BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6554
         (674 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|O22300|HKLB_LYCES|HKLB_LYCES Homeobox protein knotted-1 like LET12.>pir|...   134   1e-30   Solanum lycopersicum
gb:LEU76409_1684762 Lycopersicon esculentum homeobox 1 protein (...   128   1e-28   
gb:AK118296_1816283 Arabidopsis thaliana At5g11060 mRNA for puta...   112   6e-24   
gb:ATKNAT4_1553535 A.thaliana mRNA for KNAT4 homeobox protein.        112   6e-24   
sp|P48001|HKL4_ARATH|HKL4_ARATH Homeobox protein knotted-1 like 4 (KNAT4).>...   112   6e-24   Arabidopsis thaliana [mouse-ear cress]
pir|T03874|T03874 probable homeobox protein OSH45, splice form O...   111   1e-23   Oryza sativa Japonica Group [Japonica rice]
pir|T03875|T03875 probable homeobox protein OSH45, splice form O...   111   1e-23   Oryza sativa Japonica Group [Japonica rice]
gb:AY120762_1579644 Arabidopsis thaliana KNAT3 homeodomain prote...   109   5e-23   
gb:AY086091_1571149 Arabidopsis thaliana clone 21240 mRNA, compl...   109   5e-23   
sp|P48000|HKL3_ARATH|HKL3_ARATH Homeobox protein knotted-1 like 3 (KNAT3).>...   109   5e-23   Arabidopsis thaliana [mouse-ear cress]
sp|O04136|HKL3_MALDO|HKL3_MALDO Homeobox protein knotted-1 like 3 (KNAP3).>...   101   1e-20   Malus domestica [apple tree]
pir|T02220|T02220 homeobox protein NTH23 - common tobacco>gb:AB0...   100   2e-20   Nicotiana tabacum [American tobacco]
gb:AB043957_1520040 Ceratopteris richardii mRNA for CRKNOX3, com...    97   2e-19   
sp|P48002|HKL5_ARATH|HKL5_ARATH Homeobox protein knotted-1 like 5 (KNAT5) (...    93   5e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AY667451_1620714 Selaginella kraussiana KNOTTED1-like protein...    92   1e-17   
gb:LEU76410_1684763 Lycopersicon esculentum homeobox 2 protein (...    83   5e-15   
gb:AB061818_1522092 Oryza sativa (japonica cultivar-group) HOS59...    82   7e-15   
sp|P46606|HD1_BRANA|HD1_BRANA Homeobox protein HD1.>pir|S47535|S47535 home...    80   2e-14   Brassica napus [oilseed rape]
gb:AK118326_1816309 Arabidopsis thaliana At1g62990 mRNA for puta...    80   4e-14   
gb:AF308451_1784799 Arabidopsis thaliana homeodomain transcripti...    80   4e-14   
gb:AY084398_1569488 Arabidopsis thaliana clone 106887 mRNA, comp...    80   4e-14   
pir|A96655|A96655 hypothetical protein F16P17.16 [imported] - Ar...    80   4e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AF544051_1810417 Hordeum vulgare knotted 7 (kn7) mRNA, comple...    78   1e-13   
gb:AC098695_1736865 Oryza sativa (japonica cultivar-group) chrom...    76   5e-13   
gb:AB061819_1522093 Oryza sativa (japonica cultivar-group) HOS66...    76   5e-13   
gb:AF285148_1783116 Physcomitrella patens class 2 KNOTTED1-like ...    75   8e-13   
gb:AF533597_1809465 Lycopersicon esculentum knotted protein TKN4...    43   0.004   
gb:AF375968_1792979 Lycopersicon esculentum knotted homeodomain ...    43   0.004   
gb:AF544052_1810418 Nicotiana tabacum knotted 1 (kn1) mRNA, comp...    43   0.006   
gb:AB025573_1516211 Nicotiana tabacum NTH1 mRNA for KN1-type hom...    41   0.022   
gb:AF284817_1783102 Physcomitrella patens class 1 KNOTTED1-like ...    40   0.037   
gb:AF063248_1765407 Picea abies homeobox protein mRNA, complete ...    39   0.083   
gb:PMU90092_1700844 Picea mariana homeobox transcription factor ...    39   0.083   
gb:AY680383_1622058 Picea glauca homeobox transcription factor K...    39   0.083   
gb:AY169493_1586531 Nicotiana tabacum Knotted-1-like homeobox pr...    39   0.083   
pir|T01735|T01735 homeobox protein NTH15 - common tobacco>gb:AB0...    39   0.083   Nicotiana tabacum [American tobacco]
gb:AF483278_1804042 Picea abies KNOTTED1-like homeodomain protei...    39   0.11    
gb:AY680381_1622056 Picea glauca homeobox transcription factor K...    39   0.11    
gb:PMU90091_1700843 Picea mariana homeobox transcription factor ...    38   0.14    
gb:AY680402_1622077 Pinus taeda homeobox transcription factor KN...    37   0.31    
gb:AY680380_1622055 Pinus strobus homeobox transcription factor ...    37   0.31    
sp|O04134|HKL1_MALDO|HKL1_MALDO Homeobox protein knotted-1 like 1 (KNAP1).>...    37   0.31    Malus domestica [apple tree]
gb:AY072735_1567388 Antirrhinum majus invaginata (ina) mRNA, com...    37   0.41    
gb:AF527947_1808527 Brassica oleracea homeodomain protein BOSTM-...    36   0.54    
gb:HTU519674_1682195 Helianthus tuberosus mRNA for putative knot...    36   0.54    
gb:AY680382_1622057 Pinus strobus homeobox transcription factor ...    36   0.54    
gb:AY096802_1576296 Helianthus annuus knotted-1-like protein 1 (...    36   0.54    
gb:AY112704_1578154 Petunia x hybrida shootmeristemless-like mRN...    36   0.70    
sp|P46608|HMB1_SOYBN|HMB1_SOYBN Homeobox protein SBH1.>pir|S42543|S42543 hy...    36   0.70    Glycine max [soybeans]
gb:AY680403_1622078 Pinus taeda homeobox transcription factor KN...    35   0.92    
gb:AB016002_1512743 Ipomoea nil PKn3 (knotted-like gene) mRNA, c...    35   0.92    
sp|Q9M6D9|STM_BRAOL|STM_BRAOL Homeobox protein Shootmeristemless.>gb:AF193...    35   0.92    Brassica oleracea
gb:AF404814_1796804 Malus x domestica KNAP2-like protein mRNA, p...    35   1.2     
sp|O04135|HKL2_MALDO|HKL2_MALDO Homeobox protein knotted-1 like 2 (KNAP2).>...    35   1.2     Malus domestica [apple tree]
gb:AC090683_1734403 Oryza sativa chromosome 3 BAC OSJNBa0035I24 ...    35   1.6     
gb:AY080857_1568547 Arabidopsis thaliana putative homeobox prote...    35   1.6     
gb:AE005173_893905 Arabidopsis thaliana chromosome 1, bottom arm...    35   1.6     
pir|S68456|S68456 homeotic protein shootmeristemless, KNOTTED-li...    35   1.6     Arabidopsis thaliana [mouse-ear cress]
sp|Q38874|STM_ARATH|STM_ARATH Homeobox protein SHOOT MERISTEMLESS.>pir|T01...    35   1.6     Arabidopsis thaliana [mouse-ear cress]
gb:AC090683_1734401 Oryza sativa chromosome 3 BAC OSJNBa0035I24 ...    34   2.7     
gb:AY072736_1567389 Antirrhinum majus hirzina (hirz) mRNA, compl...    34   2.7     
gb:AB025713_1516734 Nicotiana tabacum mRNA for homeobox 9, compl...    34   2.7     
gb:AY781901_1628330 Saccharum hybrid cultivar isolate c53a homeo...    33   3.5     
pir|T06382|T06382 Knox protein 1 - garden pea>gb:AF063307_176541...    33   3.5     Pisum sativum [garden pea]
gb:AY655754_1620249 Streptocarpus saxorum STM1 protein mRNA, com...    33   4.5     
gb:AF457122S1_1801307 Zea mays knotted1-like homeodomain protein...    33   5.9     
gb:AF457119_1801304 Zea mays knotted1-like homeodomain protein l...    33   5.9     
gb:LEU76408_1684761 Lycopersicon esculentum knotted 3 protein (T...    33   5.9     
gb:DOR276389_1675995 Dendrobium grex Madame Thong-IN mRNA for kn...    33   5.9     
gb:AY655753_1620248 Streptocarpus rexii STM1 protein mRNA, compl...    32   7.7     
gb:AY655752_1620247 Streptocarpus dunnii STM1 protein mRNA, part...    32   7.7     


