SKR  FV+++++EV+G APYE+R+ EL++
Sbjct: 2   ARSGIAVGLNKGHKVVAKEVAPKVSYRKGALSKRTEFVRNIVKEVSGLAPYERRLIELIR 61

Query: 273 VGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
              +KRA K+AK++LGTHKRA RK EEM+ V+ + R
Sbjct: 62  NAGEKRAKKLAKKRLGTHKRALRKIEEMNKVIAESR 97



>gb:AF401591_2492018 Ictalurus punctatus ribosomal protein L36 mRNA,
           complete cds.
          Length = 105

 Score =  109 bits (273), Expect = 4e-23
 Identities = 54/90 (60%), Positives = 66/90 (73%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGL +GH VTK    P+ S R G+ +K   FV+ +IREV GFAPYE+R  ELLKV KDKR
Sbjct: 9   VGLKKGHPVTKNVTKPKHSRRGGRLTKHSKFVRDMIREVCGFAPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ALK  K+++GTH RAKRKREE+S +L  MR
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNILAAMR 98



>pir|S41338|S41338 ribosomal protein L36, cytosolic -
           mouse>gb:MML36_2116234 M.musculus mRNA for ribosomal
           protein L36.
          Length = 105

 Score =  106 bits (265), Expect = 3e-22
 Identities = 53/89 (59%), Positives = 64/89 (71%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S R+ + +    FV+ +IREV GFAPYE+R  ELLKV K KR
Sbjct: 9   VGLNKGHKVTKNVSKPRHSRRRSRLTNHTKFVRDMIREVCGFAPYERRAMELLKVSKSKR 68

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKM 377
           ALK  K+++GTH RAKRKREE+S VL  M
Sbjct: 69  ALKFIKKRVGTHIRAKRKREELSNVLAAM 97



>sp|P47964|RL36_MOUSE 60S ribosomal protein L36.
          Length = 104

 Score =  106 bits (265), Expect = 3e-22
 Identities = 53/89 (59%), Positives = 64/89 (71%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VGLN+GH VTK    PR S R+ + +    FV+ +IREV GFAPYE+R  ELLKV K KR
Sbjct: 8   VGLNKGHKVTKNVSKPRHSRRRSRLTNHTKFVRDMIREVCGFAPYERRAMELLKVSKSKR 67

Query: 291 ALKVAKRKLGTHKRAKRKREEMSGVLRKM 377
           ALK  K+++GTH RAKRKREE+S VL  M
Sbjct: 68  ALKFIKKRVGTHIRAKRKREELSNVLAAM 96



>pir|T28834|T28834 hypothetical protein F37C12.4 - Caenorhabditis
           elegans
          Length = 142

 Score =  105 bits (262), Expect = 8e-22
 Identities = 48/93 (51%), Positives = 66/93 (70%)
 Frame = +3

Query: 102 GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK 281
           GL VGLN+GH  T+  +  R +  KG  SK+   V+ L+RE+ GFAPYE+R+ E+L++ K
Sbjct: 46  GLAVGLNKGHAATQLPVKQRQNRHKGVASKKTKIVRELVREITGFAPYERRVLEMLRISK 105

Query: 282 DKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           DKRALK  KR++GTH+RAK KREE+  V+   R
Sbjct: 106 DKRALKFLKRRIGTHRRAKGKREELQNVIIAQR 138



>sp|P49181|RL36_CAEEL 60S ribosomal protein L36.>gb:U00033_1401384
           Caenorhabditis elegans cosmid F37C12, complete sequence.
          Length = 104

 Score =  105 bits (262), Expect = 8e-22
 Identities = 48/93 (51%), Positives = 66/93 (70%)
 Frame = +3

Query: 102 GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK 281
           GL VGLN+GH  T+  +  R +  KG  SK+   V+ L+RE+ GFAPYE+R+ E+L++ K
Sbjct: 8   GLAVGLNKGHAATQLPVKQRQNRHKGVASKKTKIVRELVREITGFAPYERRVLEMLRISK 67

Query: 282 DKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           DKRALK  KR++GTH+RAK KREE+  V+   R
Sbjct: 68  DKRALKFLKRRIGTHRRAKGKREELQNVIIAQR 100



>sp|P47834|RL36_CANAL 60S ribosomal protein L36
           (L39).>gb:CAU37010_1645515 Candida albicans ribosomal
           protein L39 (RPL39) gene, complete cds.
          Length = 99

