BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6654
         (713 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY029317_1559226 Zea mays seven transmembrane protein Mlo6 mR...   120   2e-26   
gb:AC025815_1539610 Arabidopsis thaliana chromosome 1 BAC T8D8 g...   115   6e-25   
pir|E96495|E96495 hypothetical protein F8D11.2 [imported] - Arab...   115   6e-25   Arabidopsis thaliana [mouse-ear cress]
sp|Q94KB4|MLO9_ARATH|MLO9_ARATH MLO-like protein 9 (AtMlo9).                     115   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AX063306_1458758 Sequence 15 from Patent WO0078799.                115   8e-25   
pir|F84552|F84552 similar to Mlo proteins from H. vulgare [impor...   115   8e-25   Arabidopsis thaliana [mouse-ear cress]
sp|O22757|MLO8_ARATH|MLO8_ARATH MLO-like protein 8 (AtMlo8).>gb:AC007584_15...   115   8e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AF369566_1791934 Arabidopsis thaliana membrane protein Mlo5 m...   110   2e-23   
sp|O22815|MLO5_ARATH|MLO5_ARATH MLO-like protein 5 (AtMlo5).>pir|B84748|B84...   110   2e-23   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FKY5|ML10_ARATH|ML10_ARATH MLO-like protein 10 (AtMlo10).>gb:AX063300_...   110   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AY029313_1559222 Zea mays seven transmembrane protein Mlo2 mR...   109   6e-23   
gb:AP000615_1820475 Oryza sativa (japonica cultivar-group) genom...   108   9e-23   
gb:AF384030_1794140 Oryza sativa seven transmembrane protein MLO...   108   9e-23   
gb:AC099739_1737224 Oryza sativa (japonica cultivar-group) chrom...   108   9e-23   
gb:AF388195_1794933 Oryza sativa Mlo (Mlo) mRNA, complete cds.        107   3e-22   
gb:AE016959_1023664 Oryza sativa (japonica cultivar-group) chrom...   105   6e-22   
gb:AY029312_1559221 Zea mays seven transmembrane protein Mlo1 mR...   105   8e-22   
sp|Q94KB7|MLO6_ARATH|MLO6_ARATH MLO-like protein 6 (AtMlo6).>pir|H96640|H96...   101   2e-20   Arabidopsis thaliana [mouse-ear cress]
sp|O49914|MLH1_ORYSA|MLH1_ORYSA MLO protein homolog 1.>gb:OSMLOH1_1698269 O...    98   1e-19   Oryza sativa [red rice]
sp|O22752|MLO7_ARATH|MLO7_ARATH MLO-like protein 7 (AtMlo7).                      96   5e-19   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SXB6|MLO2_ARATH|MLO2_ARATH MLO-like protein 2 (AtMlo2).>pir|B86247|B86...    93   5e-18   Arabidopsis thaliana [mouse-ear cress]
pir|B84552|B84552 similar to Mlo proteins from H. vulgare [impor...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T02582|T02582 H. vulgare Mlo protein homolog [imported] - Ar...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
sp|O49873|MLH1_HORVU|MLH1_HORVU MLO protein homolog 1.>pir|T05952|T05952 Ml...    89   8e-17   Hordeum vulgare [barley]
sp|O80961|ML12_ARATH|ML12_ARATH MLO-like protein 12 (AtMlo12) (AtMlo18).>gb...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP004191_1838788 Oryza sativa (japonica cultivar-group) genom...    86   7e-16   
gb:AY599871_1617164 Physcomitrella patens MLO1 (Mlo1) mRNA, comp...    86   7e-16   
sp|P93766|MLO_HORVU|MLO_HORVU MLO protein.>pir|T04481|T04481 Mlo protein -...    85   1e-15   Hordeum vulgare [barley]
gb:AP003346_1828444 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:AX063304_1458757 Sequence 13 from Patent WO0078799.                 84   2e-15   
sp|O49621|MLO1_ARATH|MLO1_ARATH MLO-like protein 1 (AtMlo1) (MLO protein ho...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AF384145_1794191 Triticum aestivum MLo1 protein mRNA, complet...    82   7e-15   
sp|O80580|ML15_ARATH|ML15_ARATH MLO-like protein 15 (AtMlo15).>pir|T00691|T...    82   7e-15   Arabidopsis thaliana [mouse-ear cress]
sp|Q94KB2|ML13_ARATH|ML13_ARATH MLO-like protein 13 (AtMlo13) (AtMlo20).>gb...    82   7e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AY029318_1559227 Zea mays seven transmembrane protein Mlo7 mR...    82   9e-15   
gb:AY581255_1616062 Hordeum vulgare subsp. vulgare Mlo3 (Mlo3) m...    82   1e-14   
gb:AF361932_1791455 Triticum aestivum seven transmembrane-spanni...    79   6e-14   
gb:AY584534_1616298 Triticum aestivum Mlo protein (Mlo) mRNA, pa...    79   6e-14   
gb:AY029319_1559228 Zea mays seven transmembrane protein Mlo8 mR...    79   6e-14   
gb:AX063296_1458753 Sequence 5 from Patent WO0078799.                  79   6e-14   
gb:AX063294_1458752 Sequence 3 from Patent WO0078799.                  79   6e-14   
gb:AF384144_1794190 Triticum aestivum MLo protein mRNA, complete...    78   1e-13   
gb:AX063298_1458754 Sequence 7 from Patent WO0078799.                  78   1e-13   
gb:AY029314_1559223 Zea mays seven transmembrane protein Mlo3 mR...    77   2e-13   
pir|T47469|T47469 hypothetical protein F18N11.50 - Arabidopsis t...    77   2e-13   Arabidopsis thaliana [mouse-ear cress]
sp|Q94KB9|MLO3_ARATH|MLO3_ARATH MLO-like protein 3 (AtMlo3).>gb:AF369564_17...    77   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00235_1697144 Oryza sativa genomic DNA, chromosome 4, BAC...    74   3e-12   
pir|T03797|T03797 probable mlo protein - rice                          73   4e-12   Oryza sativa Indica Group [Indian rice]
pir|T09888|T09888 hypothetical protein T22A6.80 - Arabidopsis th...    73   6e-12   Arabidopsis thaliana [mouse-ear cress]
pir|H86393|H86393 protein T24P13.8 [imported] - Arabidopsis thal...    70   4e-11   Arabidopsis thaliana [mouse-ear cress]
sp|Q94KB1|ML14_ARATH|ML14_ARATH MLO-like protein 14 (AtMlo14).>gb:AF369575_...    70   4e-11   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FI00|ML11_ARATH|ML11_ARATH MLO-like protein 11 (AtMlo11).>gb:AB017066_...    68   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AP003518_1830291 Oryza sativa (japonica cultivar-group) genom...    67   4e-10   
gb:OSJN00017_1693352 Oryza sativa genomic DNA, chromosome 4, BAC...    61   2e-08   
gb:AY029315_1559224 Zea mays seven transmembrane protein Mlo4 mR...    60   4e-08   
gb:BT010322_1640269 Arabidopsis thaliana At1g11000 mRNA, complet...    60   5e-08   
gb:AX063308_1458759 Sequence 17 from Patent WO0078799.                 60   5e-08   
sp|O23693|MLO4_ARATH|MLO4_ARATH MLO-like protein 4 (AtMlo4).>gb:AF369565_17...    60   5e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP003616_1831464 Oryza sativa (japonica cultivar-group) genom...    56   7e-07   
gb:AB020749_1514658 Arabidopsis thaliana genomic DNA, chromosome...    34   3.0     
gb:AY090639_1574179 Hordeum brevisubulatum MLO protein (Mlo) gen...    33   3.9     
gb:CP000013_869877 Borrelia garinii PBi, complete genome.              33   5.0     