>sp|O22300|HKLB_LYCES Homeobox protein knotted-1 like
           LET12.>pir|T04318|T04318 homeobox protein LeT12, class
           II knotted-like - tomato>gb:LEAF000142_1684203
           Lycopersicon esculentum class II knotted-like
           homeodomain protein (LeT12) mRNA, complete cds.
          Length = 426

 Score =  134 bits (337), Expect = 1e-30
 Identities = 97/242 (40%), Positives = 112/242 (46%), Gaps = 52/242 (21%)
 Frame = +3

Query: 105 FEDQFSEEMGV------EQQQNAGVLRSMLPDQXXXXXXXXXXX-XXVFLRLQRHHHFSD 263
           F+D FS+EM +      +QQQ   VLRSMLP+                 L  Q+H  F +
Sbjct: 3   FQDHFSQEMVLHQQQQQQQQQQNAVLRSMLPESPHHDARKSPPTWLNTSLLRQQHSQFGN 62

Query: 264 SPNNNS-----------NFLHLQTXXXXXXXXXXXXXXPTADV----------------- 359
           + + +S           NFLHLQT              PTA                   
Sbjct: 63  ASSPSSAAAAAAVAGGNNFLHLQTSNSDSSNSNQWLS-PTAAAGGGSNGGGSGHNDELSE 121

Query: 360 -----------------KKHXXXXXXXXXXXXXXXXWVREKCKADLLNHPLYDQLLSAHV 488
                            + +                W REKCKAD+LNHPLYDQLLSAHV
Sbjct: 122 SMNFAKKMSQQHSGGGEENNNNNNNNNNNNNEEENSWEREKCKADILNHPLYDQLLSAHV 181

Query: 489 SCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXXXXXXXFMTHYVMLLSSFK 668
           SCLRIATPVDQLPRIDAQLAQSQNVVA Y S+L              FMTHYV+LLSSFK
Sbjct: 182 SCLRIATPVDQLPRIDAQLAQSQNVVAKY-SVLGQGQPPLDDKDLDQFMTHYVLLLSSFK 240

Query: 669 EQ 674
           EQ
Sbjct: 241 EQ 242



>gb:LEU76409_1684762 Lycopersicon esculentum homeobox 1 protein
           (THox1) mRNA, partial cds.
          Length = 392

 Score =  128 bits (321), Expect = 1e-28
 Identities = 66/86 (76%), Positives = 69/86 (80%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHX 596
           W REKCKAD+LNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVA Y S+L   
Sbjct: 120 WEREKCKADILNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVAKY-SVLGQG 178

Query: 597 XXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                      FMTHYV+LLSSFKEQ
Sbjct: 179 QPPLDDKDLDQFMTHYVLLLSSFKEQ 204



>gb:AK118296_1816283 Arabidopsis thaliana At5g11060 mRNA for
           putative HOMEOBOX PROTEIN KNOTTED-1 LIKE 4 (KNAT4),
           complete cds, clone: RAFL19-58-H14.
          Length = 393

 Score =  112 bits (280), Expect = 6e-24
 Identities = 58/87 (66%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAH 593
           W   + KA++L+HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQNVVA YS+L  A 
Sbjct: 118 WQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSTLEAAQ 177

Query: 594 XXXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                       FMTHYV+LL SFKEQ
Sbjct: 178 GLLAGDDKELDHFMTHYVLLLCSFKEQ 204



>gb:ATKNAT4_1553535 A.thaliana mRNA for KNAT4 homeobox protein.
          Length = 393

 Score =  112 bits (280), Expect = 6e-24
 Identities = 58/87 (66%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAH 593
           W   + KA++L+HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQNVVA YS+L  A 
Sbjct: 118 WQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSTLEAAQ 177

Query: 594 XXXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                       FMTHYV+LL SFKEQ
Sbjct: 178 GLLAGDDKELDHFMTHYVLLLCSFKEQ 204



>sp|P48001|HKL4_ARATH Homeobox protein knotted-1 like 4
           (KNAT4).>pir|T51795|T51795 HOMEOBOX PROTEIN KNOTTED-1
           LIKE 4 (KNAT4) - Arabidopsis thaliana>gb:ATT5K6_1556198
           Arabidopsis thaliana DNA chromosome 5, BAC clone T5K6
           (ESSA project).
          Length = 419

 Score =  112 bits (280), Expect = 6e-24
 Identities = 58/87 (66%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAH 593
           W   + KA++L+HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQNVVA YS+L  A 
Sbjct: 118 WQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSTLEAAQ 177