 Score =  105 bits (261), Expect = 1e-21
 Identities = 51/96 (53%), Positives = 73/96 (76%)
 Frame = +3

Query: 93  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK 272
           A SG+  G+N+G   T KE+AP+ S RKG +S+R  FV+S+++EVAG APYE+R+ EL++
Sbjct: 2   AKSGIAAGVNKGRKTTAKEVAPKISYRKGASSQRTVFVRSIVKEVAGLAPYERRLIELIR 61

Query: 273 VGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
              +KRA K+AK++LGTHKRA RK EEM+ V+ + R
Sbjct: 62  NAGEKRAKKLAKKRLGTHKRALRKVEEMTQVIAESR 97



>gb:AF542001_1809977 Griffithsia japonica putative 60S ribosomal
           protein L36 mRNA, complete cds.
          Length = 94

 Score =  103 bits (258), Expect = 2e-21
 Identities = 51/94 (54%), Positives = 68/94 (72%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           +G++VG  +GH+V K+   P    +    S R+  V+S+I EV GFAPYEKR+ ELL++G
Sbjct: 2   AGIYVGNKKGHIVNKR--TPLKRRQSKPQSPRLQVVRSVINEVCGFAPYEKRVIELLRIG 59

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           KDKRALK AK++LGTH RAKRKRE+M+  LR  R
Sbjct: 60  KDKRALKFAKKRLGTHLRAKRKREQMAEALRSKR 93



>sp|Q9HFR7|RL36_TRIHM 60S ribosomal protein L36
           (TRP36).>gb:AF308443_1784798 Trichoderma hamatum 60S
           ribosomal protein (P36) gene, complete cds.
          Length = 105

 Score =  102 bits (255), Expect = 5e-21
 Identities = 51/96 (53%), Positives = 69/96 (71%)
 Frame = +3

Query: 93  ANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLK 272
           A +GL VGLN+GH  T + + PR S  KG  SKR  FV+ +++EVAG APYE+R+ ELL+
Sbjct: 7   AKTGLAVGLNKGHKTTARVVKPRVSRTKGHLSKRTAFVREVVKEVAGLAPYERRVIELLR 66

Query: 273 VGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
             KDKRA K+AK++LGT  RAKRK +E+  V+ + R
Sbjct: 67  NSKDKRARKLAKKRLGTFGRAKRKVDELQRVIAESR 102



>gb:AY769306_1350457 Bombyx mori ribosomal protein L36 (RpL36) mRNA,
           complete cds.
          Length = 119

 Score =  100 bits (250), Expect = 2e-20
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 10/100 (10%)
 Frame = +3

Query: 111 VGLNRGHVVTK----------KELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRIT 260
           VGL +GH  TK          K +  RP+  KG  +K   FV+ L+REV G A YEKR  
Sbjct: 9   VGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAM 68

Query: 261 ELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ELLKV KDKRALK  KR+LGTH RAKRKREE+S VL +MR
Sbjct: 69  ELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 108



>gb:AB180419_1202437 Plutella xylostella mRNA for Ribosomal protein
           L36A, complete cds.
          Length = 118

 Score =  100 bits (250), Expect = 2e-20
 Identities = 56/100 (56%), Positives = 65/100 (65%), Gaps = 10/100 (10%)
 Frame = +3

Query: 111 VGLNRGHVVTK----------KELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRIT 260
           VGL +GH  TK          K +  RP+  KG  +K   FV+ L+REV G A YEKR  
Sbjct: 9   VGLRKGHKTTKISAGRKGITDKAIKIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAM 68

Query: 261 ELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ELLKV KDKRALK  KR+LGTH RAKRKREE+S VL +MR
Sbjct: 69  ELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLTQMR 108



>gb:AF400198_1268297 Spodoptera frugiperda ribosomal protein L36A
           mRNA, complete cds.
          Length = 122

 Score =  100 bits (249), Expect = 3e-20
 Identities = 56/102 (54%), Positives = 66/102 (64%), Gaps = 10/102 (9%)
 Frame = +3

Query: 105 LFVGLNRGHV----------VTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKR 254
           L VGL +GH           +T K +  RP+  KG  +K   FV+ L+REV G A YEKR
Sbjct: 7   LAVGLRKGHKTLKISAGKKGITDKAIKIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKR 66