>gb:AY029317_1559226 Zea mays seven transmembrane protein Mlo6 mRNA,
           complete cds.
          Length = 515

 Score =  120 bits (301), Expect = 2e-26
 Identities = 59/95 (62%), Positives = 67/95 (70%)
 Frame = +1

Query: 337 GGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKG 516
           GGGG + RELDQTPTWAVA             EK LH VG  F  ++K+A+ EAL+K+K 
Sbjct: 4   GGGGGNSRELDQTPTWAVASVCGVIVLISILLEKGLHHVGEFFSHRKKKAMVEALEKVKA 63

Query: 517 ELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           ELMVLGFISLLL FGQNYI K+CI   AANTMLPC
Sbjct: 64  ELMVLGFISLLLVFGQNYIIKVCISNHAANTMLPC 98



>gb:AC025815_1539610 Arabidopsis thaliana chromosome 1 BAC T8D8
           genomic sequence, complete sequence.
          Length = 467

 Score =  115 bits (289), Expect = 6e-25
 Identities = 56/95 (58%), Positives = 66/95 (69%)
 Frame = +1

Query: 337 GGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKG 516
           GGGG   R+LDQTPTWAV+             E  +H VG  FERK+K+AL+EAL+KIK 
Sbjct: 7   GGGGEGPRQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKN 66

Query: 517 ELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           ELMVLGFISLLLTFGQNYIA IC+P+   + M  C
Sbjct: 67  ELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFC 101



>pir|E96495|E96495 hypothetical protein F8D11.2 [imported] -
           Arabidopsis thaliana>gb:AE005173_892521 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC035249_1539951 Arabidopsis thaliana
           chromosome 1 BAC F8D11 genomic sequence, complete
           sequence.
          Length = 443

 Score =  115 bits (289), Expect = 6e-25
 Identities = 56/95 (58%), Positives = 66/95 (69%)
 Frame = +1

Query: 337 GGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKG 516
           GGGG   R+LDQTPTWAV+             E  +H VG  FERK+K+AL+EAL+KIK 
Sbjct: 7   GGGGEGPRQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKN 66

Query: 517 ELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           ELMVLGFISLLLTFGQNYIA IC+P+   + M  C
Sbjct: 67  ELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFC 101



>sp|Q94KB4|MLO9_ARATH MLO-like protein 9 (AtMlo9).
          Length = 460

 Score =  115 bits (289), Expect = 6e-25
 Identities = 56/95 (58%), Positives = 66/95 (69%)
 Frame = +1

Query: 337 GGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKG 516
           GGGG   R+LDQTPTWAV+             E  +H VG  FERK+K+AL+EAL+KIK 
Sbjct: 7   GGGGEGPRQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEALEKIKN 66

Query: 517 ELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           ELMVLGFISLLLTFGQNYIA IC+P+   + M  C
Sbjct: 67  ELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFC 101



>gb:AX063306_1458758 Sequence 15 from Patent WO0078799.
          Length = 593

 Score =  115 bits (288), Expect = 8e-25
 Identities = 62/116 (53%), Positives = 70/116 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           ++L+QTPTWAVA             EK LH VG     + K AL +AL+KIK ELMVLGF
Sbjct: 39  KQLNQTPTWAVAAVCTFFIVVSVLLEKLLHKVGKVLWDRHKTALLDALEKIKAELMVLGF 98

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPCPAKYPIXXXXXXXXXXRRLLWYEHRLLS 705
           ISLLLTFGQ YI  ICIP+  A TMLPCPA              RRLL +EHR LS
Sbjct: 99  ISLLLTFGQTYILDICIPSHVARTMLPCPAPNLKKEDDDNGESHRRLLSFEHRFLS 154



>pir|F84552|F84552 similar to Mlo proteins from H. vulgare
           [imported] - Arabidopsis thaliana
          Length = 574

 Score =  115 bits (288), Expect = 8e-25
 Identities = 62/116 (53%), Positives = 70/116 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           ++L+QTPTWAVA             EK LH VG     + K AL +AL+KIK ELMVLGF
Sbjct: 39  KQLNQTPTWAVAAVCTFFIVVSVLLEKLLHKVGKVLWDRHKTALLDALEKIKAELMVLGF 98

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPCPAKYPIXXXXXXXXXXRRLLWYEHRLLS 705
           ISLLLTFGQ YI  ICIP+  A TMLPCPA              RRLL +EHR LS
Sbjct: 99  ISLLLTFGQTYILDICIPSHVARTMLPCPAPNLKKEDDDNGESHRRLLSFEHRFLS 154



>sp|O22757|MLO8_ARATH MLO-like protein 8
           (AtMlo8).>gb:AC007584_1535966 Arabidopsis thaliana
           chromosome 2 clone MJB20 map mi398, complete
           sequence.>gb:BT002918_1636508 Arabidopsis thaliana clone
           RAFL14-90-F20 (R20170) putative Mlo protein (At2g17480)
           mRNA, complete cds.>gb:BT004356_1637428 Arabidopsis
           thaliana clone U20170 putative Mlo protein (At2g17480)
           mRNA, complete cds.>gb:AF369569_1791937 Arabidopsis
           thaliana membrane protein Mlo8 mRNA, complete cds.
          Length = 593

 Score =  115 bits (288), Expect = 8e-25
 Identities = 62/116 (53%), Positives = 70/116 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           ++L+QTPTWAVA             EK LH VG     + K AL +AL+KIK ELMVLGF
Sbjct: 39  KQLNQTPTWAVAAVCTFFIVVSVLLEKLLHKVGKVLWDRHKTALLDALEKIKAELMVLGF 98

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPCPAKYPIXXXXXXXXXXRRLLWYEHRLLS 705
           ISLLLTFGQ YI  ICIP+  A TMLPCPA              RRLL +EHR LS
Sbjct: 99  ISLLLTFGQTYILDICIPSHVARTMLPCPAPNLKKEDDDNGESHRRLLSFEHRFLS 154



>gb:AF369566_1791934 Arabidopsis thaliana membrane protein Mlo5
           mRNA, complete cds.
          Length = 500

 Score =  110 bits (275), Expect = 2e-23
 Identities = 57/102 (55%), Positives = 66/102 (64%), Gaps = 5/102 (4%)
 Frame = +1

Query: 331 MAGGGGASE-----RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYE 495
           MAGGGG S      RELDQTPTWAV+             E  +H +G  F  +RK+ALYE
Sbjct: 1   MAGGGGGSTSGEGPRELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTERRKKALYE 60

Query: 496 ALQKIKGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           ALQKIK ELMVLGFISLLLTFGQNYIA +C+ +   + M  C
Sbjct: 61  ALQKIKNELMVLGFISLLLTFGQNYIASLCVASRYGHAMSFC 102



>sp|O22815|MLO5_ARATH MLO-like protein 5 (AtMlo5).>pir|B84748|B84748
           similar to Mlo proteins from H. vulgare [imported] -
           Arabidopsis thaliana>gb:AC002332_1530337 Arabidopsis
           thaliana chromosome 2 clone F4P9 map ve015, complete
           sequence.
          Length = 501