Query: 594 XXXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                       FMTHYV+LL SFKEQ
Sbjct: 178 GLLAGDDKELDHFMTHYVLLLCSFKEQ 204



>pir|T03874|T03874 probable homeobox protein OSH45, splice form
           OSH44 [similarity] - rice>gb:D49703S2_1674625 Oryza
           sativa (japonica cultivar-group) OSH45 gene for OSH42,
           OSH44 and OSH45 transcripts, exon 2, 3, 4, 5, 6 and 7,
           complete cds.
          Length = 375

 Score =  111 bits (277), Expect = 1e-23
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = +3

Query: 429 KCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXX 608
           +CKA++L HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQ VVA YS+L A      
Sbjct: 107 RCKAEILAHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQGVVAKYSALAA-AAAGD 165

Query: 609 XXXXXXXFMTHYVMLLSSFKEQ 674
                  FMTHYV+LL SFKEQ
Sbjct: 166 DGRELDQFMTHYVLLLCSFKEQ 187



>pir|T03875|T03875 probable homeobox protein OSH45, splice form
           OSH45 [similarity] - rice>gb:D49703S2_1674626 Oryza
           sativa (japonica cultivar-group) OSH45 gene for OSH42,
           OSH44 and OSH45 transcripts, exon 2, 3, 4, 5, 6 and 7,
           complete cds.
          Length = 374

 Score =  111 bits (277), Expect = 1e-23
 Identities = 57/82 (69%), Positives = 64/82 (78%)
 Frame = +3

Query: 429 KCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXX 608
           +CKA++L HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQ VVA YS+L A      
Sbjct: 107 RCKAEILAHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQGVVAKYSALAA-AAAGD 165

Query: 609 XXXXXXXFMTHYVMLLSSFKEQ 674
                  FMTHYV+LL SFKEQ
Sbjct: 166 DGRELDQFMTHYVLLLCSFKEQ 187



>gb:AY120762_1579644 Arabidopsis thaliana KNAT3 homeodomain protein
           (At5g25220) mRNA, complete cds.>gb:BT000139_1634417
           Arabidopsis thaliana KNAT3 homeodomain protein
           (At5g25220) mRNA, complete cds.
          Length = 306

 Score =  109 bits (272), Expect = 5e-23
 Identities = 57/87 (65%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAH 593
           W   + KA++L+HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQ+VVA YS+L  A 
Sbjct: 29  WQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVAKYSALGAAA 88

Query: 594 XXXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                       FMTHYV+LL SFKEQ
Sbjct: 89  QGLVGDDKELDQFMTHYVLLLCSFKEQ 115



>gb:AY086091_1571149 Arabidopsis thaliana clone 21240 mRNA, complete
           sequence.
          Length = 431

 Score =  109 bits (272), Expect = 5e-23
 Identities = 57/87 (65%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAH 593
           W   + KA++L+HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQ+VVA YS+L  A 
Sbjct: 154 WQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVAKYSALGAAA 213

Query: 594 XXXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                       FMTHYV+LL SFKEQ
Sbjct: 214 QGLVGDDKELDQFMTHYVLLLCSFKEQ 240



>sp|P48000|HKL3_ARATH Homeobox protein knotted-1 like 3
           (KNAT3).>gb:AC006259_1533879 Arabidopsis thaliana BAC
           F21J6 from chromosome V, containing KNAT3 and mapping
           near 60.5 cM, complete sequence.>gb:ATKNAT3_1553534
           A.thaliana mRNA for KNAT3 homeobox protein.
          Length = 431

 Score =  109 bits (272), Expect = 5e-23
 Identities = 57/87 (65%), Positives = 66/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAH 593
           W   + KA++L+HPLY+QLLSAHV+CLRIATPVDQLPRIDAQLAQSQ+VVA YS+L  A 
Sbjct: 154 WQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQHVVAKYSALGAAA 213

Query: 594 XXXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                       FMTHYV+LL SFKEQ
Sbjct: 214 QGLVGDDKELDQFMTHYVLLLCSFKEQ 240



>sp|O04136|HKL3_MALDO Homeobox protein knotted-1 like 3
           (KNAP3).>pir|T17010|T17010 knotted1-like homeobox
           protein - apple tree>gb:MDKNOX1_1685936 M.domestica mRNA
           for knotted1-like homeobox protein.
          Length = 427

 Score =  101 bits (251), Expect = 1e-20
 Identities = 54/86 (62%), Positives = 62/86 (72%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHX 596
           W   + KA++L HPLY+ LLSAHV+CLRIATPVDQLPRIDAQLAQSQNVVA YS+L    
Sbjct: 162 WQNARHKAEILAHPLYEPLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSAL--GN 219

Query: 597 XXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                      FM +YV+LL SFKEQ
Sbjct: 220 GMVGDDKELDQFMRNYVLLLCSFKEQ 245



>pir|T02220|T02220 homeobox protein NTH23 - common
           tobacco>gb:AB004797_1509182 Nicotiana tabacum NTH23
           mRNA, complete cds.
          Length = 422

 Score =  100 bits (250), Expect = 2e-20
 Identities = 53/86 (61%), Positives = 61/86 (70%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHX 596
           W     KA++L HPL++QLLSAHV+CLRIATPVDQLPRIDAQLAQSQ VVA YS+L    
Sbjct: 160 WQNAGYKAEILAHPLFEQLLSAHVACLRIATPVDQLPRIDAQLAQSQQVVAKYSTL---G 216

Query: 597 XXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                      F+THYV+LL  FKEQ
Sbjct: 217 QNIGDDKELDQFLTHYVLLLCPFKEQ 242



>gb:AB043957_1520040 Ceratopteris richardii mRNA for CRKNOX3,
           complete cds.
          Length = 436

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 49/87 (56%), Positives = 60/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAH 593
           W   + KAD+  HPLYDQLL+AHV+CLRIATPVDQLPRIDAQ+AQ+  +VA Y+ L   +
Sbjct: 168 WQNARLKADITMHPLYDQLLAAHVACLRIATPVDQLPRIDAQIAQASQIVAKYAVLGQNN 227

Query: 594 XXXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                       FM HYV+LL +FKEQ
Sbjct: 228 LLVGEEKDELDQFMAHYVLLLCTFKEQ 254



>sp|P48002|HKL5_ARATH Homeobox protein knotted-1 like 5 (KNAT5)
           (Homeodomain containing protein 1).>pir|T04641|T04641
           homeobox protein 1 - Arabidopsis
           thaliana>gb:ATCHRIV76_1547125 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 76.>gb:ATF10N7_1548221
           Arabidopsis thaliana DNA chromosome 4, BAC clone F10N7
           (ESSA project).>gb:D43962_1674592 Arabidopsis thaliana
           mRNA for homeodomein containing protein 1, complete
           cds.>gb:AF306661_1784520 Arabidopsis thaliana
           homeodomain transcription factor KNAT5 (KNAT5) mRNA,
           complete cds.
          Length = 383

