BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6571
         (647 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|O22493|GSH1_LYCES|GSH1_LYCES Glutamate--cysteine ligase, chloroplast pre...   193   2e-48   Solanum lycopersicum
gb:AB158510_1528406 Zinnia elegans ZeGSH1 mRNA for gamma-glutamy...   152   6e-36   
gb:AF428393_1799323 Arabidopsis thaliana AT4g23100/F7H19_290 mRN...   148   9e-35   
gb:CHATGSH1_1646511 A.thaliana Chloroplast gsh1 mRNA for glutama...   148   9e-35   
gb:AY056372_1563680 Arabidopsis thaliana AT4g23100/F7H19_290 mRN...   148   9e-35   
sp|P46309|GSH1_ARATH|GSH1_ARATH Glutamate--cysteine ligase, chloroplast pre...   148   9e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AF128454_1770608 Phaseolus vulgaris gamma-glutamylcysteine sy...   146   3e-34   
gb:AY186541_1588087 Lotus corniculatus var. japonicus gamma-glut...   146   3e-34   
gb:ATGGS_1551857 A.thaliana mRNA for putative gamma-glutamylcyst...   145   4e-34   
gb:AF128455_1770609 Pisum sativum gamma-glutamylcysteine synthet...   144   1e-33   
sp|Q9ZNX6|GSH1_MEDTR|GSH1_MEDTR Glutamate--cysteine ligase, chloroplast pre...   143   2e-33   Medicago truncatula
gb:AF128453_1770607 Glycine max gamma-glutamylcysteine synthetas...   143   3e-33   
sp|O23736|GSH1_BRAJU|GSH1_BRAJU Glutamate--cysteine ligase, chloroplast pre...   139   3e-32   Brassica juncea [brown mustard]
gb:BJU563922_1633058 Brassica juncea mRNA for glutamate-cysteine...   136   3e-31   
gb:BJU563923_1633059 Brassica juncea mRNA for glutamate-cysteine...   134   1e-30   
gb:AP005256_1849686 Oryza sativa (japonica cultivar-group) genom...   129   4e-29   
gb:AF401621_1796145 Allium cepa gamma-glutamylcysteine synthetas...   128   7e-29   
gb:AC130598_1740713 Oryza sativa (japonica cultivar-group) chrom...   127   1e-28   
gb:OSA508916_1692648 Oryza sativa (japonica cultivar-group) mRNA...   127   1e-28   
gb:ZMA302783_1731507 Zea mays mRNA for putative gamma-glutamylcy...   108   8e-23   
gb:OSA508915_1692647 Oryza sativa (japonica cultivar-group) gcs ...   108   1e-22   
gb:BJU5587_1633055 Brassica juncea mRNA for gamma-glutamylcystei...   106   4e-22   
gb:CP000031_87618 Silicibacter pomeroyi DSS-3, complete genome.        65   1e-09   
gb:SME591784_184788 Sinorhizobium meliloti 1021 complete chromos...    60   2e-08   
gb:AE014292_310323 Brucella suis 1330 chromosome II, complete se...    56   6e-07   
pir|D87672|D87672 glutamate-cysteine ligase [imported] - Cauloba...    56   6e-07   Caulobacter vibrioides
pir|AG3575|AG3575 glutamate-cysteine ligase (EC 6.3.2.2) [import...    56   6e-07   Brucella melitensis
gb:AE012555_284074 Xylella fastidiosa Temecula1, section 3 of 9 ...    55   1e-06   
gb:AE012458_282622 Xanthomonas campestris pv. campestris str. AT...    54   3e-06   
pir|C82682|C82682 glutamate-cysteine ligase precursor XF1428 [im...    54   3e-06   Xylella fastidiosa
gb:BX897699_827026 Bartonella henselae strain Houston-1, complet...    52   9e-06   
gb:BA000012_671388 Mesorhizobium loti MAFF303099 DNA, complete g...    52   9e-06   
gb:AE013598_297578 Xanthomonas oryzae pv. oryzae KACC10331, comp...    52   9e-06   
gb:BX897700_828540 Bartonella quintana str. Toulouse, complete g...    52   1e-05   
gb:AE011703_275688 Xanthomonas axonopodis pv. citri str. 306, se...    52   1e-05   
pir|AB2657|AB2657 glutamate-cysteine ligase gsh1 [imported] - Ag...    51   2e-05   Agrobacterium fabrum str. C58
gb:CP000009_863957 Gluconobacter oxydans 621H, complete genome.        47   3e-04   
gb:AE013598_297575 Xanthomonas oryzae pv. oryzae KACC10331, comp...    45   0.001   
gb:AE008692_241294 Zymomonas mobilis subsp. mobilis ZM4, complet...    42   0.009   
gb:BA000040_729424 Bradyrhizobium japonicum USDA 110 DNA, comple...    40   0.026   
gb:BX572595_800438 Rhodopseudomonas palustris CGA009 complete ge...    37   0.29    
gb:AY659332_2148342 Synthetic construct Peudomonas aeruginosa cl...    33   3.2     
pir|C83278|C83278 probable acyl-CoA thiolase PA2940 [imported] -...    33   3.2     Pseudomonas aeruginosa


