BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6557
         (774 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|G86162|G86162 protein F10O3.1 [imported] - Arabidopsis thali...   139   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AK176297_1818285 Arabidopsis thaliana mRNA for hypothetical p...   134   2e-30   
gb:BT010575_1640521 Arabidopsis thaliana At1g03160 gene, complet...   134   2e-30   
gb:AC105773_1738249 Oryza sativa (japonica cultivar-group) chrom...    77   5e-13   
sp|Q97LQ9|THIE_CLOAB|THIE_CLOAB Thiamine-phosphate pyrophosphorylase (EC 2....    41   0.028   Clostridium acetobutylicum
sp|P61411|THE2_GEOSL|THE2_GEOSL Putative thiamine-phosphate pyrophosphoryla...    39   0.11    Geobacter sulfurreducens
gb:AY596297_633451 Haloarcula marismortui ATCC 43049 chromosome ...    39   0.14    
sp|P72965|THIE_SYNY3|THIE_SYNY3 Probable thiamine-phosphate pyrophosphoryla...    39   0.14    Synechocystis sp.
sp|Q8U192|THIE_PYRFU|THIE_PYRFU Thiamine-phosphate pyrophosphorylase (EC 2....    37   0.31    Pyrococcus furiosus
sp|Q9UZQ5|THIE_PYRAB|THIE_PYRAB Thiamine-phosphate pyrophosphorylase (EC 2....    37   0.40    Pyrococcus abyssi
gb:AP003749_1832852 Oryza sativa (japonica cultivar-group) genom...    37   0.53    
sp|Q7U5U1|THIE_SYNPX|THIE_SYNPX Thiamine-phosphate pyrophosphorylase (EC 2....    37   0.53    Synechococcus sp.
sp|Q7V8I3|THIE_PROMM|THIE_PROMM Thiamine-phosphate pyrophosphorylase (EC 2....    37   0.53    Prochlorococcus marinus
gb:AP004052_1836965 Oryza sativa (japonica cultivar-group) genom...    36   0.69    
gb:AP008231_580186 Synechococcus elongatus PCC 6301 DNA, complet...    36   0.69    
sp|Q97RR8|THE2_STRPN|THE2_STRPN Probable thiamine-phosphate pyrophosphoryla...    36   0.69    Streptococcus pneumoniae
pir|F71057|F71057 probable thiamin biosynthetic bifunctional pro...    35   1.2     Pyrococcus horikoshii
sp|O58878|THIE_PYRHO|THIE_PYRHO Probable thiamine-phosphate pyrophosphoryla...    35   1.2     Pyrococcus horikoshii
gb:AE015942_320844 Clostridium tetani E88, section 7 of 10 of th...    35   1.5     
gb:RHMILVC_163845 Sinorhizobium meliloti ORF2 and acetohydroxy a...    35   1.5     
sp|Q893R0|THIE_CLOTE|THIE_CLOTE Thiamine-phosphate pyrophosphorylase (EC 2....    35   1.5     Clostridium tetani
gb:CR382399_1374966 Plasmodium falciparum chromosome 6, complete...    33   4.5     
gb:CP000021_873073 Vibrio fischeri ES114 chromosome II, complete...    33   4.5     
gb:AP005657_1855597 Oryza sativa (japonica cultivar-group) genom...    33   5.8     
gb:BA000030_702463 Streptomyces avermitilis MA-4680 genomic DNA,...    33   5.8     
gb:AE017354_460567 Legionella pneumophila subsp. pneumophila str...    33   5.8     
gb:CR628337_115345 Legionella pneumophila str. Lens complete gen...    33   5.8     
gb:CR628336_112283 Legionella pneumophila str. Paris complete ge...    33   5.8     
pir|C75433|C75433 hypothetical protein - Deinococcus radiodurans...    33   5.8     Deinococcus radiodurans
sp|Q87JW8|THIE_VIBPA|THIE_VIBPA Thiamine-phosphate pyrophosphorylase (EC 2....    33   5.8     
gb:OSJN00166_1696056 Oryza sativa genomic DNA, chromosome 4, BAC...    33   7.6     
gb:AE014296_1136208 Drosophila melanogaster chromosome 3L, compl...    33   7.6     
gb:AE013599_1132925 Drosophila melanogaster chromosome 2R, compl...    33   7.6     
gb:AE013599_1132923 Drosophila melanogaster chromosome 2R, compl...    33   7.6     
sp|Q9DE13|BA2B_CHICK|BA2B_CHICK Bromodomain adjacent to zinc finger domain ...    33   7.6     Gallus gallus [bantam]
gb:OSJN00040_1693740 Oryza sativa genomic DNA, chromosome 4, BAC...    32   10.0    
gb:PHY438996_1395236 Pimpla hypochondriaca mRNA for cysteine-ric...    32   10.0    
gb:AE014296_1135745 Drosophila melanogaster chromosome 3L, compl...    32   10.0    