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 47/86 (54%), Positives = 58/86 (67%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHX 596
           W     KA +L HP+Y+QLL+AHV+CLR+ATPVDQ+PRIDAQL+Q   V A YS+L    
Sbjct: 113 WRSASYKAAILRHPMYEQLLAAHVACLRVATPVDQIPRIDAQLSQLHTVAAKYSTL---- 168

Query: 597 XXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                      FM+HYV+LL SFKEQ
Sbjct: 169 GVVVDNKELDHFMSHYVVLLCSFKEQ 194



>gb:AY667451_1620714 Selaginella kraussiana KNOTTED1-like protein
           (KNOX3) mRNA, complete cds.
          Length = 363

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 47/83 (56%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +3

Query: 429 KCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXX-X 605
           K KAD++ HPLY+QLL AHVSCLRIATPVDQL +ID Q+AQ   ++A Y  L  H     
Sbjct: 101 KLKADIVTHPLYEQLLEAHVSCLRIATPVDQLGKIDGQIAQCHQLIAKYYILANHQLLCG 160

Query: 606 XXXXXXXXFMTHYVMLLSSFKEQ 674
                   FM HYVMLL SFK+Q
Sbjct: 161 NSKDELDQFMAHYVMLLRSFKDQ 183



>gb:LEU76410_1684763 Lycopersicon esculentum homeobox 2 protein
           (THox2) mRNA, complete cds.
          Length = 310

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 40/84 (47%), Positives = 55/84 (65%), Gaps = 4/84 (4%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSS----LLAHXXX 602
           K+++  HPLY+QLLSAHV+CLR+ TP+DQLP IDAQL QS N++ +Y+S       H   
Sbjct: 46  KSEIATHPLYEQLLSAHVACLRVRTPIDQLPLIDAQLTQSHNLLRSYASSQQQQQQHSLS 105

Query: 603 XXXXXXXXXFMTHYVMLLSSFKEQ 674
                    F+  Y+++L SFKEQ
Sbjct: 106 HHERQELDNFLAQYLLVLCSFKEQ 129



>gb:AB061818_1522092 Oryza sativa (japonica cultivar-group) HOS59
           mRNA for KNOX family class 2 homeodomain protein,
           complete cds.>gb:AP003517_1830262 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0062J02.>gb:AP004008_1836271 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1226_A12.
          Length = 317

 Score = 82.4 bits (202), Expect = 7e-15
 Identities = 46/89 (51%), Positives = 56/89 (62%), Gaps = 3/89 (3%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHX 596
           W REK  A +  HPLY++LL AHV+CLR+ATPVDQLPRIDAQ+A     +A  ++  A  
Sbjct: 44  WEREK--AAIAAHPLYERLLEAHVACLRVATPVDQLPRIDAQIAARPPPLAAATAAAAAA 101

Query: 597 XXX---XXXXXXXXFMTHYVMLLSSFKEQ 674
                         FMTHYV+LL SFKEQ
Sbjct: 102 AAGGAPSGGEELDLFMTHYVLLLCSFKEQ 130



>sp|P46606|HD1_BRANA Homeobox protein HD1.>pir|S47535|S47535
           homeodomain-containing protein -
           rape>gb:BNHDIBOX_1633556 B.napus hd1 mRNA for
           homeodomain-containing protein.
          Length = 294

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           K ++  HP+YDQLL+AHV+CLR+ATP+DQLP I+AQL+ S +++ +Y+S  A        
Sbjct: 32  KGEIATHPMYDQLLAAHVACLRVATPIDQLPIIEAQLSHSHHLLRSYAS-TAVGFSHHDR 90

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                F+  YVM+L SFKEQ
Sbjct: 91  QELDNFLAQYVMVLCSFKEQ 110



>gb:AK118326_1816309 Arabidopsis thaliana At1g62990 mRNA for
           putative homeodomain transcription factor KNAT6 (KNAT6),
           complete cds, clone: RAFL19-60-J07.
          Length = 284

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 38/80 (47%), Positives = 55/80 (68%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           K ++  HP+Y+QLL+AHV+CLR+ATP+DQLP I+AQL+QS +++ +Y+S           
Sbjct: 23  KGEIATHPMYEQLLAAHVACLRVATPIDQLPIIEAQLSQSHHLLRSYASTAV--GYHHDR 80

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                F+  YVM+L SFKEQ
Sbjct: 81  HELDNFLAQYVMVLCSFKEQ 100



>gb:AF308451_1784799 Arabidopsis thaliana homeodomain transcription
           factor KNAT7 (KNAT7) mRNA, complete cds.
          Length = 291

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 38/80 (47%), Positives = 55/80 (68%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           K ++  HP+Y+QLL+AHV+CLR+ATP+DQLP I+AQL+QS +++ +Y+S           
Sbjct: 30  KGEIATHPMYEQLLAAHVACLRVATPIDQLPIIEAQLSQSHHLLRSYASTAV--GYHHDR 87

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                F+  YVM+L SFKEQ
Sbjct: 88  HELDNFLAQYVMVLCSFKEQ 107



>gb:AY084398_1569488 Arabidopsis thaliana clone 106887 mRNA,
           complete sequence.
          Length = 283

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 38/80 (47%), Positives = 55/80 (68%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           K ++  HP+Y+QLL+AHV+CLR+ATP+DQLP I+AQL+QS +++ +Y+S           
Sbjct: 22  KGEIATHPMYEQLLAAHVACLRVATPIDQLPIIEAQLSQSHHLLRSYASTAV--GYHHDR 79

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                F+  YVM+L SFKEQ
Sbjct: 80  HELDNFLAQYVMVLCSFKEQ 99



>pir|A96655|A96655 hypothetical protein F16P17.16 [imported] -
           Arabidopsis thaliana>gb:AE005173_893967 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F16P17_1677647 Sequence of BAC F16P17 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 283

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 38/80 (47%), Positives = 55/80 (68%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           K ++  HP+Y+QLL+AHV+CLR+ATP+DQLP I+AQL+QS +++ +Y+S           
Sbjct: 22  KGEIATHPMYEQLLAAHVACLRVATPIDQLPIIEAQLSQSHHLLRSYASTAV--GYHHDR 79

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                F+  YVM+L SFKEQ
Sbjct: 80  HELDNFLAQYVMVLCSFKEQ 99



>gb:AF544051_1810417 Hordeum vulgare knotted 7 (kn7) mRNA, complete
           cds.
          Length = 340