>sp|O22493|GSH1_LYCES Glutamate--cysteine ligase, chloroplast
           precursor (EC 6.3.2.2) (Gamma- glutamylcysteine
           synthetase) (Gamma-ECS) (GCS).>pir|T04332|T04332
           glutamate-cysteine ligase (EC 6.3.2.2) -
           tomato>gb:AF017983_1761562 Lycopersicon esculentum
           gamma-glutamylcysteine synthetase (GSH1) mRNA, complete
           cds.
          Length = 523

 Score =  193 bits (491), Expect = 2e-48
 Identities = 100/147 (68%), Positives = 116/147 (78%), Gaps = 3/147 (2%)
 Frame = +2

Query: 215 MALMSMAGSSLHC---EMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRS 385
           MALMS AGSS HC   E +RC +G  +  NN++ +RM+E+ FG++ SS N+S+ VQG   
Sbjct: 1   MALMSQAGSS-HCIYSEKVRCISGHRSIINNMDMFRMREICFGVDISSRNASRRVQGNYL 59

Query: 386 NCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFG 565
           N IG G RR    IVAASPPTEDAVV+ EPLTK+DL+ YL SGCK KEKWRIGTEHEKFG
Sbjct: 60  NHIGVGSRRGDLTIVAASPPTEDAVVAAEPLTKEDLVGYLASGCKSKEKWRIGTEHEKFG 119

Query: 566 FEFGTLRPMKYAQIAELLNGIAERFDW 646
           FEFGTLRPMKY QIA+LLNGIAERFDW
Sbjct: 120 FEFGTLRPMKYDQIADLLNGIAERFDW 146



>gb:AB158510_1528406 Zinnia elegans ZeGSH1 mRNA for
           gamma-glutamylcysteine synthetase, complete cds.
          Length = 523

 Score =  152 bits (383), Expect = 6e-36
 Identities = 78/151 (51%), Positives = 105/151 (69%), Gaps = 7/151 (4%)
 Frame = +2

Query: 215 MALMSMAGSS--LHCEMIRCEAGCT---NSGNNLEAYRMK--EMSFGLNFSSWNSSQAVQ 373
           M LMS A  S  +H E+++ ++G +   N  +N  A+R +  +++F  N+  +      Q
Sbjct: 1   MVLMSQASPSHGIHAEILQSKSGYSSLLNGASNTNAFRHQTSKVAFSRNYLKYT-----Q 55

Query: 374 GLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEH 553
            +  + +G  ++R + +IVAASPPTEDAVV+TEPLTK+DL+ YL SGCKPKE WRIGTEH
Sbjct: 56  AMHVDAVGGNFKRGNKVIVAASPPTEDAVVATEPLTKEDLVGYLASGCKPKENWRIGTEH 115

Query: 554 EKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           EKFGF+  TLRPM Y QIA LLN I+ERFDW
Sbjct: 116 EKFGFDLKTLRPMTYEQIAHLLNAISERFDW 146



>gb:AF428393_1799323 Arabidopsis thaliana AT4g23100/F7H19_290 mRNA,
           complete cds.
          Length = 522

 Score =  148 bits (373), Expect = 9e-35
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 6/150 (4%)
 Frame = +2

Query: 215 MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG 376
           MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct: 1   MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS 56

Query: 377 LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE 556
           +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct: 57  MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE 115

Query: 557 KFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct: 116 KFGFEVNTLRPMKYDQIAELLNGIAERFEW 145



>gb:CHATGSH1_1646511 A.thaliana Chloroplast gsh1 mRNA for
           glutamate-cysteine ligase.
          Length = 533

 Score =  148 bits (373), Expect = 9e-35
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 6/150 (4%)
 Frame = +2

Query: 215 MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG 376
           MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct: 1   MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS 56

Query: 377 LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE 556
           +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct: 57  MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE 115

Query: 557 KFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct: 116 KFGFEVNTLRPMKYDQIAELLNGIAERFEW 145



>gb:AY056372_1563680 Arabidopsis thaliana AT4g23100/F7H19_290 mRNA,
           complete cds.
          Length = 522