 Score =  110 bits (275), Expect = 2e-23
 Identities = 57/102 (55%), Positives = 66/102 (64%), Gaps = 5/102 (4%)
 Frame = +1

Query: 331 MAGGGGASE-----RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYE 495
           MAGGGG S      RELDQTPTWAV+             E  +H +G  F  +RK+ALYE
Sbjct: 1   MAGGGGGSTSGEGPRELDQTPTWAVSTVCGVIILISIVLELMIHKIGEVFTERRKKALYE 60

Query: 496 ALQKIKGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           ALQKIK ELMVLGFISLLLTFGQNYIA +C+ +   + M  C
Sbjct: 61  ALQKIKNELMVLGFISLLLTFGQNYIASLCVASRYGHAMSFC 102



>sp|Q9FKY5|ML10_ARATH MLO-like protein 10
           (AtMlo10).>gb:AX063300_1458755 Sequence 9 from Patent
           WO0078799.>gb:AB011474_1511339 Arabidopsis thaliana
           genomic DNA, chromosome 5, TAC
           clone:K2A18.>gb:AF369571_1791939 Arabidopsis thaliana
           membrane protein Mlo10 mRNA, complete cds.
          Length = 569

 Score =  110 bits (274), Expect = 3e-23
 Identities = 56/100 (56%), Positives = 65/100 (65%)
 Frame = +1

Query: 328 KMAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQK 507
           + +  GGA E+ L QTPTWAVA             EK LH V +    K K +L EAL+K
Sbjct: 24  RASSAGGAKEKGLSQTPTWAVALVCTFFILVSVLLEKALHRVATWLWEKHKNSLLEALEK 83

Query: 508 IKGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPA 627
           IK ELM+LGFISLLLTFG+ YI KICIP  AA +MLPCPA
Sbjct: 84  IKAELMILGFISLLLTFGEQYILKICIPEKAAASMLPCPA 123



>gb:AY029313_1559222 Zea mays seven transmembrane protein Mlo2 mRNA,
           complete cds.
          Length = 565

 Score =  109 bits (272), Expect = 6e-23
 Identities = 54/93 (58%), Positives = 62/93 (66%)
 Frame = +1

Query: 343 GGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGEL 522
           GG   R LDQTPTWAVA             E FLH +G    +KRK+AL++AL+K+K EL
Sbjct: 2   GGDGTRALDQTPTWAVAAVCAVIVAASILLEGFLHHLGQLLNKKRKKALFDALEKVKSEL 61

Query: 523 MVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           M LGFISLLLT    YIA+ICIP  AANTMLPC
Sbjct: 62  MTLGFISLLLTVTGRYIARICIPEGAANTMLPC 94



>gb:AP000615_1820475 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 3, clone:P0043E01.
          Length = 555

 Score =  108 bits (270), Expect = 9e-23
 Identities = 62/120 (51%), Positives = 72/120 (60%), Gaps = 1/120 (0%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MAGGGG   R L +TPTWAVA             E  LH +G  F ++ K+A+ EAL+KI
Sbjct: 1   MAGGGGG--RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALEKI 58

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPAKYPI-XXXXXXXXXXRRLLWY 687
           K ELM+LGFISLLLT  Q  I+KICIP +AAN MLPC A   I           RRLLWY
Sbjct: 59  KAELMLLGFISLLLTVAQTPISKICIPESAANIMLPCKAGQDIVKGLKGKKDHRRRLLWY 118



>gb:AF384030_1794140 Oryza sativa seven transmembrane protein MLO2
           mRNA, complete cds.
          Length = 555

 Score =  108 bits (270), Expect = 9e-23
 Identities = 62/120 (51%), Positives = 72/120 (60%), Gaps = 1/120 (0%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MAGGGG   R L +TPTWAVA             E  LH +G  F ++ K+A+ EAL+KI
Sbjct: 1   MAGGGGG--RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALEKI 58

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPAKYPI-XXXXXXXXXXRRLLWY 687
           K ELM+LGFISLLLT  Q  I+KICIP +AAN MLPC A   I           RRLLWY
Sbjct: 59  KAELMLLGFISLLLTVAQTPISKICIPESAANIMLPCKAGQDIVKGLKGKKDHRRRLLWY 118



>gb:AC099739_1737224 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1528D07, complete sequence.
          Length = 583

 Score =  108 bits (270), Expect = 9e-23
 Identities = 62/120 (51%), Positives = 72/120 (60%), Gaps = 1/120 (0%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MAGGGG   R L +TPTWAVA             E  LH +G  F ++ K+A+ EAL+KI
Sbjct: 1   MAGGGGG--RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALEKI 58

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPAKYPI-XXXXXXXXXXRRLLWY 687
           K ELM+LGFISLLLT  Q  I+KICIP +AAN MLPC A   I           RRLLWY
Sbjct: 59  KAELMLLGFISLLLTVAQTPISKICIPESAANIMLPCKAGQDIVKGLKGKKDHRRRLLWY 118



>gb:AF388195_1794933 Oryza sativa Mlo (Mlo) mRNA, complete cds.
          Length = 554

 Score =  107 bits (266), Expect = 3e-22
 Identities = 62/120 (51%), Positives = 71/120 (59%), Gaps = 1/120 (0%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MAGGGG   R L +TPTWAVA             E  LH +G  F ++ K+A+ EAL KI
Sbjct: 1   MAGGGGG--RALPETPTWAVAVVCAVIVLVSVAMEHGLHKLGHWFHKREKKAMGEALGKI 58

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPAKYPI-XXXXXXXXXXRRLLWY 687
           K ELM+LGFISLLLT  Q  I+KICIP +AAN MLPC A   I           RRLLWY
Sbjct: 59  KAELMLLGFISLLLTVAQTPISKICIPESAANIMLPCKAGQDIVKGLKGKKDHRRRLLWY 118



>gb:AE016959_1023664 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC073166_1540980
           Oryza sativa chromosome 10 BAC OSJNBb0064P21 genomic
           sequence, complete sequence.>gb:AE017116_1753483 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           70 of 77 of the complete sequence.
          Length = 580

 Score =  105 bits (263), Expect = 6e-22
 Identities = 51/95 (53%), Positives = 63/95 (66%)
 Frame = +1

Query: 337 GGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKG 516
           G GG   R LDQTPTWAVA             E  LH +G  F ++RK+AL++AL+K+K 
Sbjct: 11  GAGGDGARALDQTPTWAVAAVCAVIVAASILLEGLLHHLGQWFSKRRKKALFDALEKVKS 70

Query: 517 ELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           ELM LGFISLLL+    YI++ICIP  AA+TMLPC
Sbjct: 71  ELMTLGFISLLLSVTGRYISRICIPVGAADTMLPC 105



>gb:AY029312_1559221 Zea mays seven transmembrane protein Mlo1 mRNA,
           complete cds.
          Length = 563

 Score =  105 bits (262), Expect = 8e-22
 Identities = 59/121 (48%), Positives = 70/121 (57%), Gaps = 2/121 (1%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MAGGGG   R+L  TPTWAVA             E  LH +G  F  ++K+A+ EAL+KI
Sbjct: 1   MAGGGGG--RDLPSTPTWAVALVCAVIVLVSVAMEHGLHKLGHWFHTRQKKAMREALEKI 58