>pir|G86162|G86162 protein F10O3.1 [imported] - Arabidopsis
           thaliana>gb:AE005172_889336 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F10O3_1677279 Arabidopsis thaliana
           chromosome 1 BAC F10O3 sequence, complete sequence.
          Length = 823

 Score =  139 bits (350), Expect = 6e-32
 Identities = 91/223 (40%), Positives = 126/223 (56%), Gaps = 9/223 (4%)
 Frame = +2

Query: 119 HRRRSQLPPPSNSVFFHTSSNLSMVSLLSQCCSVHSPSHCHFASPT-------PSHYSPP 277
           HRRR          +   S +LSM +L+S    V SP     ASP         S ++PP
Sbjct: 26  HRRR----------YLTLSLSLSMRTLISHRQCVTSPFLISAASPPFPGRCFKLSSFTPP 75

Query: 278 HFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQ 457
             +   R +++S+R  +  +       ++    +PRTL+PGG+KRPE+ VP L+L+L   
Sbjct: 76  RHR---RFSSLSIRNISHESA------DQTSSSRPRTLYPGGYKRPELAVPGLLLRLDAD 126

Query: 458 EVF--DNRNVLDEIDQAXXXXXXXXXXXXXXXXXXXXYEAACLLKSVIRERAYLLVDERV 631
           EV   +    LD +D+A                    YEAACLLKS+++ RAYLL+ ERV
Sbjct: 127 EVMSGNREETLDLVDRALAKSVQIVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERV 185

Query: 632 DIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVARI 760
           DIA+AV ASGV LSD+GLP IVARNT++ +  +SV+LPLVARI
Sbjct: 186 DIASAVGASGVALSDEGLPAIVARNTLMGSNPDSVLLPLVARI 228



>gb:AK176297_1818285 Arabidopsis thaliana mRNA for hypothetical
           protein, complete cds, clone: RAFL23-24-P19.
          Length = 740

 Score =  134 bits (337), Expect = 2e-30
 Identities = 84/200 (42%), Positives = 117/200 (58%), Gaps = 9/200 (4%)
 Frame = +2

Query: 188 MVSLLSQCCSVHSPSHCHFASPT-------PSHYSPPHFKPRLRCTNISVRAAARSNVSL 346
           M +L+S    V SP     ASP         S ++PP  +   R +++S+R  +  +   
Sbjct: 1   MRTLISHRQCVTSPFLISAASPPFPGRCFKLSSFTPPRHR---RFSSLSIRNISHESA-- 55

Query: 347 VFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF--DNRNVLDEIDQAXXXXXX 520
               ++    +PRTL+PGG+KRPE+ VP L+L+L   EV   +    LD +D+A      
Sbjct: 56  ----DQTSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQ 111

Query: 521 XXXXXXXXXXXXXXYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVA 700
                         YEAACLLKS+++ RAYLL+ ERVDIA+AV ASGV LSD+GLP IVA
Sbjct: 112 IVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAVGASGVALSDEGLPAIVA 170

Query: 701 RNTMLDTKSESVVLPLVARI 760
           RNT++ +  +SV+LPLVARI
Sbjct: 171 RNTLMGSNPDSVLLPLVARI 190



>gb:BT010575_1640521 Arabidopsis thaliana At1g03160 gene, complete
           cds.
          Length = 642