Query: 255 ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
             ELLKV KDKRALK  KR+LGTH RAKRKREE+S VL +MR
Sbjct: 67  AMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLTQMR 108



>gb:AE016819_1748675 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 100

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 50/94 (53%), Positives = 68/94 (72%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           SG+ VGLN+G  VT    AP+ S RKG +SKR  FV+S++REVAG APYE+R+ +L++  
Sbjct: 5   SGIAVGLNKGKKVTPMTPAPKVSYRKGASSKRTTFVRSIVREVAGMAPYERRLIDLIRNA 64

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
            +KRA KVAK++LGT  RAK K EEM+ ++   R
Sbjct: 65  GEKRARKVAKKRLGTFGRAKAKVEEMNEIIAASR 98



>gb:AY752831_1179974 Culicoides sonorensis clone CsRPL36 ribosomal
           protein L36 mRNA, partial cds.
          Length = 118

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 54/100 (54%), Positives = 62/100 (62%), Gaps = 10/100 (10%)
 Frame = +3

Query: 111 VGLNRGHVVTK----------KELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRIT 260
           VGLN+GH  TK          K    RP   K   +K   FV+ L+REV G APYE+R  
Sbjct: 13  VGLNKGHKTTKIKQLQYKGEHKVKGIRPQRLKNLQTKHTKFVRDLVREVVGHAPYERRTM 72

Query: 261 ELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           ELLKV KDKRALK  KR+LGTH RAKRKREE+  +L  MR
Sbjct: 73  ELLKVSKDKRALKFLKRRLGTHIRAKRKREELGNILAHMR 112



>gb:AE017347_1757712 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 197

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 51/108 (47%), Positives = 73/108 (67%)
 Frame = +3

Query: 66  IERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPY 245
           ++   AP Q  S L  G+N+G   T      RPS++KG  +++  FV+S+IREVAGF+PY
Sbjct: 90  VDMSSAPAQ-RSNLRYGMNKGRPTTVIPKTARPSNKKGLKTEKKTFVRSVIREVAGFSPY 148

Query: 246 EKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATG 389
           EKR+ ELL+  KDK+A K+ K++LGT  R+KRK EE+S V+ + R  G
Sbjct: 149 EKRVMELLRNSKDKKAKKLTKKRLGTLLRSKRKIEELSAVIVEQRRAG 196



>gb:AY231780_1177073 Drosophila yakuba clone yak-em_RpL36 mRNA
           sequence.
          Length = 115

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 52/102 (50%), Positives = 65/102 (63%), Gaps = 10/102 (9%)
 Frame = +3

Query: 105 LFVGLNRGHVVTKKELAPRPSDRKGK----------TSKRINFVKSLIREVAGFAPYEKR 254
           L +GLN+GH  TK        D+K K           ++   F++ L+REV G APYEKR
Sbjct: 7   LAIGLNKGHKTTKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKR 66

Query: 255 ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
             ELLKV KDKRALK  KR+LGTH RAKRKREE+S +L ++R
Sbjct: 67  TMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108



>gb:AF401680_1796150 Orobanche cumana putative 60S ribosomal protein
           L36 mRNA, partial cds.
          Length = 80

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 48/69 (69%), Positives = 58/69 (84%)
 Frame = +3

Query: 156 PRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRA 335
           PRPS RKGKTSKR++FV++LI+EVAGFAPYEKRITELLKVGKDKRALKV + K+G H + 
Sbjct: 1   PRPSYRKGKTSKRVHFVRNLIKEVAGFAPYEKRITELLKVGKDKRALKVRQEKIG-HPQE 59

Query: 336 KRKREEMSG 362
            ++ E   G
Sbjct: 60  SKEEERGDG 68



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +2

Query: 278 KGQACFEGSQAKVGYSQEG*KEERGDVWCSPKDEGYWRW 394
           K +   +  Q K+G+ QE  +EERGD WC P+DEG WRW
Sbjct: 42  KDKRALKVRQEKIGHPQESKEEERGDGWCPPQDEGCWRW 80



