BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6527
         (1424 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF414114_1797603 Solanum tuberosum G protein beta subunit 2 (...   657   0.0     
gb:AF170921_1774379 Pisum sativum G protein beta subunit mRNA, c...   656   0.0     
sp|P93398|GBB2_TOBAC|GBB2_TOBAC Guanine nucleotide-binding protein beta sub...   655   0.0     Nicotiana tabacum [American tobacco]
gb:AF249743_1780784 Nicotiana tabacum heterotrimeric GTP-binding...   654   0.0     
sp|P93397|GBB1_TOBAC|GBB1_TOBAC Guanine nucleotide-binding protein beta sub...   654   0.0     Nicotiana tabacum [American tobacco]
gb:AF533440_1809462 Pisum sativum G protein beta subunit gene, c...   650   0.0     
sp|P93563|GBB_SOLTU|GBB_SOLTU Guanine nucleotide-binding protein beta subu...   650   0.0     Solanum tuberosum [potatoes]
gb:AF145976_1772045 Pisum sativum G protein beta subunit mRNA, c...   649   0.0     
sp|Q40507|GBB3_TOBAC|GBB3_TOBAC Guanine nucleotide-binding protein beta sub...   646   0.0     Nicotiana tabacum [American tobacco]
sp|P93339|GBB_NICPL|GBB_NICPL Guanine nucleotide-binding protein beta subu...   641   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P49177|GBB_ARATH|GBB_ARATH Guanine nucleotide-binding protein beta subu...   604   e-171   Arabidopsis thaliana [mouse-ear cress]
sp|Q40687|GBB_ORYSA|GBB_ORYSA Guanine nucleotide-binding protein beta subu...   604   e-171   Oryza sativa [red rice]
sp|P49178|GBB_MAIZE|GBB_MAIZE Guanine nucleotide-binding protein beta subu...   604   e-171   Zea mays [maize]
gb:BT020366_1642761 Arabidopsis thaliana At4g34460 gene, complet...   598   e-170   
gb:AB090160_1524945 Triticum aestivum TaGB1 mRNA for G protein b...   587   e-166   
pir|T08036|T08036 GTP-binding regulatory protein beta chain - wi...   576   e-163   Avena fatua
gb:PPA428878_1701231 Physcomitrella patens mRNA for putative het...   426   e-118   
gb:NTU22524_1691820 Nicotiana tabacum heterotrimeric GTP-binding...   422   e-117   
pir|T02059|T02059 GTP-binding regulatory protein beta chain - co...   422   e-117   Nicotiana tabacum [American tobacco]
gb:AF056182_1764686 Emericella nidulans G-protein beta subunit (...   338   1e-91   
gb:AF484341_1804059 Sporothrix schenckii G-protein beta subunit ...   335   1e-90   
gb:AB072452_1523016 Fusarium oxysporum fgb1 gene for guanine nuc...   334   2e-90   
sp|O14435|GBB_CRYPA|GBB_CRYPA Guanine nucleotide-binding protein beta subu...   333   7e-90   Cryphonectria parasitica
gb:AB086901_1524594 Magnaporthe grisea Mgb1 gene for heterotrime...   332   9e-90   
gb:AY190116_1588470 Trichoderma atroviride heterotrimeric G prot...   331   2e-89   
gb:BX908807_1644488 Neurospora crassa DNA linkage group III BAC ...   330   3e-89   
gb:AF536325_1809659 Ustilago maydis G-protein beta subunit Bpp1 ...   327   5e-88   
gb:AY661671_1620416 Lentinula edodes guanine nucleotide binding ...   326   6e-88   
gb:AY211190_1589696 Cochliobolus heterostrophus G-protein beta s...   326   6e-88   
gb:AF277161_2483898 Ambystoma tigrinum G-protein B1 subunit mRNA...   323   5e-87   
gb:BC056708_2551901 Danio rerio guanine nucleotide binding prote...   323   7e-87   
gb:AF091120_1767420 Filobasidiella neoformans G-protein beta sub...   323   7e-87   
gb:BC084263_2563650 Xenopus laevis beta 1 subunit of heterotrime...   322   9e-87   
gb:BC044482_2548786 Danio rerio guanine nucleotide binding prote...   322   9e-87   
gb:AB099715_2464872 Oryzias latipes Ol-Gb1 mRNA for guanine nucl...   322   9e-87   
gb:BC076910_2559649 Xenopus tropicalis guanine nucleotide bindin...   322   1e-86   
pir|S09591|RGKWB GTP-binding regulatory protein beta chain - Cae...   322   1e-86   
gb:AE017344_1756343 Cryptococcus neoformans var. neoformans JEC2...   322   2e-86   
sp|P54311|GBB1_RAT|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/...   321   2e-86   Rattus norvegicus [brown rat]
gb:AJ719819_2502006 Gallus gallus mRNA for hypothetical protein,...   321   3e-86   
sp|P79959|GBB1_XENLA|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S...   320   3e-86   Xenopus laevis [clawed frog]
gb:AB071106_1871172 Macaca fascicularis testis cDNA clone:QtsA-1...   320   5e-86   
gb:AB071095_1871161 Macaca fascicularis testis cDNA clone:QtsA-1...   320   5e-86   
sp|P04901|GBB1_HUMAN|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S...   320   5e-86   Homo sapiens [man]
gb:CR860734_1184787 Pongo pygmaeus mRNA; cDNA DKFZp459O1427 (fro...   320   6e-86   
sp|P17343|GBB1_CAEEL|GBB1_CAEEL Guanine nucleotide-binding protein beta sub...   320   6e-86   Caenorhabditis elegans [roundworm]
sp|P36408|GBB_DICDI|GBB_DICDI Guanine nucleotide-binding protein beta subu...   319   8e-86   Dictyostelium discoideum
gb:BTTRDBR_1437413 Bovine retinal mRNA for transducin beta-subunit.   319   1e-85   
gb:AY392427_2084491 Cricetulus griseus guanine nucleotide bindin...   316   7e-85   
gb:AY626793_1341614 Litopenaeus vannamei G protein beta 1 subuni...   316   7e-85   
gb:RNU88324_2137869 Rattus norvegicus G protein beta1 subunit (r...   316   9e-85   
gb:AF306565_1784516 Pneumocystis carinii guanine nucleotide-bind...   315   1e-84   
gb:BC056002_2551585 Xenopus laevis guanine nucleotide binding pr...   314   2e-84   
gb:BC084504_2563875 Xenopus tropicalis hypothetical LOC496520, m...   313   4e-84   
gb:BC055978_2551562 Xenopus laevis G protein beta-subunit gene, ...   313   6e-84   
sp|O45040|GBB1_HOMAM|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S...   311   2e-83   Homarus americanus
gb:AK030354_1161960 Mus musculus adult male pituitary gland cDNA...   311   2e-83   
sp|Q61011|GBB3_MOUSE|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S...   311   2e-83   Mus musculus [mouse]
sp|P26308|GBB1_DROME|GBB1_DROME Guanine nucleotide-binding protein beta sub...   310   4e-83   Drosophila melanogaster
gb:BC074250_2557765 Xenopus laevis MGC84000 protein, mRNA (cDNA ...   310   5e-83   
gb:BC084797_2564042 Xenopus laevis hypothetical LOC495335, mRNA ...   310   6e-83   
gb:BC000115_1966437 Homo sapiens guanine nucleotide binding prot...   309   8e-83   
gb:AY884129_1631976 Thanatephorus cucumeris guanine nucleotide b...   309   8e-83   
sp|P16520|GBB3_HUMAN|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S...   309   1e-82   Homo sapiens [man]
gb:AY205294_1309687 Sitobion avenae heterotrimeric guanine nucle...   308   1e-82   
sp|P52287|GBB3_RAT|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/...   307   4e-82   Rattus norvegicus [brown rat]
gb:AY524667_1333026 Pinctada fucata G protein beta subunit mRNA,...   306   5e-82   
sp|P79147|GBB3_CANFA|GBB3_CANFA Guanine nucleotide-binding protein G(I)/G(S...   306   9e-82   Canis lupus familiaris [dogs]
sp|Q08706|GBB_LYMST|GBB_LYMST Guanine nucleotide-binding protein beta subu...   305   1e-81   Lymnaea stagnalis
sp|Q9HAV0|GBB4_HUMAN|GBB4_HUMAN Guanine nucleotide-binding protein beta sub...   305   2e-81   Homo sapiens [man]
pir|A26617|RGBOB2 GTP-binding regulatory protein beta-2 chain - ...   304   3e-81   
sp|P11016|GBB2_HUMAN|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S...   304   3e-81   Homo sapiens [man]
sp|P11017|GBB2_BOVIN|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S...   304   3e-81   Bos taurus [bovine]
gb:MMU34960_2120934 Mouse G protein beta 2 subunit mRNA, complet...   304   3e-81   
gb:AY552804_2086499 Rattus norvegicus G-protein beta 4 subunit (...   304   3e-81   
sp|P29387|GBB4_MOUSE|GBB4_MOUSE Guanine nucleotide-binding protein beta sub...   304   3e-81   Mus musculus [mouse]
gb:HUMGP_2031605 Human signal-transducing guanine nucleotide-bin...   303   8e-81   
pir|JS0669|RGMSB4 GTP-binding regulatory protein beta-4 chain - ...   303   8e-81   
gb:AF277162_2483899 Ambystoma tigrinum G-protein B3 subunit mRNA...   301   2e-80   
gb:AY389499_1324996 Loligo pealei visual G-protein beta subunit ...   301   2e-80   
sp|P23232|GBB_LOLFO|GBB_LOLFO Guanine nucleotide-binding protein beta subu...   301   2e-80   Loligo forbesii
gb:AF501886_2067152 Mus musculus guanine nucleotide binding prot...   300   4e-80   
gb:AB047301_1195879 Halocynthia roretzi HrG-beta mRNA for G prot...   299   1e-79   
gb:AJ719919_2502106 Gallus gallus mRNA for hypothetical protein,...   298   2e-79   
sp|P54313|GBB2_RAT|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/...   295   1e-78   Rattus norvegicus [brown rat]
gb:BC076127_2559002 Danio rerio guanine nucleotide binding prote...   295   2e-78   
gb:AY050538_1562266 Phytophthora infestans isolate H30P04 G-prot...   291   2e-77   
gb:AF369757_2489646 Ambystoma tigrinum G-protein beta 5 mRNA, co...   283   8e-75   
gb:BC059544_2552521 Danio rerio guanine nucleotide binding prote...   282   1e-74   
gb:AB070162_1871033 Macaca fascicularis testis cDNA clone:QtsA-1...   282   1e-74   
pir|A54969|A54969 beta-5 GTP-binding protein - mouse>gb:AF001953...   281   2e-74   Mus musculus [mouse]
sp|P54314|GBB5_MOUSE|GBB5_MOUSE Guanine nucleotide-binding protein beta sub...   281   2e-74   Mus musculus [mouse]
gb:AF480880_2066808 Tamias striatus G protein beta subunit 5 sho...   281   2e-74   
gb:AF017656_1876801 Homo sapiens G protein beta 5 subunit mRNA, ...   281   2e-74   
gb:CR857754_1181968 Pongo pygmaeus mRNA; cDNA DKFZp469O0337 (fro...   281   2e-74   
sp|O14775|GBB5_HUMAN|GBB5_HUMAN Guanine nucleotide-binding protein beta sub...   281   2e-74   Homo sapiens [man]
gb:AY591252_1431703 Oryctolagus cuniculus guanine nucleotide bin...   281   3e-74   
gb:AE014298_1124760 Drosophila melanogaster chromosome X, comple...   276   6e-73   
gb:BC059436_2552413 Danio rerio guanine nucleotide binding prote...   275   1e-72   
gb:HUMTRNB1_2037888 Human transducin beta-1 subunit mRNA, 3' end.     268   2e-70   
sp|Q20636|GBB2_CAEEL|GBB2_CAEEL Guanine nucleotide-binding protein beta sub...   263   7e-69   Caenorhabditis elegans [roundworm]
gb:AB057374_2462759 Oryzias latipes Ol-Gb mRNA for guaninenucleo...   262   1e-68   
gb:BC085387_2564338 Danio rerio zgc:101614, mRNA (cDNA clone MGC...   243   9e-63   
gb:A92590_1451234 Sequence 1 from Patent WO9811212.                   241   3e-62   
gb:AF397193_2064860 Rattus norvegicus G-protein beta-2 subunit m...   238   2e-61   
pir|S72457|S72457 GTP-binding regulatory protein beta chain - fi...   227   4e-58   Schizosaccharomyces pombe
sp|Q10282|GBB_SCHPO|GBB_SCHPO Guanine nucleotide-binding protein beta subu...   227   4e-58   Schizosaccharomyces pombe
gb:GCY14250_1385215 Geodia cydonium mRNA for G protein beta subu...   222   1e-56   
gb:CVI250442_1376009 Calliphora vicina mRNA for guanine nucleoti...   221   4e-56   
gb:AF070603_1880754 Homo sapiens clone 24584 beta-subunit signal...   220   5e-56   
gb:BC015920_1975380 Homo sapiens guanine nucleotide binding prot...   218   2e-55   
gb:CR380958_1653187 Candida glabrata strain CBS138 chromosome L ...   212   2e-53   
pir|JU0269|RGFFB GTP-binding regulatory protein beta chain - fru...   212   2e-53   
sp|P29829|GBB2_DROME|GBB2_DROME Guanine nucleotide-binding protein beta sub...   211   4e-53   Drosophila melanogaster
gb:HS283E3_1997889 Human DNA sequence from clone RP1-283E3 on ch...   209   1e-52   
gb:CR382135_1668471 Debaryomyces hansenii chromosome C of strain...   208   3e-52   
gb:BOVGP_1435480 Bovine signal-transducing guanine nucleotide-bi...   208   3e-52   
gb:DROGNRPBS_1382073 Drosophila melanogaster guanine nucleotide ...   208   3e-52   
gb:AE016816_1746787 Ashbya gossypii (= Eremothecium gossypii) AT...   203   6e-51   
gb:CR382131_1663509 Yarrowia lipolytica chromosome E of strain C...   199   9e-50   
sp|P18851|GBB_YEAST|GBB_YEAST Guanine nucleotide-binding protein beta subu...   199   9e-50   Saccharomyces cerevisiae [brewer's yeast]
gb:YSCSTE4_1730713 Saccharomyces cerevisiae mating factor recept...   197   3e-49   
gb:CR382124_1656626 Kluyveromyces lactis strain NRRL Y-1140 chro...   193   8e-48   
gb:AK018747_1159733 Mus musculus adult male kidney cDNA, RIKEN f...   191   2e-47   
gb:AF044736_1236091 Homarus americanus G protein beta 2 subunit ...   186   1e-45   
pir|T17256|T17256 hypothetical protein DKFZp586O1922.1 - human>g...   169   2e-40   Homo sapiens [man]
sp|Q00808|HET1_PODAN|HET1_PODAN Vegetatible incompatibility protein HET-E-1...   152   2e-35   Podospora anserina
gb:BA000045_744431 Gloeobacter violaceus PCC 7421 DNA, complete ...   146   9e-34   
gb:AF022086_2051145 Rattus norvegicus guanine nucleotide binding...   146   1e-33   
gb:AF323584_1786294 Podospora anserina beta transducin-like prot...   146   1e-33   
gb:AF323582_1786292 Podospora anserina beta transducin-like prot...   146   1e-33   
gb:AF323583_1786293 Podospora anserina beta transducin-like prot...   145   2e-33   
gb:MMGPRBSU_2115087 M.musculus mRNA for G-protein beta-subunit.       145   3e-33   
pir|S29121|S29121 GTP-binding regulatory protein beta chain - mo...   145   3e-33   Mus musculus [mouse]
gb:BA000045_742040 Gloeobacter violaceus PCC 7421 DNA, complete ...   142   2e-32   
sp|Q8YRI1|YY46_ANASP|YY46_ANASP Hypothetical WD-repeat protein alr3466.>pir...   139   2e-31   Anabaena sp.
gb:AF070597_1880751 Homo sapiens clone 24596 beta-subunit signal...   138   3e-31   
gb:BA000045_744426 Gloeobacter violaceus PCC 7421 DNA, complete ...   137   5e-31   
gb:AF323585_1786295 Podospora anserina beta transducin-like prot...   136   1e-30   
gb:BA000045_742896 Gloeobacter violaceus PCC 7421 DNA, complete ...   130   7e-29   
gb:BA000045_742963 Gloeobacter violaceus PCC 7421 DNA, complete ...   127   6e-28   
pir|AE1810|AE1810 WD-40 repeat protein [imported] - Nostoc sp. (...   127   7e-28   Nostoc sp. PCC 7120
sp|Q8YTC2|YS00_ANASP|YS00_ANASP Hypothetical WD-repeat protein alr2800.>pir...   125   3e-27   Anabaena sp.
gb:BA000045_741250 Gloeobacter violaceus PCC 7421 DNA, complete ...   122   2e-26   
pir|AE1861|AE1861 serine/threonine kinase with WD-40 repeat [imp...   120   9e-26   Nostoc sp. PCC 7120
gb:MMU38505_2121134 Mus musculus G protein beta 2 subunit mRNA, ...   119   1e-25   
pir|AI2493|AI2493 WD-repeat protein [imported] - Nostoc sp. (str...   118   3e-25   Nostoc sp. PCC 7120
pir|AD1842|AD1842 WD-40 repeat protein [imported] - Nostoc sp. (...   117   8e-25   Nostoc sp. PCC 7120
pir|AH2195|AH2195 hypothetical protein alr3119 [imported] - Nost...   116   1e-24   Nostoc sp. PCC 7120
pir|AG1889|AG1889 WD-40 repeat protein [imported] - Nostoc sp. (...   116   1e-24   Nostoc sp. PCC 7120
gb:BA000045_742730 Gloeobacter violaceus PCC 7421 DNA, complete ...   116   1e-24   
gb:MMU38494_2121123 Mus musculus G protein beta 3 subunit mRNA, ...   114   5e-24   
pir|AC1842|AC1842 WD-40 repeat protein [imported] - Nostoc sp. (...   113   1e-23   Nostoc sp. PCC 7120
gb:AK016201_1158645 Mus musculus adult male testis cDNA, RIKEN f...   111   3e-23   
sp|P49695|PKWA_THECU|PKWA_THECU Probable serine/threonine-protein kinase pk...   111   4e-23   Thermomonospora curvata
gb:BC089247_2566129 Xenopus laevis cDNA clone MGC:85213 IMAGE:33...   110   5e-23   
gb:AE010946_267844 Methanosarcina acetivorans str. C2A, section ...   110   5e-23   
gb:AK097409_1914851 Homo sapiens cDNA FLJ40090 fis, clone TESTI2...   110   7e-23   
gb:AK098821_1915232 Homo sapiens cDNA FLJ25955 fis, clone TST03904.   110   9e-23   