 Score =  134 bits (337), Expect = 2e-30
 Identities = 84/200 (42%), Positives = 117/200 (58%), Gaps = 9/200 (4%)
 Frame = +2

Query: 188 MVSLLSQCCSVHSPSHCHFASPT-------PSHYSPPHFKPRLRCTNISVRAAARSNVSL 346
           M +L+S    V SP     ASP         S ++PP  +   R +++S+R  +  +   
Sbjct: 1   MRTLISHRQCVTSPFLISAASPPFPGRCFKLSSFTPPRHR---RFSSLSIRNISHESA-- 55

Query: 347 VFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF--DNRNVLDEIDQAXXXXXX 520
               ++    +PRTL+PGG+KRPE+ VP L+L+L   EV   +    LD +D+A      
Sbjct: 56  ----DQTSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQ 111

Query: 521 XXXXXXXXXXXXXXYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVA 700
                         YEAACLLKS+++ RAYLL+ ERVDIA+AV ASGV LSD+GLP IVA
Sbjct: 112 IVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAVGASGVALSDEGLPAIVA 170

Query: 701 RNTMLDTKSESVVLPLVARI 760
           RNT++ +  +SV+LPLVARI
Sbjct: 171 RNTLMGSNPDSVLLPLVARI 190



>gb:AC105773_1738249 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1562_H01, complete sequence.
          Length = 803

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 38/63 (60%), Positives = 51/63 (80%)
 Frame = +2

Query: 569 AACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPL 748
           AA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + S+S+ LPL
Sbjct: 3   AALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSDSIYLPL 62

Query: 749 VAR 757
           VAR
Sbjct: 63  VAR 65



>sp|Q97LQ9|THIE_CLOAB Thiamine-phosphate pyrophosphorylase (EC
           2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>pir|H96960|H96960
           thiamine monophosphate syntase [imported] - Clostridium
           acetobutylicum>gb:AE007564_227836 Clostridium
           acetobutylicum ATCC 824 section 52 of 356 of the
           complete genome.>gb:AE001437_1090791 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 211

 Score = 40.8 bits (94), Expect = 0.028
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +2

Query: 446 LSTQEVFDNRNVLDEIDQAXXXXXXXXXXXXXXXXXXXXYEAACLLKSVIRE-RAYLLVD 622
           ++ ++V   R++   I++A                    YE+A  LK +    +  L+++
Sbjct: 11  VTDRKVLKERDLYKSIEEAIKGGVTLVQLREKEMSTLDFYESALKLKKITETYKIPLIIN 70

Query: 623 ERVDIAAAVNASGVLLSDQGLPTIVARNTM 712
           +R+DIA A+NA GV +    +P I AR  +
Sbjct: 71  DRIDIALAINADGVHIGQSDMPLIKARELL 100



>sp|P61411|THE2_GEOSL Putative thiamine-phosphate pyrophosphorylase
           (EC 2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>gb:AE017180_398891
           Geobacter sulfurreducens PCA, complete genome.
          Length = 213

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +2

Query: 605 AYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM 712
           A LL+++RVDIA A  A GV L ++G+P  VAR  +
Sbjct: 65  ARLLINDRVDIALAAGADGVHLGEEGMPAAVARELL 100



>gb:AY596297_633451 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 211

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +2

Query: 563 YEAACLLKSVIRER-AYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD 718
           YE    L+ + RE     +V++R+D+A A++A GV L D  LP  VAR+ + D
Sbjct: 48  YELGQKLRELTREADVTFVVNDRIDLAQAIDADGVHLGDDDLPVSVARDILGD 100



>sp|P72965|THIE_SYNY3 Probable thiamine-phosphate pyrophosphorylase
           (EC 2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>pir|S74943|S74943
           thiamine-phosphate diphosphorylase (EC 2.5.1.3) -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_687762
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 343

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 31/95 (32%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +2