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 43/86 (50%), Positives = 51/86 (59%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHX 596
           W  EK   +   HPLY++LL AHV+CLR+ATPVDQLPRIDAQ+A      A     +   
Sbjct: 42  WEGEKAAVEA--HPLYERLLEAHVACLRVATPVDQLPRIDAQIA------ARAPPPMPPA 93

Query: 597 XXXXXXXXXXXFMTHYVMLLSSFKEQ 674
                      FMTHYV+LL SFKEQ
Sbjct: 94  SALSGGEELDLFMTHYVLLLCSFKEQ 119



>gb:AC098695_1736865 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1126B12, complete sequence.
          Length = 171

 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 37/84 (44%), Positives = 53/84 (63%)
 Frame = +3

Query: 423 REKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXX 602
           R+  K ++  HPL +QL++AHV CLR+ATP+D LP IDAQLAQS  ++ +Y++       
Sbjct: 42  RQLLKGEIAVHPLCEQLVAAHVGCLRVATPIDHLPLIDAQLAQSSGLLHSYAAHHRPFLS 101

Query: 603 XXXXXXXXXFMTHYVMLLSSFKEQ 674
                    F+  Y+MLL SF+EQ
Sbjct: 102 PHDKQELDSFLAQYMMLLCSFREQ 125



>gb:AB061819_1522093 Oryza sativa (japonica cultivar-group) HOS66
           mRNA for KNOX family class 2 homeodomain protein,
           complete cds.
          Length = 314

 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 37/84 (44%), Positives = 53/84 (63%)
 Frame = +3

Query: 423 REKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXX 602
           R+  K ++  HPL +QL++AHV CLR+ATP+D LP IDAQLAQS  ++ +Y++       
Sbjct: 50  RQLLKGEIAVHPLCEQLVAAHVGCLRVATPIDHLPLIDAQLAQSSGLLHSYAAHHRPFLS 109

Query: 603 XXXXXXXXXFMTHYVMLLSSFKEQ 674
                    F+  Y+MLL SF+EQ
Sbjct: 110 PHDKQELDSFLAQYMMLLCSFREQ 133



>gb:AF285148_1783116 Physcomitrella patens class 2 KNOTTED1-like
           protein MKN1-3 (MKN1-3) gene, complete cds.
          Length = 533

 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 39/87 (44%), Positives = 52/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query: 417 WVREKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAH- 593
           W + + K  ++ HPLY  LL+AH SCLR+ TPVDQLP I+AQL Q+++V + YS L    
Sbjct: 264 WEQARDKFLIVAHPLYPDLLNAHASCLRVGTPVDQLPHIEAQLTQARHVTSKYSVLHPDH 323

Query: 594 -XXXXXXXXXXXXFMTHYVMLLSSFKE 671
                        FM  Y+MLL SFK+
Sbjct: 324 LEITEDEKTELDQFMAQYIMLLCSFKD 350



>gb:AF533597_1809465 Lycopersicon esculentum knotted protein TKN4
           (kn4) mRNA, complete cds.
          Length = 335

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA + NHPLY  LLSA++ C ++  P +    +D ++++  N++    S   H       
Sbjct: 77  KAQIANHPLYPNLLSAYLQCRKVGAPQEMTSILD-EISKENNLI----SSSRHSSEIGAD 131

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  +KE+
Sbjct: 132 PELDEFMESYCAVLVKYKEE 151



>gb:AF375968_1792979 Lycopersicon esculentum knotted homeodomain
           protein 4 (KN4) mRNA, partial cds.
          Length = 338

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA + NHPLY  LLSA++ C ++  P +    +D ++++  N++    S   H       
Sbjct: 80  KAQIANHPLYPNLLSAYLQCRKVGAPQEMTSILD-EISKENNLI----SSSRHSSEIGAD 134

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  +KE+
Sbjct: 135 PELDEFMESYCAVLVKYKEE 154



>gb:AF544052_1810418 Nicotiana tabacum knotted 1 (kn1) mRNA,
           complete cds.
          Length = 327

 Score = 42.7 bits (99), Expect = 0.006
 Identities = 22/80 (27%), Positives = 41/80 (51%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA + NHPLY  LLSA++ C ++ TP  ++  I  ++++  +++++      H       
Sbjct: 58  KAQIANHPLYPNLLSAYLQCRKVGTP-QEMASILEEISKENHLISS-----CHNTEIGTD 111

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  +KE+
Sbjct: 112 PELDDFMESYCAVLLKYKEE 131



>gb:AB025573_1516211 Nicotiana tabacum NTH1 mRNA for KN1-type
           homeobox protein, complete cds.
          Length = 327

 Score = 40.8 bits (94), Expect = 0.022
 Identities = 21/80 (26%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA + NHPLY  LLSA++ C ++  P  ++  I  ++++  +++++      H       
Sbjct: 58  KAQIANHPLYPNLLSAYLQCRKVGAP-QEMASILEEISKENHLISS-----GHNTEIGTD 111

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  +KE+
Sbjct: 112 PELDDFMESYCAVLLKYKEE 131



>gb:AF284817_1783102 Physcomitrella patens class 1 KNOTTED1-like
           protein MKN4 (MKN4) gene, complete cds.
          Length = 488

 Score = 40.0 bits (92), Expect = 0.037
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = +3

Query: 444 LLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSL-LAHXXXXXXXXX 620
           +++HPLY +L+ AH+S  +I  P   L ++D    + Q      SS  + H         
Sbjct: 217 IVDHPLYPELVVAHISIFKIGAPKGLLIKLDEMEKKFQRFQYGESSWNVLHVTKFGQDPS 276

Query: 621 XXXFMTHYVMLLSSFKE 671
              FM  Y+ LL+ F+E
Sbjct: 277 LDFFMRSYIDLLTKFRE 293



>gb:AF063248_1765407 Picea abies homeobox protein mRNA, complete
           cds.
          Length = 434

 Score = 38.9 bits (89), Expect = 0.083
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           E  KA +L HP Y  LL A++ C +I  P + + R+DA   + +N
Sbjct: 171 EAIKAKILAHPQYPSLLGAYIDCQKIGAPPEVVARLDALTHEYEN 215



>gb:PMU90092_1700844 Picea mariana homeobox transcription factor
           SKN2 mRNA, complete cds.
          Length = 442

 Score = 38.9 bits (89), Expect = 0.083
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           E  KA +L HP Y  LL A++ C +I  P + + R+DA   + +N
Sbjct: 179 EAIKAKILAHPQYPSLLGAYIDCQKIGAPPEVVARLDALTHEYEN 223