gb:BA000045_740981 Gloeobacter violaceus PCC 7421 DNA, complete ...   109   1e-22   
gb:BC064252_2553805 Xenopus tropicalis hypothetical protein MGC7...   108   2e-22   
gb:BA000039_726273 Thermosynechococcus elongatus BP-1 DNA, compl...   108   2e-22   
gb:SCO939118_177541 Streptomyces coelicolor A3(2) complete genom...   108   3e-22   
pir|T42045|T42045 beta transducin-like protein homolog - Strepto...   108   3e-22   Streptomyces coelicolor
sp|Q8YV57|YL24_ANASP|YL24_ANASP Hypothetical WD-repeat protein all2124.>pir...   108   4e-22   Anabaena sp.
pir|AH2154|AH2154 WD-repeat protein [imported] - Nostoc sp. (str...   107   6e-22   Nostoc sp. PCC 7120
pir|AB2410|AB2410 WD-repeat protein [imported] - Nostoc sp. (str...   107   8e-22   Nostoc sp. PCC 7120
pir|S33263|S33263 transcription initiation factor IID-associated...   106   1e-21   Drosophila melanogaster
sp|P49846|TAF5_DROME|TAF5_DROME Transcription initiation factor TFIID subun...   106   1e-21   Drosophila melanogaster
gb:BC067651_2554823 Danio rerio cDNA clone IMAGE:6963216, partia...   104   4e-21   
pir|AB2202|AB2202 hypothetical protein all3169 [imported] - Nost...   104   5e-21   Nostoc sp. PCC 7120
gb:AE016818_1747903 Ashbya gossypii (= Eremothecium gossypii) AT...   103   7e-21   
pir|AG1837|AG1837 WD-40 repeat protein [imported] - Nostoc sp. (...   103   9e-21   Nostoc sp. PCC 7120
gb:CZA382_119892 Amycolatopsis orientalis cosmid pCZA382.             102   1e-20   
gb:BC043494_1983422 Homo sapiens WD repeat domain 5B, mRNA (cDNA...   101   4e-20   
gb:AX878269_1477372 Sequence 13174 from Patent EP1074617.>gb:AK0...   101   4e-20   
gb:AC117075_1207781 Dictyostelium discoideum chromosome 2 map 52...   100   6e-20   
gb:CR857638_1181860 Pongo pygmaeus mRNA; cDNA DKFZp469A0528 (fro...   100   7e-20   
pir|AG2375|AG2375 WD-40 repeat-protein [imported] - Nostoc sp. (...   100   1e-19   Nostoc sp. PCC 7120
gb:BC081008_2561918 Xenopus laevis WD repeat domain 5, mRNA (cDN...   100   1e-19   
gb:BC077844_2560496 Xenopus laevis WD repeat domain 5, mRNA (cDN...    99   2e-19   
sp|Q9V3J8|WDS_DROME|WDS_DROME Will die slowly protein.>gb:AE014298_1124067...    99   2e-19   Drosophila melanogaster
gb:CR382138_1671323 Debaryomyces hansenii chromosome F of strain...    99   3e-19   
sp|O13282|TAF5_SCHPO|TAF5_SCHPO Transcription initiation factor TFIID subun...    99   3e-19   Schizosaccharomyces pombe
gb:AK127882_1916943 Homo sapiens cDNA FLJ45988 fis, clone PUAEN2...    98   4e-19   
sp|P38129|TAF5_YEAST|TAF5_YEAST Transcription initiation factor TFIID subun...    98   4e-19   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382125_1658273 Kluyveromyces lactis strain NRRL Y-1140 chro...    98   5e-19   
gb:BC052124_2550472 Danio rerio zgc:76895, mRNA (cDNA clone MGC:...    97   8e-19   
gb:HSU75309_2025968 Human TBP-associated factor (hTAFII100) mRNA...    97   8e-19   
gb:HSTAFII10_2020620 H.sapiens mRNA for TAFII100 protein.              97   8e-19   
gb:HSA011376_2000038 Homo sapiens mRNA for hypothetical protein ...    97   8e-19   
gb:BC052268_1984779 Homo sapiens TAF5 RNA polymerase II, TATA bo...    97   8e-19   
gb:AL591408_1930058 Human DNA sequence from clone RP11-792D24 on...    97   8e-19   
gb:AF391288_1267431 Branchiostoma floridae cosmid MPMGc117G0971,...    97   8e-19   
gb:AK088953_1175721 Mus musculus 2 days neonate thymus thymic ce...    97   8e-19   
sp|P61964|WDR5_HUMAN|WDR5_HUMAN WD-repeat protein 5.>sp|P61965|WDR5_MOUSE W...    97   8e-19   Homo sapiens [man]
sp|Q15542|TAF5_HUMAN|TAF5_HUMAN Transcription initiation factor TFIID subun...    97   8e-19   Homo sapiens [man]
gb:AE012949_287446 Chlorobium tepidum TLS section 170 of 194 of ...    97   1e-18   
gb:AJ720488_2502675 Gallus gallus mRNA for hypothetical protein,...    96   2e-18   
sp|Q8C092|TAF5_MOUSE|TAF5_MOUSE Transcription initiation factor TFIID subun...    96   2e-18   Mus musculus [mouse]
gb:BA000012_667578 Mesorhizobium loti MAFF303099 DNA, complete g...    96   2e-18   
gb:AB007645_1510148 Arabidopsis thaliana genomic DNA, chromosome...    95   3e-18   
sp|P74442|Y143_SYNY3|Y143_SYNY3 Hypothetical WD-repeat protein slr0143.>pir...    94   5e-18   Synechocystis sp.
gb:CR380959_1653880 Candida glabrata strain CBS138 chromosome M ...    94   9e-18   
gb:BA000045_742319 Gloeobacter violaceus PCC 7421 DNA, complete ...    94   9e-18   
gb:CNS07EGR_2569984 BAC A of library A from Tetraodon nigrovirid...    93   1e-17   
gb:AE014297_1141988 Drosophila melanogaster chromosome 3R, compl...    93   1e-17   
gb:AE014297_1138047 Drosophila melanogaster chromosome 3R, compl...    93   2e-17   
gb:BC056820_2552003 Danio rerio TAF5-like RNA polymerase II, p30...    92   2e-17   
gb:AY463620_1607709 Arabidopsis thaliana TAF5 (At5g25150) mRNA, ...    92   2e-17   
gb:AK009247_1155025 Mus musculus adult male tongue cDNA, RIKEN f...    92   2e-17   
gb:BA000045_740800 Gloeobacter violaceus PCC 7421 DNA, complete ...    92   2e-17   
gb:CR382135_1668291 Debaryomyces hansenii chromosome C of strain...    92   3e-17   
gb:AY524043_625304 Micromonospora echinospora ATCC 15835 gentami...    92   3e-17   
gb:MPU575934_149470 Micromonospora purpurea DOS biosynthetic gen...    92   3e-17   
gb:BC051783_2550450 Danio rerio zgc:56312, mRNA (cDNA clone MGC:...    92   3e-17   
pir|AG2400|AG2400 WD-repeat protein [imported] - Nostoc sp. (str...    92   3e-17   Nostoc sp. PCC 7120
sp|P25387|GBLP_CHLRE|GBLP_CHLRE Guanine nucleotide-binding protein beta sub...    91   4e-17   Chlamydomonas reinhardtii
gb:AF268195_2060958 Mus musculus strain BALB/c IRA1 mRNA, comple...    91   6e-17   
gb:AC087851_1734183 Oryza sativa chromosome 3 BAC OSJNBb0072E24 ...    91   6e-17   
gb:CR382134_1667630 Debaryomyces hansenii chromosome B of strain...    91   6e-17   
gb:CR382127_1660168 Yarrowia lipolytica chromosome A of strain C...    91   6e-17   
pir|T46032|T46032 WD-40 repeat regulatory protein tup1 homolog -...    91   6e-17   Arabidopsis thaliana [mouse-ear cress]
gb:BC045888_2549405 Danio rerio zgc:56055, mRNA (cDNA clone MGC:...    91   8e-17   
gb:AB086191_2047797 Mus musculus mRNA for putative WDC146, compl...    91   8e-17   
gb:BT012225_1641431 Arabidopsis thaliana At5g13480 gene, complet...    91   8e-17   
gb:AK050653_1169412 Mus musculus 2 days neonate thymus thymic ce...    91   8e-17   
gb:AK036064_1164339 Mus musculus 16 days neonate cerebellum cDNA...    91   8e-17   
pir|AI2099|AI2099 WD-40 repeat protein [imported] - Nostoc sp. (...    91   8e-17   Nostoc sp. PCC 7120
sp|Q9C0J8|W146_HUMAN|W146_HUMAN WD-repeat protein WDC146.>gb:AB044749_18671...    91   8e-17   Homo sapiens [man]
sp|O15736|TIPD_DICDI|TIPD_DICDI Protein tipD.>pir|T08602|T08602 protein Tip...    91   8e-17   Dictyostelium discoideum
gb:BC073215_2557068 Xenopus laevis cDNA clone MGC:80502 IMAGE:51...    90   1e-16   
gb:AY648770_2541598 Danio rerio FLJ11294-like mRNA, partial cds.       90   1e-16   
gb:AY225088_2520401 Xenopus laevis nuclear receptor co-repressor...    90   1e-16   
pir|T19776|T19776 hypothetical protein C36B1.5 - Caenorhabditis ...    90   1e-16   Caenorhabditis elegans [roundworm]
sp|Q55563|Y163_SYNY3|Y163_SYNY3 Hypothetical WD-repeat protein sll0163.>pir...    90   1e-16   Synechocystis sp.
gb:AX882446_1478938 Sequence 17351 from Patent EP1074617.>gb:AK0...    90   1e-16   
gb:CQ783423_1452458 Sequence 3563 from Patent EP1396543.>gb:AK07...    90   1e-16   
gb:AE014296_1135687 Drosophila melanogaster chromosome 3L, compl...    90   1e-16   
sp|Q9BZK7|TBLR_HUMAN|TBLR_HUMAN F-box-like/WD-repeat protein TBLR1 (Nuclear...    90   1e-16   Homo sapiens [man]
sp|O22212|PRP4_ARATH|PRP4_ARATH Hypothetical Trp-Asp repeats containing pro...    90   1e-16   Arabidopsis thaliana [mouse-ear cress]
sp|Q10281|GBLP_SCHPO|GBLP_SCHPO Guanine nucleotide-binding protein beta sub...    90   1e-16   Schizosaccharomyces pombe
gb:BC075548_2558648 Xenopus tropicalis MGC89488 protein, mRNA (c...    89   2e-16   
gb:AJ719937_2502124 Gallus gallus mRNA for hypothetical protein,...    89   2e-16   
gb:AY461709_1329432 Bombyx mori will die slowly mRNA, complete cds.    89   2e-16   
gb:AE010953_267897 Methanosarcina acetivorans str. C2A, section ...    89   2e-16   
sp|Q09715|TU11_SCHPO|TU11_SCHPO Transcriptional repressor tup11.>pir|S58306...    89   2e-16   Schizosaccharomyces pombe
sp|Q8BHJ5|TBLR_MOUSE|TBLR_MOUSE F-box-like/WD-repeat protein TBLR1 (Nuclear...    89   2e-16   Mus musculus [mouse]
sp|Q94775|GBLP_TRYBB|GBLP_TRYBB Guanine nucleotide-binding protein beta sub...    89   2e-16   Trypanosoma brucei brucei
gb:AF268193_1893996 Homo sapiens IRA1 mRNA, complete cds, altern...    89   2e-16   
gb:YSPGNRP_1731112 Schizosaccharomyces pombe guanine nucleotide ...    89   2e-16   
gb:BT008700_1639896 Arabidopsis thaliana clone RAFL17-34-N02 (R5...    89   2e-16   
gb:AK016977_1158973 Mus musculus adult male testis cDNA, RIKEN f...    89   2e-16   
gb:AF090988_1882483 Homo sapiens U5 snRNP-specific 40 kDa protei...    89   3e-16   
gb:BC058365_2103177 Mus musculus U5 snRNP-specific protein (Prp8...    88   4e-16   
gb:AF083383_1881616 Homo sapiens 38kDa splicing factor mRNA, com...    88   4e-16   
gb:AK002371_1151155 Mus musculus adult male kidney cDNA, RIKEN f...    88   4e-16   
gb:BA000045_743736 Gloeobacter violaceus PCC 7421 DNA, complete ...    88   4e-16   
gb:CQ782448_1451984 Sequence 2588 from Patent EP1396543.>gb:AL45...    88   5e-16   
gb:AL354928_1923557 Human DNA sequence from clone RP11-175D17 on...    87   6e-16   
gb:AK089463_1175945 Mus musculus B6-derived CD11 +ve dendritic c...    87   6e-16   
gb:AP004312_555846 Synechocystis sp. PCC 6803 plasmid pSYSG DNA,...    87   6e-16   
gb:SCO939125_179666 Streptomyces coelicolor A3(2) complete genom...    87   6e-16   
sp|Q91WQ5|TA5L_MOUSE|TA5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associ...    87   6e-16   Mus musculus [mouse]
sp|O75529|TA5L_HUMAN|TA5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associ...    87   6e-16   Homo sapiens [man]
gb:BC045034_2548989 Xenopus laevis U5 snRNP-specific 40 kDa prot...    87   8e-16   
gb:AF093689_1240446 Dictyostelium discoideum MEK kinase alpha (m...    87   8e-16   
gb:SPU92792_1722273 Schizosaccharomyces pombe general transcript...    87   1e-15   
sp|P56093|TUP1_CANAL|TUP1_CANAL Transcriptional repressor TUP1.>gb:AF005741...    87   1e-15   Candida albicans
sp|Q9UUG8|TU12_SCHPO|TU12_SCHPO Transcriptional repressor tup12.>pir|T38992...    87   1e-15   Schizosaccharomyces pombe
gb:BC056720_2551913 Danio rerio PRP4 pre-mRNA processing factor ...    86   1e-15   
gb:AX135811_1461885 Sequence 5 from Patent WO0132614.                  86   1e-15   
gb:AK007246_1153889 Mus musculus adult male testis cDNA, RIKEN f...    86   1e-15   
pir|AE1866|AE1866 WD-40 repeat protein [imported] - Nostoc sp. (...    86   1e-15   Nostoc sp. PCC 7120
gb:BC002884_1968496 Homo sapiens Notchless gene homolog (Drosoph...    86   2e-15   
gb:AF079369_1239501 Dictyostelium discoideum transcriptional rep...    86   2e-15   
gb:CR860672_1184728 Pongo pygmaeus mRNA; cDNA DKFZp459M2115 (fro...    86   2e-15   
gb:CR857200_1181447 Pongo pygmaeus mRNA; cDNA DKFZp468I2316 (fro...    86   2e-15   
sp|Q9NVX2|HUS7_HUMAN|HUS7_HUMAN WD-repeat protein HUSSY-07.>gb:AX405715_146...    86   2e-15   Homo sapiens [man]
gb:BC044710_2548906 Xenopus laevis Notchless gene homolog (Droso...    86   2e-15   
gb:AY130394_2514062 Petromyzon marinus guanine nucleotide-bindin...    86   2e-15   
gb:AF069737_2471573 Xenopus laevis notchless (nle) mRNA, complet...    86   2e-15   
gb:AE016959_1023236 Oryza sativa (japonica cultivar-group) chrom...    86   2e-15   
gb:AE016959_1020595 Oryza sativa (japonica cultivar-group) chrom...    86   2e-15   
sp|P20053|PRP4_YEAST|PRP4_YEAST U4/U6 small nuclear ribonucleoprotein PRP4....    86   2e-15   
gb:BC062834_2553423 Danio rerio zgc:77675, mRNA (cDNA clone MGC:...    85   3e-15   
gb:AF548359_1810723 Paracoccidioides brasiliensis RACK1-like pro...    85   3e-15   
gb:CR382137_1669755 Debaryomyces hansenii chromosome E of strain...    85   3e-15   
gb:CR857310_1181554 Pongo pygmaeus mRNA; cDNA DKFZp469N2132 (fro...    85   3e-15   
gb:BA000012_668152 Mesorhizobium loti MAFF303099 DNA, complete g...    85   3e-15   
pir|G85034|G85034 probable WD-repeat protein [imported] - Arabid...    85   3e-15   
gb:HSA9770_2009927 Homo sapiens mRNA for putative transcription ...    85   4e-15   
gb:AK030547_1162058 Mus musculus adult male pituitary gland cDNA...    85   4e-15   
sp|Q9QXE7|TBLX_MOUSE|TBLX_MOUSE F-box-like/WD-repeat protein TBL1X (Transdu...    85   4e-15   
gb:BC056099_2551681 Xenopus laevis hypothetical protein MGC69111...    84   5e-15   
gb:AF197225_1776129 Emericella nidulans TUPA (tupA) gene, comple...    84   5e-15   
gb:AE017348_1758402 Cryptococcus neoformans var. neoformans JEC2...    84   5e-15   
gb:AE017342_1755058 Cryptococcus neoformans var. neoformans JEC2...    84   5e-15   
gb:OSJN00083_1694591 Oryza sativa genomic DNA, chromosome 4, BAC...    84   5e-15   
sp|O18640|GBLP_DROME|GBLP_DROME Guanine nucleotide-binding protein beta sub...    84   5e-15   
gb:BC075435_2558538 Xenopus tropicalis MGC89209 protein, mRNA (c...    84   9e-15   
gb:BC061324_2553100 Xenopus tropicalis hypothetical protein MGC7...    84   9e-15   
gb:AJ719967_2502154 Gallus gallus mRNA for hypothetical protein,...    84   9e-15   
gb:AF427101_2065587 Mus musculus F-box protein (Fbwd6) mRNA, com...    84   9e-15   
gb:BC039254_1982522 Homo sapiens WD repeat domain 47, mRNA (cDNA...    84   9e-15   
gb:BC037320_1982178 Homo sapiens F-box and WD-40 domain protein ...    84   9e-15   
gb:AF383178_1900017 Homo sapiens F-box protein FBX30 mRNA, parti...    84   9e-15   
gb:CR382133_1666880 Debaryomyces hansenii chromosome A of strain...    84   9e-15   
gb:AX877849_1477188 Sequence 12754 from Patent EP1074617.>gb:AK0...    84   9e-15   
gb:AX722159_1473864 Sequence 17 from Patent WO03024999.>gb:AY008...    84   9e-15   
gb:AX722147_1473863 Sequence 5 from Patent WO03024999.>gb:AF4119...    84   9e-15   
gb:AF032878_1234644 Drosophila melanogaster Slimb (slimb) mRNA, ...    84   9e-15   
gb:AK032174_1162787 Mus musculus adult male olfactory brain cDNA...    84   9e-15   
gb:AE014134_1126817 Drosophila melanogaster chromosome 2L, compl...    84   9e-15   
gb:BA000045_741705 Gloeobacter violaceus PCC 7421 DNA, complete ...    84   9e-15   
sp|Q01369|GBLP_NEUCR|GBLP_NEUCR Guanine nucleotide-binding protein beta sub...    84   9e-15   
sp|Q8VBV4|FBW7_MOUSE|FBW7_MOUSE F-box/WD-repeat protein 7 (F-box and WD-40 ...    84   9e-15   
sp|Q969H0|FBW7_HUMAN|FBW7_HUMAN F-box/WD-repeat protein 7 (F-box and WD-40 ...    84   9e-15   
gb:AY422998_2532084 Danio rerio TUWD12 (TUWD12) mRNA, complete cds.    83   1e-14   
gb:CQ783661_1452567 Sequence 3801 from Patent EP1396543.>gb:AK07...    83   1e-14   
gb:HSM804229_1187124 Homo sapiens mRNA; cDNA DKFZp762M0115 (from...    83   1e-14   
gb:AK031937_1162655 Mus musculus adult male medulla oblongata cD...    83   1e-14   
sp|Q8VEJ4|HUS7_MOUSE|HUS7_MOUSE WD-repeat protein HUSSY-07.>gb:BC018399_209...    83   1e-14   
gb:AY342000_2528963 Oreochromis mossambicus receptor for activat...    83   2e-14   
gb:AL603745_2071172 Mouse DNA sequence from clone RP23-392I13 on...    83   2e-14   