Query: 431 SLVLQLSTQEVFDNRNVLDEIDQAXXXXXXXXXXXXXXXXXXXXYEAACLLKSVIRE-RA 607
           SL L  S QE     N+L  ++ A                    ++ A  L+ + R+  A
Sbjct: 144 SLYLVTSPQE-----NLLATVEAALQGGLKLVQYRDKDAEDQLRWQRAKDLRELCRQYEA 198

Query: 608 YLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM 712
             LV++RVD+A AV+A GV L  Q LP  VAR  +
Sbjct: 199 LFLVNDRVDLALAVDADGVHLGQQDLPIAVARQLL 233



>sp|Q8U192|THIE_PYRFU Thiamine-phosphate pyrophosphorylase (EC
           2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>gb:AE010238_260901
           Pyrococcus furiosus DSM 3638, section 113 of 173 of the
           complete genome.>gb:AE009950_901682 Pyrococcus furiosus
           DSM 3638, complete genome.
          Length = 207

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +2

Query: 563 YEAACLLKSVIRER-AYLLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
           YE    L+ + RE  A   VD+RVD+A AV+A GV L  + +P  VA+
Sbjct: 48  YEIGKTLRQLTREYDALFFVDDRVDVALAVDADGVQLGPEDMPIEVAK 95



>sp|Q9UZQ5|THIE_PYRAB Thiamine-phosphate pyrophosphorylase (EC
           2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>pir|D75087|D75087 thiamin
           phosphate pyrophosphorylase (thie) PAB1645 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX04_849848 Pyrococcus
           abyssi complete genome; segment 4/6.
          Length = 207

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +2

Query: 563 YEAACLLKSVIRER-AYLLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
           YE    ++ + +E  A   VD+R+D+A AVNA GV L  + +P  VAR
Sbjct: 48  YEVGKEIRRLTQEYDALFFVDDRIDVALAVNADGVQLGPEDMPIEVAR 95



>gb:AP003749_1832852 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1136_D11.
          Length = 652

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 28/79 (35%), Positives = 36/79 (45%), Gaps = 10/79 (12%)
 Frame = +2

Query: 107 PYPHHRRRSQLPPPSNSVFF-HTSSNLSMVSLLSQCCSVHSPSHCHFASPT--------- 256
           P  H    SQ P P NS+   H+ S +   +L SQ  +  SPS  H  +PT         
Sbjct: 335 PKHHKPHTSQSPRPQNSITHPHSGSEIFHHTLSSQRTNSCSPSAGHNGAPTAPLQSWPSA 394

Query: 257 PSHYSPPHFKPRLRCTNIS 313
           P ++SPP   P L   NIS
Sbjct: 395 PPYHSPPVNYPDLNRINIS 413



>sp|Q7U5U1|THIE_SYNPX Thiamine-phosphate pyrophosphorylase (EC
           2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>gb:BX569693_776506
           Synechococcus sp. WH8102 complete genome; segment 5/7.
          Length = 349

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = +2

Query: 605 AYLLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
           A L++++R+D+A AV+A GV L    LPT VAR
Sbjct: 204 ALLIINDRIDLALAVDADGVHLGQDDLPTDVAR 236



>sp|Q7V8I3|THIE_PROMM Thiamine-phosphate pyrophosphorylase (EC
           2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>gb:BX572096_797705
           Prochlorococcus marinus MIT9313 complete genome; segment
           2/7.
          Length = 353

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 1/103 (0%)
 Frame = +2

Query: 398 GGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAXXXXXXXXXXXXXXXXXXXXYEAAC 577
           G  +R +++   L L  ++Q   ++ ++L  ++ A                       A 
Sbjct: 142 GKKRRQQLQDCHLCLITTSQSDLNSNDLLRTVNAALVAGIDMVQYRNKEASDLQRLTQAK 201

Query: 578 LLKSVIRER-AYLLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
            L S+ R+  A  +V++R+D+A AV+A GV L    LPT VAR
Sbjct: 202 ELASLCRKHGALFIVNDRIDLALAVDADGVHLGQDDLPTDVAR 244



>gb:AP004052_1836965 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1218_D07.>gb:AP005825_1858542 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0724B10.
          Length = 350