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC--PAKYPIXXXXXXXXXXRRLLW 684
           K ELM++GFISLLL  GQ  I+KICIPA A + MLPC  P               RRLLW
Sbjct: 59  KAELMLMGFISLLLAVGQTPISKICIPAKAGSIMLPCKPPKGAAAAADDDKSDGRRRLLW 118

Query: 685 Y 687
           Y
Sbjct: 119 Y 119



>sp|Q94KB7|MLO6_ARATH MLO-like protein 6 (AtMlo6).>pir|H96640|H96640
           hypothetical protein T25B24.9 [imported] - Arabidopsis
           thaliana>gb:AE005173_893826 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC005850_1533097 Arabidopsis thaliana
           chromosome I BAC T25B24 genomic sequence, complete
           sequence.>gb:AF369567_1791935 Arabidopsis thaliana
           membrane protein Mlo6 mRNA, complete cds.
          Length = 583

 Score =  101 bits (251), Expect = 2e-20
 Identities = 48/91 (52%), Positives = 62/91 (68%)
 Frame = +1

Query: 355 ERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLG 534
           E+ L++T TWAVA             EK +H +GS F++K K+ALYEAL+K+K ELM++G
Sbjct: 7   EKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKKKNKKALYEALEKVKAELMLMG 66

Query: 535 FISLLLTFGQNYIAKICIPATAANTMLPCPA 627
           FISLLLT GQ YI+ ICIP   A +M PC A
Sbjct: 67  FISLLLTIGQGYISNICIPKNIAASMHPCSA 97



>sp|O49914|MLH1_ORYSA MLO protein homolog 1.>gb:OSMLOH1_1698269
           Oryza sativa (indica cultivar-group) Mlo1.
          Length = 540

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 50/96 (52%), Positives = 63/96 (65%)
 Frame = +1

Query: 340 GGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGE 519
           GG +  REL +TPTWAVA             E  LH++   F R++K+A+ +AL KIK E
Sbjct: 3   GGRSGSRELPETPTWAVAVVCAVLVLVSAAMEHGLHNLSHWFRRRQKKAMGDALDKIKAE 62

Query: 520 LMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPA 627
           LM+LGFISLLLT  Q  I+KICIP +AAN +LPC A
Sbjct: 63  LMLLGFISLLLTVAQAPISKICIPKSAANILLPCKA 98



>sp|O22752|MLO7_ARATH MLO-like protein 7 (AtMlo7).
          Length = 542

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 50/96 (52%), Positives = 61/96 (63%)
 Frame = +1

Query: 334 AGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIK 513
           A G  +  +EL QTPTWAVA             EK L  + +   +K K +L EAL+KIK
Sbjct: 23  ATGAPSGGKELSQTPTWAVAVVCTFLILISHLLEKGLQRLANWLWKKHKNSLLEALEKIK 82

Query: 514 GELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
            ELM+LGFISLLLTFG+ YI KIC+P  AA +MLPC
Sbjct: 83  AELMILGFISLLLTFGEPYILKICVPRKAALSMLPC 118



>sp|Q9SXB6|MLO2_ARATH MLO-like protein 2 (AtMlo2).>pir|B86247|B86247
           hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890137 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AX063302_1458756 Sequence 11 from Patent
           WO0078799.>gb:AC007259_1535683 Arabidopsis thaliana
           chromosome I BAC T28P6 genomic sequence, complete
           sequence.>gb:AY086586_1571633 Arabidopsis thaliana clone
           259664 mRNA, complete sequence.>gb:AF369563_1791931
           Arabidopsis thaliana membrane protein Mlo2 mRNA,
           complete cds.
          Length = 573

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 46/91 (50%), Positives = 60/91 (65%)
 Frame = +1

Query: 355 ERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLG 534
           ER L++T TWAVA             E  +H +G+ F++K K+AL+EAL+K+K ELM+LG
Sbjct: 7   ERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKQALFEALEKVKAELMLLG 66

Query: 535 FISLLLTFGQNYIAKICIPATAANTMLPCPA 627
           FISLLLT GQ  I+ ICI    A+TM PC A
Sbjct: 67  FISLLLTIGQTPISNICISQKVASTMHPCSA 97



>pir|B84552|B84552 similar to Mlo proteins from H. vulgare
           [imported] - Arabidopsis thaliana>gb:AC002329_1530270
           Arabidopsis thaliana chromosome II section 100 of 255 of
           the complete sequence. Sequence from clones T23A1, F5J6,
           MJB20.
          Length = 580

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 54/126 (42%), Positives = 65/126 (51%), Gaps = 30/126 (23%)
 Frame = +1

Query: 334 AGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEK----------------------FLH 447
           A G  +  +EL QTPTWAVA             EK                      F H
Sbjct: 23  ATGAPSGGKELSQTPTWAVAVVCTFLILISHLLEKGLQRLANVCFLLLLLLFLRVFLFKH 82

Query: 448 SVGSTFE--------RKRKRALYEALQKIKGELMVLGFISLLLTFGQNYIAKICIPATAA 603
           S+  T+E        +K K +L EAL+KIK ELM+LGFISLLLTFG+ YI KIC+P  AA
Sbjct: 83  SLSETYEFVSSQWLWKKHKNSLLEALEKIKAELMILGFISLLLTFGEPYILKICVPRKAA 142

Query: 604 NTMLPC 621
            +MLPC
Sbjct: 143 LSMLPC 148



>pir|T02582|T02582 H. vulgare Mlo protein homolog [imported] -
           Arabidopsis thaliana
          Length = 570

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 45/89 (50%), Positives = 57/89 (64%)
 Frame = +1

Query: 355 ERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLG 534
           ER L++TPTWAVA             E FLH +G  F++K K+AL EAL+K+K ELM+LG
Sbjct: 5   ERSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALSEALEKVKAELMLLG 64

Query: 535 FISLLLTFGQNYIAKICIPATAANTMLPC 621
           FISLLL   Q  +++ICIP   A T  PC
Sbjct: 65  FISLLLVVLQTPVSEICIPRNIAATWHPC 93



>sp|O49873|MLH1_HORVU MLO protein homolog 1.>pir|T05952|T05952
           Mlo-h1 protein - barley>gb:HVMLOH1_1682457 H.vulgare
           Mlo-h1 gene.
          Length = 544

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 51/116 (43%), Positives = 63/116 (54%)
 Frame = +1

Query: 343 GGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGEL 522
           G A  REL  TPTWAVA             E  LH +G  F + RK+AL EAL+K+K EL
Sbjct: 3   GPAGGRELSDTPTWAVAVVCAVMILVSVAMEHALHKLGHWFHKWRKKALGEALEKMKAEL 62

Query: 523 MVLGFISLLLTFGQNYIAKICIPATAANTMLPCPAKYPIXXXXXXXXXXRRLLWYE 690
           M++GFISLLL   Q+ +++ICI   A   MLPC   Y            RRLLW +
Sbjct: 63  MLVGFISLLLIVTQDPVSRICISKEAGEKMLPC-KPYDGAGGGKGKDNHRRLLWLQ 117



>sp|O80961|ML12_ARATH MLO-like protein 12 (AtMlo12)
           (AtMlo18).>gb:AC004697_1532103 Arabidopsis thaliana
           chromosome 2 clone T16B24 map CIC10A06, complete
           sequence.>gb:AF369573_1791941 Arabidopsis thaliana
           membrane protein Mlo12 mRNA, complete cds.
          Length = 576