 Score =  148 bits (373), Expect = 9e-35
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 6/150 (4%)
 Frame = +2

Query: 215 MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG 376
           MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct: 1   MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS 56

Query: 377 LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE 556
           +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct: 57  MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE 115

Query: 557 KFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct: 116 KFGFEVNTLRPMKYDQIAELLNGIAERFEW 145



>sp|P46309|GSH1_ARATH Glutamate--cysteine ligase, chloroplast
           precursor (EC 6.3.2.2) (Gamma- glutamylcysteine
           synthetase) (Gamma-ECS) (GCS).>pir|T05142|T05142
           glutamate-cysteine ligase (EC 6.3.2.2) precursor,
           chloroplast - Arabidopsis thaliana>gb:ATCHRIV58_1546147
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 58.>gb:ATF7H19_1550953 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F7H19 (ESSA
           project).>gb:AY143970_1583427 Arabidopsis thaliana
           At4g23100/F7H19_290 mRNA, complete
           cds.>gb:AF068299_1765638 Arabidopsis thaliana
           gamma-glutamylcysteine synthetase gene, complete
           cds.>gb:AF419576_1798438 Arabidopsis thaliana
           AT4g23100/F7H19_290 mRNA, complete cds.
          Length = 522

 Score =  148 bits (373), Expect = 9e-35
 Identities = 84/150 (56%), Positives = 104/150 (69%), Gaps = 6/150 (4%)
 Frame = +2

Query: 215 MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG 376
           MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS++ S + + 
Sbjct: 1   MALLSQAGGSYTVVPSGVCSKAGTKAVVSGGVRNLDVLRMKE-AFG---SSYSRSLSTKS 56

Query: 377 LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE 556
           +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct: 57  MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE 115

Query: 557 KFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct: 116 KFGFEVNTLRPMKYDQIAELLNGIAERFEW 145



>gb:AF128454_1770608 Phaseolus vulgaris gamma-glutamylcysteine
           synthetase precursor (gsh1) mRNA, complete cds.
          Length = 508

 Score =  146 bits (368), Expect = 3e-34
 Identities = 70/101 (69%), Positives = 83/101 (82%)
 Frame = +2

Query: 344 SSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKP 523
           S+W+S++ +   +      G      +IVAASPPTEDAVV+T+PLTK+DL+DYL SGCKP
Sbjct: 36  SNWDSAKKLSPTQRIVTRGGR-----VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKP 90

Query: 524 KEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           +EKWRIGTEHEKFGFEFG+LRPMKY QIAELLNGIAERFDW
Sbjct: 91  REKWRIGTEHEKFGFEFGSLRPMKYEQIAELLNGIAERFDW 131



>gb:AY186541_1588087 Lotus corniculatus var. japonicus
           gamma-glutamylcysteine synthetase gene, complete
           cds.>gb:AY204516_1589101 Lotus corniculatus var.
           japonicus gamma-glutamylcysteine synthetase mRNA,
           complete cds.
          Length = 495

 Score =  146 bits (368), Expect = 3e-34
 Identities = 68/80 (85%), Positives = 73/80 (91%)
 Frame = +2

Query: 407 RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR 586
           RR   LIVAASPPTEDAVV+TEPLTK+DL+DYL SGCKPK+ WRIGTEHEKFGFE G+LR
Sbjct: 39  RRGRRLIVAASPPTEDAVVATEPLTKQDLVDYLASGCKPKQNWRIGTEHEKFGFELGSLR 98

Query: 587 PMKYAQIAELLNGIAERFDW 646
           PMKY QIAELLNGIAERFDW
Sbjct: 99  PMKYEQIAELLNGIAERFDW 118



>gb:ATGGS_1551857 A.thaliana mRNA for putative
           gamma-glutamylcysteine synthetase.
          Length = 522

 Score =  145 bits (367), Expect = 4e-34
 Identities = 84/150 (56%), Positives = 103/150 (68%), Gaps = 6/150 (4%)
 Frame = +2

Query: 215 MALMSMAGSSLH------CEMIRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQG 376
           MAL+S AG S        C     +A  +    NL+  RMKE +FG   SS + S + + 
Sbjct: 1   MALLSQAGGSYTVVPSGVCSKTGTKAVVSGGVRNLDVLRMKE-AFG---SSNSRSLSTKS 56

Query: 377 LRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHE 556
           +  + +    +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+K+RIGTEHE
Sbjct: 57  MLLHSVKRS-KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKTKDKYRIGTEHE 115

Query: 557 KFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           KFGFE  TLRPMKY QIAELLNGIAERF+W
Sbjct: 116 KFGFEVNTLRPMKYDQIAELLNGIAERFEW 145