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 32/86 (37%), Positives = 41/86 (47%), Gaps = 2/86 (2%)
 Frame = -1

Query: 555 PPLTPPPLSNTMPTRPETA*SISSRTFRLSKTSWVLSWSTRLGTLISGR-LNPPG-KSVR 382
           PP +PPPL   +  RPET         RL +     + S RL  +  GR L+PP  +S R
Sbjct: 238 PPASPPPL---LRPRPETP------LLRLLRPCTAHARSRRLPAVALGRCLSPPQPRSPR 288

Query: 381 GCCFGCSSLLNTKETLLRAAARTEML 304
            C   CSS+L     LL+  AR   L
Sbjct: 289 HCRSACSSVLTPPLHLLQPRARPSPL 314



>gb:AP008231_580186 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 343

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +2

Query: 566 EAACLLKSVI-RERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM 712
           E AC L  +  R  A  LV++RVD+A A  A GV L  Q +P  VAR  +
Sbjct: 189 ETACRLAELCQRYGALFLVNDRVDLALACGADGVHLGQQDVPMDVARRIL 238



>sp|Q97RR8|THE2_STRPN Probable thiamine-phosphate pyrophosphorylase
           2 (EC 2.5.1.3) (TMP pyrophosphorylase 2) (TMP-PPase 2)
           (Thiamine-phosphate synthase 2).>pir|A95084|A95084
           thiamin-phosphate pyrophosphorylase [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>pir|E97951|E97951 thiamine-phosphate
           diphosphorylase (EC 2.5.1.3) [imported] - Streptococcus
           pneumoniae (strain R6)>gb:AE007380_225927 Streptococcus
           pneumoniae TIGR4 section 63 of 194 of the complete
           genome.>gb:AE008441_236958 Streptococcus pneumoniae R6
           section 57 of 184 of the complete
           genome.>gb:AE007317_943116 Streptococcus pneumoniae R6,
           complete genome.>gb:AE005672_1103695 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 210

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 18/49 (36%), Positives = 28/49 (57%)
 Frame = +2

Query: 611 LLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVVLPLVAR 757
           L++D+R+D+  AV+A+G+ + D  LP  VAR  +   K   V    V R
Sbjct: 67  LIIDDRLDVCLAVDAAGLHIGDDELPVSVARKVLGPEKILGVTAKTVKR 115



>pir|F71057|F71057 probable thiamin biosynthetic bifunctional
           protein - Pyrococcus horikoshii>gb:BA000001_649818
           Pyrococcus horikoshii OT3 DNA, complete genome.
          Length = 161

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +2

Query: 605 AYLLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
           A   VD+R+D+A AVNA GV L    +P  +AR
Sbjct: 17  ALFFVDDRIDVALAVNADGVQLGPDDMPIEIAR 49



>sp|O58878|THIE_PYRHO Probable thiamine-phosphate pyrophosphorylase
           (EC 2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).
          Length = 207

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +2

Query: 605 AYLLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
           A   VD+R+D+A AVNA GV L    +P  +AR
Sbjct: 63  ALFFVDDRIDVALAVNADGVQLGPDDMPIEIAR 95



>gb:AE015942_320844 Clostridium tetani E88, section 7 of 10 of the
           complete genome.>gb:AE015927_963633 Clostridium tetani
           E88, complete genome.
          Length = 222

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +2

Query: 446 LSTQEVFDNRNVLDEIDQAXXXXXXXXXXXXXXXXXXXXYEAACLLKSVI-RERAYLLVD 622
           ++ +++   R++   +++A                    YE A  +K +  +    L+++
Sbjct: 26  VTDRDILKGRDLKKVLEEAILGGTTLVQLREKNVSSKEFYEIAKDIKVITDKYNIPLIIN 85

Query: 623 ERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTK 724
           +RVDIA AVNA G+ +  + LP  + R  + + K
Sbjct: 86  DRVDIALAVNAEGIHIGQKDLPANIVRKIIGEDK 119



>gb:RHMILVC_163845 Sinorhizobium meliloti ORF2 and acetohydroxy acid
           isomeroreductase (ilvC) genes, complete cds.
          Length = 337