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 45/89 (50%), Positives = 57/89 (64%)
 Frame = +1

Query: 355 ERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLG 534
           ER L++TPTWAVA             E FLH +G  F++K K+AL EAL+K+K ELM+LG
Sbjct: 5   ERSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALSEALEKVKAELMLLG 64

Query: 535 FISLLLTFGQNYIAKICIPATAANTMLPC 621
           FISLLL   Q  +++ICIP   A T  PC
Sbjct: 65  FISLLLVVLQTPVSEICIPRNIAATWHPC 93



>gb:AP004191_1838788 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1524_D08.
          Length = 386

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 43/97 (44%), Positives = 56/97 (57%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           M  G G  E+ L  TPTW VA             E+ LH +G   +   + AL+ ALQ++
Sbjct: 1   MGAGEGGEEQSLALTPTWVVAGVCFIIVAISLAAERLLHRLGKVLKFNGQEALFSALQRV 60

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           K ELM+LGFIS LL+  Q +I  ICIP +AA+ MLPC
Sbjct: 61  KEELMLLGFISFLLSVFQKFINHICIPESAAHLMLPC 97



>gb:AY599871_1617164 Physcomitrella patens MLO1 (Mlo1) mRNA,
           complete cds.
          Length = 580

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 47/113 (41%), Positives = 59/113 (52%)
 Frame = +1

Query: 343 GGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGEL 522
           GG  E+ L+ TPTWAVA             E+ L  +G   ++K+++ L   L KIK EL
Sbjct: 3   GGEDEKSLEATPTWAVAAVCAVFVVASLVVERGLEHLGHQLKKKKRKQLLHTLGKIKDEL 62

Query: 523 MVLGFISLLLTFGQNYIAKICIPATAANTMLPCPAKYPIXXXXXXXXXXRRLL 681
           M+LGFISL LT  Q+ IA IC+P      MLPCP K             RRLL
Sbjct: 63  MLLGFISLSLTVFQSKIASICMPERLNKFMLPCPYKAGAVVDATAAAGHRRLL 115



>sp|P93766|MLO_HORVU MLO protein.>pir|T04481|T04481 Mlo protein -
           barley>gb:HVCH4H_1682307 Hordeum vulgare DNA for
           chromosome 4H.>gb:HVMLO_1682456 H.vulgare mRNA for Mlo
           protein.
          Length = 533

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 49/110 (44%), Positives = 64/110 (58%), Gaps = 9/110 (8%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           M+   G   REL +TP+WAVA             E  LH +G  F+ + K+AL+EAL+K+
Sbjct: 1   MSDKKGVPARELPETPSWAVAVVFAAMVLVSVLMEHGLHKLGHWFQHRHKKALWEALEKM 60

Query: 511 KGELMVLGFISLLLTFGQN-YIAKICIPATAANTMLPC--------PAKY 633
           K ELM++GFISLLL   Q+  IAKICI   AA+ M PC        P+KY
Sbjct: 61  KAELMLVGFISLLLIVTQDPIIAKICISEDAADVMWPCKRGTEGRKPSKY 110



>gb:AP003346_1828444 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0434C04.>gb:AP003431_1829240 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1099D03.
          Length = 502

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 41/86 (47%), Positives = 53/86 (61%)
 Frame = +1

Query: 364 LDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGFIS 543
           L+ TPTW VA             E+ LH +G T +RK ++AL+EAL K+K ELM+LGFIS
Sbjct: 10  LEFTPTWIVAAICSLIVLISLAAERCLHYLGKTLKRKNQKALFEALLKVKEELMLLGFIS 69

Query: 544 LLLTFGQNYIAKICIPATAANTMLPC 621
           LLLT  Q  + K C+P    N +LPC
Sbjct: 70  LLLTVSQGILQKTCVPPKWTNYLLPC 95



>gb:AX063304_1458757 Sequence 13 from Patent WO0078799.
          Length = 526

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 42/94 (44%), Positives = 54/94 (57%)
 Frame = +1

Query: 340 GGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGE 519
           G G     L+ TPTW VA             E+ LH  G+  ++K+++ LYEALQK+K E
Sbjct: 2   GHGGEGMSLEFTPTWVVAGVCTVIVAISLAVERLLHYFGTVLKKKKQKPLYEALQKVKEE 61

Query: 520 LMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           LM+LGFISLLLT  Q  I+K C+       MLPC
Sbjct: 62  LMLLGFISLLLTVFQGLISKFCVKENVLMHMLPC 95



>sp|O49621|MLO1_ARATH MLO-like protein 1 (AtMlo1) (MLO protein
           homolog 1) (AtMLO-H1).>pir|T01089|T01089 hypothetical
           protein T10P11.12 - Arabidopsis
           thaliana>gb:AC002330_1530284 Arabidopsis thaliana BAC
           T10P11 from chromosome IV, near 15 cM, complete
           sequence.>gb:ATCHRIV6_1546248 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 6.>gb:ATMLOH1_1553735
           A.thaliana AtMlo-h1 gene.>gb:AY072135_1567029
           Arabidopsis thaliana putative AtMlo-h1 protein
           (At4g02600) mRNA, complete cds.>gb:AY113992_1578403
           Arabidopsis thaliana putative AtMlo-h1 protein
           (At4g02600) mRNA, complete cds.
          Length = 526

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 42/94 (44%), Positives = 54/94 (57%)
 Frame = +1

Query: 340 GGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGE 519
           G G     L+ TPTW VA             E+ LH  G+  ++K+++ LYEALQK+K E
Sbjct: 2   GHGGEGMSLEFTPTWVVAGVCTVIVAISLAVERLLHYFGTVLKKKKQKPLYEALQKVKEE 61

Query: 520 LMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           LM+LGFISLLLT  Q  I+K C+       MLPC
Sbjct: 62  LMLLGFISLLLTVFQGLISKFCVKENVLMHMLPC 95



>gb:AF384145_1794191 Triticum aestivum MLo1 protein mRNA, complete
           cds.
          Length = 534

 Score = 82.4 bits (202), Expect = 7e-15
 Identities = 43/88 (48%), Positives = 54/88 (61%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TP+WAVA             E  LH +G  F ++ K AL EAL+KIK ELM++GF
Sbjct: 11  RTLPETPSWAVALVFAVMIIVSVLLEHALHKLGHWFHKRHKNALAEALEKIKAELMLVGF 70

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPC 621
           ISLLL   Q+ I+ ICIP  AA+ M PC
Sbjct: 71  ISLLLAVTQDPISGICIPEKAASIMRPC 98



>sp|O80580|ML15_ARATH MLO-like protein 15
           (AtMlo15).>pir|T00691|T00691 H. vulgare Mlo protein
           homolog At2g44110 [imported] - Arabidopsis
           thaliana>gb:AC004005_1531322 Arabidopsis thaliana
           chromosome 2 clone F6E13 map CIC10F02, CIC02E07,
           complete sequence.>gb:AF369576_1791944 Arabidopsis
           thaliana membrane protein Mlo15 mRNA, complete cds.
          Length = 496