>gb:AF128455_1770609 Pisum sativum gamma-glutamylcysteine synthetase
           precursor (gsh1) mRNA, complete cds.
          Length = 499

 Score =  144 bits (363), Expect = 1e-33
 Identities = 75/112 (66%), Positives = 86/112 (76%)
 Frame = +2

Query: 311 RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD 490
           R   +S G +FSS    + +       + +G RR   LIVAASPPTEDAVV+TEPLTK+D
Sbjct: 21  RKTPVSNGFSFSSICFDRRI-------VSSGGRR---LIVAASPPTEDAVVATEPLTKQD 70

Query: 491 LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           LIDYL SGCKPK+KWRIGTEHEKFGFE G+LRP+KY QIAELLN IAERFDW
Sbjct: 71  LIDYLASGCKPKDKWRIGTEHEKFGFELGSLRPVKYEQIAELLNAIAERFDW 122



>sp|Q9ZNX6|GSH1_MEDTR Glutamate--cysteine ligase, chloroplast
           precursor (EC 6.3.2.2) (Gamma- glutamylcysteine
           synthetase) (Gamma-ECS) (GCS).>gb:AF041340_1763458
           Medicago truncatula gamma-glutamylcysteine synthetase
           mRNA, nuclear gene encoding putative plastid protein,
           complete cds.
          Length = 508

 Score =  143 bits (361), Expect = 2e-33
 Identities = 77/112 (68%), Positives = 85/112 (75%)
 Frame = +2

Query: 311 RMKEMSFGLNFSSWNSSQAVQGLRSNCIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKD 490
           R   +S   +FSS NS    + L S     G RR    IVAASPPTEDAVV+TEPLTK+D
Sbjct: 27  RKTSISNTFSFSSKNSLSFKRILTSG----GSRR---FIVAASPPTEDAVVATEPLTKQD 79

Query: 491 LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           LIDYL SGCK K+KWRIGTEHEKFGFE G+LRPMKY QI+ELLNGIAERFDW
Sbjct: 80  LIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKYEQISELLNGIAERFDW 131



>gb:AF128453_1770607 Glycine max gamma-glutamylcysteine synthetase
           precursor (gsh1) mRNA, partial cds.
          Length = 308

 Score =  143 bits (360), Expect = 3e-33
 Identities = 65/75 (86%), Positives = 72/75 (96%)
 Frame = +2

Query: 422 LIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA 601
           +IVAASPPTEDAVV+T+PLTK+DL+DYL SGCKPK+KWRIGTEHEKFGFE G+LRPMKY 
Sbjct: 53  VIVAASPPTEDAVVATDPLTKQDLVDYLASGCKPKDKWRIGTEHEKFGFEIGSLRPMKYD 112

Query: 602 QIAELLNGIAERFDW 646
           QIAELLNGIAERFDW
Sbjct: 113 QIAELLNGIAERFDW 127



>sp|O23736|GSH1_BRAJU Glutamate--cysteine ligase, chloroplast
           precursor (EC 6.3.2.2) (Gamma- glutamylcysteine
           synthetase) (Gamma-ECS) (GCS).>gb:BJU563921_1633057
           Brassica juncea mRNA for glutamate-cysteine ligase (gsh1
           gene), allele 1-1.>gb:BJY10848_1633067 Brassica juncea
           mRNA for gamma-glutamylcysteine synthetase.
          Length = 514

 Score =  139 bits (351), Expect = 3e-32
 Identities = 78/146 (53%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query: 215 MALMSMAGSSLHCEM--IRCEAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSN 388
           MAL+S AG +       +    G       +   RMKE       SS++ + + + +   
Sbjct: 1   MALLSQAGGAYTVPSGHVSSRTGTKTVSGCVNVLRMKETYV----SSYSRTLSTKSMLKR 56

Query: 389 CIGAGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGF 568
                 +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK KEKWRIGTEHEKFGF
Sbjct: 57  S-----KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKEKWRIGTEHEKFGF 111

Query: 569 EFGTLRPMKYAQIAELLNGIAERFDW 646
           E  TLRPMKY QIAELLN IAERF+W
Sbjct: 112 EVNTLRPMKYDQIAELLNSIAERFEW 137



>gb:BJU563922_1633058 Brassica juncea mRNA for glutamate-cysteine
           ligase (gsh1 gene), allele 1-2.
          Length = 511

 Score =  136 bits (343), Expect = 3e-31
 Identities = 64/80 (80%), Positives = 71/80 (88%)
 Frame = +2