gb:CR380953_1651041 Candida glabrata strain CBS138 chromosome G ...    83   2e-14   
gb:AY457171_1327891 Leishmania amazonensis antigenic WD protein ...    83   2e-14   
gb:AF100286_1241136 Trypanosoma congolense strain IL1180 activat...    83   2e-14   
gb:AB089281_1198579 Mamestra brassicae mRNA for receptor for act...    83   2e-14   
pir|AF1890|AF1890 WD-repeat protein [imported] - Nostoc sp. (str...    83   2e-14   
sp|Q39336|GBLP_BRANA|GBLP_BRANA Guanine nucleotide-binding protein beta sub...    83   2e-14   
gb:AJ719544_2501731 Gallus gallus mRNA for hypothetical protein,...    82   2e-14   
gb:AE017343_1755380 Cryptococcus neoformans var. neoformans JEC2...    82   2e-14   
gb:AB009055_1510732 Arabidopsis thaliana genomic DNA, chromosome...    82   2e-14   
gb:AX019507_1456592 Sequence 1 from Patent WO9938969.>gb:AF12953...    82   2e-14   
gb:DDI512336_1376967 Dictyostelium discoideum mRNA for LIS1 prot...    82   2e-14   
gb:CR857777_1181989 Pongo pygmaeus mRNA; cDNA DKFZp469O1137 (fro...    82   2e-14   
gb:CR749295_1180924 Homo sapiens mRNA; cDNA DKFZp781N011 (from c...    82   2e-14   
sp|Q17963|YKY4_CAEEL|YKY4_CAEEL Hypothetical 40.4 kDa Trp-Asp repeats conta...    82   2e-14   
sp|O42249|GBLP_ORENI|GBLP_ORENI Guanine nucleotide-binding protein beta sub...    82   2e-14   
sp|O42248|GBLP_BRARE|GBLP_BRARE Guanine nucleotide-binding protein beta sub...    82   2e-14   
sp|Q9Y297|FW1A_HUMAN|FW1A_HUMAN F-box/WD-repeat protein 1A (F-box and WD-re...    82   2e-14   
gb:BC055275_2551353 Danio rerio zgc:63538, mRNA (cDNA clone MGC:...    82   3e-14   
gb:BC054992_2551194 Xenopus laevis hypothetical protein MGC64565...    82   3e-14   
gb:BC041541_2547987 Xenopus laevis guanine nucleotide binding pr...    82   3e-14   
gb:AY608585_2540152 Paralichthys olivaceus receptor for activate...    82   3e-14   
gb:AF105259_2473905 Xenopus laevis activated protein kinase C re...    82   3e-14   
gb:AE017345_1756987 Cryptococcus neoformans var. neoformans JEC2...    82   3e-14   
gb:CR380949_1649566 Candida glabrata strain CBS138 chromosome C ...    82   3e-14   
gb:ATF8L15_1551226 Arabidopsis thaliana DNA chromosome 5, BAC cl...    82   3e-14   
gb:CR859650_1183756 Pongo pygmaeus mRNA; cDNA DKFZp459C1034 (fro...    82   3e-14   
gb:AE014297_1140594 Drosophila melanogaster chromosome 3R, compl...    82   3e-14   
gb:AE014296_1136763 Drosophila melanogaster chromosome 3L, compl...    82   3e-14   
pir|T39490|T39490 transcription initiation factor TFIID subunitb...    82   3e-14   
pir|AE2490|AE2490 WD-repeat protein [imported] - Nostoc sp. (str...    82   3e-14   
gb:BT008246_2151178 Synthetic construct Homo sapiens guanine nuc...    82   4e-14   
gb:MUSGPBSL_2126043 Mus musculus p205 mRNA for G protein beta su...    82   4e-14   
gb:BC052304_1984804 Homo sapiens transducin (beta)-like 1X-linke...    82   4e-14   
gb:AY159316_1937391 Homo sapiens lung cancer oncogene 7 mRNA, co...    82   4e-14   
gb:AC129717_1740626 Oryza sativa (japonica cultivar-group) chrom...    82   4e-14   
gb:AY249909_1428015 Oryctolagus cuniculus G-protein beta subunit...    82   4e-14   
gb:AY737531_1348925 Toxoptera citricida putative activated prote...    82   4e-14   
gb:AK045302_1167348 Mus musculus 9.5 days embryo parthenogenote ...    82   4e-14   
sp|O60907|TBLX_HUMAN|TBLX_HUMAN F-box-like/WD-repeat protein TBL1X (Transdu...    82   4e-14   
sp|O24076|GBLP_MEDSA|GBLP_MEDSA Guanine nucleotide-binding protein beta sub...    82   4e-14   
sp|P25388|GBLP_HUMAN|GBLP_HUMAN Guanine nucleotide-binding protein beta sub...    82   4e-14   
gb:BC077313_2560027 Xenopus laevis TAF5-like RNA polymerase II, ...    81   5e-14   
gb:BC040337_2098498 Mus musculus WD repeat domain 47, mRNA (cDNA...    81   5e-14   
gb:AK122397_2069062 Mus musculus mRNA for mKIAA0893 protein.           81   5e-14   
gb:AF176775_1774587 Emericella nidulans Gbeta like protein (cpcB...    81   5e-14   
gb:AY082798_1569212 Penicillium marneffei TupA protein (tupA) ge...    81   5e-14   
gb:DMU96491_1381140 Drosophila melanogaster RACK1 (rack1) mRNA, ...    81   5e-14   
gb:AK028113_1160795 Mus musculus 10 day old male pancreas cDNA, ...    81   5e-14   
sp|O42937|COPP_SCHPO|COPP_SCHPO Probable coatomer beta' subunit (Beta'-coat...    81   5e-14   
gb:AF113946_2474699 Gallus gallus LIS1 (LIS1) mRNA, complete cds.      81   6e-14   
gb:AF310672_1896230 Homo sapiens PF20 variant 1a (PF20) mRNA, co...    81   6e-14   
gb:CR382128_1660923 Yarrowia lipolytica chromosome B of strain C...    81   6e-14   
gb:CR382127_1660063 Yarrowia lipolytica chromosome A of strain C...    81   6e-14   
gb:BT002053_1635656 Arabidopsis thaliana putative protein (At5g2...    81   6e-14   
gb:CR858112_1182299 Pongo pygmaeus mRNA; cDNA DKFZp469O1927 (fro...    81   6e-14   
pir|A36986|A36986 activated protein kinase C receptor RACK1 - ra...    81   6e-14   
pir|E86245|E86245 hypothetical protein [imported] - Arabidopsis ...    81   6e-14   
sp|P78706|RCO1_NEUCR|RCO1_NEUCR Transcriptional repressor rco-1.>gb:NCU5706...    81   6e-14   
gb:BC085125_2109076 Rattus norvegicus beta-transducin repeat con...    80   8e-14   
gb:AF081887_2053835 Mus musculus ubiquitin ligase FWD1 mRNA, com...    80   8e-14   
gb:BC034964_1981429 Homo sapiens WD repeat domain 47, mRNA (cDNA...    80   8e-14   
gb:AL449266_1927816 Human DNA sequence from clone RP11-475E11 on...    80   8e-14   
gb:AL449266_1927814 Human DNA sequence from clone RP11-475E11 on...    80   8e-14   
gb:AB020700_1865298 Homo sapiens mRNA for KIAA0893 protein, part...    80   8e-14   
gb:AF443204_1800322 Chlamydomonas reinhardtii WD40-repeat-contai...    80   8e-14   
gb:BT015296_1358373 Drosophila melanogaster AT26369 full insert ...    80   8e-14   
gb:AF181630_1248297 Drosophila melanogaster BcDNA.GH04922 (BcDNA...    80   8e-14   
gb:AB189027_1202851 Plutella xylostella mRNA for receptor for ac...    80   8e-14   
gb:AK090114_1176151 Mus musculus skin RCB-1283 B16 melanoma cDNA...    80   8e-14   
gb:AE013599_1132649 Drosophila melanogaster chromosome 2R, compl...    80   8e-14   
gb:AE013599_1132648 Drosophila melanogaster chromosome 2R, compl...    80   8e-14   
gb:AE013599_1132646 Drosophila melanogaster chromosome 2R, compl...    80   8e-14   
pir|T16607|T16607 hypothetical protein K10B2.1 - Caenorhabditis ...    80   8e-14   
sp|O94967|Y893_HUMAN|Y893_HUMAN Hypothetical protein KIAA0893.>gb:AL449266_...    80   8e-14   
sp|Q09990|LI23_CAEEL|LI23_CAEEL F-box/WD-repeat protein lin-23.>gb:AF275253...    80   8e-14   
gb:BC051639_2100799 Mus musculus PRP4 pre-mRNA processing factor...    80   1e-13   
gb:AL732594_2072985 Mouse DNA sequence from clone RP24-189G18 on...    80   1e-13   
gb:AK005464_1153044 Mus musculus adult female placenta cDNA, RIK...    80   1e-13   
sp|Q95RJ9|EBI_DROME|EBI_DROME F-box-like/WD-repeat protein ebi.>gb:AE01413...    80   1e-13   
gb:BC075582_2558678 Xenopus tropicalis TAF5-like RNA polymerase ...    80   1e-13   
gb:AJ721075_2503262 Gallus gallus mRNA for hypothetical protein,...    80   1e-13   
gb:AF110396_2054867 Mus musculus beta-transducin repeat-containi...    80   1e-13   
gb:HSU82756_2026633 Homo sapiens WD splicing factor Hprp4p (HPRP...    80   1e-13   
gb:AP005908_1859916 Oryza sativa (japonica cultivar-group) genom...    80   1e-13   
gb:AP003517_1830286 Oryza sativa (japonica cultivar-group) genom...    80   1e-13   
gb:CR382131_1664617 Yarrowia lipolytica chromosome E of strain C...    80   1e-13   
sp|Q91854|TRCB_XENLA|TRCB_XENLA Beta-TrCP (Beta-transducin repeat-containin...    80   1e-13   
gb:D89247_1675364 Schizosaccharomyces pombe mRNA, partial cds, c...    79   2e-13   
gb:AY064077_1293671 Aedes aegypti clone unKRc2 unknown protein (...    79   2e-13   
gb:AF100287_1241137 Trypanosoma vivax strain ILDat1.2 activated ...    79   2e-13   
pir|T20593|T20593 hypothetical protein F08G12.2 - Caenorhabditis...    79   2e-13   
pir|T43158|T43158 probable GTP-binding protein beta chain - fiss...    79   2e-13   
sp|Q9BQ87|TBLY_HUMAN|TBLY_HUMAN F-box-like/WD-repeat protein TBL1Y (Transdu...    79   2e-13   
gb:AY694127_2544498 Gallus gallus cosmid c12.1 chromosome 16 BR ...    79   2e-13   
gb:AY130395_2514063 Scyliorhinus canicula guanine nucleotide-bin...    79   2e-13   
gb:AF112979_2054942 Mus musculus beta-transducin repeat containi...    79   2e-13   
gb:AF400434_1901097 Homo sapiens platelet-activating factor acet...    79   2e-13   
gb:AF208837_1890045 Homo sapiens isolate 3 Miller-Dieker lissenc...    79   2e-13   
gb:AF407335_1796936 Lentinula edodes guanine nucleotide binding ...    79   2e-13   
gb:CNS07EG9_1372894 chromosome II of strain GB-M1 of Encephalito...    79   2e-13   
gb:AY588074_1339433 Homalodisca coagulata putative activated pro...    79   2e-13   
gb:AE014296_1136134 Drosophila melanogaster chromosome 3L, compl...    79   2e-13   
gb:AE017192_1054003 Tetraodon nigroviridis target 1 genomic scaf...    79   2e-13   
gb:AY316746_608765 Rhizobium sp. NGR234 megaplasmid 2 contig 2, ...    79   2e-13   
pir|S48052|S48052 platelet-activating factor acetylhydrolase 45K...    79   2e-13   
pir|S36113|S36113 LIS-1 protein - human                                79   2e-13   
pir|A96638|A96638 hypothetical protein F11P17.7 [imported] - Ara...    79   2e-13   
sp|O13615|PRP5_SCHPO|PRP5_SCHPO Pre-mRNA splicing protein prp5.>gb:AB004535...    79   2e-13   
sp|P43035|LIS1_MOUSE|LIS1_MOUSE Platelet-activating factor acetylhydrolase ...    79   2e-13   
sp|P43034|LIS1_HUMAN|LIS1_HUMAN Platelet-activating factor acetylhydrolase ...    79   2e-13   
sp|Q39836|GBLP_SOYBN|GBLP_SOYBN Guanine nucleotide-binding protein beta sub...    79   2e-13   
sp|P46800|GBLP_DICDI|GBLP_DICDI Guanine nucleotide-binding protein beta sub...    79   2e-13   
gb:CR457105_1993312 Homo sapiens full open reading frame cDNA cl...    79   3e-13   
gb:AL449305_1927826 Human DNA sequence from clone RP11-110L1 on ...    79   3e-13   
gb:AF016369_1876688 Homo sapiens U4/U6 small nuclear ribonucleop...    79   3e-13   
gb:CR382136_1669316 Debaryomyces hansenii chromosome D of strain...    79   3e-13   
gb:AB180244_1528964 Fusarium oxysporum fgb2 gene for G-protein b...    79   3e-13   
gb:AB018110_1513757 Arabidopsis thaliana genomic DNA, chromosome...    79   3e-13   
gb:CR926107_1185612 Pongo pygmaeus mRNA; cDNA DKFZp459M0410 (fro...    79   3e-13   
gb:AK016991_1158982 Mus musculus adult male testis cDNA, RIKEN f...    79   3e-13   
pir|T16970|T16970 GTP-binding protein beta chain homolog - curle...    79   3e-13   
sp|O43172|PRP4_HUMAN|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 ...    79   3e-13   
gb:AB083321_1871858 Macaca fascicularis pafah1b1 mRNA for platel...    78   4e-13   
gb:AE016817_1747302 Ashbya gossypii (= Eremothecium gossypii) AT...    78   4e-13   
gb:AC135228_1742183 Oryza sativa chromosome 3 BAC OSJNBb0122C16 ...    78   4e-13   
gb:YSCTUP1A_1730843 S.cerevisiae TUP1 protein gene, complete cds.      78   4e-13   
gb:SCSFL2_1709495 Yeast suppressor gene for flocculation SFL2, p...    78   4e-13   
gb:BOVPAF45K_1435710 Bovine mRNA for PAF acetylhydrolase 45 kDa ...    78   4e-13   
gb:DDU27537_1377318 Dictyostelium discoideum G beta like protein...    78   4e-13   
gb:AY064076_1293670 Aedes aegypti clone unKMc3 unknown protein (...    78   4e-13   
gb:AF326340_1262805 Aedes aegypti unknown protein i8 mRNA, compl...    78   4e-13   
gb:AF326339_1262804 Aedes aegypti unknown protein i8 mRNA, compl...    78   4e-13   
gb:AE014134_1126890 Drosophila melanogaster chromosome 2L, compl...    78   4e-13   
sp|P16649|TUP1_YEAST|TUP1_YEAST Glucose repression regulatory protein TUP1 ...    78   4e-13   
sp|P43033|LIS1_BOVIN|LIS1_BOVIN Platelet-activating factor acetylhydrolase ...    78   4e-13   
gb:BC059759_2552703 Xenopus tropicalis hypothetical protein MGC7...    78   5e-13   
gb:AF208838_1890046 Homo sapiens isolate 4 Miller-Dieker lissenc...    78   5e-13   
gb:AF001687_1875759 Homo sapiens U4/U6 snRNP 60 kDa protein gene...    78   5e-13   
gb:BT002991_1636574 Arabidopsis thaliana clone RAFL15-17-A08 (R2...    78   5e-13   
gb:AY383553_1604108 Pichia angusta Vps4p (VPS4) and Tup1p (TUP1)...    78   5e-13   
gb:AY084972_1570054 Arabidopsis thaliana clone 123113 mRNA, comp...    78   5e-13   
gb:AF319658_1418326 Sus scrofa platelet-activating factor acetyl...    78   5e-13   
gb:AF124742_1242964 Euprymna scolopes guanine nucleotide-binding...    78   5e-13   
gb:CR857562_1181788 Pongo pygmaeus mRNA; cDNA DKFZp469J1511 (fro...    78   5e-13   
sp|Q42384|PRL1_ARATH|PRL1_ARATH PP1/PP2A phosphatases pleiotropic regulator...    78   5e-13   
gb:BC044530_2548832 Danio rerio platelet-activating factor acety...    77   7e-13   
gb:AF295529_2061896 Mus musculus activated protein kinase C rece...    77   7e-13   
gb:CR382135_1668127 Debaryomyces hansenii chromosome C of strain...    77   7e-13   
gb:CR380951_1649957 Candida glabrata strain CBS138 chromosome E ...    77   7e-13   
gb:AY054181_1563003 Arabidopsis thaliana AT3g16650/MGL6_10 mRNA,...    77   7e-13   
gb:AB022217_1515068 Arabidopsis thaliana genomic DNA, chromosome...    77   7e-13   
gb:AE017188_1054024 Takifugu rubripes target 1 genomic scaffold.       77   7e-13   
pir|S49821|S49821 PRL2 protein - Arabidopsis thaliana (fragment)       77   7e-13   
sp|Q39190|PRL2_ARATH|PRL2_ARATH PP1/PP2A phosphatases pleiotropic regulator...    77   7e-13   
gb:BC034901_2097799 Mus musculus RIKEN cDNA 2510040D07 gene, mRN...    77   9e-13   
gb:AF519545_1905749 Homo sapiens hypertension associated protein...    77   9e-13   
gb:AB022686_1515256 Lycopersicon esculentum mRNA for LeArcA1 pro...    77   9e-13   
gb:CER06A4_1366510 Caenorhabditis elegans cosmid R06A4, complete...    77   9e-13   
pir|AE1901|AE1901 WD-repeat containing protein [imported] - Nost...    77   9e-13   
gb:AY665285_1958590 Pan troglodytes platelet-activating factor a...    77   1e-12   
gb:AB033280_1866304 Homo sapiens BTRCP2 mRNA for F-box and WD-re...    77   1e-12   
gb:AB033279_1866303 Homo sapiens BTRCP2 mRNA for F-box and WD-re...    77   1e-12   
gb:AB014596_1864625 Homo sapiens mRNA for KIAA0696 protein, part...    77   1e-12   
gb:TBR250726_1399228 Trypanosoma brucei HSP100 gene, GPI-PLC gen...    77   1e-12   
gb:AE017150_1030095 Trypanosoma brucei chromosome 2, complete se...    77   1e-12   
sp|P93340|GBLP_NICPL|GBLP_NICPL Guanine nucleotide-binding protein beta sub...    77   1e-12   
sp|Q9UKB1|FW1B_HUMAN|FW1B_HUMAN F-box/WD-repeat protein 1B (F-box and WD-re...    77   1e-12   
gb:CEF55B12_1364502 Caenorhabditis elegans cosmid F55B12, comple...    76   1e-12   
gb:AF357839_1265102 Leishmania donovani LACK protective antigen ...    76   1e-12   
gb:AF223065_1252599 Drosophila melanogaster putative microtubule...    76   1e-12   
gb:AK011064_1156171 Mus musculus 13 days embryo liver cDNA, RIKE...    76   1e-12   
pir|T22703|T22703 hypothetical protein F55B12.3 - Caenorhabditis...    76   1e-12   
sp|Q93794|SE10_CAEEL|SE10_CAEEL F-box/WD-repeat protein sel-10 (Suppressor/...    76   1e-12   
gb:AY389907_2531403 Latimeria chalumnae guanine nucleotide bindi...    76   2e-12   
gb:AE017348_1758370 Cryptococcus neoformans var. neoformans JEC2...    76   2e-12   