>sp|P49630|RL36_DROME 60S ribosomal protein L36 (Minute(1)1B
           protein).>pir|T13383|T13383 hypothetical protein 115C2.7
           - fruit fly (Drosophila
           melanogaster)>gb:AE014298_1123737 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE014298_1123738 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014298_1123739
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1123740 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003418_1208919
           Drosophila melanogaster chromosome X, section 2 of 74 of
           the complete sequence.>gb:AE003418_1208920 Drosophila
           melanogaster chromosome X, section 2 of 74 of the
           complete sequence.>gb:AE003418_1208921 Drosophila
           melanogaster chromosome X, section 2 of 74 of the
           complete sequence.>gb:AE003418_1208922 Drosophila
           melanogaster chromosome X, section 2 of 74 of the
           complete sequence.>gb:AY070831_1294916 Drosophila
           melanogaster AT29875 full length
           cDNA.>gb:DMC115C2_1378286 Drosophila melanogaster cosmid
           clone 115C2.>gb:DMU20543_1380495 Drosophila melanogaster
           minute(1)1B protein (M(1)1B) gene, complete cds.
          Length = 115

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 51/102 (50%), Positives = 65/102 (63%), Gaps = 10/102 (9%)
 Frame = +3

Query: 105 LFVGLNRGHVVTKKELAPRPSDRKGK----------TSKRINFVKSLIREVAGFAPYEKR 254
           L +GLN+GH  +K        D+K K           ++   F++ L+REV G APYEKR
Sbjct: 7   LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKR 66

Query: 255 ITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
             ELLKV KDKRALK  KR+LGTH RAKRKREE+S +L ++R
Sbjct: 67  TMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108



>pir|S72661|S72661 ribosomal protein L36.e.B, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SCYPL249C_1714770
           S.cerevisiae chromosome XVI reading frame ORF
           YPL249c.>gb:SCYPL250C_1714773 S.cerevisiae chromosome
           XVI reading frame ORF YPL250c.
          Length = 100

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 44/94 (46%), Positives = 67/94 (71%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           +G+ +GLN+G  VT+   AP+ S +KG  S R  FV+SL+RE+AG +PYE+R+ +L++  
Sbjct: 5   TGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNS 64

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
            +KRA KVAK++LG+  RAK K EEM+ ++   R
Sbjct: 65  GEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASR 98



>sp|O14455|R36B_YEAST 60S ribosomal protein L36-B (L39B) (YL39).
          Length = 99

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 44/94 (46%), Positives = 67/94 (71%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           +G+ +GLN+G  VT+   AP+ S +KG  S R  FV+SL+RE+AG +PYE+R+ +L++  
Sbjct: 4   TGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNS 63

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
            +KRA KVAK++LG+  RAK K EEM+ ++   R
Sbjct: 64  GEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASR 97



>gb:CR382124_1656884 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 100

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 47/94 (50%), Positives = 66/94 (70%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           SG+ VGLN+G  V +   AP+ S RKG  S+R  FV+S+++EVA  APYE+R+ EL++  
Sbjct: 5   SGIAVGLNKGKKVNQLTPAPKISYRKGAASQRTTFVRSIVKEVASLAPYERRLIELIRNA 64

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
            +KRA KVAK++LGT  RAK K EEM+ ++   R
Sbjct: 65  GEKRARKVAKKRLGTFGRAKAKVEEMNEIITASR 98



>pir|S11263|S50922 ribosomal protein L36.e.A, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SC9646_1706075
           S.cerevisiae chromosome XIII cosmid 9646.
          Length = 100

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 44/94 (46%), Positives = 66/94 (70%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           +G+ +GLN+G  VT    AP+ S +KG  S R  FV+SL+RE+AG +PYE+R+ +L++  
Sbjct: 5   TGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNS 64

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
            +KRA KVAK++LG+  RAK K EEM+ ++   R
Sbjct: 65  GEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASR 98



>sp|P05745|R36A_YEAST 60S ribosomal protein L36-A (L39A) (YL39).
          Length = 99

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 44/94 (46%), Positives = 66/94 (70%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           +G+ +GLN+G  VT    AP+ S +KG  S R  FV+SL+RE+AG +PYE+R+ +L++  
Sbjct: 4   TGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNS 63

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
            +KRA KVAK++LG+  RAK K EEM+ ++   R
Sbjct: 64  GEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASR 97



>gb:AE014186_938071 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014837_1228805 Plasmodium falciparum 3D7
           chromosome 11 section 2 of 8 of the complete sequence.
          Length = 130

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 48/89 (53%), Positives = 62/89 (69%), Gaps = 3/89 (3%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG---K 281
           VG N GHVVTK+ L  +   +K   SKR   +K ++RE+ GF+PYEKRI EL+K+G    
Sbjct: 33  VGFNSGHVVTKRNL--KLHKKKKPFSKRKELIKDVVREITGFSPYEKRIIELIKIGTSAS 90