Query: 407 RRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLR 586
           +R H LIVAASPPTE+AVV+TEPLT++DLI YL SGCK K+KWRIGTEHEKFGFE  TLR
Sbjct: 55  KRGHQLIVAASPPTEEAVVATEPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLR 114

Query: 587 PMKYAQIAELLNGIAERFDW 646
           PMKY QIAELLN IAERF+W
Sbjct: 115 PMKYEQIAELLNSIAERFEW 134



>gb:BJU563923_1633059 Brassica juncea mRNA for glutamate-cysteine
           ligase (gsh1 gene), allele 1-3.
          Length = 515

 Score =  134 bits (337), Expect = 1e-30
 Identities = 80/154 (51%), Positives = 94/154 (61%), Gaps = 10/154 (6%)
 Frame = +2

Query: 215 MALMSMAG------SSLHCEMIRCEA--GCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAV 370
           MAL+S  G      S   C   R +A  GC N        RMK+ SF  + S        
Sbjct: 1   MALLSQGGGAYTVPSGTLCSKTRAKAVSGCVN------VLRMKDCSFSRSLSP------- 47

Query: 371 QGLRSNCIGAGYRRRHGLIVAASPPTEDA--VVSTEPLTKKDLIDYLTSGCKPKEKWRIG 544
              +S  +    R +H LIVAASPPT++A   V+ EPLT++DLI YL SGCK K+KWRIG
Sbjct: 48  ---KSMLVERSKRGQHQLIVAASPPTDEASAAVAAEPLTREDLIAYLASGCKSKDKWRIG 104

Query: 545 TEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           TEHEKFGFE  TLRPMKY QIAELLN IAERF+W
Sbjct: 105 TEHEKFGFEVKTLRPMKYDQIAELLNSIAERFEW 138



>gb:AP005256_1849686 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0038F09.
          Length = 496

 Score =  129 bits (324), Expect = 4e-29
 Identities = 61/83 (73%), Positives = 68/83 (81%)
 Frame = +2

Query: 398 AGYRRRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFG 577
           AG  R  G  VAASPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  
Sbjct: 37  AGRGRGRGGAVAASPPTEEAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVD 96

Query: 578 TLRPMKYAQIAELLNGIAERFDW 646
           TLRP+KY QI ++LNG+AERFDW
Sbjct: 97  TLRPIKYDQIRDILNGLAERFDW 119



>gb:AF401621_1796145 Allium cepa gamma-glutamylcysteine synthetase
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 496

 Score =  128 bits (322), Expect = 7e-29
 Identities = 60/78 (76%), Positives = 65/78 (83%)
 Frame = +2

Query: 413 RHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPM 592
           R   +V+ASPPTEDAVV TEPLTK DL+ YL SGCK K+KWRIGTEHEKFGF+  TLRPM
Sbjct: 42  RGKFVVSASPPTEDAVVMTEPLTKDDLVAYLASGCKTKDKWRIGTEHEKFGFQINTLRPM 101

Query: 593 KYAQIAELLNGIAERFDW 646
            Y QIA LLNGIAERFDW
Sbjct: 102 TYEQIAYLLNGIAERFDW 119



>gb:AC130598_1740713 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0056I11, complete sequence.
          Length = 492

 Score =  127 bits (320), Expect = 1e-28
 Identities = 59/79 (74%), Positives = 66/79 (83%)
 Frame = +2

Query: 410 RRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP 589
           R  G  VAASPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP
Sbjct: 37  RGRGGAVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRP 96

Query: 590 MKYAQIAELLNGIAERFDW 646
           +KY QI ++LNG+AERFDW
Sbjct: 97  IKYDQIRDILNGLAERFDW 115



>gb:OSA508916_1692648 Oryza sativa (japonica cultivar-group) mRNA
           for gamma-glutamylcysteine synthetase (gcs gene).
          Length = 492

 Score =  127 bits (320), Expect = 1e-28
 Identities = 59/79 (74%), Positives = 66/79 (83%)
 Frame = +2

Query: 410 RRHGLIVAASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRP 589
           R  G  VAASPPTE+AV  TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP
Sbjct: 37  RGRGGAVAASPPTEEAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRP 96

Query: 590 MKYAQIAELLNGIAERFDW 646
           +KY QI ++LNG+AERFDW
Sbjct: 97  IKYDQIRDILNGLAERFDW 115



>gb:ZMA302783_1731507 Zea mays mRNA for putative
           gamma-glutamylcysteine synthetase (gsh1 gene).
          Length = 438

 Score =  108 bits (270), Expect = 8e-23
 Identities = 47/60 (78%), Positives = 53/60 (88%)
 Frame = +2