>gb:AF414114_1797603 Solanum tuberosum G protein beta subunit 2 (GB2)
            mRNA, complete cds.
          Length = 377

 Score =  657 bits (1696), Expect = 0.0
 Identities = 315/377 (83%), Positives = 336/377 (89%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSVAELKERHMAATQTVN              DTDV+ YA++QGKTP++FGPTDLVCCR 
Sbjct: 1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKTQGKTPVTFGPTDLVCCRI 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct: 61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct: 121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADVSSVSIS+SN  +FVSGSCDTTA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVSSVSISSSNPKLFVSGSCDTTARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             RTFHGHE DV  VKFFPDGNRFGTGSDDG+CRLFDIRTGHQLQVY+QPH D ++  VTS
Sbjct: 241  QRTFHGHESDVTTVKFFPDGNRFGTGSDDGSCRLFDIRTGHQLQVYNQPHGDGDIPHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            IAFSISGRLLF GY+NGDCYVWDTLLAK+VLNLGS+QNSH+GRISCLGLS DGSALCTGS
Sbjct: 301  IAFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGSVQNSHEGRISCLGLSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R VI
Sbjct: 361  WDTNLKIWAFGGHRSVI 377



>gb:AF170921_1774379 Pisum sativum G protein beta subunit mRNA,
            complete cds.
          Length = 377

 Score =  656 bits (1692), Expect = 0.0
 Identities = 311/377 (82%), Positives = 337/377 (89%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSVAELKERH+AAT+TVN+             DTD+A YARSQG+ P++FGPTD++CCR 
Sbjct: 1    MSVAELKERHIAATETVNNLRERLKQRRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRT 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct: 61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct: 121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADV S+SI+ SN+ +FVSGSCD TA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVLSISINGSNSKLFVSGSCDATARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            VRTFHGHEGDV +VKFFPDGNRFGTGS+DGTCRLFDIRTGHQLQVY+Q H DNE+  VTS
Sbjct: 241  VRTFHGHEGDVNSVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYNQQHQDNEMAHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            IAFSISGRLL AGYTNGDCYVWDTLLAK+VLNLGSLQNSH+GRI+CLG+S DGSALCTGS
Sbjct: 301  IAFSISGRLLIAGYTNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGMSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R+VI
Sbjct: 361  WDTNLKIWAFGGHRKVI 377



>sp|P93398|GBB2_TOBAC Guanine nucleotide-binding protein beta subunit
            2.>pir|T04089|T04089 GTP-binding protein beta chain
            (clone Gbeta2) - common tobacco>gb:NTZ84821_1691955
            N.tabacum mRNA for G protein beta subunit (clone
            NtGbeta2).
          Length = 377

 Score =  655 bits (1689), Expect = 0.0
 Identities = 314/377 (83%), Positives = 335/377 (88%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSV ELKERHMAATQTVN              DTDV+ YARSQGKTP+ FGPTDLVCCR 
Sbjct: 1    MSVKELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVIFGPTDLVCCRI 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct: 61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED H+ITSSGD+T
Sbjct: 121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHVITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADV SVSIS+SN  +FVSGSCD+TA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVQSVSISSSNPRLFVSGSCDSTARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             RTF+GHEGDV  VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY QPH D ++  VTS
Sbjct: 241  QRTFYGHEGDVNTVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +AFSISGRLLF GY+NGDCYVWDTLLAK+VLNLG++QNSH+GRISCLGLS DGSALCTGS
Sbjct: 301  MAFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGAVQNSHEGRISCLGLSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R VI
Sbjct: 361  WDTNLKIWAFGGHRSVI 377



>gb:AF249743_1780784 Nicotiana tabacum heterotrimeric GTP-binding
            protein subunit beta 1 mRNA, complete cds.
          Length = 377

 Score =  654 bits (1687), Expect = 0.0
 Identities = 314/377 (83%), Positives = 334/377 (88%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSV ELKERHMAATQTVN              DTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct: 1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct: 61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct: 121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADV SVSIS+SN  +FVSGSCDTTA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVQSVSISSSNPRLFVSGSCDTTAGLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             RTF+GHEGDV  VKF PDGNRFGTGS+DGTCRLFDIRTGHQLQVY QPH D ++  VTS
Sbjct: 241  QRTFYGHEGDVNTVKFSPDGNRFGTGSEDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +AFSISGRLLF GY+NGDCYVWDTLLAK+VLNLG +QNSH+GRISCLGLS DGSALCTGS
Sbjct: 301  MAFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGGVQNSHEGRISCLGLSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R VI
Sbjct: 361  WDTNLKIWAFGGHRSVI 377



>sp|P93397|GBB1_TOBAC Guanine nucleotide-binding protein beta subunit
            1.>pir|T04086|T04086 GTP binding protein beta chain -
            common tobacco>gb:NTZ84820_1691954 N.tabacum mRNA for G
            protein beta subunit (clone NtGbeta1).
          Length = 377

 Score =  654 bits (1687), Expect = 0.0
 Identities = 314/377 (83%), Positives = 334/377 (88%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSV ELKERHMAATQTVN              DTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct: 1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct: 61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct: 121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADV SVSIS+SN  +FVSGSCDTTA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVQSVSISSSNPRLFVSGSCDTTARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             RTF+GHEGDV  VKFFPDGNRFGTGS+DGTCRLFDIRT HQLQVY QPH D ++  VTS
Sbjct: 241  QRTFYGHEGDVNTVKFFPDGNRFGTGSEDGTCRLFDIRTEHQLQVYYQPHGDGDIPHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +AFSISGRLLF GY+NGDCYVWDTLLAK+VLNLG +QNSH+GRISCLGLS DGSALCTGS
Sbjct: 301  MAFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGGVQNSHEGRISCLGLSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R VI
Sbjct: 361  WDTNLKIWAFGGHRSVI 377



>gb:AF533440_1809462 Pisum sativum G protein beta subunit gene,
            complete cds.
          Length = 377

 Score =  650 bits (1678), Expect = 0.0
 Identities = 308/377 (81%), Positives = 335/377 (88%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSVA++KERH+AAT+TVN+             DTD+A YARSQG+ P++ GPTD++CCR 
Sbjct: 1    MSVADVKERHIAATETVNNLRERLKQRRLSLLDTDIAGYARSQGRAPVTLGPTDILCCRT 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct: 61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct: 121  SVACGGLDSVCSIFNLNSPTDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADV S+SI+ SN+ +FVSGSCD TA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVLSISINGSNSKLFVSGSCDATARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            VRTFHGHEGDV  VKFFPDGNRFGTGS+DGTCRLFDIRTGHQLQVY+Q H DNE+  VTS
Sbjct: 241  VRTFHGHEGDVNPVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYNQQHQDNEMAHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            IAFSISGRLL AGYTNGDCYVWDTLLAK+VLNLGSLQNSH+GRI+CLG+S DGSALCTGS
Sbjct: 301  IAFSISGRLLIAGYTNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGMSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R+VI
Sbjct: 361  WDTNLKIWAFGGHRKVI 377



>sp|P93563|GBB_SOLTU Guanine nucleotide-binding protein beta
            subunit.>pir|T07376|T07376 G-protein beta chain GB1 -
            potato>gb:STGB1GENE_1722777 S.tuberosum mRNA for beta 1
            subunit of heterotrimeric G-protein.
          Length = 377

 Score =  650 bits (1678), Expect = 0.0
 Identities = 311/377 (82%), Positives = 334/377 (88%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSVAELKERHMAATQTVN              DTDV+ YA+ QGK+P++FGPTDLVCCR 
Sbjct: 1    MSVAELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYAKRQGKSPVTFGPTDLVCCRI 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct: 61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDS CSIFNLN P D DG   VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct: 121  SVACGGLDSACSIFNLNSPIDKDGIHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADV SVSIS+SN  +FVSGSCDTTA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVLSVSISSSNPKLFVSGSCDTTARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             RTFHGHE DV  VKFFPDGNRFGTGSDDG+CRLFDIRTGHQLQVY+QPH D ++  VTS
Sbjct: 241  QRTFHGHESDVNTVKFFPDGNRFGTGSDDGSCRLFDIRTGHQLQVYNQPHGDGDIPHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +AFSISGRLLF GY+NGDCYVWDTLLAK+VLNLGS+QNSH+GRISCLGLS DGSALCTGS
Sbjct: 301  MAFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGSVQNSHEGRISCLGLSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R V+
Sbjct: 361  WDTNLKIWAFGGHRSVV 377



>gb:AF145976_1772045 Pisum sativum G protein beta subunit mRNA,
            complete cds.
          Length = 377

 Score =  649 bits (1675), Expect = 0.0
 Identities = 308/377 (81%), Positives = 336/377 (89%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSVA++KERH+AAT+TVN+             DTD+A YARSQG+ P++FGPTD++CCR 
Sbjct: 1    MSVADVKERHIAATETVNNLRERLSRDRLSLLDTDIAGYARSQGRAPVTFGPTDILCCRT 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWT EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ
Sbjct: 61   LQGHTGKVYSLDWTSEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP ED HLIT SGD+T
Sbjct: 121  SVACGGLDSVCSIFNLNSPLDRDGNLNVSRMLSGHKGYVSSCQYVPGEDTHLITGSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVF GE+QSGHTADV S+SI+ SN+ +FVSGSCD TA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFLGEFQSGHTADVLSISINGSNSKLFVSGSCDATARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            VRTFHGHEGDV +VKFFPDGNRFGTGS+DGTCRLFDIRTGHQLQVY+Q H DNE+  VTS
Sbjct: 241  VRTFHGHEGDVNSVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYNQQHQDNEMAHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            IAFSISGRLL AGYTNGDCYVWDTLLAK+VLNLGSLQNSH+GRI+CLG+S DGSALCTGS
Sbjct: 301  IAFSISGRLLIAGYTNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGMSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R+VI
Sbjct: 361  WDTNLKIWAFGGHRKVI 377



>sp|Q40507|GBB3_TOBAC Guanine nucleotide-binding protein beta
            subunit.>pir|T03256|T03256 GTP-binding protein beta chain
            - common tobacco>gb:NTGPRTBET_1691573 N.tabacum mRNA for
            G protein, beta subunit.
          Length = 375

 Score =  646 bits (1667), Expect = 0.0
 Identities = 309/372 (83%), Positives = 330/372 (88%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSV ELKERHMAATQTV+              DTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct: 1    MSVTELKERHMAATQTVSDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+GQ
Sbjct: 61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSI+NLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct: 121  SVACGGLDSVCSIYNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+QSGHTADV SVSIS+SN  +FVSGSCDTTA LWD RVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQSGHTADVQSVSISSSNPRLFVSGSCDTTARLWDNRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             RTF+GHEGDV  VKFFPDGNRFGTGS+DGTCRLFDIRTGHQLQVY QPH D ++  VTS
Sbjct: 241  QRTFYGHEGDVNTVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +AFSISGRLLF GY+NGDCYVWDTLLAK+VLNLG +QNSH+GRISCLGLS DGSALCTGS
Sbjct: 301  MAFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGGVQNSHEGRISCLGLSADGSALCTGS 360

Query: 1209 WDTTLKIWAFGG 1244
            WDT LKIWAFGG
Sbjct: 361  WDTNLKIWAFGG 372



>sp|P93339|GBB_NICPL Guanine nucleotide-binding protein beta subunit
            (NpGPB1).>pir|T16985|T16985 GTP-binding protein beta
            chain - curled-leaved tobacco>gb:NPY09513_1691143
            N.plumbaginifolia mRNA for G protein beta subunit.
          Length = 377

 Score =  641 bits (1654), Expect = 0.0
 Identities = 308/377 (81%), Positives = 329/377 (87%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSV ELKERHMAATQTVN              DTDV+ YARSQGKTP++FGPTDLVCCR 
Sbjct: 1    MSVTELKERHMAATQTVNDLREKLKQKRLQLLDTDVSGYARSQGKTPVTFGPTDLVCCRI 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP+G 
Sbjct: 61   LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPSGH 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+T
Sbjct: 121  SVACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDITTGLRTSVFGGE+Q GHTADV SVSIS+SN  +FVSGSCDTTA LWDTRVASRA
Sbjct: 181  CVLWDITTGLRTSVFGGEFQFGHTADVQSVSISSSNPRLFVSGSCDTTARLWDTRVASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             RTF+ HEGDV  VKFFPDGNRFGTGS+DGTCRLFDIRTGHQLQVY QPH D ++  VTS
Sbjct: 241  QRTFYCHEGDVNTVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTS 300

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +AFSISGRLLF  Y+NGDCYVWDTLLAK+VLNLG++QNSH+G ISCLGLS DG  LCTGS
Sbjct: 301  MAFSISGRLLFVRYSNGDCYVWDTLLAKVVLNLGAVQNSHEGXISCLGLSADGXXLCTGS 360

Query: 1209 WDTTLKIWAFGGYRQVI 1259
            WDT LKIWAFGG+R VI
Sbjct: 361  WDTNLKIWAFGGHRSVI 377



>sp|P49177|GBB_ARATH Guanine nucleotide-binding protein beta subunit
            (transducin) (AGB1).>pir|T05266|T05266 GTP-binding
            regulatory protein chain T4L20.40 - Arabidopsis
            thaliana>gb:ATCHRIV81_1547407 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 81.>gb:ATT4L20_1556050
            Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20
            (ESSA project).>gb:ATU12232_1556755 Arabidopsis thaliana
            Columbia GTP binding protein beta subunit (AGB1) mRNA,
            complete cds.
          Length = 377

 Score =  604 bits (1558), Expect = e-171
 Identities = 294/378 (77%), Positives = 322/378 (85%), Gaps = 1/378 (0%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSV+ELKERH  AT+TVN+             DTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct: 1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct: 61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct: 121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWD+TTGL+TSVFGGE+QSGHTADV SVSIS SN N F+SGSCD+TA LWDTR ASRA
Sbjct: 181  CILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            VRTFHGHEGDV  VKFFPDG RFGTGSDDGTCRL+DIRTGHQLQVY QPH D E   VTS
Sbjct: 241  VRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGHQLQVY-QPHGDGENGPVTS 299

Query: 1029 IAFSISGRLLFAGY-TNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            IAFS+SGRLLFAGY +N  CYVWDTLL ++VL+LG  Q+SH  RISCLGLS DGSALCTG
Sbjct: 300  IAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQDSHRNRISCLGLSADGSALCTG 359

Query: 1206 SWDTTLKIWAFGGYRQVI 1259
            SWD+ LKIWAFGG+R+VI
Sbjct: 360  SWDSNLKIWAFGGHRRVI 377



>sp|Q40687|GBB_ORYSA Guanine nucleotide-binding protein beta
            subunit.>pir|T03765|T03765 GTP-binding regulatory protein
            beta chain - rice>gb:OSGPROTBS_1693020 O.sativa mRNA for
            g protein b subunit.>gb:AC133930_1741606 Oryza sativa
            chromosome 3 BAC OSJNBa0039O18 genomic sequence, complete
            sequence.
          Length = 380

 Score =  604 bits (1557), Expect = e-171
 Identities = 286/378 (75%), Positives = 324/378 (85%), Gaps = 2/378 (0%)
 Frame = +3

Query: 132  SVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRNL 311
            SVAELKE+H AAT +VNS             DTDV  Y+R+QG+TP+SF PTDLVCCR L
Sbjct: 3    SVAELKEKHAAATASVNSLRERLRQRRQMLLDTDVERYSRTQGRTPVSFNPTDLVCCRTL 62

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVMTCAF+P GQS
Sbjct: 63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMTCAFAPNGQS 122

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct: 123  VACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC 182

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LWD+TTG R S+FGGE+ SGHTADV S+SI++SN+NMFVSGSCD T  LWD R+ASRAV
Sbjct: 183  VLWDVTTGQRISIFGGEFPSGHTADVLSLSINSSNSNMFVSGSCDATVRLWDIRIASRAV 242

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ--PHSDNEVHRVT 1025
            RT+HGHEGD+ +VKFFPDG RFGTGSDDGTCRLFD+RTGHQLQVYS+    +DNE+  VT
Sbjct: 243  RTYHGHEGDINSVKFFPDGQRFGTGSDDGTCRLFDVRTGHQLQVYSREPDRNDNELPTVT 302

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            SIAFSISGRLLFAGY+NGDCYVWDTLLA++VLNLG+LQNSH+GRISCLGLS DGSALCTG
Sbjct: 303  SIAFSISGRLLFAGYSNGDCYVWDTLLAEVVLNLGNLQNSHEGRISCLGLSSDGSALCTG 362

Query: 1206 SWDTTLKIWAFGGYRQVI 1259
            SWD  LKIWAF G+R+++
Sbjct: 363  SWDKNLKIWAFSGHRKIV 380



>sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein beta
            subunit.>pir|T02085|T02085 GTP-binding protein beta chain
            - maize>gb:ZMU12233_1732080 Zea mays GTP binding protein
            beta subunit (ZGB1) mRNA, complete cds.
          Length = 380

 Score =  604 bits (1557), Expect = e-171
 Identities = 287/378 (75%), Positives = 323/378 (85%), Gaps = 2/378 (0%)
 Frame = +3

Query: 132  SVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRNL 311
            SVAELKE+H AAT +VNS             DTDVA Y++SQG+ P+SF PTDLVCCR L
Sbjct: 3    SVAELKEKHAAATASVNSLRERLRQRRETLLDTDVARYSKSQGRVPVSFNPTDLVCCRTL 62

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct: 63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMACAFAPNGQS 122

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            VACGGLDS CSIFNLN   D DGN  VSR L+GHKGYVS+CQYVP+++  LITSSGD+TC
Sbjct: 123  VACGGLDSACSIFNLNSQADRDGNMPVSRILTGHKGYVSSCQYVPDQETRLITSSGDQTC 182

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LWD+TTG R S+FGGE+ SGHTADV SVSI++SNTNMFVSGSCDTT  LWD R+ASRAV
Sbjct: 183  VLWDVTTGQRISIFGGEFPSGHTADVQSVSINSSNTNMFVSGSCDTTVRLWDIRIASRAV 242

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ--PHSDNEVHRVT 1025
            RT+HGHE DV +VKFFPDG+RFGTGSDDGTCRLFD+RTGHQLQVYS+    + NE+  VT
Sbjct: 243  RTYHGHEDDVNSVKFFPDGHRFGTGSDDGTCRLFDMRTGHQLQVYSREPDRNSNELPTVT 302

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            SIAFSISGRLLFAGY+NGDCYVWDTLLA++VLNLG+LQNSHDGRISCLG+S DGSALCTG
Sbjct: 303  SIAFSISGRLLFAGYSNGDCYVWDTLLAEVVLNLGNLQNSHDGRISCLGMSSDGSALCTG 362