 Score = 82.4 bits (202), Expect = 7e-15
 Identities = 44/97 (45%), Positives = 56/97 (57%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MAGGG      L+ TPTW VA             E+ +H  G  F+   ++ L+ ALQKI
Sbjct: 1   MAGGGTT----LEYTPTWVVALVCSVIVSISFAVERLIHRAGKHFKNNDQKQLFGALQKI 56

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           K ELM++GFISLLL+ GQ+ IAKICI    +   LPC
Sbjct: 57  KEELMLVGFISLLLSVGQSKIAKICISKELSEKFLPC 93



>sp|Q94KB2|ML13_ARATH MLO-like protein 13 (AtMlo13)
           (AtMlo20).>gb:AF369574_1791942 Arabidopsis thaliana
           membrane protein Mlo13 mRNA, complete cds.
          Length = 478

 Score = 82.4 bits (202), Expect = 7e-15
 Identities = 41/91 (45%), Positives = 53/91 (58%)
 Frame = +1

Query: 349 ASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMV 528
           A    L+ TPTW VA             E+ LH +G   +R+++ AL+EALQK+K ELM+
Sbjct: 4   ARSGSLEYTPTWVVAFICFIIVLLSLLAERGLHHLGKCLKRRQQDALFEALQKLKEELML 63

Query: 529 LGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           LGFISL+LT  Q  I  IC+P    N M PC
Sbjct: 64  LGFISLMLTVSQAAIRHICVPPALVNNMFPC 94



>gb:AY029318_1559227 Zea mays seven transmembrane protein Mlo7 mRNA,
           complete cds.
          Length = 499

 Score = 82.0 bits (201), Expect = 9e-15
 Identities = 40/89 (44%), Positives = 54/89 (60%)
 Frame = +1

Query: 355 ERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLG 534
           E  L  TPTW VA             E+ LH +G   E K+++AL+ ALQ++K ELM+LG
Sbjct: 4   EATLAFTPTWVVAIVCLVIVSISLAAERSLHYLGKYLECKKQKALFSALQRLKEELMLLG 63

Query: 535 FISLLLTFGQNYIAKICIPATAANTMLPC 621
           FIS +L+  Q +I  ICIP T+ + MLPC
Sbjct: 64  FISFVLSLSQGFIVSICIPETSTDFMLPC 92



>gb:AY581255_1616062 Hordeum vulgare subsp. vulgare Mlo3 (Mlo3)
           mRNA, complete cds.
          Length = 491

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 44/97 (45%), Positives = 56/97 (57%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MAGGGG + + L+ TPTW VA             E+ LH +G    R RK+ LYEAL K+
Sbjct: 1   MAGGGGKA-KPLEFTPTWIVALVCSVMVIISLLFERLLHRLGKRLIRSRKKPLYEALLKV 59

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           K ELM+LGFISLLLT  Q  + K+C+       + PC
Sbjct: 60  KEELMLLGFISLLLTVFQGPMGKVCVSPITMLHLQPC 96



>gb:AF361932_1791455 Triticum aestivum seven transmembrane-spanning
           protein (Mlo2) mRNA, complete cds.
          Length = 534

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 42/88 (47%), Positives = 53/88 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TP+WAVA             E  LH +G  F ++ K AL EAL+KIK ELM++GF
Sbjct: 11  RTLPETPSWAVALVFAVMIIVSVLLEHALHKLGHWFHKRHKNALAEALEKIKAELMLVGF 70

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPC 621
           ISLLL   Q+ I+ ICI   AA+ M PC
Sbjct: 71  ISLLLAVTQDPISGICISEKAASIMRPC 98



>gb:AY584534_1616298 Triticum aestivum Mlo protein (Mlo) mRNA,
           partial cds.
          Length = 413

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 42/88 (47%), Positives = 53/88 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TP+WAVA             E  LH +G  F ++ K AL EAL+KIK ELM++GF
Sbjct: 11  RTLPETPSWAVALVFAVMIIVSVLLEHALHKLGHWFHKRHKNALAEALEKIKAELMLVGF 70

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPC 621
           ISLLL   Q+ I+ ICI   AA+ M PC
Sbjct: 71  ISLLLAVTQDPISGICISEKAASIMRPC 98



>gb:AY029319_1559228 Zea mays seven transmembrane protein Mlo8 mRNA,
           complete cds.
          Length = 492

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 45/97 (46%), Positives = 55/97 (56%)
 Frame = +1

Query: 331 MAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKI 510
           MA  G A+  E   TPTW VA             E+ LH +G T +RK ++ L+EAL K+
Sbjct: 1   MAAEGEAAALEF--TPTWIVAAVCSLIVLLSLVAERCLHYLGKTLKRKNQKPLFEALLKV 58

Query: 511 KGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           K ELM+LGFISLLLT  Q  I + CIP      MLPC
Sbjct: 59  KEELMLLGFISLLLTVFQGMIRRTCIPERWTFHMLPC 95



>gb:AX063296_1458753 Sequence 5 from Patent WO0078799.
          Length = 534

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 42/88 (47%), Positives = 53/88 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TP+WAVA             E  LH +G  F ++ K AL EAL+KIK ELM++GF
Sbjct: 11  RTLPETPSWAVALVFAVMIIVSVLLEHALHKLGHWFHKRHKNALAEALEKIKAELMLVGF 70

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPC 621
           ISLLL   Q+ I+ ICI   AA+ M PC
Sbjct: 71  ISLLLAVTQDPISGICISEKAASIMRPC 98



>gb:AX063294_1458752 Sequence 3 from Patent WO0078799.
          Length = 534

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 42/88 (47%), Positives = 53/88 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TP+WAVA             E  LH +G  F ++ K AL EAL+KIK ELM++GF
Sbjct: 11  RTLPETPSWAVALVFAVMIIVSVLLEHALHKLGHWFHKRHKNALAEALEKIKAELMLVGF 70

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPC 621
           ISLLL   Q+ I+ ICI   AA+ M PC
Sbjct: 71  ISLLLAVTQDPISGICISEKAASIMRPC 98



>gb:AF384144_1794190 Triticum aestivum MLo protein mRNA, complete
           cds.
          Length = 534

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 41/88 (46%), Positives = 53/88 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TP+WAVA             E  LH +G  F ++ K AL EAL+K+K ELM++GF
Sbjct: 11  RTLPETPSWAVALVFAVMIIVSVLLEHALHKLGHWFHKRHKNALAEALEKMKAELMLVGF 70

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPC 621
           ISLLL   Q+ I+ ICI   AA+ M PC
Sbjct: 71  ISLLLAVTQDPISGICISQKAASIMRPC 98



>gb:AX063298_1458754 Sequence 7 from Patent WO0078799.
          Length = 534

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 41/88 (46%), Positives = 53/88 (60%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TP+WAVA             E  LH +G  F ++ K AL EAL+K+K ELM++GF
Sbjct: 11  RTLPETPSWAVALVFAVMIIVSVLLEHALHKLGHWFHKRHKNALAEALEKMKAELMLVGF 70

Query: 538 ISLLLTFGQNYIAKICIPATAANTMLPC 621
           ISLLL   Q+ I+ ICI   AA+ M PC
Sbjct: 71  ISLLLAVTQDPISGICISQKAASIMRPC 98



>gb:AY029314_1559223 Zea mays seven transmembrane protein Mlo3 mRNA,
           complete cds.
          Length = 496

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 41/91 (45%), Positives = 52/91 (57%)
 Frame = +1