Query: 467 TEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++LNG+AERFDW
Sbjct: 2   TEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPLKYDQIRDILNGLAERFDW 61



>gb:OSA508915_1692647 Oryza sativa (japonica cultivar-group) gcs
           gene for gamma-glutamylcysteine synthetase, exons 1-15.
          Length = 438

 Score =  108 bits (269), Expect = 1e-22
 Identities = 47/60 (78%), Positives = 53/60 (88%)
 Frame = +2

Query: 467 TEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           TEPLTK+DL+ YL SGCKPKE WRIGTEHEKFGFE  TLRP+KY QI ++LNG+AERFDW
Sbjct: 2   TEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDILNGLAERFDW 61



>gb:BJU5587_1633055 Brassica juncea mRNA for gamma-glutamylcysteine
           synthetase.
          Length = 436

 Score =  106 bits (264), Expect = 4e-22
 Identities = 48/59 (81%), Positives = 52/59 (88%)
 Frame = +2

Query: 470 EPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQIAELLNGIAERFDW 646
           EPLT++DLI YL SGCK K+KWRIGTEHEKFGFE  TLRPMKY QIAELLN IAERF+W
Sbjct: 1   EPLTREDLIAYLASGCKSKDKWRIGTEHEKFGFEVNTLRPMKYEQIAELLNSIAERFEW 59



>gb:CP000031_87618 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 456

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 3/57 (5%)
 Frame = +2

Query: 485 KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW 646
           + L +YL SGCKPK +WRIGTEHEKFGF   TL+P+ +     I  +L G+ +R  W
Sbjct: 15  EQLAEYLASGCKPKSEWRIGTEHEKFGFCKDTLKPLPFEGTRSIVAVLEGLRDRHGW 71



>gb:SME591784_184788 Sinorhizobium meliloti 1021 complete
           chromosome; segment 3/12.
          Length = 481

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 34/68 (50%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = +2

Query: 452 DAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLN 622
           D    T   +  +L  YL SG KPKEK+RIGTEHEKF F      P+ Y   A I  LLN
Sbjct: 28  DTTDQTPVTSVAELTAYLASGSKPKEKFRIGTEHEKFAFFKADNSPVPYFGDASIQALLN 87

Query: 623 GIAERFDW 646
           G+AER  W
Sbjct: 88  GMAERNGW 95



>gb:AE014292_310323 Brucella suis 1330 chromosome II, complete
           sequence.
          Length = 457

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/68 (41%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
 Frame = +2

Query: 452 DAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLN 622
           D    T   + ++L  YL  GCKPK+ WRIGTEHEKF F      P+ Y     I  +L 
Sbjct: 4   DTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILE 63

Query: 623 GIAERFDW 646
           G+  R  W
Sbjct: 64  GMQARLGW 71



>pir|D87672|D87672 glutamate-cysteine ligase [imported] -
           Caulobacter crescentus>gb:AE006001_214539 Caulobacter
           crescentus CB15 section 327 of 359 of the complete
           genome.>gb:AE005673_924438 Caulobacter crescentus CB15
           complete genome.
          Length = 453

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = +2

Query: 449 EDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELL 619
           + A V    LT  DL  Y   G KPKE +R+G EHEKFGF  G+  P+ Y     +  LL
Sbjct: 3   DTASVQERQLTLDDLTAYFAKGSKPKEAFRVGAEHEKFGFYLGSHEPVPYEGDKGVHALL 62

Query: 620 NGIAERFDW 646
            G+ +RF W
Sbjct: 63  TGL-QRFGW 70



>pir|AG3575|AG3575 glutamate-cysteine ligase (EC 6.3.2.2) [imported]
           - Brucella melitensis (strain 16M)>gb:AE009688_254507
           Brucella melitensis 16M chromosome II, section 50 of 107
           of the complete sequence.>gb:AE008918_980419 Brucella
           melitensis 16M chromosome II, complete sequence.
          Length = 457

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/68 (41%), Positives = 35/68 (51%), Gaps = 3/68 (4%)
 Frame = +2

Query: 452 DAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLN 622
           D    T   + ++L  YL  GCKPK+ WRIGTEHEKF F      P+ Y     I  +L 
Sbjct: 4   DTTDETALTSVEELATYLAGGCKPKDAWRIGTEHEKFPFYTANNSPVPYGGPRGIKAILE 63

Query: 623 GIAERFDW 646
           G+  R  W
Sbjct: 64  GMQARLGW 71



>gb:AE012555_284074 Xylella fastidiosa Temecula1, section 3 of 9 of
           the complete genome.>gb:AE009442_960650 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 454