Query: 282 DKRALKVAKRKLGTHKRAKRKREEMSGVL 368
            KR+LK AK+KLGTHKR K KREE+  V+
Sbjct: 91  TKRSLKYAKKKLGTHKRGKAKREEIQKVV 119



>gb:AC117072_1207641 Dictyostelium discoideum chromosome 2 map
           3879572-4071762 strain AX4, complete
           sequence.>gb:AY007805_1286231 Dictyostelium discoideum
           ribosomal protein L36 mRNA, complete cds.
          Length = 105

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 42/95 (44%), Positives = 69/95 (72%)
 Frame = +3

Query: 99  SGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVG 278
           SG+  G N+GH V K+ +    + +K   +KR+  ++ +IRE++GF+PYE+R++ELLK G
Sbjct: 12  SGIIKGFNKGHAVAKRTVTS--TFKKQVVTKRVAAIRDVIREISGFSPYERRVSELLKSG 69

Query: 279 KDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRA 383
            DKRALKVAK++LG+ +  K+KR++++ + RK  A
Sbjct: 70  LDKRALKVAKKRLGSIQAGKKKRDDIANINRKASA 104



>gb:LMFL1375_1387746 Leishmania major Friedlin chromosome 21 cosmid
           L1375.
          Length = 105

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 41/98 (41%), Positives = 61/98 (62%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           M+     +G+  G N+GHV T++   P P+DR     K +  VK++I ++ G +P EKR+
Sbjct: 1   MSAPTPRTGIIAGFNKGHVTTRRPRQPSPNDRFAVPHKHLRAVKAIIADLVGLSPLEKRV 60

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLR 371
            E L+VGK+KRALK  K++LG    AK+KR +M   LR
Sbjct: 61  QEFLRVGKEKRALKYCKKRLGDFTAAKKKRSKMEEALR 98



>gb:AB083110_1524156 Allium cepa L36 mRNA for 60S ribosomal protein
           L36 homolog, complete cds.
          Length = 64

 Score = 79.0 bits (193), Expect = 8e-14
 Identities = 48/110 (43%), Positives = 55/110 (50%)
 Frame = +3

Query: 78  MAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRI 257
           MAP Q N+GLFVGLN+GH+VTK+EL  RP                               
Sbjct: 1   MAPPQLNTGLFVGLNKGHIVTKRELPLRP------------------------------- 29

Query: 258 TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKKK 407
                          + RKLGTHKRAKRKREEMS VLRKMR+ G  +KKK
Sbjct: 30  ---------------SSRKLGTHKRAKRKREEMSNVLRKMRSAGVSEKKK 64



>gb:AF486843_1276111 Aplysia californica ribosomal protein L36 mRNA,
           partial cds.
          Length = 44

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 26/38 (68%), Positives = 31/38 (81%)
 Frame = +3

Query: 267 LKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
           LK+ KDKRALK  K++LGTH R KRKREEM  +L+KMR
Sbjct: 1   LKISKDKRALKFCKKRLGTHIRGKRKREEMQMMLQKMR 38



>gb:AB002792_1192808 Entamoeba histolytica mRNA for ribosomal
           protein L36, partial cds.
          Length = 79

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +3

Query: 102 GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK 281
           G+ VGL RG+ V   + A R        +KR + V  +IRE  GF+ YE+ + +LL+ G 
Sbjct: 1   GIAVGLKRGYPVHTMKTAKRHYG----VTKRKHVVNDVIREACGFSAYERHMMDLLRRGL 56

Query: 282 DKRALKVAKR-KLGTHKRAKRKR 347
           DK+ALK AK+    T KR  ++R
Sbjct: 57  DKKALKYAKKTSWNTQKRTCQER 79



>gb:AX972459_1487768 Sequence 3262 from Patent EP1104808.
          Length = 90

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 29/70 (41%), Positives = 37/70 (52%)
 Frame = +3

Query: 111 VGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKR 290
           VG N+GH VTK    PR S R+G+  +                PYE+R  ELLKV KDKR
Sbjct: 9   VGSNKGHKVTKNVSKPRHSRRRGRLDQTHQVRAGHDSGGVWLCPYERRAMELLKVSKDKR 68