>gb:AY680383_1622058 Picea glauca homeobox transcription factor KN2
           (Kn2) gene, exons 1, 2, 3 and partial cds.
          Length = 248

 Score = 38.9 bits (89), Expect = 0.083
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           E  KA +L HP Y  LL A++ C +I  P + + R+DA   + +N
Sbjct: 171 EAIKAKILAHPQYPSLLGAYIDCQKIGAPPEVVARLDALTHEYEN 215



>gb:AY169493_1586531 Nicotiana tabacum Knotted-1-like homeobox
           protein H1 (H1) mRNA, complete cds.
          Length = 343

 Score = 38.9 bits (89), Expect = 0.083
 Identities = 20/80 (25%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           K+ ++ HP Y +LLSA+V+C +I  P + + R++   A S  +  N   ++         
Sbjct: 88  KSKIMAHPHYPRLLSAYVNCQKIGAPPEVVARLEEVCATSATIGRNSGGIIGE------D 141

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L+ ++++
Sbjct: 142 PALDQFMEAYCEMLTKYEQE 161



>pir|T01735|T01735 homeobox protein NTH15 - common
           tobacco>gb:AB004785_1509180 Nicotiana tabacum NTH15
           mRNA, complete cds.
          Length = 342

 Score = 38.9 bits (89), Expect = 0.083
 Identities = 20/80 (25%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           K+ ++ HP Y +LLSA+V+C +I  P + + R++   A S  +  N   ++         
Sbjct: 88  KSKIMAHPHYPRLLSAYVNCQKIGAPPEVVARLEEVCATSATIGRNSGGIIGE------D 141

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L+ ++++
Sbjct: 142 PALDQFMEAYCEMLTKYEQE 161



>gb:AF483278_1804042 Picea abies KNOTTED1-like homeodomain protein 3
           (HBK3) mRNA, complete cds.
          Length = 433

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           K+ +L HP Y  LL A++ C +I  P + + R+DA   + QN
Sbjct: 174 KSKILAHPQYPSLLGAYIDCQKIGAPPEAVARLDALTREYQN 215



>gb:AY680381_1622056 Picea glauca homeobox transcription factor KN1
           (Kn1) gene, exons 1, 2, 3 and partial cds.
          Length = 238

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           K+ +L HP Y  LL A++ C +I  P + + R+DA   + QN
Sbjct: 174 KSKILAHPQYPSLLGAYIDCQKIGAPPEAVARLDALTREYQN 215



>gb:PMU90091_1700843 Picea mariana homeobox transcription factor
           SKN1 mRNA, complete cds.
          Length = 433

 Score = 38.1 bits (87), Expect = 0.14
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           K+ +L HP Y  LL A++ C +I  P + + R+DA   + QN
Sbjct: 174 KSKILAHPQYPSLLGAYIDCQKIGAPPEAVARLDALTHEYQN 215



>gb:AY680402_1622077 Pinus taeda homeobox transcription factor KN1
           (Kn1) mRNA, complete cds.
          Length = 434

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           K+ +L HP Y  LL A++ C +I  P + + R+DA   + Q+
Sbjct: 175 KSKILAHPQYPSLLGAYIDCQKIGAPPEAVARLDALTREHQD 216



>gb:AY680380_1622055 Pinus strobus homeobox transcription factor KN1
           (Kn1) gene, exons 1, 2, 3 and partial cds.
          Length = 240

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           K+ +L HP Y  LL A++ C +I  P + + R+DA   + Q+
Sbjct: 176 KSKILAHPQYPSLLGAYIDCQKIGAPPEAVARLDALTREHQD 217



>sp|O04134|HKL1_MALDO Homeobox protein knotted-1 like 1
           (KNAP1).>pir|T17009|T17009 knotted1-like homeobox
           protein - apple tree>gb:MDKN11_1685934 M.domestica mRNA
           for kn1-like protein (1759 bp).
          Length = 398

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRI 533
           E  KA ++ HP Y  L+ A++ C R+  P D +PR+
Sbjct: 131 EAIKAKIIAHPQYSNLVEAYMDCQRVGAPSDVVPRL 166



>gb:AY072735_1567388 Antirrhinum majus invaginata (ina) mRNA,
           complete cds.
          Length = 351

 Score = 36.6 bits (83), Expect = 0.41
 Identities = 19/83 (22%), Positives = 40/83 (48%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXX 605
           +  KA ++ HP Y +LL+A+++C +I  P +   +++   A +  +  N  S +      
Sbjct: 96  DSVKAKIMAHPYYHKLLAAYINCQKIGAPPEVAVKLEEACASAATMGRNSVSRIGE---- 151

Query: 606 XXXXXXXXFMTHYVMLLSSFKEQ 674
                   FM  Y  +LS ++++
Sbjct: 152 --DPALDQFMEAYCEMLSKYEQE 172



>gb:AF527947_1808527 Brassica oleracea homeodomain protein BOSTM-1
           (STM-1) mRNA, complete cds.
          Length = 380

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 19/80 (23%), Positives = 39/80 (48%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA ++ HP Y +LL A+V+C ++  P    P + A+L ++ +  A  ++ +         
Sbjct: 122 KAKIMGHPHYHRLLLAYVNCQKVGAP----PEVQARLEETCSSAAAAAASMGPTGSLGED 177

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  ++++
Sbjct: 178 PGLDQFMEAYCEMLVKYEQE 197



>gb:HTU519674_1682195 Helianthus tuberosus mRNA for putative
           knotted-1-like protein (knot1HT gene).
          Length = 362

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSS 581
           KA +++HP Y +LLSA+++C +I  P + + R++   A   +VVA  SS
Sbjct: 95  KAKIMSHPHYPRLLSAYLNCQKIGAPPEVVERLEE--ACRASVVAAMSS 141



>gb:AY680382_1622057 Pinus strobus homeobox transcription factor KN2
           (Kn2) gene, exons 1, 2, 3 and partial cds.
          Length = 244

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           K+ +L HP Y  LL A++ C +I  P +   R+DA   + +N
Sbjct: 170 KSKILAHPQYPSLLGAYIDCQKIGAPPEVAARLDALTREYEN 211



>gb:AY096802_1576296 Helianthus annuus knotted-1-like protein 1
           (kn1) mRNA, complete cds.
          Length = 362

 Score = 36.2 bits (82), Expect = 0.54
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSS 581
           KA +++HP Y +LLSA+++C +I  P + + R++   A   +VVA  SS
Sbjct: 95  KAKIMSHPHYPRLLSAYLNCQKIGAPPEVVERLEE--ACRASVVAAMSS 141



>gb:AY112704_1578154 Petunia x hybrida shootmeristemless-like mRNA,
           complete cds.
          Length = 347