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 4/62 (6%)
 Frame = +2

Query: 473 PLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ---IAELLNGIAERF 640
           P+T +  L++ L SG KP  +WRIGTEHEKFGF    LRP  +     I  LL G+  RF
Sbjct: 11  PITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLRPPTFDDERGIEALLTGMT-RF 69

Query: 641 DW 646
            W
Sbjct: 70  GW 71



>gb:AE012458_282622 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 366 of 460 of the complete
           genome.>gb:AE008922_915904 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 454

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +2

Query: 461 VSTEPLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGI 628
           V+  P+T++ +LI  L SG KP   WRIGTEHEKFGF    LRP  +     I  LL G+
Sbjct: 7   VAETPITERAELIQVLASGEKPGADWRIGTEHEKFGFRLDDLRPPTFDGERGIEALLVGM 66

Query: 629 AERFDW 646
             RF W
Sbjct: 67  T-RFGW 71



>pir|C82682|C82682 glutamate-cysteine ligase precursor XF1428
           [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE003973_49066 Xylella fastidiosa 9a5c, section
           119 of 229 of the complete genome.>gb:AE003849_1116276
           Xylella fastidiosa 9a5c, complete genome.
          Length = 454

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 4/66 (6%)
 Frame = +2

Query: 461 VSTEPLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ---IAELLNGI 628
           ++  P+T +  L++ L SG KP  +WRIGTEHEKFGF    L P  +     I  LL G+
Sbjct: 7   ITETPITNRAQLVEVLASGEKPASQWRIGTEHEKFGFRLDDLHPPTFDDERGIEALLTGM 66

Query: 629 AERFDW 646
             RF W
Sbjct: 67  T-RFGW 71



>gb:BX897699_827026 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 457

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 27/68 (39%), Positives = 33/68 (48%), Gaps = 3/68 (4%)
 Frame = +2

Query: 452 DAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLN 622
           D    +E      L+ Y   GCK +  WRIGTEHEKF F  G  RP+ Y     I  LL 
Sbjct: 4   DITDESEIYNLDSLVSYSQGGCKAEHDWRIGTEHEKFPFYRGDFRPVPYEGSRGIRALLE 63

Query: 623 GIAERFDW 646
           G+ +   W
Sbjct: 64  GMQKALGW 71



>gb:BA000012_671388 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 457

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
 Frame = +2

Query: 488 DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYA---QIAELLNGIAERFDW 646
           +L+D+L  G KP++KWRIGTEHEKF F      P+ Y     I  +L G+  +  W
Sbjct: 16  ELVDHLAEGNKPRDKWRIGTEHEKFPFYVDGNAPVPYGGERGIRAILEGMQSKLGW 71



>gb:AE013598_297578 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 454

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 4/66 (6%)
 Frame = +2

Query: 461 VSTEPLTK-KDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGI 628
           V+  P+T+  +L+  L SG KP   WRIGTEHEKFGF+   LR   +     I  LL G+
Sbjct: 7   VAETPITECAELVQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFEGARGIEALLTGL 66

Query: 629 AERFDW 646
             RF W
Sbjct: 67  T-RFGW 71



>gb:BX897700_828540 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 457

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 26/68 (38%), Positives = 32/68 (47%), Gaps = 3/68 (4%)
 Frame = +2

Query: 452 DAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLN 622
           D    +E      L+ Y   GCK +  WRIGTEHEKF F     RP+ Y     I  LL 
Sbjct: 4   DITDESEVYNLDSLVSYFQGGCKAENDWRIGTEHEKFPFYIDDFRPVPYEGSRGIRALLE 63

Query: 623 GIAERFDW 646
           G+ +   W
Sbjct: 64  GMQKALGW 71



>gb:AE011703_275688 Xanthomonas axonopodis pv. citri str. 306,
           section 81 of 469 of the complete
           genome.>gb:AE008923_917463 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 454

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 4/66 (6%)
 Frame = +2

Query: 461 VSTEPLTKK-DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGI 628
           V+  P+T++ +L   L SG KP   WRIGTEHEKFGF+   LR   +     I  LL G+
Sbjct: 7   VAETPITERAELAQVLASGEKPSADWRIGTEHEKFGFQLDDLRAPTFDGARGIEALLTGL 66

Query: 629 AERFDW 646
             RF W
Sbjct: 67  T-RFGW 71



>pir|AB2657|AB2657 glutamate-cysteine ligase gsh1 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>pir|G97438|G97438 glutamate-cysteine ligase
           precursor, chloroplast  (gamma-glutamylcysteine
           synthetase) (gamma-ecs) (gcs) [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>gb:AE008000_232404
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 58 of 254 of the complete
           sequence.>gb:AE009034_247699 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 60 of 256 of the
           complete sequence.>gb:AE007869_1082073 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1085542 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 457