Query: 291 ALKVAKRKLG 320
           A ++ + K G
Sbjct: 69  APQIYQEKGG 78



>gb:AB002781_1192802 Entamoeba histolytica mRNA for ribosomal
           protein L36, partial cds.
          Length = 103

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 32/89 (35%), Positives = 47/89 (52%)
 Frame = +3

Query: 102 GLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGK 281
           G+ VGL RG+ V   + A R        +KR + V  +IRE  GF  YE+ + +LL+ G 
Sbjct: 1   GIAVGLKRGYPVHTMKTAKRHYG----VTKRKHVVNDVIREACGFPAYERHMMDLLRRGL 56

Query: 282 DKRALKVAKRKLGTHKRAKRKREEMSGVL 368
           DK+AL  AK+     ++   + E  S VL
Sbjct: 57  DKKALNYAKKTSWYTQKRTCQAEMKSNVL 85



>gb:AB046410_1867336 Homo sapiens RPL36 gene for ribosomal protein
           L36, partial cds.
          Length = 32

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 23/31 (74%), Positives = 27/31 (87%)
 Frame = +3

Query: 267 LKVGKDKRALKVAKRKLGTHKRAKRKREEMS 359
           LKV KDKRALK  K+++GTH RAKRKREE+S
Sbjct: 1   LKVSKDKRALKFIKKRVGTHIRAKRKREELS 31



>pir|G90111|G90111 60S ribosomal protein L36 [imported] - Guillardia
           theta nucleomorph>gb:GTAJ10592_1681131 Guillardia theta
           DNA for complete sequence of nucleomorph chromosome 2.
          Length = 75

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 25/65 (38%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = +3

Query: 189 KRINFVKSLIREVA----GFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEM 356
           K+ NF K  I  V     G   +EK+IT  +K+G +++ALK++K+KLG  +RAK+K + +
Sbjct: 8   KKTNFKKFNINVVLTSTFGLNEFEKKITNYIKLGYEQKALKMSKKKLGNLQRAKKKIDSI 67

Query: 357 SGVLR 371
           + +L+
Sbjct: 68  NHILK 72



>gb:CNS07EGD_1373527 chromosome VI of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 107

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 22/78 (28%), Positives = 45/78 (57%)
 Frame = +3

Query: 135 VTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRK 314
           V +K+  PR   ++ +         ++  E++G +P EK+   LL+   + +A K+ +++
Sbjct: 32  VKRKQRGPRAETQESRF-----LAAAVADEISGLSPLEKKAISLLEAKNNNKAQKLLRKR 86

Query: 315 LGTHKRAKRKREEMSGVL 368
           LG+HKRA  K E+++ +L
Sbjct: 87  LGSHKRAVAKVEKLARML 104



>gb:CR382139_1671957 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1458

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 27/88 (30%), Positives = 42/88 (47%)
 Frame = +3

Query: 105  LFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKD 284
            + +G  + H   KKE   R  +RK K  +RI+  +  IR         KR  ++ K  + 
Sbjct: 1209 VLLGARKRHSREKKESKERKMERKRKEKERISKREEDIR---------KREEKIRKREEK 1259

Query: 285  KRALKVAKRKLGTHKRAKRKREEMSGVL 368
            ++  K  KR+    KRA+ KRE+ S  L
Sbjct: 1260 EKIRKREKREKRERKRAEEKREKESAAL 1287



>pir|T16554|T16554 hypothetical protein K04C2.2 - Caenorhabditis
           elegans>gb:U00044_1401459 Caenorhabditis elegans cosmid
           K04C2, complete sequence.
          Length = 990

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 23/86 (26%), Positives = 41/86 (47%)
 Frame = +3

Query: 144 KELAPRPSDRKGKTSKRINFVKSLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGT 323
           K +AP+    K +++K +  +K  I ++   A   K + E  K+      LK AK    T
Sbjct: 675 KAIAPKAGKDKKRSAKSVEALKMKIADLLLIAISSKELAEQSKIKLVVPLLKWAKVDAKT 734

Query: 324 HKRAKRKREEMSGVLRKMRATGGGDK 401
           H +  +K  E+  ++ KM+ T   +K
Sbjct: 735 HDKVAQKVLELVNIVVKMKFTDVSEK 760



>gb:AF210726_2215814 Macaca mulatta rhadinovirus 26-95 long unique
           region L-DNA, complete sequence.
          Length = 92