Query: 1206 SWDTTLKIWAFGGYRQVI 1259
            SWD  LKIWAF G+R+++
Sbjct: 363  SWDKNLKIWAFSGHRKIV 380



>gb:BT020366_1642761 Arabidopsis thaliana At4g34460 gene, complete
            cds.
          Length = 375

 Score =  598 bits (1542), Expect = e-170
 Identities = 291/373 (78%), Positives = 317/373 (84%), Gaps = 1/373 (0%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            MSV+ELKERH  AT+TVN+             DTDVA Y+ +QG+T +SFG TDLVCCR 
Sbjct: 1    MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRT 60

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGHTGKVYSLDWTPE+NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP GQ
Sbjct: 61   LQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQ 120

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            SVACGGLDSVCSIF+L+   D DG   VSR L+GH+GYVS CQYVPNEDAHLITSSGD+T
Sbjct: 121  SVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQT 180

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWD+TTGL+TSVFGGE+QSGHTADV SVSIS SN N F+SGSCD+TA LWDTR ASRA
Sbjct: 181  CILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRA 240

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            VRTFHGHEGDV  VKFFPDG RFGTGSDDGTCRL+DIRTGHQLQVY QPH D E   VTS
Sbjct: 241  VRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGHQLQVY-QPHGDGENGPVTS 299

Query: 1029 IAFSISGRLLFAGY-TNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            IAFS+SGRLLFAGY +N  CYVWDTLL ++VL+LG  Q+SH  RISCLGLS DGSALCTG
Sbjct: 300  IAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQDSHRNRISCLGLSADGSALCTG 359

Query: 1206 SWDTTLKIWAFGG 1244
            SWD+ LKIWAFGG
Sbjct: 360  SWDSNLKIWAFGG 372



>gb:AB090160_1524945 Triticum aestivum TaGB1 mRNA for G protein beta
            subunit, complete cds.
          Length = 380

 Score =  587 bits (1513), Expect = e-166
 Identities = 276/378 (73%), Positives = 317/378 (83%), Gaps = 2/378 (0%)
 Frame = +3

Query: 132  SVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRNL 311
            SVAELKE+H AAT +VNS             DTDV  Y+++QG+T +SF PTDLVCCR L
Sbjct: 3    SVAELKEKHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNPTDLVCCRTL 62

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WVM CAF+P GQS
Sbjct: 63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVMECAFAPNGQS 122

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            VACGGLDS CSIFNL+   D DGN  VSR L+GHKGY S+CQYVP+++  LIT SGD+TC
Sbjct: 123  VACGGLDSACSIFNLSSQADRDGNMPVSRVLTGHKGYASSCQYVPDQETRLITGSGDQTC 182

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LWD+TTG R S+FG E+ SGHTADV S+SI++ N NMF+SGSCDTT  LWD R+ SRAV
Sbjct: 183  VLWDVTTGQRISIFGSEFPSGHTADVLSLSINSLNANMFISGSCDTTVRLWDLRITSRAV 242

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ--PHSDNEVHRVT 1025
            RT+HGHEGD+ +VKFFPDG RFGTGSDDGTCRLFD+RTGHQLQVY++    +DNE+  VT
Sbjct: 243  RTYHGHEGDINSVKFFPDGQRFGTGSDDGTCRLFDMRTGHQLQVYNREPDRNDNELPIVT 302

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            S+AFSISGRLLFAGY+NGDCYVWDTLLA+MVLNLG+LQNSH+GRISCLGLS DGSALCTG
Sbjct: 303  SVAFSISGRLLFAGYSNGDCYVWDTLLAEMVLNLGTLQNSHEGRISCLGLSSDGSALCTG 362

Query: 1206 SWDTTLKIWAFGGYRQVI 1259
            SWD  LKIWAF G+R+++
Sbjct: 363  SWDKNLKIWAFSGHRKIV 380



>pir|T08036|T08036 GTP-binding regulatory protein beta chain - wild
            oat>gb:AF033357_1762690 Avena fatua G protein beta
            subunit (Gb1) mRNA, complete cds.
          Length = 380

 Score =  576 bits (1485), Expect = e-163
 Identities = 274/378 (72%), Positives = 316/378 (83%), Gaps = 2/378 (0%)
 Frame = +3

Query: 132  SVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRNL 311
            SVAELKERH AAT +VNS             DTDV  Y+++QG+T +SF  TDLVCCR L
Sbjct: 3    SVAELKERHAAATASVNSLRERLRQRRQTLLDTDVEKYSKAQGRTAVSFNQTDLVCCRTL 62

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            QGH+GKVYSLDWTPEKN IVSASQDGRLIVWNALTSQKTHAIKL C WV+TCAF+P GQS
Sbjct: 63   QGHSGKVYSLDWTPEKNWIVSASQDGRLIVWNALTSQKTHAIKLHCPWVITCAFAPNGQS 122

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            VACGGL+S CSIFNLN   D +GN  VS+ L+G KGYV +CQYVP+++  +IT SGD TC
Sbjct: 123  VACGGLNSACSIFNLNSQVDRNGNMPVSKLLTGPKGYVLSCQYVPDQETRMITGSGDPTC 182

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LWD+TTG R S+FGGE+ SGHTADV S+SI++ NTNMFVSGSCDTT  LWD R+ASRAV
Sbjct: 183  VLWDVTTGQRISIFGGEFPSGHTADVLSLSINSLNTNMFVSGSCDTTVRLWDLRIASRAV 242

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ--PHSDNEVHRVT 1025
            RT+HGHEGD+ +VKFFPDG+RFGTGSDDGTCRLFD+R  HQLQVYS+    +DNE+  VT
Sbjct: 243  RTYHGHEGDINSVKFFPDGHRFGTGSDDGTCRLFDMRIRHQLQVYSREPDRNDNELPSVT 302

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            SIAFSISGRLLFAGY+NGDCY WDTLLA++VLNLG+LQNSH+GRISCLGLS DGSALCTG
Sbjct: 303  SIAFSISGRLLFAGYSNGDCYAWDTLLAEVVLNLGTLQNSHEGRISCLGLSSDGSALCTG 362

Query: 1206 SWDTTLKIWAFGGYRQVI 1259
            SWD  LKIWAF G+R+++
Sbjct: 363  SWDKNLKIWAFSGHRKIV 380



>gb:PPA428878_1701231 Physcomitrella patens mRNA for putative
            heterotrimeric G protein beta subunit (gb1 gene).
          Length = 377

 Score =  426 bits (1095), Expect = e-118
 Identities = 214/377 (56%), Positives = 270/377 (71%), Gaps = 5/377 (1%)
 Frame = +3

Query: 129  MSVAE-LKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCR 305
            MSVA+ ++ER+  +   V S             DTD   +  +     ISF    +VC R
Sbjct: 1    MSVADSVRERYEVSKAEVQSLREQLHEKRASLLDTDGGPFIPADFVVVISF--VFMVCVR 58

Query: 306  NLQGHTGKVYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
             LQGHTGK+YSLDW   E +RIVSASQDGRLIVWNA++SQKT+++KL CAWV   A SP 
Sbjct: 59   TLQGHTGKIYSLDWAYRETSRIVSASQDGRLIVWNAISSQKTYSLKLACAWVKAAAISPG 118

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G +VACGGLD+VCSIFNL+  PD +GN  VS TL+GH GY+S+C+Y+P ++ H++TSSGD
Sbjct: 119  GNTVACGGLDNVCSIFNLSSVPDKEGNLPVSGTLAGHTGYLSSCKYMPTQEKHIVTSSGD 178

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC  WD+ T    +VFGG+  +GHT DV SVS+S+S+ ++F+SGSCD +A LWD R  +
Sbjct: 179  HTCRFWDVETQCCIAVFGGDILTGHTGDVMSVSVSSSSPHVFISGSCDKSAKLWDVRTPA 238

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY--SQPHSDNEVH 1016
            RA RTF+GHEGDV  V F  +G  FGTGSDDG+CRLFDI TGH+LQ Y   Q  +   V+
Sbjct: 239  RAQRTFYGHEGDVNTVNFLSEGRHFGTGSDDGSCRLFDIGTGHELQQYWDKQALARGPVN 298

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL-GSLQNSHDGRISCLGLSGDGSA 1193
             VTS+AFS SGRLLFAGY+NG+CYVWDTLLAK+V NL G   + H  R+SCLGL+ DG A
Sbjct: 299  -VTSVAFSRSGRLLFAGYSNGNCYVWDTLLAKVVANLGGGRDDGHTNRVSCLGLAADGDA 357

Query: 1194 LCTGSWDTTLKIWAFGG 1244
            LCTGS+D TLK+W+  G
Sbjct: 358  LCTGSYDATLKVWSCAG 374



>gb:NTU22524_1691820 Nicotiana tabacum heterotrimeric GTP-binding
            protein beta subunit mRNA, partial cds.
          Length = 240

 Score =  422 bits (1086), Expect = e-117
 Identities = 199/240 (82%), Positives = 216/240 (90%)
 Frame = +3

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+TC
Sbjct: 1    VACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTC 60

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LWDITTGLRTSVFGGE+QSGHTADV SVSIS+SN  +FVSGSCDTTA LWD RVASRA 
Sbjct: 61   VLWDITTGLRTSVFGGEFQSGHTADVQSVSISSSNPRLFVSGSCDTTARLWDNRVASRAQ 120

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            RTF+GHEGDV  VKFFPDGNRFGTGS+DGTCRLFDIRTGHQLQVY QPH D ++  VTS+
Sbjct: 121  RTFYGHEGDVNTVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTSM 180

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            AFSISGRLLF GY+NGDCYVWDTLLAK+VLNLG +QNSH+GRISCLGLS DGSA+CTG+W
Sbjct: 181  AFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGGVQNSHEGRISCLGLSADGSAICTGTW 240



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 2/129 (1%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGN-RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            R   GH+G V + ++ PD +    T S D TC L+DI TG +  V+           V S
Sbjct: 29   RMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTADVQS 88

Query: 1029 IAFSISG-RLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            ++ S S  RL  +G  +    +WD  +A            H+G ++ +    DG+   TG
Sbjct: 89   VSISSSNPRLFVSGSCDTTARLWDNRVASRAQRTFY---GHEGDVNTVKFFPDGNRFGTG 145

Query: 1206 SWDTTLKIW 1232
            S D T +++
Sbjct: 146  SEDGTCRLF 154



>pir|T02059|T02059 GTP-binding regulatory protein beta chain - common
            tobacco  (fragment)
          Length = 240

 Score =  422 bits (1086), Expect = e-117
 Identities = 199/240 (82%), Positives = 216/240 (90%)
 Frame = +3

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            VACGGLDSVCSIFNLN P D DGN  VSR LSGHKGYVS+CQYVP+ED HLITSSGD+TC
Sbjct: 1    VACGGLDSVCSIFNLNSPIDKDGNHPVSRMLSGHKGYVSSCQYVPDEDTHLITSSGDQTC 60

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LWDITTGLRTSVFGGE+QSGHTADV SVSIS+SN  +FVSGSCDTTA LWD RVASRA 
Sbjct: 61   VLWDITTGLRTSVFGGEFQSGHTADVQSVSISSSNPRLFVSGSCDTTARLWDNRVASRAQ 120

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            RTF+GHEGDV  VKFFPDGNRFGTGS+DGTCRLFDIRTGHQLQVY QPH D ++  VTS+
Sbjct: 121  RTFYGHEGDVNTVKFFPDGNRFGTGSEDGTCRLFDIRTGHQLQVYYQPHGDGDIPHVTSM 180

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            AFSISGRLLF GY+NGDCYVWDTLLAK+VLNLG +QNSH+GRISCLGLS DGSA+CTG+W
Sbjct: 181  AFSISGRLLFVGYSNGDCYVWDTLLAKVVLNLGGVQNSHEGRISCLGLSADGSAICTGTW 240



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 2/129 (1%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGN-RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            R   GH+G V + ++ PD +    T S D TC L+DI TG +  V+           V S
Sbjct: 29   RMLSGHKGYVSSCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTADVQS 88

Query: 1029 IAFSISG-RLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            ++ S S  RL  +G  +    +WD  +A            H+G ++ +    DG+   TG
Sbjct: 89   VSISSSNPRLFVSGSCDTTARLWDNRVASRAQRTFY---GHEGDVNTVKFFPDGNRFGTG 145

Query: 1206 SWDTTLKIW 1232
            S D T +++
Sbjct: 146  SEDGTCRLF 154



>gb:AF056182_1764686 Emericella nidulans G-protein beta subunit (sfaD)
            gene, complete cds.
          Length = 352

 Score =  338 bits (868), Expect = 1e-91
 Identities = 165/312 (52%), Positives = 221/312 (70%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct: 59   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS 118

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  +ITSSGD
Sbjct: 119  GNYVACGGLDNICSIYNLS---SREGPTRVARELSGHSGYLSCCRFI--NDRRIITSSGD 173

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI +G + + F     + H  DV S+SI+ +N N+FVSG+CD  A LWD R   
Sbjct: 174  MTCMLWDIESGSKVTEF-----ADHFGDVMSISINPTNQNIFVSGACDAFAKLWDIR-TG 227

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +AV+TF GHE D+ A++FFPDGN FGTGSDD TCRLFDIR    L  Y    SD  +  +
Sbjct: 228  KAVQTFAGHESDINAIQFFPDGNAFGTGSDDTTCRLFDIRADRSLNTY---QSDQILCGI 284

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+ FS+SGRLLFAGY + +C VWD L    V   GSL + H+ R+SCLG+S DG +LCT
Sbjct: 285  TSVGFSVSGRLLFAGYDDFECKVWDVLRGDKV---GSL-SGHENRVSCLGVSNDGISLCT 340

Query: 1203 GSWDTTLKIWAF 1238
            GSWD+ LK+WA+
Sbjct: 341  GSWDSLLKVWAW 352



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 29/134 (21%), Positives = 54/134 (40%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  +  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 52   RIGMKPRRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSS--- 108

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +    +    + H G +SC     D  
Sbjct: 109  --WVMTCAYAPSGNYVACGGLDNICSIYNLSSREGPTRVARELSGHSGYLSCCRFIND-R 165

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S D T  +W
Sbjct: 166  RIITSSGDMTCMLW 179



>gb:AF484341_1804059 Sporothrix schenckii G-protein beta subunit
            (gb-1) gene, complete cds.>gb:AF484342_1804060 Sporothrix
            schenckii G-protein beta subunit (gb-1) mRNA, complete
            cds.
          Length = 359

 Score =  335 bits (859), Expect = 1e-90
 Identities = 164/312 (52%), Positives = 222/312 (71%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct: 65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS 124

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct: 125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSSGD 180

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC  WDI TG R   F     + H  DV S+S++ +N N F+SG+CD  A LWD R A 
Sbjct: 181  MTCMKWDIETGTRVVEF-----ADHLGDVMSISLNPTNQNTFISGACDAFAKLWDIR-AG 234

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +AV+TF GHE D+ A++FFPDG+ F TGSDD TCRLFDIR   +L VY    S++ +  +
Sbjct: 235  KAVQTFAGHESDINAIQFFPDGHSFVTGSDDATCRLFDIRADRELNVYG---SESILCGI 291

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+A S+SGRLLFAGY + +C VWD    + V   GSL   H+ R+SCLG+S DG +LCT
Sbjct: 292  TSVATSVSGRLLFAGYDDFECKVWDVTRGEKV---GSLV-GHENRVSCLGVSNDGISLCT 347

Query: 1203 GSWDTTLKIWAF 1238
            GSWD++LKIWA+
Sbjct: 348  GSWDSSLKIWAY 359



>gb:AB072452_1523016 Fusarium oxysporum fgb1 gene for guanine
            nucleotide-binding protein beta subunit, partial
            cds.>gb:AY219172_1590347 Fusarium oxysporum f. sp.
            lycopersici G protein beta subunit (fgb1) gene, complete
            cds.
          Length = 359

 Score =  334 bits (857), Expect = 2e-90
 Identities = 173/375 (46%), Positives = 242/375 (64%)
 Frame = +3

Query: 114  QGKTKMSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDL 293
            QG + +S   ++ R   A +   +             DT +   A+ Q   PI      +
Sbjct: 4    QGNSDVSPEAMQSRIQQARREAETLKDRIKRKKDDLADTTLRAVAQ-QAHEPIPKNQL-M 61

Query: 294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
               R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+
Sbjct: 62   KAKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAY 121

Query: 474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
            +P+G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TS
Sbjct: 122  APSGNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTS 177

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            SGD TC  WDI TG + + F     + H  DV S+S++ +N N F+SG+CD  A LWD R
Sbjct: 178  SGDMTCMKWDIETGQKVTEF-----ADHLGDVMSISLNPTNQNTFISGACDAFAKLWDIR 232

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
             A +AV+TF GHE D+ A++FFPDG+ F TGSDD TCRLFDIR   +L +Y    S++ +
Sbjct: 233  -AGKAVQTFAGHESDINAIQFFPDGHSFVTGSDDATCRLFDIRADRELNLYG---SESIL 288

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
              +TS+A S+SGRLLFAGY + +C VWD    + V   GSL   H+ R+SCLG+S DG++
Sbjct: 289  CGITSVATSVSGRLLFAGYDDFECKVWDITRGEKV---GSLV-GHENRVSCLGVSNDGTS 344

Query: 1194 LCTGSWDTTLKIWAF 1238
            LCTGSWD+ LKIWA+
Sbjct: 345  LCTGSWDSLLKIWAY 359



>sp|O14435|GBB_CRYPA Guanine nucleotide-binding protein beta
            subunit.>gb:CPU95139_1648936 Cryphonectria parasitica GTP
            binding protein beta subunit (cpgb-1) gene, complete cds.
          Length = 359

 Score =  333 bits (853), Expect = 7e-90
 Identities = 163/312 (52%), Positives = 221/312 (70%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct: 65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS 124

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct: 125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSSGD 180

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC  WDI TG +   F     + H  DV S+S++ +N N F+SG+CD  A LWD R A 
Sbjct: 181  MTCMKWDIETGTKQIEF-----ADHLGDVMSISLNPTNQNTFISGACDAFAKLWDIR-AG 234

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +AV+TF GHE D+ A++FFPDG+ F TGSDD TCRLFDIR   +L VY    S++ +  +
Sbjct: 235  KAVQTFAGHESDINAIQFFPDGHSFVTGSDDATCRLFDIRADRELNVYG---SESILCGI 291

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+A S+SGRLLFAGY + +C VWD    + V   GSL   H+ R+SCLG+S DG +LCT
Sbjct: 292  TSVATSVSGRLLFAGYDDFECKVWDVTRGEKV---GSLV-GHENRVSCLGVSNDGISLCT 347

Query: 1203 GSWDTTLKIWAF 1238
            GSWD+ LKIWA+
Sbjct: 348  GSWDSLLKIWAY 359



>gb:AB086901_1524594 Magnaporthe grisea Mgb1 gene for heterotrimeric
            G-protein beta subunit, complete cds.
          Length = 359

 Score =  332 bits (852), Expect = 9e-90
 Identities = 163/312 (52%), Positives = 220/312 (70%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct: 65   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS 124

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NLN   + DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct: 125  GNYVACGGLDNICSIYNLN--QNRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSSGD 180

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC  WDI TG +   F     + H  DV S+S+  +N N F+SG+CD+ A LWD R A 
Sbjct: 181  MTCMKWDIETGTKVIEF-----ADHLGDVMSISLDPTNQNTFISGACDSFAKLWDIR-AG 234