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = -1

Query: 531 SNTMPTRPETA*SISSRTFRLSKTSWVLSWSTRLGTLISGRLNPPGKSVRG 379
           ++T PT PET+ +      R + TS   S S RLG   + R   PG +VRG
Sbjct: 87  TSTRPTSPETSATARQSPLRTASTSTSASSSRRLGRRRNDRSEGPGHTVRG 137



>sp|Q893R0|THIE_CLOTE Thiamine-phosphate pyrophosphorylase (EC
           2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).
          Length = 209

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = +2

Query: 446 LSTQEVFDNRNVLDEIDQAXXXXXXXXXXXXXXXXXXXXYEAACLLKSVI-RERAYLLVD 622
           ++ +++   R++   +++A                    YE A  +K +  +    L+++
Sbjct: 13  VTDRDILKGRDLKKVLEEAILGGTTLVQLREKNVSSKEFYEIAKDIKVITDKYNIPLIIN 72

Query: 623 ERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTK 724
           +RVDIA AVNA G+ +  + LP  + R  + + K
Sbjct: 73  DRVDIALAVNAEGIHIGQKDLPANIVRKIIGEDK 106



>gb:CR382399_1374966 Plasmodium falciparum chromosome 6, complete
           sequence; segment 2/5.
          Length = 545

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +2

Query: 563 YEAACLLKSVIRE-RAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTK 724
           Y  A  +K+++      L+++ R+DI  +VNA GV L    LP   ARN + + K
Sbjct: 65  YNTAVKMKNLLLPFNVPLIINNRLDICLSVNADGVHLGKSDLPLYHARNILGENK 119



>gb:CP000021_873073 Vibrio fischeri ES114 chromosome II, complete
           sequence.
          Length = 212

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query: 581 LKSVIRERAY-LLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
           +K ++++    L++++RVD+A AV A GV L    +P  +AR
Sbjct: 54  IKEILKDSGVPLIINDRVDVALAVQADGVHLGQSDMPAQIAR 95



>gb:AP005657_1855597 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0427G12.
          Length = 159

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 19/49 (38%), Positives = 21/49 (42%)
 Frame = +2

Query: 119 HRRRSQLPPPSNSVFFHTSSNLSMVSLLSQCCSVHSPSHCHFASPTPSH 265
           HRR     P S+S +FH    L   S L    SV SPS      P P H
Sbjct: 77  HRRLHPQVPSSSSAYFHRRRRLLHHSPLHSHLSVQSPSRRRRRGPVPGH 125



>gb:BA000030_702463 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 558

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = -3

Query: 706 IPSHNGRKTLIGEQNPTGINSGSNINTFIDQQVGSFADDRLQQAGSLVQFPAAHPTATEQ 527
           + +H  + T IG+ +      GS  +  +++   SFADD  + AG +++   ++  +TEQ
Sbjct: 128 LDAHAAKATDIGDHD------GSPSDAAVEKAKTSFADDSAEAAGLMIKLAQSYTASTEQ 181

Query: 526 HDA 518
            DA
Sbjct: 182 IDA 184



>gb:AE017354_460567 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 590

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = -1

Query: 456 WVLSWSTRLGTLISGRLNPPGKSVRGCCFGCSSLLNTKETLLRAAARTEML-VQRRRGLK 280
           W  SW+T LGT+I  ++ P     R   +  ++L +  + LL+  AR +++ +++++ LK
Sbjct: 334 WGASWATSLGTVIYRQITPQAVQDRVSAYAPATLDSEAKALLQELARQQLIELKKQQSLK 393



>gb:CR628337_115345 Legionella pneumophila str. Lens complete
           genome.
          Length = 590

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = -1

Query: 456 WVLSWSTRLGTLISGRLNPPGKSVRGCCFGCSSLLNTKETLLRAAARTEML-VQRRRGLK 280
           W  SW+T LGT+I  ++ P     R   +  ++L +  + LL+  AR +++ +++++ LK
Sbjct: 334 WGASWATSLGTVIYRQITPQAVQDRVVAYAPATLDSEAKALLQELARQQLIELKKQQSLK 393