 Score = 35.8 bits (81), Expect = 0.70
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVAN 572
           KA ++ HP Y +LL+A+++C +I  P + + R++   A S ++  N
Sbjct: 86  KAKIMAHPHYPRLLAAYINCQKIGAPPEVVARLEEVCATSAHMGRN 131



>sp|P46608|HMB1_SOYBN Homeobox protein SBH1.>pir|S42543|S42543
           hypothetical protein - soybean>gb:SOYHOMEOGE_1716020
           Glycine max homeobox-containing (Sbh1) mRNA, complete
           cds.
          Length = 379

 Score = 35.8 bits (81), Expect = 0.70
 Identities = 18/80 (22%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA ++ HP Y +LL+A+V+C ++  P + + R++   A +  +    ++  A        
Sbjct: 125 KAKIMAHPHYHRLLAAYVNCQKVGAPPEVVARLEEACASAATMAGGDAA--AGSSCIGED 182

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L+ ++++
Sbjct: 183 PALDQFMEAYCEMLTKYEQE 202



>gb:AY680403_1622078 Pinus taeda homeobox transcription factor KN2
           (Kn2) mRNA, complete cds.
          Length = 429

 Score = 35.4 bits (80), Expect = 0.92
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQN 560
           K+ +L HP Y  LL A++ C +I  P +   R+DA   + +N
Sbjct: 169 KSKILAHPQYPNLLGAYIDCQKIGAPPEVASRLDALSHEYEN 210



>gb:AB016002_1512743 Ipomoea nil PKn3 (knotted-like gene) mRNA,
           complete cds.
          Length = 358

 Score = 35.4 bits (80), Expect = 0.92
 Identities = 22/80 (27%), Positives = 36/80 (45%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA + +HPLY  L+SA++ C ++A P    P + A L +   V    ++           
Sbjct: 100 KAQIASHPLYPNLVSAYIQCRKVAAP----PEMAALLEELSKVTQPITT-----AEIGAD 150

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  +KE+
Sbjct: 151 PELDEFMESYCEVLYKYKEE 170



>sp|Q9M6D9|STM_BRAOL Homeobox protein
           Shootmeristemless.>gb:AF193813_1775565 Brassica oleracea
           shoot meristemless (Stm) mRNA, complete cds.
          Length = 383

 Score = 35.4 bits (80), Expect = 0.92
 Identities = 19/80 (23%), Positives = 39/80 (48%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA ++ HP Y +LL A+V+C ++  P    P + A+L ++ +  A  ++ +         
Sbjct: 124 KAKIMAHPHYHRLLLAYVNCQKVGAP----PEVQARLEETCSSAAAAAASMGPTGSLGED 179

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  ++++
Sbjct: 180 PGLDQFMEAYCEMLVKYEQE 199



>gb:AF404814_1796804 Malus x domestica KNAP2-like protein mRNA,
           partial cds.
          Length = 76

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRI 533
           E  KA ++ HP Y  LL A++ C R+  P D + R+
Sbjct: 24  EAIKAKIIAHPQYSNLLEAYMDCQRVGAPSDVVARL 59



>sp|O04135|HKL2_MALDO Homeobox protein knotted-1 like 2
           (KNAP2).>pir|T17008|T17008 knotted1-like homeobox
           protein - apple tree>gb:MDKN12_1685935 M.domestica mRNA
           for kn1-like protein (1791 bp).
          Length = 397

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRI 533
           E  KA ++ HP Y  LL A++ C R+  P D + R+
Sbjct: 130 EAIKAKIIAHPQYSNLLEAYMDCQRVGAPSDVVARL 165



>gb:AC090683_1734403 Oryza sativa chromosome 3 BAC OSJNBa0035I24
           genomic sequence, complete sequence.
          Length = 337

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 18/80 (22%), Positives = 37/80 (46%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA +++HPLY  LL A + C ++  P + + R+ A   +  +   +      +       
Sbjct: 63  KAKIMSHPLYPALLRAFIDCQKVGAPPEVVGRLSALAGELDSRAED-----RYLQGQSSD 117

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y+ +L S++++
Sbjct: 118 PELDEFMETYIDMLVSYRQE 137



>gb:AY080857_1568547 Arabidopsis thaliana putative homeobox protein
           (At1g62360) mRNA, partial cds.
          Length = 326

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/80 (23%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA ++ HP Y +LL+A+V+C ++  P    P + A+L ++ +  A  ++ +         
Sbjct: 66  KAKIMAHPHYHRLLAAYVNCQKVGAP----PEVVARLEEACSSAAAAAASMGPTGCLGED 121

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  ++++
Sbjct: 122 PGLDQFMEAYCEMLVKYEQE 141



>gb:AE005173_893905 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC003113_1531104 Genomic sequence
           for Arabidopsis thaliana BAC F24O1 from chromosome I,
           complete sequence.
          Length = 377

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/80 (23%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA ++ HP Y +LL+A+V+C ++  P    P + A+L ++ +  A  ++ +         
Sbjct: 122 KAKIMAHPHYHRLLAAYVNCQKVGAP----PEVVARLEEACSSAAAAAASMGPTGCLGED 177

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  ++++
Sbjct: 178 PGLDQFMEAYCEMLVKYEQE 197



>pir|S68456|S68456 homeotic protein shootmeristemless, KNOTTED-like
           - Arabidopsis thaliana>gb:ATU32344_1556908 Arabidopsis
           thaliana Shootmeristemless (STM) mRNA, complete cds.
          Length = 382

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/80 (23%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA ++ HP Y +LL+A+V+C ++  P    P + A+L ++ +  A  ++ +         
Sbjct: 122 KAKIMAHPHYHRLLAAYVNCQKVGAP----PEVVARLEEACSSAAAAAASMGPTGCLGED 177

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  ++++
Sbjct: 178 PGLDQFMEAYCEMLVKYEQE 197



>sp|Q38874|STM_ARATH Homeobox protein SHOOT
           MERISTEMLESS.>pir|T01446|T01446 hypothetical protein
           F24O1.8 - Arabidopsis thaliana
          Length = 382

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/80 (23%), Positives = 40/80 (50%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           KA ++ HP Y +LL+A+V+C ++  P    P + A+L ++ +  A  ++ +         
Sbjct: 122 KAKIMAHPHYHRLLAAYVNCQKVGAP----PEVVARLEEACSSAAAAAASMGPTGCLGED 177

Query: 615 XXXXXFMTHYVMLLSSFKEQ 674
                FM  Y  +L  ++++
Sbjct: 178 PGLDQFMEAYCEMLVKYEQE 197



>gb:AC090683_1734401 Oryza sativa chromosome 3 BAC OSJNBa0035I24
           genomic sequence, complete sequence.
          Length = 337