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +AV+TF GHE D+ A++FFPDG+ F TGSDD TCRLFDIR   +L VY    S++ +  +
Sbjct: 235  KAVQTFAGHESDINAIQFFPDGHSFVTGSDDATCRLFDIRADRELNVYG---SESILCGI 291

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+A S+SGRLLFAGY + +C VWD      V   GSL   H+ R+SCLG+S DG +LCT
Sbjct: 292  TSVATSVSGRLLFAGYDDFECKVWDITRGDKV---GSLV-GHENRVSCLGVSNDGMSLCT 347

Query: 1203 GSWDTTLKIWAF 1238
            GSWD+ LKIWA+
Sbjct: 348  GSWDSLLKIWAY 359



>gb:AY190116_1588470 Trichoderma atroviride heterotrimeric G protein
            beta subunit TGB1 (tgb1) gene, complete cds.
          Length = 358

 Score =  331 bits (849), Expect = 2e-89
 Identities = 161/312 (51%), Positives = 221/312 (70%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct: 64   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS 123

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NLN     DG + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct: 124  GNFVACGGLDNICSIYNLN--QQRDGPTRVARELSGHAGYLSCCRFI--NDRSILTSSGD 179

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC  WDI TG + + F     + H  DV S+S++ +N N F+SG+CD  A LWD R A 
Sbjct: 180  MTCMNWDIETGQKVTEF-----ADHLGDVMSISLNPTNQNTFISGACDAFAKLWDIR-AG 233

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +AV+TF GHE D+ A++FFPDG+ F TGSDD TCRLFDIR   +L +Y    S++ +  +
Sbjct: 234  KAVQTFAGHESDINAIQFFPDGHSFVTGSDDATCRLFDIRADRELNLYG---SESILCGI 290

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+A S+SGRLLFAGY + +C VWD    + V   GSL   H+ R+SCLG+S DG +LCT
Sbjct: 291  TSVATSVSGRLLFAGYDDFECKVWDITRGEKV---GSLV-GHENRVSCLGVSNDGISLCT 346

Query: 1203 GSWDTTLKIWAF 1238
            GSWD+ LK+WA+
Sbjct: 347  GSWDSLLKVWAY 358



>gb:BX908807_1644488 Neurospora crassa DNA linkage group III BAC
            contig B13B7.>gb:AF491286_1804870 Neurospora crassa
            G-protein beta subunit (gnb-1) gene, complete cds.
          Length = 358

 Score =  330 bits (847), Expect = 3e-89
 Identities = 162/312 (51%), Positives = 221/312 (70%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA++P+
Sbjct: 64   KTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS 123

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NLN   + DG + V R LSGH GY+S C+++   D  ++TSSGD
Sbjct: 124  GNFVACGGLDNICSIYNLN--SNRDGPTRVYRELSGHAGYLSCCRFI--NDRSILTSSGD 179

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC  WDI TG +   F     + H  DV S+S++ +N N FVSG+CD+ A LWD R A 
Sbjct: 180  MTCMKWDIETGTKVVEF-----ADHLGDVMSISLNPTNQNTFVSGACDSFAKLWDIR-AG 233

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +AV+TF GHE D+ A++FFPDG+ F TGSDD TCRLFDIR   +L  Y    S++ +  +
Sbjct: 234  KAVQTFAGHESDINAIQFFPDGHSFVTGSDDATCRLFDIRADRELNCY---RSESILCGI 290

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+A S+SGRLLFAGY + +C VWD   A+ V   GSL   H+ R+SCLG+S DG +LCT
Sbjct: 291  TSVATSVSGRLLFAGYDDFECKVWDLTRAEKV---GSLV-GHENRVSCLGVSNDGISLCT 346

Query: 1203 GSWDTTLKIWAF 1238
            GSWD+ LK+WA+
Sbjct: 347  GSWDSLLKVWAY 358



>gb:AF536325_1809659 Ustilago maydis G-protein beta subunit Bpp1
            (bpp1) gene, complete cds.
          Length = 349

 Score =  327 bits (837), Expect = 5e-88
 Identities = 173/367 (47%), Positives = 234/367 (63%), Gaps = 1/367 (0%)
 Frame = +3

Query: 138  AELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTP-ISFGPTDLVCCRNLQ 314
            A+L+ER  AA +  +              DT +   A      P I   P      R L+
Sbjct: 6    ADLQERIAAARREADGLKEKIRAKKDQMADTSLRAMANDIEPLPRIVMKPR-----RTLK 60

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA++P+G SV
Sbjct: 61   GHLAKIYAMHWASDKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPSGNSV 120

Query: 495  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG 674
            ACGGLD++CSI++L     +  N  V R LS H GY+S C+++   D  ++TSSGD +C 
Sbjct: 121  ACGGLDNICSIYSLR--GRDPHNIKVGRELSAHTGYLSCCRFL--NDQQILTSSGDMSCI 176

Query: 675  LWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVR 854
            LWDI +G R S F     + HT DV S+S+S SN N+FVSG+CD  A +WD R + +AV+
Sbjct: 177  LWDIDSGTRISEF-----NDHTGDVMSISLS-SNPNVFVSGACDAVAKVWDIR-SGKAVQ 229

Query: 855  TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIA 1034
            TF GHE D+ AV+FFP+G+ F TGSDD +CRLFD+R   +L  Y+    DN +  +TS+ 
Sbjct: 230  TFAGHESDINAVQFFPNGDAFATGSDDASCRLFDLRADRELNTYTH---DNILCGITSVG 286

Query: 1035 FSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWD 1214
            FS+SGR+LFAGY +  C VWDTL  + V     +  +H+ R+SCLG+S DG ALCTGSWD
Sbjct: 287  FSVSGRILFAGYDDYTCNVWDTLKGERV----GVLAAHENRVSCLGVSADGMALCTGSWD 342

Query: 1215 TTLKIWA 1235
            + L IWA
Sbjct: 343  SRLLIWA 349



>gb:AY661671_1620416 Lentinula edodes guanine nucleotide binding
            protein beta subunit 2 (Gbeta2) mRNA, complete cds.
          Length = 349

 Score =  326 bits (836), Expect = 6e-88
 Identities = 174/369 (47%), Positives = 229/369 (62%), Gaps = 1/369 (0%)
 Frame = +3

Query: 132  SVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTP-ISFGPTDLVCCRN 308
            S  +++ER  AA +   S             DT +   A      P I   P      R 
Sbjct: 4    SQGDIQERIAAARREAESLKEKIRAKKESSADTSLRAMAAEVDALPRIVMRPR-----RA 58

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  K+Y++ W  ++  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+S +G 
Sbjct: 59   LRGHLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSASGN 118

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VACGGLD++CSI+NLN       N   +R LS H GY+S C+++   D  ++TSSGD T
Sbjct: 119  FVACGGLDNICSIYNLN--SKEGTNLRGARELSAHSGYLSCCRFL--NDRQIVTSSGDMT 174

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDI  G+R   F     S HT DV S+S+   N N+FVSG+CD TA LWD R + RA
Sbjct: 175  CMLWDIEAGVRVVEF-----SDHTGDVMSLSL-GPNQNVFVSGACDATAKLWDIR-SGRA 227

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             +TF GHE D+ AV+FFP+G+ F TGSDD +CRLFDIR   +L  +     DN +  +TS
Sbjct: 228  TQTFTGHESDINAVQFFPNGDAFATGSDDASCRLFDIRADRELNTFIH---DNILCGITS 284

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +AFSISGR+LF GY +  C VWDTL  + V     +   H+ R+SCLG+S DG ALCTGS
Sbjct: 285  VAFSISGRILFGGYDDWTCNVWDTLKGERV----GVLTGHENRVSCLGVSTDGMALCTGS 340

Query: 1209 WDTTLKIWA 1235
            WD+TL++WA
Sbjct: 341  WDSTLRVWA 349



>gb:AY211190_1589696 Cochliobolus heterostrophus G-protein beta
            subunit Cgb1 gene, complete cds.
          Length = 351

 Score =  326 bits (836), Expect = 6e-88
 Identities = 160/311 (51%), Positives = 216/311 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ ++  +VSASQDG+LI+W+A T+ K HAI L  +WVMTCA+SP+
Sbjct: 59   RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYSPS 118

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL+     +G + V+R LSGH GY+S C+++   D  ++TSSGD
Sbjct: 119  GNYVACGGLDNICSIYNLSA---REGPTRVARELSGHSGYLSCCRFI--SDKRILTSSGD 173

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWD+ TG +   F     + H  DV S+SI+  + N FVSG+CD  A LWD R   
Sbjct: 174  MTCVLWDLETGSKVHEF-----ADHLGDVMSLSINPLDHNQFVSGACDAFAKLWDIR-QQ 227

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            + V+TF  H+ D+ A++FFP+GN FGTGSDD +CRLFDIR   +L  Y  P     V  +
Sbjct: 228  KCVQTFAAHDSDINAIQFFPNGNAFGTGSDDASCRLFDIRADRELASYQIP---EPVCGI 284

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS+SGRLLFAGY + +C VWD L  + V   G+LQ  HD R+SCLG+S D  +LCT
Sbjct: 285  TSVAFSVSGRLLFAGYDDFECKVWDVLRGERV---GTLQ-GHDNRVSCLGVSNDALSLCT 340

Query: 1203 GSWDTTLKIWA 1235
            GSWD+ L+IWA
Sbjct: 341  GSWDSMLRIWA 351



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 54/231 (23%), Positives = 96/231 (41%), Gaps = 4/231 (1%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            RTL GH   + A  +   +  HL+++S D    +WD  T  +            ++ V +
Sbjct: 59   RTLKGHLAKIYAMHW-STDRRHLVSASQDGKLIIWDAYTTNKVHAI-----PLRSSWVMT 112

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVA---SRAVRTFHGHEGDVIAVKFFPDGNRFGTG 926
             + S S  N    G  D    +++       +R  R   GH G +   +F  D  R  T 
Sbjct: 113  CAYSPSG-NYVACGGLDNICSIYNLSAREGPTRVARELSGHSGYLSCCRFISD-KRILTS 170

Query: 927  SDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFS-ISGRLLFAGYTNGDCYVWDTL 1103
            S D TC L+D+ TG ++  ++    D     V S++ + +      +G  +    +WD  
Sbjct: 171  SGDMTCVLWDLETGSKVHEFADHLGD-----VMSLSINPLDHNQFVSGACDAFAKLWDIR 225

Query: 1104 LAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
              K V    +    HD  I+ +    +G+A  TGS D + +++     R++
Sbjct: 226  QQKCVQTFAA----HDSDINAIQFFPNGNAFGTGSDDASCRLFDIRADREL 272



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 30/134 (22%), Positives = 54/134 (40%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  +  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 52   RLTMKTKRTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSS--- 108

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A+S SG  +  G  +  C +++    +    +    + H G +SC     D  
Sbjct: 109  --WVMTCAYSPSGNYVACGGLDNICSIYNLSAREGPTRVARELSGHSGYLSCCRFISD-K 165

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S D T  +W
Sbjct: 166  RILTSSGDMTCVLW 179



>gb:AF277161_2483898 Ambystoma tigrinum G-protein B1 subunit mRNA,
            complete cds.
          Length = 340

 Score =  323 bits (828), Expect = 5e-87
 Identities = 161/310 (51%), Positives = 214/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFI--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A ++  FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----AGHTGDVMSLSL-APDSRCFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFI-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>gb:BC056708_2551901 Danio rerio guanine nucleotide binding protein (G
            protein), beta polypeptide 1, mRNA (cDNA clone MGC:65927
            IMAGE:6789772), complete cds.>gb:BC071277_2556023 Danio
            rerio guanine nucleotide binding protein (G protein),
            beta polypeptide 1, mRNA (cDNA clone MGC:85666
            IMAGE:6960336), complete cds.
          Length = 340

 Score =  323 bits (827), Expect = 7e-87
 Identities = 160/310 (51%), Positives = 214/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----AGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:AF091120_1767420 Filobasidiella neoformans G-protein beta subunit
            GPB1 gene, complete cds.
          Length = 352

 Score =  323 bits (827), Expect = 7e-87
 Identities = 161/316 (50%), Positives = 215/316 (68%), Gaps = 5/316 (1%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y+L W  +   IVSASQDG+LIVW+A T+ K HAI L  +WVMT A++P+
Sbjct: 53   RTLKGHLAKIYALHWAADTRHIVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTAAYAPS 112

Query: 483  GQSVACGGLDSVCSIFNL-----NLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            G  VACGGLD+VCSI++L       P    G   V+R LS H GY+S C+++   D  ++
Sbjct: 113  GNLVACGGLDNVCSIYSLRGAGPGAPGAPGGQVKVARELSAHSGYLSCCRFI--NDRQIV 170

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            TSSGD TC LWDI  G RT  F     + HT DV  +S+ A N N+FVSG+CD TA +WD
Sbjct: 171  TSSGDMTCMLWDIEQGTRTMEF-----NDHTGDVMCISL-APNANLFVSGACDATAKVWD 224

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
             R   +AV+TF GHE D+ AV+FFP+G+ F TGSDD +C+LFD+R   +L  Y+    DN
Sbjct: 225  IR-TGKAVQTFTGHESDINAVQFFPNGDAFATGSDDASCKLFDLRADRELNSYAH---DN 280

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
             +  +TS+AFSISGR+LFAGY + +C VWDTL  + +     +   H+ R+SC+G+SGDG
Sbjct: 281  ILCGITSVAFSISGRVLFAGYDDYNCNVWDTLKGERI----GVLAGHENRVSCMGVSGDG 336

Query: 1188 SALCTGSWDTTLKIWA 1235
             ALCTGSWD+ LK+W+
Sbjct: 337  VALCTGSWDSLLKVWS 352



 Score = 35.4 bits (80), Expect = 2.9
 Identities = 32/142 (22%), Positives = 57/142 (40%), Gaps = 8/142 (5%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  +A RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 46   RITLKARRTLKGHLAKIYALHWAADTRHIVSASQDGKLIVWDAYTTNKVHAIPLRSS--- 102

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM--------VLNLGSLQNSHDGRISC 1166
               V + A++ SG L+  G  +  C ++    A           + +    ++H G +SC
Sbjct: 103  --WVMTAAYAPSGNLVACGGLDNVCSIYSLRGAGPGAPGAPGGQVKVARELSAHSGYLSC 160

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 D   + T S D T  +W
Sbjct: 161  CRFIND-RQIVTSSGDMTCMLW 181



>gb:BC084263_2563650 Xenopus laevis beta 1 subunit of heterotrimeric
            GTP-binding protein, mRNA (cDNA clone MGC:81991
            IMAGE:7010476), complete cds.
          Length = 340

 Score =  322 bits (826), Expect = 9e-87
 Identities = 161/310 (51%), Positives = 214/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A ++  FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDSRCFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>gb:BC044482_2548786 Danio rerio guanine nucleotide binding protein (G
            protein), beta polypeptide 1, like, mRNA (cDNA clone
            MGC:55774 IMAGE:3817085), complete cds.
          Length = 340

 Score =  322 bits (826), Expect = 9e-87
 Identities = 160/310 (51%), Positives = 215/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYSLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----AGHTGDVMSLSL-APDTRLFVSGACDASAKLWDIR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 40.8 bits (94), Expect = 0.070
 Identities = 31/134 (23%), Positives = 55/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:AB099715_2464872 Oryzias latipes Ol-Gb1 mRNA for guanine
            nucleotide-binding protein beta subunit, complete cds.
          Length = 340

 Score =  322 bits (826), Expect = 9e-87
 Identities = 159/310 (51%), Positives = 215/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             +C LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TSCALWDIETGQQTTTF-----AGHTGDVMSLSL-APDTRLFVSGACDASAKLWDIR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L +YS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMIYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/134 (22%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DT+  +W
Sbjct: 156  QIVTSSGDTSCALW 169



>gb:BC076910_2559649 Xenopus tropicalis guanine nucleotide binding
            protein (G protein), beta polypeptide 2, mRNA (cDNA clone
            MGC:89081 IMAGE:7006060), complete cds.
          Length = 340

 Score =  322 bits (825), Expect = 1e-86
 Identities = 161/310 (51%), Positives = 214/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A ++  FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDSRCFVSGACDASAKLWDIR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>pir|S09591|RGKWB GTP-binding regulatory protein beta chain -
            Caenorhabditis elegans>gb:CEBSGP_1359852 Caenorhabditis
            elegans gene for beta-subunit G-protein.
          Length = 340

 Score =  322 bits (825), Expect = 1e-86
 Identities = 167/336 (49%), Positives = 223/336 (66%)
 Frame = +3

Query: 225  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW 404
            DT +AT A +    PI  G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW
Sbjct: 27   DTTLATVASNL--EPI--GRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVW 82

Query: 405  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL 584
            ++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L
Sbjct: 83   DSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGGLDNICSIYSLK---TREGNVRVSREL 139

Query: 585  SGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSI 764
             GH GY+S C+++  +D  ++TSSGD TC LWDI TG + + F     +GHT DV S+S+
Sbjct: 140  PGHTGYLSCCRFL--DDNQIVTSSGDMTCALWDIETGQQCTAF-----TGHTGDVMSLSL 192

Query: 765  SASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTC 944
            S  +   F+SG+CD +A LWD R      +TF GHE D+ AV FFP GNRF TGSDD TC
Sbjct: 193  S-PDFRTFISGACDASAKLWDIR-DGMCKQTFPGHESDINAVAFFPSGNRFATGSDDATC 250

Query: 945  RLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLN 1124
            RLFDIR   +L +YS    DN +  +TS+AFS SGRLLFAGY + +C VWD++  +    
Sbjct: 251  RLFDIRADQELAMYSH---DNIICGITSVAFSKSGRLLFAGYDDFNCNVWDSMRQER--- 304

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
               +   HD R+SCLG++ DG A+CTGSWD+ LKIW
Sbjct: 305  -AGVLAGHDNRVSCLGVTEDGMAVCTGSWDSFLKIW 339



>gb:AE017344_1756343 Cryptococcus neoformans var. neoformans JEC21
            chromosome 4, complete sequence.
          Length = 343

 Score =  322 bits (824), Expect = 2e-86
 Identities = 159/311 (51%), Positives = 214/311 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y+L W  +   +VSASQDGRLIVW+A ++ K HA+ L  +WVMT A++P+
Sbjct: 53   RTLKGHLAKIYALHWAADTRHLVSASQDGRLIVWDAYSTNKVHAVPLRSSWVMTVAYAPS 112

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD+VCS++ L       G + V R LS H GY+S C+++   D  ++TSSGD
Sbjct: 113  GAFVACGGLDNVCSVYAL----APGGQAKVRRELSAHSGYLSCCRFI--NDRQIVTSSGD 166

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI  G RT  F     + HT DV S+S+ A N N+FVSG+CD TA +WD R   
Sbjct: 167  MTCMLWDIEQGTRTMEF-----NDHTGDVMSISL-APNANLFVSGACDATAKVWDIR-TG 219

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +AV+TF GHE D+ AV+FFP+G+ F TGSDD +C+LFD+R   +L  Y+    DN +  +
Sbjct: 220  KAVQTFTGHESDINAVQFFPNGDAFATGSDDASCKLFDLRADRELNSYAH---DNILRGI 276

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFSISGR+LFAGY + +C VWDTL  + +     +   H+ RISC+G+SGDG ALCT
Sbjct: 277  TSVAFSISGRVLFAGYDDYNCNVWDTLKGERI----GVLAGHENRISCMGVSGDGVALCT 332