Query: 349 ASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMV 528
           + E  L+ TPTW VA             E+ LH +G   ER+RK  LYEAL K+K ELM+
Sbjct: 2   SEEATLEDTPTWIVASVCSVIVLISFVFERALHHLGKALERRRK-TLYEALLKLKEELML 60

Query: 529 LGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           LGF+SLLL   Q+ I KICI  +     +PC
Sbjct: 61  LGFVSLLLVVSQDLIQKICIDDSLMEHWMPC 91



>pir|T47469|T47469 hypothetical protein F18N11.50 - Arabidopsis
           thaliana>gb:ATF18N11_1549181 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F18N11.
          Length = 485

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 40/103 (38%), Positives = 61/103 (59%)
 Frame = +1

Query: 313 EKEQFKMAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALY 492
           +KE+   +   GA  R L +TPTWA+A             E+ ++ + +  ++ RK +L 
Sbjct: 3   DKEESNHSSEVGAV-RSLQETPTWALATVCFFFIAVSICLERLINLLSTRLKKNRKTSLL 61

Query: 493 EALQKIKGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           EA++K+K  LMVLGF+SL+L   +  ++KICIP   AN MLPC
Sbjct: 62  EAVEKLKSVLMVLGFMSLMLNVTEGEVSKICIPIKYANRMLPC 104



>sp|Q94KB9|MLO3_ARATH MLO-like protein 3
           (AtMlo3).>gb:AF369564_1791932 Arabidopsis thaliana
           membrane protein Mlo3 mRNA, complete cds.
          Length = 508

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 40/103 (38%), Positives = 61/103 (59%)
 Frame = +1

Query: 313 EKEQFKMAGGGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALY 492
           +KE+   +   GA  R L +TPTWA+A             E+ ++ + +  ++ RK +L 
Sbjct: 3   DKEESNHSSEVGAV-RSLQETPTWALATVCFFFIAVSICLERLINLLSTRLKKNRKTSLL 61

Query: 493 EALQKIKGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           EA++K+K  LMVLGF+SL+L   +  ++KICIP   AN MLPC
Sbjct: 62  EAVEKLKSVLMVLGFMSLMLNVTEGEVSKICIPIKYANRMLPC 104



>gb:OSJN00235_1697144 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0027P08, complete
           sequence.>gb:OSJN00249_1697367 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0058G03, complete
           sequence.
          Length = 476

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 40/86 (46%), Positives = 49/86 (56%)
 Frame = +1

Query: 364 LDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGFIS 543
           ++ TPTW VA             E+ LH +G   ER+R R LYEAL K+K ELM+LGFIS
Sbjct: 9   IEDTPTWIVAAVCSAIVLISFAFERSLHYLGKALERRR-RTLYEALLKLKEELMLLGFIS 67

Query: 544 LLLTFGQNYIAKICIPATAANTMLPC 621
           LLL   Q  I +ICI  +     LPC
Sbjct: 68  LLLVVFQEPIQRICIAESLMGHWLPC 93



>pir|T03797|T03797 probable mlo protein - rice
          Length = 537

 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 42/96 (43%), Positives = 52/96 (54%)
 Frame = +1

Query: 340 GGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGE 519
           GG +  REL +TPTWAVA             E  LH++     +     L   +     E
Sbjct: 3   GGRSGSRELPETPTWAVAVVCAVLVLVSAAMEHGLHNLS---HKTTAEVLIFLVLSALAE 59

Query: 520 LMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPA 627
           LM+LGFISLLLT  Q  I+KICIP +AAN +LPC A
Sbjct: 60  LMLLGFISLLLTVAQAPISKICIPKSAANILLPCKA 95



>pir|T09888|T09888 hypothetical protein T22A6.80 - Arabidopsis
           thaliana>gb:ATCHRIV61_1546308 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 61.>gb:ATT22A6_1555174
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22A6
           (ESSA project).
          Length = 429

 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 37/81 (45%), Positives = 49/81 (60%)
 Frame = +1

Query: 349 ASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMV 528
           A    L+ TPTW VA             E+ LH +G   +R+++ AL+EALQK+K ELM+
Sbjct: 4   ARSGSLEYTPTWVVAFICFIIVLLSLLAERGLHHLGKCLKRRQQDALFEALQKLKEELML 63

Query: 529 LGFISLLLTFGQNYIAKICIP 591
           LGFISL+LT  Q  I  IC+P
Sbjct: 64  LGFISLMLTVSQAAIRHICVP 84



>pir|H86393|H86393 protein T24P13.8 [imported] - Arabidopsis
           thaliana>gb:AE005172_891544 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006535_1534410 Genomic sequence for
           Arabidopsis thaliana BAC T24P13 from chromosome I,
           complete sequence.
          Length = 507

 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +1

Query: 352 SERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVL 531
           SER L  TPTW+VA             E+ +H + +  ++ +++ L+ AL+K+K ELM+L
Sbjct: 8   SERTLGLTPTWSVATVLTIFVFVSLIVERSIHRLSNWLQKTKRKPLFAALEKMKEELMLL 67

Query: 532 GFISLLLTFGQNYIAKICIPATAAN-TMLPC 621
           GFISLLLT   + IA IC+ ++  N   +PC
Sbjct: 68  GFISLLLTATSSTIANICVSSSFHNDRFVPC 98



>sp|Q94KB1|ML14_ARATH MLO-like protein 14
           (AtMlo14).>gb:AF369575_1791943 Arabidopsis thaliana
           membrane protein Mlo14 mRNA, complete cds.
          Length = 554

 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +1

Query: 352 SERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVL 531
           SER L  TPTW+VA             E+ +H + +  ++ +++ L+ AL+K+K ELM+L
Sbjct: 8   SERTLGLTPTWSVATVLTIFVFVSLIVERSIHRLSNWLQKTKRKPLFAALEKMKEELMLL 67

Query: 532 GFISLLLTFGQNYIAKICIPATAAN-TMLPC 621
           GFISLLLT   + IA IC+ ++  N   +PC
Sbjct: 68  GFISLLLTATSSTIANICVSSSFHNDRFVPC 98



>sp|Q9FI00|ML11_ARATH MLO-like protein 11
           (AtMlo11).>gb:AB017066_1513391 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MGN6.>gb:AY057502_1563921 Arabidopsis thaliana
           AT5g53760/MGN6_12 mRNA, complete
           cds.>gb:BT000434_1634712 Arabidopsis thaliana putative
           protein (At5g53760) mRNA, complete
           cds.>gb:BT002581_1636184 Arabidopsis thaliana putative
           protein (At5g53760) mRNA, complete
           cds.>gb:AF369572_1791940 Arabidopsis thaliana membrane
           protein Mlo11 mRNA, complete cds.
          Length = 573

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 56/92 (60%), Gaps = 1/92 (1%)
 Frame = +1

Query: 349 ASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMV 528
           ++ER L  +PTW+VA             E+ ++ + +   + +++ ++ AL+K+K ELM+
Sbjct: 13  SNERSLALSPTWSVAIVLTVFVVVSLIVERSIYRLSTWLRKTKRKPMFAALEKMKEELML 72

Query: 529 LGFISLLLTFGQNYIAKICIPATAAN-TMLPC 621
           LGFISLLLT   + IA IC+P++  N   LPC
Sbjct: 73  LGFISLLLTATSSTIANICVPSSFYNDRFLPC 104