>gb:CR628336_112283 Legionella pneumophila str. Paris complete
           genome.
          Length = 590

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = -1

Query: 456 WVLSWSTRLGTLISGRLNPPGKSVRGCCFGCSSLLNTKETLLRAAARTEML-VQRRRGLK 280
           W  SW+T LGT+I  ++ P     R   +  ++L +  + LL+  AR +++ +++++ LK
Sbjct: 334 WGASWATSLGTVIYRQITPQAVQDRVSAYAPATLDSEAKALLQELARQQLIELKKQQSLK 393



>pir|C75433|C75433 hypothetical protein - Deinococcus radiodurans
           (strain R1)>gb:AE001963_41411 Deinococcus radiodurans R1
           section 100 of 229 of the complete chromosome
           1.>gb:AE000513_882306 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 124

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 31/87 (35%), Positives = 36/87 (41%)
 Frame = -1

Query: 564 YNFPPLTPPPLSNTMPTRPETA*SISSRTFRLSKTSWVLSWSTRLGTLISGRLNPPGKSV 385
           +NF PL PP  S T+PTR   A         L +    L    RL   + GRL P   +V
Sbjct: 21  FNFVPLIPPATSVTLPTRITQA--------ELKRAGEEL----RLSVTLDGRLEPGYLTV 68

Query: 384 RGCCFGCSSLLNTKETLLRAAARTEML 304
               F  S  L T    L AA RT  L
Sbjct: 69  H--WFDGSRDLGTDSVFLDAAKRTAEL 93



>sp|Q87JW8|THIE_VIBPA Thiamine-phosphate pyrophosphorylase (EC
           2.5.1.3) (TMP pyrophosphorylase) (TMP-PPase)
           (Thiamine-phosphate synthase).>gb:BA000032_708670 Vibrio
           parahaemolyticus RIMD 2210633 DNA, chromosome 2,
           complete sequence.
          Length = 204

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 14/31 (45%), Positives = 22/31 (70%)
 Frame = +2

Query: 611 LLVDERVDIAAAVNASGVLLSDQGLPTIVAR 703
           L++++RVD+A AV+A GV L    +P  +AR
Sbjct: 64  LIINDRVDVALAVDADGVHLGQSDMPAEIAR 94



>gb:OSJN00166_1696056 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0034E24, complete sequence.
          Length = 744

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = -3

Query: 640 SNINTFIDQQVGSFADDRLQQAGSLVQFPAAHPTATEQHDADPTRDRLIYLIKDVP 473
           +++N  ++++V     D     G+    PA HPT   QHDA P++ R      +VP
Sbjct: 299 ASMNAMVEERVNKVLADMNIPRGTT---PAVHPTPCAQHDASPSQHRSSCASTEVP 351



>gb:AE014296_1136208 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003536_1214502 Drosophila melanogaster
           chromosome 3L, section 49 of 83 of the complete
           sequence.
          Length = 3146

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 3/81 (3%)
 Frame = +2

Query: 170 TSSNLSMVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLV 349
           +S+NL+  + +S      S S   FA+ TP+  +P H  P      + V AA  S+ +LV
Sbjct: 630 SSNNLAQSNSMSNLAGPRSNSGSGFATTTPTPATPLHLTP--VNVPVHVEAAPPSSPALV 687

Query: 350 FNNEE---QPKQQPRTLFPGG 403
             + +   QP+QQ +   P G
Sbjct: 688 KGSSQPPAQPQQQQQQAHPLG 708



>gb:AE013599_1132925 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003792_1224789 Drosophila melanogaster
           chromosome 2R, section 58 of 74 of the complete
           sequence.
          Length = 567

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 21/56 (37%), Positives = 28/56 (50%)
 Frame = +2

Query: 125 RRSQLPPPSNSVFFHTSSNLSMVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPR 292
           +R   PPP +S+   + SN SM +     CS+ SPSH H +        PP  KPR
Sbjct: 209 KRPPSPPPRHSM--RSRSNSSMSTSSDDSCSLCSPSHRHRSRSRGPRSPPP--KPR 260