Query: 1203 GSWDTTLKIWA 1235
            GSWD+ LK+W+
Sbjct: 333  GSWDSLLKVWS 343



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 35/141 (24%), Positives = 57/141 (40%), Gaps = 7/141 (4%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R A +A RT  GH   + A+ +  D     + S DG   ++D             +S N+
Sbjct: 46   RAALKARRTLKGHLAKIYALHWAADTRHLVSASQDGRLIVWD------------AYSTNK 93

Query: 1011 VHR-------VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCL 1169
            VH        V ++A++ SG  +  G  +  C V+  L       +    ++H G +SC 
Sbjct: 94   VHAVPLRSSWVMTVAYAPSGAFVACGGLDNVCSVY-ALAPGGQAKVRRELSAHSGYLSCC 152

Query: 1170 GLSGDGSALCTGSWDTTLKIW 1232
                D   + T S D T  +W
Sbjct: 153  RFIND-RQIVTSSGDMTCMLW 172



>sp|P54311|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T)
            beta subunit 1 (Transducin beta chain
            1).>gb:RRU34958_2138287 Rat G protein beta 1 subunit
            mRNA, complete cds.
          Length = 340

 Score =  321 bits (823), Expect = 2e-86
 Identities = 159/310 (51%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD L A    +L      HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGDLA----GHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:AJ719819_2502006 Gallus gallus mRNA for hypothetical protein,
            clone 6n13.
          Length = 340

 Score =  321 bits (822), Expect = 3e-86
 Identities = 160/310 (51%), Positives = 212/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +   FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDARCFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPKGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>sp|P79959|GBB1_XENLA Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain 1)
            (XGbeta1).>gb:XLXGBETA1_2583619 X.laevis mRNA for beta 1
            subunit of heterotrimeric GTP-binding protein.
          Length = 340

 Score =  320 bits (821), Expect = 3e-86
 Identities = 160/310 (51%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++C I+NL      +GN  VSR L+GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNYVACGGLDNICPIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A ++  FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDSRCFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 40.8 bits (94), Expect = 0.070
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICPIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>gb:AB071106_1871172 Macaca fascicularis testis cDNA clone:QtsA-18134,
            full insert sequence.
          Length = 309

 Score =  320 bits (820), Expect = 5e-86
 Identities = 158/310 (50%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 18   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTANKVHAIPLRSSWVMTCAYAPS 77

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 78   GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 132

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 133  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 185

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 186  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 242

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 243  TSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 298

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 299  GSWDSFLKIW 308



 Score = 42.0 bits (97), Expect = 0.031
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 11   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTANKVHAIPLRSS--- 67

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 68   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 124

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 125  QIVTSSGDTTCALW 138



>gb:AB071095_1871161 Macaca fascicularis testis cDNA clone:QtsA-17843,
            full insert sequence.
          Length = 296

 Score =  320 bits (820), Expect = 5e-86
 Identities = 158/310 (50%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 5    RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 64

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 65   GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 119

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 120  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 172

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 173  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 229

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 230  TSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 285

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 286  GSWDSFLKIW 295



 Score = 38.9 bits (89), Expect = 0.26
 Identities = 30/130 (23%), Positives = 54/130 (41%)
 Frame = +3

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S      V
Sbjct: 2    RTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS-----WV 56

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             + A++ SG  +  G  +  C +++    +  + +      H G +SC     D + + T
Sbjct: 57   MTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDNQIVT 115

Query: 1203 GSWDTTLKIW 1232
             S DTT  +W
Sbjct: 116  SSGDTTCALW 125



>sp|P04901|GBB1_HUMAN Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain
            1).>pir|A24225|RGBOB1 GTP-binding regulatory protein
            beta-1 chain - bovine>pir|A24853|RGHUB1 GTP-binding
            regulatory protein beta-1 chain - human>pir|JC5057|JC5057
            G protein beta 1 - mouse>gb:BOVTRNB2_1435926 Bovine
            transducin beta subunit mRNA, complete
            cds.>gb:CFRTB_1438667 C.familiaris mRNA for rod
            transducin beta subunit.>gb:AF501882_1905401 Homo sapiens
            guanine nucleotide binding protein beta 1 (GNB1) mRNA,
            complete cds.>gb:BC004186_1969056 Homo sapiens guanine
            nucleotide binding protein (G protein), beta polypeptide
            1, mRNA (cDNA clone MGC:2819 IMAGE:2964393), complete
            cds.>gb:BC005888_1969909 Homo sapiens guanine nucleotide
            binding protein (G protein), beta polypeptide 1, mRNA
            (cDNA clone MGC:4855 IMAGE:3605228), complete
            cds.>gb:BC008991_1971749 Homo sapiens guanine nucleotide
            binding protein (G protein), beta polypeptide 1, mRNA
            (cDNA clone MGC:18208 IMAGE:4155946), complete
            cds.>gb:BT007305_1990743 Homo sapiens guanine nucleotide
            binding protein (G protein), beta polypeptide 1 mRNA,
            complete cds.>gb:CR456784_1992991 Homo sapiens full open
            reading frame cDNA clone RZPDo834G064D for gene GNB1,
            guanine nucleotide binding protein (G protein), beta
            polypeptide 1; complete cds, incl.
            stopcodon.>gb:HS283E3_1997890 Human DNA sequence from
            clone RP1-283E3 on chromosome 1p36.21-36.33 Contains the
            MMP23B gene for matrix metalloproteinase 23B, the CDC2L2
            gene for cell division cycle 2-like 2, a novel gene, the
            SLC35E2 gene for solute carrier family 35 member E2, a
            ribosomal protein S7 (RPS7) pseudogene, the gene for an
            NAD kinase (FLJ13052), the 3' end of the GNB1 gene for
            guanine nucleotide binding protein (G protein) beta
            polypeptide 1 and four CpG islands, complete
            sequence.>gb:HSGBR_2013392 Human liver mRNA for
            beta-subunit signal transducing proteins Gs/Gi
            (beta-G).>gb:AB04284S10_2045612 Mus musculus GNB1 gene
            for G protein beta1 subunit, exon 11 and complete
            ccds.>gb:AY552805_2086500 Rattus norvegicus G-protein
            beta 1 subunit (Gnb1) mRNA, complete
            cds.>gb:BC013058_2091691 Mus musculus guanine nucleotide
            binding protein, beta 1, mRNA (cDNA clone MGC:11501
            IMAGE:3964965), complete cds.>gb:BC078809_2106965 Rattus
            norvegicus cDNA clone MGC:93395 IMAGE:7123318, complete
            cds.>gb:MMU29055_2120279 Mus musculus G protein beta 36
            subunit mRNA, complete cds.
          Length = 340

 Score =  320 bits (820), Expect = 5e-86
 Identities = 158/310 (50%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:CR860734_1184787 Pongo pygmaeus mRNA; cDNA DKFZp459O1427 (from
            clone DKFZp459O1427).
          Length = 340

 Score =  320 bits (819), Expect = 6e-86
 Identities = 158/310 (50%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDDRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein beta subunit
            1.>pir|T20830|T20830 hypothetical protein F13D12.7 -
            Caenorhabditis elegans>gb:AF291846_1259374 Caenorhabditis
            elegans heterotrimeric G protein beta subunit 1 (gpb-1)
            mRNA, complete cds.>gb:CEF13D12_1362339 Caenorhabditis
            elegans cosmid F13D12, complete sequence.
          Length = 340

 Score =  320 bits (819), Expect = 6e-86
 Identities = 166/336 (49%), Positives = 222/336 (66%)
 Frame = +3

Query: 225  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW 404
            DT +AT A +    PI  G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW
Sbjct: 27   DTTLATVASNL--EPI--GRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVW 82

Query: 405  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL 584
            ++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L
Sbjct: 83   DSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGGLDNICSIYSLK---TREGNVRVSREL 139

Query: 585  SGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSI 764
             GH GY+S C+++  +D  ++TSSGD TC LWDI TG + + F     +GHT DV S+S+
Sbjct: 140  PGHTGYLSCCRFL--DDNQIVTSSGDMTCALWDIETGQQCTAF-----TGHTGDVMSLSL 192

Query: 765  SASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTC 944
            S  +   F+SG+CD +A LWD R      +TF GHE D+ AV FFP GN F TGSDD TC
Sbjct: 193  S-PDFRTFISGACDASAKLWDIR-DGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATC 250

Query: 945  RLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLN 1124
            RLFDIR   +L +YS    DN +  +TS+AFS SGRLLFAGY + +C VWD++  +    
Sbjct: 251  RLFDIRADQELAMYSH---DNIICGITSVAFSKSGRLLFAGYDDFNCNVWDSMRQER--- 304

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
               +   HD R+SCLG++ DG A+CTGSWD+ LKIW
Sbjct: 305  -AGVLAGHDNRVSCLGVTEDGMAVCTGSWDSFLKIW 339



>sp|P36408|GBB_DICDI Guanine nucleotide-binding protein beta
            subunit.>pir|A47370|A47370 GTP-binding regulatory protein
            beta chain - slime mold  (Dictyostelium
            discoideum)>gb:AC116977_1207002 Dictyostelium discoideum
            chromosome 2 map 5515173-5817331 strain AX4, complete
            sequence.>gb:DDGPBS_1376912 Dictyostelium discoideum gene
            for G-protein beta-subunit.
          Length = 347

 Score =  319 bits (818), Expect = 8e-86
 Identities = 168/366 (45%), Positives = 225/366 (61%)
 Frame = +3

Query: 138  AELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRNLQG 317
            +++ E+   A +   S             DT + T+ R     P   G   +   RNL+G
Sbjct: 3    SDISEKIQQARRDAESMKEQIRANRDVMNDTTLKTFTRDLPGLPKMEGKIKVR--RNLKG 60

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H  K+Y++ W  +   +VSASQDG+L+VW+ LT+ K HAI L  +WVMTCA+SPT   VA
Sbjct: 61   HLAKIYAMHWAEDNVHLVSASQDGKLLVWDGLTTNKVHAIPLRSSWVMTCAYSPTANFVA 120

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            CGGLD++CSI+NL      +    V R L+ H GY+S C+++   D  ++TSSGD TC L
Sbjct: 121  CGGLDNICSIYNLR---SREQPIRVCRELNSHTGYLSCCRFL--NDRQIVTSSGDMTCIL 175

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            WD+  G + + F     S H  DV SVS+S  + N F+SG+CD TA LWD R + + V+T
Sbjct: 176  WDVENGTKITEF-----SDHNGDVMSVSVS-PDKNYFISGACDATAKLWDLR-SGKCVQT 228

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAF 1037
            F GHE D+ AV++FP+G  FGTGSDD +CRLFDIR   +L  Y+    DN +  +TS+ F
Sbjct: 229  FTGHEADINAVQYFPNGLSFGTGSDDASCRLFDIRADRELMQYTH---DNILCGITSVGF 285

Query: 1038 SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDT 1217
            S SGR LFAGY +  C VWDTL  + VL+L      H  R+SCLG+  DG ALCTGSWD+
Sbjct: 286  SFSGRFLFAGYDDFTCNVWDTLKGERVLSL----TGHGNRVSCLGVPTDGMALCTGSWDS 341

Query: 1218 TLKIWA 1235
             LKIWA
Sbjct: 342  LLKIWA 347



>gb:BTTRDBR_1437413 Bovine retinal mRNA for transducin beta-subunit.
          Length = 340

 Score =  319 bits (817), Expect = 1e-85
 Identities = 157/310 (50%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   ++SASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 40.8 bits (94), Expect = 0.070
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:AY392427_2084491 Cricetulus griseus guanine nucleotide binding
            protein beta 1 mRNA, complete cds.
          Length = 340

 Score =  316 bits (810), Expect = 7e-85
 Identities = 157/310 (50%), Positives = 211/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++   D  ++TSS D
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--NDNQIVTSSED 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLND-N 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSEDTTCALW 169



>gb:AY626793_1341614 Litopenaeus vannamei G protein beta 1 subunit
            mRNA, complete cds.
          Length = 340

 Score =  316 bits (810), Expect = 7e-85
 Identities = 163/334 (48%), Positives = 217/334 (64%)
 Frame = +3

Query: 231  DVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNA 410
            D      + G  PI  G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW++
Sbjct: 27   DTTLVQATSGMDPI--GRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 84

Query: 411  LTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSG 590
             T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L G
Sbjct: 85   YTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNICSIYNLK---TREGNVRVSRELPG 141

Query: 591  HKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISA 770
            H GY+S C+++  +D  ++TSSGD TC LWDI TG + + F     +GHT DV S+S+S 
Sbjct: 142  HTGYLSCCRFL--DDNQIVTSSGDMTCALWDIETGQQCTQF-----TGHTGDVMSLSLS- 193

Query: 771  SNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
             N N F SG+CD +A LWD R      +TF GHE D+ AV FFP+G+ F TGSDD TCRL
Sbjct: 194  PNMNTFTSGACDASAKLWDIR-DGMCRQTFPGHESDINAVTFFPNGHAFATGSDDATCRL 252

Query: 951  FDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLG 1130
            FDIR   +L +YS    DN +  +TS+AFS SGRLL AGY + +C VWD++  +      
Sbjct: 253  FDIRADQELAMYSH---DNIICGITSVAFSKSGRLLLAGYDDFNCNVWDSMRTER----A 305

Query: 1131 SLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             +   HD R+SCLG++ DG A+ TGSWD+ LKIW
Sbjct: 306  GVLAGHDNRVSCLGVTEDGMAVATGSWDSFLKIW 339



>gb:RNU88324_2137869 Rattus norvegicus G protein beta1 subunit (rGb1)
            mRNA, complete cds.
          Length = 340

 Score =  316 bits (809), Expect = 9e-85
 Identities = 156/310 (50%), Positives = 210/310 (67%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +  LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASVKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+ FS SGRLL  GY + +C VWD L A    +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVPFSKSGRLLLGGYDDFNCNVWDALNA----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:AF306565_1784516 Pneumocystis carinii guanine nucleotide-binding
            protein beta subunit mRNA, complete cds.
          Length = 347

 Score =  315 bits (807), Expect = 1e-84
 Identities = 164/369 (44%), Positives = 237/369 (64%)
 Frame = +3

Query: 129  MSVAELKERHMAATQTVNSXXXXXXXXXXXXXDTDVATYARSQGKTPISFGPTDLVCCRN 308
            M++ +L+++  AA +                 DT++    RS  +T        +     
Sbjct: 1    MTIKDLQDKISAACKEAEYLKEKIKKKKDELADTNL----RSMAQTLDVIERLSIRVRYT 56

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  K+Y++ W+ ++  +VSASQDG+LIVW+A T++KTHAI L  +WVMTCA++P+G 
Sbjct: 57   LKGHLAKIYAMHWSTDQKHLVSASQDGKLIVWDAYTTRKTHAIPLRSSWVMTCAYAPSGN 116

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             V+CGGLD+VC+I++++     DG++ ++R L  H GY+S C+++   D  ++TSSGD +
Sbjct: 117  FVSCGGLDNVCTIYDIS---SKDGHAKIARELMAHTGYLSCCRFL--SDEQILTSSGDMS 171

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C LWDI TG +   F       H  DV S+SI  +N N+FVSG+CD  A +WD R+  ++
Sbjct: 172  CILWDINTGSKIQEF-----LDHLGDVMSLSIHPTNPNLFVSGACDAFAKIWDIRI-GKS 225

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            V+TF GHE D+ AV++FP+GN F TGSDD +CRLFD+R   +L  YS   + N +  +TS
Sbjct: 226  VQTFAGHESDINAVQYFPNGNAFATGSDDASCRLFDVRADRELNQYS---AANIMCGITS 282

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            I+FS SGRLLFAGY + +C VWD L    V   G LQ  HD R+SC+G+S DG +L TGS
Sbjct: 283  ISFSNSGRLLFAGYDDFNCNVWDVLRGNRV---GILQ-GHDNRVSCVGVSKDGRSLATGS 338

Query: 1209 WDTTLKIWA 1235
            WD+ LKIWA
Sbjct: 339  WDSLLKIWA 347



>gb:BC056002_2551585 Xenopus laevis guanine nucleotide binding protein
            (G protein), beta polypeptide 3, mRNA (cDNA clone
            MGC:68913 IMAGE:4930251), complete cds.
          Length = 340

 Score =  314 bits (805), Expect = 2e-84
 Identities = 152/310 (49%), Positives = 214/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTC+++P+
Sbjct: 49   RTLRGHLAKIYAMHWSTDSRLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCSYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+ H GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYNLK---TREGNVRVSRELAAHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF     +GHT D  S+++S  + N+F+SG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQKTVF-----TGHTGDCMSLAVS-PDFNLFISGACDASAKLWDVR-QG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP G    TGSDD TCR+FD+R   ++ VYSQ   D+ +  +
Sbjct: 217  ECRQTFTGHESDINAICFFPSGQAICTGSDDATCRMFDLRADQEISVYSQ---DSIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS+SGRLLFAGY + +C +WDTL  + V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSLSGRLLFAGYDDFNCNIWDTLKRERV----GVLSGHDNRVSCLGVTADGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 56/218 (25%), Positives = 94/218 (43%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L  HTG +    +  + N+IV++S D    +W+  T Q+           M+ A SP 
Sbjct: 137 RELAAHTGYLSCCRFLDD-NQIVTSSGDTTCALWDIETGQQKTVFTGHTGDCMSLAVSPD 195

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
                 G  D+   ++++             +T +GH+  ++A  + P+  A + T S D
Sbjct: 196 FNLFISGACDASAKLWDVR-------QGECRQTFTGHESDINAICFFPSGQA-ICTGSDD 247

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            TC ++D+      SV+    Q      ++SVS S S   +F +G  D    +WDT    
Sbjct: 248 ATCRMFDLRADQEISVYS---QDSIICGITSVSFSLSGRLLF-AGYDDFNCNIWDTLKRE 303

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
           R V    GH+  V  +    DG    TGS D   ++++
Sbjct: 304 R-VGVLSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN 340



 Score = 40.8 bits (94), Expect = 0.070
 Identities = 30/134 (22%), Positives = 57/134 (42%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQLRTRRTLRGHLAKIYAMHWSTDSRLLVSASQDGKLIVWDTYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + +++ SG  +  G  +  C +++    +  + +     +H G +SC     D +
Sbjct: 99   --WVMTCSYAPSGNFVACGGLDNMCSIYNLKTREGNVRVSRELAAHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:BC084504_2563875 Xenopus tropicalis hypothetical LOC496520, mRNA
            (cDNA clone MGC:89605 IMAGE:6995086), complete cds.
          Length = 340

 Score =  313 bits (803), Expect = 4e-84
 Identities = 152/310 (49%), Positives = 214/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWSTDARLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+ H GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYNLK---TREGNVRVSRELAAHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF     +GHT D  S+++S  + N+F+SG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQKTVF-----TGHTGDCMSLAVS-PDFNLFISGACDASAKLWDVR-QG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP G    TGSDD TCR+FD+R   ++ VYSQ   D+ +  +
Sbjct: 217  ECRQTFTGHESDINAICFFPSGQAICTGSDDATCRMFDLRADQEISVYSQ---DSIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS+SGRLLFAGY + +C +WD+L  + V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSLSGRLLFAGYDDFNCNIWDSLKRERV----GVLSGHDNRVSCLGVTSDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 55/218 (25%), Positives = 94/218 (43%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L  HTG +    +  + N+IV++S D    +W+  T Q+           M+ A SP 
Sbjct: 137 RELAAHTGYLSCCRFLDD-NQIVTSSGDTTCALWDIETGQQKTVFTGHTGDCMSLAVSPD 195