 Score = 33.9 bits (76), Expect = 2.9
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 10/77 (12%)
 Frame = -1

Query: 251 LLVRSKSSNFPDQALHEIDSFACFAFPIRGP------WC*FL-LGHNMSSVQSNKQPRIS 93
           LLV++KSSN        + + +C   P RG       WC ++ + HN +++ S + P IS
Sbjct: 2   LLVKNKSSN--------LTAVSCTNAPKRGARVSILDWCVYVAIKHNCNALSSTRSPEIS 53

Query: 92  LFR-RHPSFD--LILRW 51
           L R R P     ++LRW
Sbjct: 54  LRRGRDPKTQSPVVLRW 70



>gb:BX908808_1644523 Neurospora crassa DNA linkage group IV Cosmid
            contig G21B4.
          Length = 1847

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 27/116 (23%), Positives = 53/116 (45%)
 Frame = +3

Query: 57   QNQIERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIREVAGF 236
            + + ER    K     L  GL+R  +V++ EL      R+ +T++         ++++  
Sbjct: 1728 RRKAEREAGMKHERQLLEAGLSRARLVSEAELEMEERKRE-QTAQWEQQRLQAAKQLSDV 1786

Query: 237  APYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMRATGGGDKK 404
              +E+R  E ++   D R +K    +LG HK+    +E ++  L      GGG ++
Sbjct: 1787 RVHERREMERIEAMSDARMVK----RLGEHKKLVETQERLARSLNGAGQPGGGRRQ 1838



>pir|S18732|S18732 autoantigen, 64K - human
          Length = 572

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 34/117 (29%), Positives = 47/117 (40%), Gaps = 30/117 (25%)
 Frame = +3

Query: 114 GLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIRE------VAGFAPYEKRI------ 257
           G  RG   +KK L PR +   GK  KR    KS  R+       +G  P E++I      
Sbjct: 73  GQERGRDASKKALGPRRNSDLGKEPKRGGLKKSFSRDRDESGGKSGEKPKEEKIIRGIDK 132

Query: 258 ------TELLKVGKD----KRALKVAK--------RKLGTHKRAKRKREEMSGVLRK 374
                  +  + GKD    +RA+   K        R  G  +   +KREEM  V +K
Sbjct: 133 GRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGGDRNTGLSRDKDKKREEMKEVAKK 189



>sp|P29536|LMD1_HUMAN Leiomodin 1 (Leiomodin, muscle form) (64 kDa
           autoantigen D1) (64 kDa autoantigen 1D) (64 kDa
           autoantigen 1D3) (Thyroid-associated ophthalmopathy
           autoantigen) (Smooth muscle leiomodin)
           (SM-Lmod).>gb:HSAUTAN64_2010737 Human mRNA for a 64 Kd
           autoantigen expressed in thyroid and extra-ocular
           muscle.
          Length = 572

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 34/117 (29%), Positives = 47/117 (40%), Gaps = 30/117 (25%)
 Frame = +3

Query: 114 GLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIRE------VAGFAPYEKRI------ 257
           G  RG   +KK L PR +   GK  KR    KS  R+       +G  P E++I      
Sbjct: 73  GQERGRDASKKALGPRRNSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDK 132

Query: 258 ------TELLKVGKD----KRALKVAK--------RKLGTHKRAKRKREEMSGVLRK 374
                  +  + GKD    +RA+   K        R  G  +   +KREEM  V +K
Sbjct: 133 GRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGGDRNTGLSRDKDKKREEMKEVAKK 189



>gb:BA000016_673234 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 235

 Score = 33.1 bits (74), Expect = 4.9
 Identities = 18/57 (31%), Positives = 34/57 (59%)
 Frame = -1

Query: 425 IVQEGLFLLVTTSSSPHLSENTRHLLSLPFSPLVSTQLSLGYLQSTLVLSNFKKLSD 255
           +V   +F+++ TS    +S+N+R    L +  + ++  SLG L STL + +FK+ +D
Sbjct: 137 LVYRFIFIILETSEMMFISQNSR----LGYRDIKTSYKSLGALASTLFIRSFKRAND 189



>gb:AE017148_391187 Helicobacter hepaticus ATCC 51449 section 5 of 6
           of the complete genome.>gb:AE017125_1025449 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 1164

 Score = 33.1 bits (74), Expect = 4.9
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 9/86 (10%)
 Frame = -1