>gb:AP003518_1830291 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0008F02.>gb:AP004012_1836362 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1568_D07.
          Length = 536

 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 43/98 (43%), Positives = 51/98 (52%), Gaps = 2/98 (2%)
 Frame = +1

Query: 340 GGGASERELDQTPTWAVAXXXXXXXXXXXXXEKFLHSV--GSTFERKRKRALYEALQKIK 513
           GG +  REL +TPTWAVA             E  LH++  GS   R+R  A      K  
Sbjct: 3   GGRSGSRELPETPTWAVAVVCAVLVLVSVAMEHGLHNLSHGSVGGRRRPWATPSTRSK-- 60

Query: 514 GELMVLGFISLLLTFGQNYIAKICIPATAANTMLPCPA 627
                 GFISLLLT  Q  I+KICIP +AAN +LPC A
Sbjct: 61  -----QGFISLLLTVAQAPISKICIPKSAANILLPCKA 93



>gb:OSJN00017_1693352 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0017I01, complete sequence.
          Length = 608

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 8/105 (7%)
 Frame = +1

Query: 331 MAGG--GGASE-----RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRAL 489
           MAGG  GGA+      R L  TPTW+VA             E+ +H +    ++  +  L
Sbjct: 1   MAGGEGGGAAAVPEEGRSLALTPTWSVAIVLTLLVAGSLLIERSIHRLSYWLKKTHRNPL 60

Query: 490 YEALQKIKGELMVLGFISLLLTFGQNYIAKICIPATAANT-MLPC 621
           ++A++K+K E+M+LGFISLLL      I+ ICI +   N+   PC
Sbjct: 61  HKAMEKMKEEMMLLGFISLLLAATSRIISGICIDSKYYNSNFSPC 105



>gb:AY029315_1559224 Zea mays seven transmembrane protein Mlo4 mRNA,
           complete cds.
          Length = 509

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 29/80 (36%), Positives = 47/80 (58%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TPTW+VA             E+ L        + +++A+  AL+KI+ ELM+LG 
Sbjct: 7   RSLAETPTWSVATVTTLMVAACFLVERSLSRFAKWLRKTKRKAMLAALEKIREELMLLGV 66

Query: 538 ISLLLTFGQNYIAKICIPAT 597
           ISLLL+    +I++IC+P++
Sbjct: 67  ISLLLSQTARFISEICVPSS 86



>gb:BT010322_1640269 Arabidopsis thaliana At1g11000 mRNA, complete
           cds.
          Length = 573

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 29/84 (34%), Positives = 52/84 (61%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TPT++VA             E+ ++  G   ++ R++AL+ +L+K+K ELM+LG 
Sbjct: 9   RSLAETPTYSVASVVTVLVFVCFLVERAIYRFGKWLKKTRRKALFTSLEKMKEELMLLGL 68

Query: 538 ISLLLTFGQNYIAKICIPATAANT 609
           ISLLL+    +I++IC+ ++  N+
Sbjct: 69  ISLLLSQSARWISEICVNSSLFNS 92



>gb:AX063308_1458759 Sequence 17 from Patent WO0078799.
          Length = 542

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 29/84 (34%), Positives = 52/84 (61%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TPT++VA             E+ ++  G   ++ R++AL+ +L+K+K ELM+LG 
Sbjct: 9   RSLAETPTYSVASVVTVLVFVCFLVERAIYRFGKWLKKTRRKALFTSLEKMKEELMLLGL 68

Query: 538 ISLLLTFGQNYIAKICIPATAANT 609
           ISLLL+    +I++IC+ ++  N+
Sbjct: 69  ISLLLSQSARWISEICVNSSLFNS 92



>sp|O23693|MLO4_ARATH MLO-like protein 4
           (AtMlo4).>gb:AF369565_1791933 Arabidopsis thaliana
           membrane protein Mlo4 mRNA, complete cds.
          Length = 573

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 29/84 (34%), Positives = 52/84 (61%)
 Frame = +1

Query: 358 RELDQTPTWAVAXXXXXXXXXXXXXEKFLHSVGSTFERKRKRALYEALQKIKGELMVLGF 537
           R L +TPT++VA             E+ ++  G   ++ R++AL+ +L+K+K ELM+LG 
Sbjct: 9   RSLAETPTYSVASVVTVLVFVCFLVERAIYRFGKWLKKTRRKALFTSLEKMKEELMLLGL 68

Query: 538 ISLLLTFGQNYIAKICIPATAANT 609
           ISLLL+    +I++IC+ ++  N+
Sbjct: 69  ISLLLSQSARWISEICVNSSLFNS 92



>gb:AP003616_1831464 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0490F09.
          Length = 503

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 24/52 (46%), Positives = 37/52 (71%)
 Frame = +1

Query: 466 ERKRKRALYEALQKIKGELMVLGFISLLLTFGQNYIAKICIPATAANTMLPC 621
           + K ++ALY AL+++K ELM+LGFIS +L+  + +I  IC+   A + MLPC
Sbjct: 42  KHKDQKALYSALERLKEELMLLGFISFVLSLSEGFIVGICVSENAMHLMLPC 93



>gb:AB020749_1514658 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MRC8.>gb:AY056224_1563546 Arabidopsis thaliana
           unknown protein (At3g18215) mRNA, complete
           cds.>gb:AY091383_1574586 Arabidopsis thaliana unknown
           protein (At3g18215) mRNA, complete cds.
          Length = 244

 Score = 33.9 bits (76), Expect = 3.0
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +2

Query: 461 PLRENEREHCMKLCRRLRVSSWFWDLFPSS*HLVRITLLRFAFLQLLPTLCCHALLSILY 640
           P+   +REHC  + R L  +S+FW L   + +     L  + F  +   +CC  + SILY
Sbjct: 151 PVSRGKREHCEYVSRNLNRASYFWSLGLRAFYF-SFPLFLWTFGPIPMFVCCCMMSSILY 209



>gb:AY090639_1574179 Hordeum brevisubulatum MLO protein (Mlo) gene,
           partial cds.>gb:AY090643_1574183 Hordeum chilense MLO
           protein (Mlo) gene, partial cds.>gb:AY090645_1574185
           Hordeum murinum subsp. murinum MLO protein (Mlo) gene,
           partial cds.
          Length = 77

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 22/42 (52%), Positives = 24/42 (57%), Gaps = 9/42 (21%)
 Frame = +1

Query: 535 FISLLLTFGQN-YIAKICIPATAANTMLPC--------PAKY 633
           FISLLL   Q+  IAKICI   AAN M PC        P+KY
Sbjct: 1   FISLLLIVTQDPIIAKICISEKAANLMWPCKRSTEGLKPSKY 42



>gb:CP000013_869877 Borrelia garinii PBi, complete genome.
          Length = 327

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)
 Frame = +1

Query: 184 SALLAAPKVFDYFPKVQHRTVSYPWGRWCSYPI--GLSNFRIRE*EKEQFK 330
           SA+L +P +F Y  +     V YPWGR  +Y I  G + F  +E ++++ K
Sbjct: 170 SAVLISPNIFPYDKRTN--IVYYPWGRQIAYLITGGYNKFETKEDKRKEHK 218


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 775,795,193
Number of Sequences: 1806583
Number of extensions: 16349496
Number of successful extensions: 34706
Number of sequences better than 10.0: 62
Number of HSP's better than 10.0 without gapping: 33767
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34681
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 42145286112
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)