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 3/56 (5%)
 Frame = +2

Query: 488 DLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERFDW 646
           +L DYL +GC+ +  +RIGTEHEKF F      P+ Y   A I+ LL G+ E+  W
Sbjct: 16  ELTDYLAAGCRAEADFRIGTEHEKFAFFRKDNSPVPYFGEASISALLKGMQEKLGW 71



>gb:CP000009_863957 Gluconobacter oxydans 621H, complete genome.
          Length = 486

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 21/46 (45%), Positives = 29/46 (63%)
 Frame = +2

Query: 431 AASPPTEDAVVSTEPLTKKDLIDYLTSGCKPKEKWRIGTEHEKFGF 568
           A S P      S E  ++  L++ +  GCKP+ +W+IGTEHEKFGF
Sbjct: 28  AMSNPGTSNTASIE--SRAQLVEAIARGCKPQSEWKIGTEHEKFGF 71



>gb:AE013598_297575 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 579

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 19/29 (65%), Positives = 22/29 (75%)
 Frame = +2

Query: 503 LTSGCKPKEKWRIGTEHEKFGFEFGTLRP 589
           L SG KP+ +WRIGTEHE+FGF    LRP
Sbjct: 2   LASGEKPEAQWRIGTEHEQFGFRLDDLRP 30



>gb:AE008692_241294 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.>gb:AF088897_478330 Zymomonas mobilis cosmid
           clone 65G3, partial sequence.
          Length = 462

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 3/59 (5%)
 Frame = +2

Query: 479 TKKDLIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKYAQ---IAELLNGIAERFDW 646
           ++ DL+    +G KPK +WR+GTEHEK  ++    +   Y +   I +LL G   RF W
Sbjct: 16  SRDDLLRIFQAGEKPKAQWRVGTEHEKLVYKKQNHQAPSYEEKGGICDLLQGFT-RFGW 73



>gb:BA000040_729424 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 456

 Score = 40.4 bits (93), Expect = 0.026
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 4/66 (6%)
 Frame = +2

Query: 461 VSTEPLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGI 628
           +   PL  +D L+ +   GCK   ++R+GTEHEK  F     RP+ Y     I  LL G+
Sbjct: 6   IDMTPLQSRDELVAWFEEGCKDPSEFRMGTEHEKTPFTLEGYRPVPYEGARGIGALLEGM 65

Query: 629 AERFDW 646
                W
Sbjct: 66  KLLLGW 71



>gb:BX572595_800438 Rhodopseudomonas palustris CGA009 complete
           genome; segment 3/16.
          Length = 478

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 4/62 (6%)
 Frame = +2

Query: 473 PLTKKD-LIDYLTSGCKPKEKWRIGTEHEKFGFEFGTLRPMKY---AQIAELLNGIAERF 640
           PL  +D L+ +L +G K   ++RIGTEHEK  F      P+ Y     I  LL G+    
Sbjct: 32  PLNSRDELVAWLEAGVKSPAEFRIGTEHEKTPFTLDGHHPVPYEGARGIGALLEGMQILL 91

Query: 641 DW 646
            W
Sbjct: 92  GW 93



>gb:AY659332_2148342 Synthetic construct Peudomonas aeruginosa clone
           FLH037137.01F PA2940 gene, partial cds.
          Length = 380

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +2

Query: 269 EAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSNCI-GAGYRRRHGLIVAA 436
           E GC   G NLE+    + +FG + ++  SS    G  +  +    + RRHGL++ A
Sbjct: 203 EDGCIRPGTNLESLAQLKPAFGGSVTAATSSPLTDGSAALLVCSEDFARRHGLVILA 259



>pir|C83278|C83278 probable acyl-CoA thiolase PA2940 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004720_57176
           Pseudomonas aeruginosa PAO1, section 281 of 529 of the
           complete genome.>gb:AE004091_971276 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 379

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +2

Query: 269 EAGCTNSGNNLEAYRMKEMSFGLNFSSWNSSQAVQGLRSNCI-GAGYRRRHGLIVAA 436
           E GC   G NLE+    + +FG + ++  SS    G  +  +    + RRHGL++ A
Sbjct: 203 EDGCIRPGTNLESLAQLKPAFGGSVTAATSSPLTDGSAALLVCSEDFARRHGLVILA 259


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 626,645,906
Number of Sequences: 1806583
Number of extensions: 12246105
Number of successful extensions: 32523
Number of sequences better than 10.0: 43
Number of HSP's better than 10.0 without gapping: 31325
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32497
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 35225721408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)