>gb:AE013599_1132923 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132924 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003792_1224787
           Drosophila melanogaster chromosome 2R, section 58 of 74
           of the complete sequence.>gb:AE003792_1224788 Drosophila
           melanogaster chromosome 2R, section 58 of 74 of the
           complete sequence.>gb:AY052101_1290695 Drosophila
           melanogaster SD04973 full length cDNA.
          Length = 607

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 21/56 (37%), Positives = 28/56 (50%)
 Frame = +2

Query: 125 RRSQLPPPSNSVFFHTSSNLSMVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPR 292
           +R   PPP +S+   + SN SM +     CS+ SPSH H +        PP  KPR
Sbjct: 249 KRPPSPPPRHSM--RSRSNSSMSTSSDDSCSLCSPSHRHRSRSRGPRSPPP--KPR 300



>sp|Q9DE13|BA2B_CHICK Bromodomain adjacent to zinc finger domain 2B
           (Extracellular matrix protein F22).>gb:AF224275_2480979
           Gallus gallus extracellular matrix protein F22 mRNA,
           complete cds.
          Length = 2130

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 35/128 (27%), Positives = 53/128 (41%)
 Frame = -1

Query: 651 LTAAAISTRSSTNK*ALSRMTDFNKQAASYNFPPLTPPPLSNTMPTRPETA*SISSRTFR 472
           LT  A S  S+ N     R  D + ++ +  FPPL  PPL    P     A +  S  F 
Sbjct: 37  LTTGAASLSSTINTGEWWRTADSHSRSGAAFFPPLLGPPLLGISPLFAPPAQNHDSTPFH 96

Query: 471 LSKTSWVLSWSTRLGTLISGRLNPPGKSVRGCCFGCSSLLNTKETLLRAAARTEMLVQRR 292
              T      S   G  I+G LN  G S        +S+L+T  ++  +A + +++    
Sbjct: 97  PRTTGKNNRGSLEKG--INGSLN--GNSTTAASAISTSVLST--SIATSAGQVKVVTSGA 150

Query: 291 RGLKWGGE 268
            G K+  E
Sbjct: 151 GGRKYNQE 158



>gb:OSJN00040_1693740 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0050N09, complete sequence.
          Length = 718

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = -3

Query: 640 SNINTFIDQQVGSFADDRLQQAGSLVQFPAAHPTATEQHDADPTRDRLIYLIKDVP 473
           +++N  ++++V     D     G+    PA HPT   QHDA P++ R      +VP
Sbjct: 243 ASMNARVEERVNKVLADMNIPRGTT---PAVHPTPRAQHDASPSQHRSSCAFTEVP 295



>gb:PHY438996_1395236 Pimpla hypochondriaca mRNA for cysteine-rich
           venom protein 5 (cvp5 gene).
          Length = 115

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = -2

Query: 674 RRAKPXXXXXXXXXXXXHRPTSRLFRG*PTSTSRQPRTISRRSP 543
           RR +P             RPT+R  R  PT+ SR+P+   RR P
Sbjct: 65  RRTQPTRRTRGPKVTRSSRPTNRTRRPKPTNRSRRPKPTHRRKP 108



>gb:AE014296_1135745 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003546_1214905 Drosophila melanogaster
           chromosome 3L, section 39 of 83 of the complete
           sequence.
          Length = 803

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = +2

Query: 140 PPPSNSVFFHTSSNLSMVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVR 319
           PPP+ S     +S+L  +S LS   S HS      ++ TP+H  PP+  P     N +  
Sbjct: 461 PPPALSA----ASSLESMSALSPASSSHSGHMPITSAATPNHQPPPN-SPYANAMNAAHA 515

Query: 320 AAARSNVSLV 349
           AAA +  +++
Sbjct: 516 AAAAAAAAMI 525


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 756,577,783
Number of Sequences: 1806583
Number of extensions: 15032013
Number of successful extensions: 60925
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 57063
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60775
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 48804504615
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)