Query: 431 RYIVQEGLFLLVTTSS---SPHLSENTRHLLSLPFSPLVSTQLSLGYLQST------LVL 279
           +++ + G+F LV   S      + E TR LL   F  L   +L+     ST      L  
Sbjct: 599 QFLKEGGIFALVLPVSILQKGGIYEKTRELLLAHFKFLCLVELNSRTFGSTGTQTIILFA 658

Query: 278 SNFKKLSDPLLVRSKSSNFPDQALHE 201
              KK  + L+ R K SNF D+AL +
Sbjct: 659 KRVKKYDEDLISRLKDSNFSDEALSD 684



>gb:BC080187_1989716 Homo sapiens leiomodin 1 (smooth muscle), mRNA
           (cDNA clone MGC:87977 IMAGE:6177902), complete cds.
          Length = 600

 Score = 32.7 bits (73), Expect = 6.4
 Identities = 33/117 (28%), Positives = 44/117 (37%), Gaps = 30/117 (25%)
 Frame = +3

Query: 114 GLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIRE------VAGFAPYEKRI------ 257
           G  RG   +KK L PR     GK  KR    KS  R+       +G  P E++I      
Sbjct: 101 GEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDK 160

Query: 258 ------TELLKVGKDKRA------------LKVAKRKLGTHKRAKRKREEMSGVLRK 374
                  +  + GKD R              K + R  G  +   +KREEM  V +K
Sbjct: 161 GRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKK 217



>gb:BC001755_1967831 Homo sapiens leiomodin 1 (smooth muscle), mRNA
           (cDNA clone IMAGE:3355265), complete cds.
          Length = 269

 Score = 32.7 bits (73), Expect = 6.4
 Identities = 33/117 (28%), Positives = 44/117 (37%), Gaps = 30/117 (25%)
 Frame = +3

Query: 114 GLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIRE------VAGFAPYEKRI------ 257
           G  RG   +KK L PR     GK  KR    KS  R+       +G  P E++I      
Sbjct: 73  GEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDK 132

Query: 258 ------TELLKVGKDKRA------------LKVAKRKLGTHKRAKRKREEMSGVLRK 374
                  +  + GKD R              K + R  G  +   +KREEM  V +K
Sbjct: 133 GRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKK 189



>gb:AL513217_1928762 Human DNA sequence from clone RP11-307B6 on
           chromosome 1 Contains the 3' end of the IPO9 gene for
           importin 9, the C1orf40 gene for chromosome 1 open
           reading frame 40, a novel gene and the 3' end of the
           LMOD1 gene for leimodin 1 (smooth muscle), complete
           sequence.
          Length = 631

 Score = 32.7 bits (73), Expect = 6.4
 Identities = 33/117 (28%), Positives = 44/117 (37%), Gaps = 30/117 (25%)
 Frame = +3

Query: 114 GLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIRE------VAGFAPYEKRI------ 257
           G  RG   +KK L PR     GK  KR    KS  R+       +G  P E++I      
Sbjct: 101 GEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDK 160

Query: 258 ------TELLKVGKDKRA------------LKVAKRKLGTHKRAKRKREEMSGVLRK 374
                  +  + GKD R              K + R  G  +   +KREEM  V +K
Sbjct: 161 GRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKK 217



>gb:CR382139_1673149 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 284

 Score = 32.7 bits (73), Expect = 6.4
 Identities = 28/112 (25%), Positives = 46/112 (41%)
 Frame = +3

Query: 45  LRPSQNQIERGMAPKQANSGLFVGLNRGHVVTKKELAPRPSDRKGKTSKRINFVKSLIRE 224
           L P    +   +     +  + +G  + H   K+E   R  +RK K  +RI   +  IR 
Sbjct: 118 LPPQDTYLGAPLYDAHVSREVLLGARKRHSRDKRERKERKMERKRKEKERIRKREEDIR- 176

Query: 225 VAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSGVLRKMR 380
                   KR  ++ K  + ++  K  KR+    KRA+ KRE+    L   R
Sbjct: 177 --------KREEKIRKREEKEKIRKREKREKRERKRAEEKREKERAALMPKR 220


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 759,476,170
Number of Sequences: 1806583
Number of extensions: 15762133
Number of successful extensions: 57240
Number of sequences better than 10.0: 72
Number of HSP's better than 10.0 without gapping: 55261
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56911
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 41055321816
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)