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDA 539
           KA +++HPLY  LL A V C ++  P + + R+ +
Sbjct: 72  KAKIMSHPLYPSLLRAFVDCKKVGAPPEVVGRLSS 106



>gb:AY072736_1567389 Antirrhinum majus hirzina (hirz) mRNA, complete
           cds.
          Length = 353

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLA 548
           KA ++ HP Y +LL+A+V+C +I  P + + R++   A
Sbjct: 108 KAKIMAHPHYHRLLAAYVNCHKIGAPPEVVSRLEEAAA 145



>gb:AB025713_1516734 Nicotiana tabacum mRNA for homeobox 9, complete
           cds.
          Length = 322

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 19/78 (24%), Positives = 36/78 (46%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXXXXX 614
           +A + +HPLY +LL  ++ C ++  P D++      +  + N+V + + L          
Sbjct: 81  RAKISSHPLYPKLLRTYIDCHKVGAPSDEI----VDMLDNINIV-HENDLSRRSNRLSDD 135

Query: 615 XXXXXFMTHYVMLLSSFK 668
                FM  Y  +L+ FK
Sbjct: 136 SELDAFMETYCDVLAKFK 153



>gb:AY781901_1628330 Saccharum hybrid cultivar isolate c53a homeobox
           protein mRNA, complete cds.
          Length = 315

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 23/83 (27%), Positives = 36/83 (43%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXX 605
           E  KA + +HP Y  LLSA++ C ++  P    P++ + L   + V    S   A     
Sbjct: 38  ELMKAQIASHPRYPSLLSAYIECRKVGAP----PQVASLL---EEVSRERSPGAAGAGEI 90

Query: 606 XXXXXXXXFMTHYVMLLSSFKEQ 674
                   FM  Y  +L  +KE+
Sbjct: 91  GVDPELDEFMDSYCRVLVRYKEE 113



>pir|T06382|T06382 Knox protein 1 - garden pea>gb:AF063307_1765410
           Pisum sativum Knox class 1 protein (Hop1) mRNA, complete
           cds.>gb:AF080104_1766433 Pisum sativum knotted1-like
           class I homeodomain protein (PsKn1) mRNA, complete cds.
          Length = 371

 Score = 33.5 bits (75), Expect = 3.5
 Identities = 12/40 (30%), Positives = 25/40 (62%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQS 554
           KA ++ HP Y +LL A+++C ++  P + + R++   A +
Sbjct: 115 KAKIMAHPHYHRLLEAYINCQKVGAPSEVVTRLEEACASA 154



>gb:AY655754_1620249 Streptocarpus saxorum STM1 protein mRNA,
           complete cds.
          Length = 353

 Score = 33.1 bits (74), Expect = 4.5
 Identities = 13/40 (32%), Positives = 26/40 (65%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQS 554
           K+ ++ HP Y +LL+A+VSC +I  P + + +++   A +
Sbjct: 98  KSKIIAHPHYPRLLAAYVSCQKIGAPPEVVAKLEEVCASA 137



>gb:AF457122S1_1801307 Zea mays knotted1-like homeodomain protein
           liguleless4b (lg4b) gene, exons 1, 2, 3 and partial cds.
          Length = 150

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/83 (25%), Positives = 36/83 (43%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXX 605
           E  KA +  HP Y  LLSA++ C ++  P  ++  +  ++ + +   A+     A     
Sbjct: 44  ELVKAQIAGHPRYPSLLSAYIDCRKVGAP-SEVATLLEEIGRERCAAAS-----AGGEVV 97

Query: 606 XXXXXXXXFMTHYVMLLSSFKEQ 674
                   FM  Y  LL  +KE+
Sbjct: 98  GMDPELDEFMETYCRLLERYKEE 120



>gb:AF457119_1801304 Zea mays knotted1-like homeodomain protein
           liguleless4b (lg4b) mRNA, complete cds.
          Length = 298

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/83 (25%), Positives = 36/83 (43%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQSQNVVANYSSLLAHXXXX 605
           E  KA +  HP Y  LLSA++ C ++  P  ++  +  ++ + +   A+     A     
Sbjct: 44  ELVKAQIAGHPRYPSLLSAYIDCRKVGAP-SEVATLLEEIGRERCAAAS-----AGGEVV 97

Query: 606 XXXXXXXXFMTHYVMLLSSFKEQ 674
                   FM  Y  LL  +KE+
Sbjct: 98  GMDPELDEFMETYCRLLERYKEE 120



>gb:LEU76408_1684761 Lycopersicon esculentum knotted 3 protein
           (TKn3) mRNA, complete cds.
          Length = 320

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 11/26 (42%), Positives = 19/26 (73%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATP 512
           KA +L+HP Y +LL+A++ C ++  P
Sbjct: 91  KAKILSHPYYPKLLNAYIDCQKVGAP 116



>gb:DOR276389_1675995 Dendrobium grex Madame Thong-IN mRNA for
           knotted1-like homeobox protein.
          Length = 286

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +3

Query: 426 EKCKADLLNHPLYDQLLSAHVSCLRIATPVD 518
           E+ KA + +HP Y  LL A++ C ++  P D
Sbjct: 39  EEMKARIASHPRYPHLLEAYIDCQKVGAPPD 69



>gb:AY655753_1620248 Streptocarpus rexii STM1 protein mRNA, complete
           cds.
          Length = 358

 Score = 32.3 bits (72), Expect = 7.7
 Identities = 12/40 (30%), Positives = 26/40 (65%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQS 554
           K+ ++ HP Y +LL+A+V+C +I  P + + +++   A +
Sbjct: 103 KSKIMAHPHYPRLLAAYVNCQKIGAPPEVVAKLEEACAST 142



>gb:AY655752_1620247 Streptocarpus dunnii STM1 protein mRNA, partial
           cds.
          Length = 356

 Score = 32.3 bits (72), Expect = 7.7
 Identities = 12/40 (30%), Positives = 26/40 (65%)
 Frame = +3

Query: 435 KADLLNHPLYDQLLSAHVSCLRIATPVDQLPRIDAQLAQS 554
           K+ ++ HP Y +LL+A+V+C +I  P + + +++   A +
Sbjct: 101 KSKIMAHPHYPRLLAAYVNCQKIGAPPEVVAKLEEACAST 140


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 447,956,385
Number of Sequences: 1806583
Number of extensions: 6263613
Number of successful extensions: 17225
Number of sequences better than 10.0: 71
Number of HSP's better than 10.0 without gapping: 16424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17180
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 37973313560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)