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
                 G  D+   ++++             +T +GH+  ++A  + P+  A + T S D
Sbjct: 196 FNLFISGACDASAKLWDVR-------QGECRQTFTGHESDINAICFFPSGQA-ICTGSDD 247

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            TC ++D+      SV+    Q      ++SVS S S   +F +G  D    +WD+    
Sbjct: 248 ATCRMFDLRADQEISVYS---QDSIICGITSVSFSLSGRLLF-AGYDDFNCNIWDSLKRE 303

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
           R V    GH+  V  +    DG    TGS D   ++++
Sbjct: 304 R-VGVLSGHDNRVSCLGVTSDGMAVATGSWDSFLKIWN 340



 Score = 42.0 bits (97), Expect = 0.031
 Identities = 31/134 (23%), Positives = 57/134 (42%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQLRTRRTLRGHLAKIYAMHWSTDARLLVSASQDGKLIVWDTYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +     +H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYNLKTREGNVRVSRELAAHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>gb:BC055978_2551562 Xenopus laevis G protein beta-subunit gene, mRNA
            (cDNA clone MGC:68852 IMAGE:4680122), complete cds.
          Length = 340

 Score =  313 bits (802), Expect = 6e-84
 Identities = 152/310 (49%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWSTDSRLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+ H GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYNLK---TREGNVRVSRELAAHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF     +GHT D  S+++S  + N+F+SG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQKTVF-----TGHTGDCMSLAVS-PDFNLFISGACDASAKLWDVR-QG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP G    TGSDD TCR+FD+R   ++ VYSQ   D+ +  +
Sbjct: 217  ECRQTFTGHESDINAICFFPSGQAICTGSDDATCRMFDLRADQEISVYSQ---DSIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS+SGRLLFAGY + +C +WD L  + V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSLSGRLLFAGYDDFNCNIWDCLKRERV----GVLSGHDNRVSCLGVTSDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 42.0 bits (97), Expect = 0.031
 Identities = 31/134 (23%), Positives = 57/134 (42%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQLRTRRTLRGHLAKIYAMHWSTDSRLLVSASQDGKLIVWDTYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +     +H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYNLKTREGNVRVSRELAAHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



>sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 1 (Transducin beta chain
            1).>gb:AF044735_1236090 Homarus americanus G protein beta
            1 subunit (Gbeta1) mRNA, complete cds.
          Length = 340

 Score =  311 bits (798), Expect = 2e-83
 Identities = 161/334 (48%), Positives = 216/334 (64%)
 Frame = +3

Query: 231  DVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNA 410
            D      + G  PI  G   +   R L+GH  K+Y++ W  +   +VSASQDG+LIVW++
Sbjct: 27   DTTLVQATAGMDPI--GRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 84

Query: 411  LTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSG 590
             T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI++L      +GN  VSR L G
Sbjct: 85   YTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNICSIYSLK---TREGNVRVSRELPG 141

Query: 591  HKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISA 770
            H GY+S C++V  +D  ++TSSGD TC LWDI TG + + F     +GHT DV S+S+S 
Sbjct: 142  HTGYLSCCRFV--DDNQIVTSSGDMTCALWDIETGQQCTQF-----TGHTGDVMSLSLS- 193

Query: 771  SNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
             N   F SG+CD +A LWD R      +TF GHE D+ AV FFP+G+ F TGSDD TCRL
Sbjct: 194  PNMRTFTSGACDASAKLWDIR-DGMCRQTFPGHESDINAVTFFPNGHAFATGSDDATCRL 252

Query: 951  FDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLG 1130
            FDIR   +L +YS    DN +  +TS+AFS SG+LL AGY + +C VWD++  +      
Sbjct: 253  FDIRADQELAMYSH---DNIICGITSVAFSKSGKLLLAGYDDFNCNVWDSMRTER----A 305

Query: 1131 SLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             +   HD R+SCLG++ DG A+ TGSWD+ LKIW
Sbjct: 306  GVLAGHDNRVSCLGVTEDGMAVATGSWDSFLKIW 339



>gb:AK030354_1161960 Mus musculus adult male pituitary gland cDNA,
            RIKEN full-length enriched library, clone:5330400P12
            product:GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)/G(S)/G(T)
            BETA SUBUNIT 3 (TRANSDUCIN BETA CHAIN 3), full insert
            sequence.
          Length = 296

 Score =  311 bits (797), Expect = 2e-83
 Identities = 153/310 (49%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 5    RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS 64

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++  +D +++TSSGD
Sbjct: 65   GNFVACGGLDNMCSIYNLK---SREGNVKVSRELSAHTGYLSCCRFL--DDNNIVTSSGD 119

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF      GHT D  S+++S  +  +F+SG+CD +A LWD R  +
Sbjct: 120  TTCALWDIETGQQKTVF-----VGHTGDCMSLAVS-PDYKLFISGACDASAKLWDVREGT 173

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R   +L  YSQ   ++ +  +
Sbjct: 174  -CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELTAYSQ---ESIICGI 229

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS+SGRLLFAGY + +C VWD+L  + V     + + HD R+SCLG++ DG A+ T
Sbjct: 230  TSVAFSLSGRLLFAGYDDFNCNVWDSLKCERV----GILSGHDNRVSCLGVTADGMAVAT 285

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 286  GSWDSFLKIW 295



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 30/130 (23%), Positives = 56/130 (43%)
 Frame = +3

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S      V
Sbjct: 2    RTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSS-----WV 56

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             + A++ SG  +  G  +  C +++    +  + +    ++H G +SC     D + + T
Sbjct: 57   MTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN-IVT 115

Query: 1203 GSWDTTLKIW 1232
             S DTT  +W
Sbjct: 116  SSGDTTCALW 125



>sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain
            3).>gb:AK014789_1158135 Mus musculus 0 day neonate head
            cDNA, RIKEN full-length enriched library,
            clone:4833431H09 product:GUANINE NUCLEOTIDE-BINDING
            PROTEIN G(I)/G(S)/G(T) BETA SUBUNIT 3 (TRANSDUCIN BETA
            CHAIN 3), full insert sequence.>gb:AB042402_2045544 Mus
            musculus GNB3 gene for GTP-binding protein beta3 subunit,
            complete cds.>gb:AC002397_2049802 Mouse chromosome 6
            BAC-284H12 (Research Genetics mouse BAC library) complete
            sequence.>gb:BC018239_2092601 Mus musculus guanine
            nucleotide binding protein, beta 3, mRNA (cDNA clone
            MGC:25269 IMAGE:4511683), complete cds.
          Length = 340

 Score =  311 bits (797), Expect = 2e-83
 Identities = 153/310 (49%), Positives = 213/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++  +D +++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYNLK---SREGNVKVSRELSAHTGYLSCCRFL--DDNNIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF      GHT D  S+++S  +  +F+SG+CD +A LWD R  +
Sbjct: 164  TTCALWDIETGQQKTVF-----VGHTGDCMSLAVS-PDYKLFISGACDASAKLWDVREGT 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R   +L  YSQ   ++ +  +
Sbjct: 218  -CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELTAYSQ---ESIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS+SGRLLFAGY + +C VWD+L  + V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSLSGRLLFAGYDDFNCNVWDSLKCERV----GILSGHDNRVSCLGVTADGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 32/134 (23%), Positives = 58/134 (43%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +    ++H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN 156

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 157  -IVTSSGDTTCALW 169



>sp|P26308|GBB1_DROME Guanine nucleotide-binding protein beta subunit
            1.>pir|A40489|RGFFBH GTP-binding regulatory protein beta
            chain homolog - fruit fly (Drosophila
            melanogaster)>gb:AE014298_1125851 Drosophila melanogaster
            chromosome X, complete sequence.>gb:AE014298_1125852
            Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE014298_1125853 Drosophila melanogaster
            chromosome X, complete sequence.>gb:AE014298_1125854
            Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE014298_1125855 Drosophila melanogaster
            chromosome X, complete sequence.>gb:AE014298_1125856
            Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003500_1212860 Drosophila melanogaster
            chromosome X, section 52 of 74 of the complete
            sequence.>gb:AE003500_1212861 Drosophila melanogaster
            chromosome X, section 52 of 74 of the complete
            sequence.>gb:AE003500_1212862 Drosophila melanogaster
            chromosome X, section 52 of 74 of the complete
            sequence.>gb:AE003500_1212863 Drosophila melanogaster
            chromosome X, section 52 of 74 of the complete
            sequence.>gb:AE003500_1212864 Drosophila melanogaster
            chromosome X, section 52 of 74 of the complete
            sequence.>gb:AE003500_1212865 Drosophila melanogaster
            chromosome X, section 52 of 74 of the complete
            sequence.>gb:AY058566_1291720 Drosophila melanogaster
            LD25526 full length cDNA.>gb:DROGGBCS_1382062 Drosophila
            melanogaster guanine nucleotide-binding regulatory
            protein (G&bgr;13F) gene, complete cds.
          Length = 340

 Score =  310 bits (795), Expect = 4e-83
 Identities = 156/310 (50%), Positives = 210/310 (67%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GSYVACGGLDNMCSIYNLK---TREGNVRVSRELPGHGGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             +CGLWDI TGL+ + F      GHT DV ++S+ A     FVSG+CD +A LWD R   
Sbjct: 164  MSCGLWDIETGLQVTSF-----LGHTGDVMALSL-APQCKTFVSGACDASAKLWDIR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFDIR   +L +YS    DN +  +
Sbjct: 217  VCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C VWDT+ A+       +   HD R+SCLG++ +G A+ T
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTMKAER----SGILAGHDNRVSCLGVTENGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ L++W
Sbjct: 330  GSWDSFLRVW 339



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 35/158 (22%), Positives = 62/158 (39%), Gaps = 13/158 (8%)
 Frame = +3

Query: 798  SCDTTACLWDT------RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
            +CDT+     T      R+  R  RT  GH   + A+ +  D     + S DG   ++D 
Sbjct: 25   ACDTSLLQAATSLEPIGRIQMRTRRTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWD- 83

Query: 960  RTGHQLQVYSQPHSDNEVHR-------VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMV 1118
                        H+ N+VH        V + A++ SG  +  G  +  C +++    +  
Sbjct: 84   -----------SHTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGN 132

Query: 1119 LNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            + +      H G +SC     D + + T S D +  +W
Sbjct: 133  VRVSRELPGHGGYLSCCRFL-DDNQIVTSSGDMSCGLW 169



>gb:BC074250_2557765 Xenopus laevis MGC84000 protein, mRNA (cDNA clone
            MGC:84000 IMAGE:6946106), complete cds.
          Length = 340

 Score =  310 bits (794), Expect = 5e-83
 Identities = 156/320 (48%), Positives = 213/320 (66%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSIYNLK---TREGNVRVSRELPGHTGYLSCCRFI--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D  ++TSSGD TC LWDI TG +T+ F     +GHT DV S+S+S  +   FVSG+CD +
Sbjct: 154  DNEIVTSSGDTTCALWDIETGQQTTTF-----TGHTGDVMSLSLS-PDMRTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            + LWD R      ++F GH  D+ AV FFP+G+ F TGSDD TCRLFD+R   +L +YS 
Sbjct: 208  SKLWDIR-DGMCRQSFTGHVSDINAVCFFPNGHAFATGSDDATCRLFDLRADQELMMYSH 266

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
               DN +  +TS+AFS SGRLL AGY + +C VWDTL  +       +   HD R+SCLG
Sbjct: 267  ---DNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGER----AGVLAGHDNRVSCLG 319

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++ DG A+ TGSWD+ L+IW
Sbjct: 320  VTDDGMAVATGSWDSFLRIW 339



>gb:BC084797_2564042 Xenopus laevis hypothetical LOC495335, mRNA (cDNA
            clone MGC:84119 IMAGE:6950342), complete cds.
          Length = 340

 Score =  310 bits (793), Expect = 6e-83
 Identities = 155/320 (48%), Positives = 213/320 (66%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSIYNLK---TREGNVRVSRKLPGHTGYLSCCRFI--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D  ++TSSGD TC LWDI TG +T+ F     +GHT DV S+S+S  +   FVSG+CD +
Sbjct: 154  DNEIVTSSGDTTCALWDIETGQQTTTF-----TGHTGDVMSLSVS-PDMRTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            + LWD R      ++F GH  D+ AV FFP+G+ F TGSDD TCRLFD+R   ++ +YS 
Sbjct: 208  SKLWDIR-DGMCRQSFTGHVSDINAVCFFPNGHAFATGSDDATCRLFDLRADQEMMMYSH 266

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
               DN +  +TS+AFS SGRLL AGY + +C VWDTL  +       +   HD R+SCLG
Sbjct: 267  ---DNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGER----AGVLAGHDNRVSCLG 319

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++ DG A+ TGSWD+ L+IW
Sbjct: 320  VADDGMAVATGSWDSFLRIW 339



>gb:BC000115_1966437 Homo sapiens guanine nucleotide binding protein
            (G protein), beta polypeptide 3, mRNA (cDNA clone
            MGC:3116 IMAGE:3351520), complete
            cds.>gb:BC002454_1968127 Homo sapiens guanine nucleotide
            binding protein (G protein), beta polypeptide 3, mRNA
            (cDNA clone MGC:1738 IMAGE:3342882), complete
            cds.>gb:BT009800_1990937 Homo sapiens guanine nucleotide
            binding protein (G protein), beta polypeptide 3 mRNA,
            complete cds.
          Length = 340

 Score =  309 bits (792), Expect = 8e-83
 Identities = 151/310 (48%), Positives = 215/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++  +D +++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYNLK---SREGNVKVSRELSAHTGYLSCCRFL--DDNNIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF      GHT D  S+++S  + N+F+SG+CD +A LWD R  +
Sbjct: 164  TTCALWDIETGQQKTVF-----VGHTGDCMSLAVS-PDFNLFISGACDASAKLWDVREGT 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R   +L  +S    ++ +  +
Sbjct: 218  -CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSH---ESIICSI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS+SGRLLFAGY + +C VWD++ ++ V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSLSGRLLFAGYDDFNCNVWDSMKSERV----GILSGHDNRVSCLGVTADGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 55/218 (25%), Positives = 94/218 (43%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L  HTG +    +  + N IV++S D    +W+  T Q+           M+ A SP 
Sbjct: 137 RELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPD 195

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
                 G  D+   ++++          T  +T +GH+  ++A  + PN +A + T S D
Sbjct: 196 FNLFISGACDASAKLWDVR-------EGTCRQTFTGHESDINAICFFPNGEA-ICTGSDD 247

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            +C L+D+        F  E        ++SV+ S S   +F +G  D    +WD+  + 
Sbjct: 248 ASCRLFDLRADQELICFSHE---SIICSITSVAFSLSGRLLF-AGYDDFNCNVWDSMKSE 303

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
           R V    GH+  V  +    DG    TGS D   ++++
Sbjct: 304 R-VGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN 340



 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 56/238 (23%), Positives = 95/238 (39%), Gaps = 10/238 (4%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            RTL GH   + A  +  +    L+++S D    +WD  T  +           H   + S
Sbjct: 49   RTLRGHLAKIYAMHWATDSKL-LVSASQDGKLIVWDSYTTNKV----------HAIPLRS 97

Query: 756  VSIS----ASNTNMFVSGSCDTTACLWDTRVASRAV---RTFHGHEGDVIAVKFFPDGNR 914
              +     A + N    G  D    +++ +     V   R    H G +   +F  D N 
Sbjct: 98   SWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN- 156

Query: 915  FGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVW 1094
              T S D TC L+DI TG Q  V+     D       S+A S    L  +G  +    +W
Sbjct: 157  IVTSSGDTTCALWDIETGQQKTVFVGHTGD-----CMSLAVSPDFNLFISGACDASAKLW 211

Query: 1095 DTLLAKMVLNLGSLQNS---HDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQVI 1259
            D       +  G+ + +   H+  I+ +    +G A+CTGS D + +++     +++I
Sbjct: 212  D-------VREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELI 262



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 32/134 (23%), Positives = 58/134 (43%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +    ++H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN 156

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 157  -IVTSSGDTTCALW 169



>gb:AY884129_1631976 Thanatephorus cucumeris guanine nucleotide
            binding protein beta subunit gene, complete cds.
          Length = 370

 Score =  309 bits (792), Expect = 8e-83
 Identities = 154/311 (49%), Positives = 205/311 (65%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +K  +VSASQDG+LIVW+A T+ K HAI L  +WVMTCA+SP+
Sbjct: 77   RTLKGHLAKIYAMHWAADKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSPS 136

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL       G +  +R LS H GY+S C+++   D  ++TSSGD
Sbjct: 137  GNFVACGGLDNICSIYNLR--NKEGGGNKSARELSAHSGYLSCCRFI--NDRQIVTSSGD 192

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI  G R   F     + HT DV S+S+   N N+FVSG+CD TA LWD R   
Sbjct: 193  MTCMLWDIEAGARVMEF-----NDHTGDVMSLSL-GPNQNVFVSGACDATAKLWDIRTGK 246

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               R+   ++   +  +FFP+G+ F TGSDD +CRLFDIR   +L  ++    DN +  +
Sbjct: 247  ATRRSPATNQISTLCSEFFPNGDAFATGSDDASCRLFDIRADRELNSFTH---DNILCGI 303

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFSISGR+LF GY +  C VWDTL  + V     +   H+ R+SCLG+S DG ALCT
Sbjct: 304  TSVAFSISGRVLFGGYDDWTCNVWDTLKGERV----GVLTGHENRVSCLGVSVDGMALCT 359

Query: 1203 GSWDTTLKIWA 1235
            GSWD+TLK+WA
Sbjct: 360  GSWDSTLKVWA 370



 Score = 38.9 bits (89), Expect = 0.26
 Identities = 33/135 (24%), Positives = 57/135 (42%), Gaps = 1/135 (0%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 70   RVVMRPRRTLKGHLAKIYAMHWAADKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSS--- 126

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ-NSHDGRISCLGLSGDG 1187
               V + A+S SG  +  G  +  C +++    +   N  + + ++H G +SC     D 
Sbjct: 127  --WVMTCAYSPSGNFVACGGLDNICSIYNLRNKEGGGNKSARELSAHSGYLSCCRFIND- 183

Query: 1188 SALCTGSWDTTLKIW 1232
              + T S D T  +W
Sbjct: 184  RQIVTSSGDMTCMLW 198



>sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain
            3).>pir|A35096|RGHUB3 GTP-binding regulatory protein
            beta-3 chain - human>gb:A93384_1451260 Sequence 1 from
            Patent WO9743442.>gb:AF501884_1905403 Homo sapiens
            guanine nucleotide binding protein beta 3 (GNB3) mRNA,
            complete cds.>gb:AY631872_1957788 Homo sapiens guanine
            nucleotide binding protein (G protein), beta polypeptide
            3 (GNB3) gene, complete cds.>gb:HSGNBPB33_2013536 Homo
            sapiens gene encoding guanine nucleotide-binding protein
            beta3 subunit, exon 3 (and joined
            CDS).>gb:HSU47924_2024502 Human chromosome 12p13
            sequence, complete sequence.>gb:HUMGNBPB3_2031589 Human
            guanine nucleotide-binding protein beta-3 subunit mRNA,
            complete cds.
          Length = 340

 Score =  309 bits (791), Expect = 1e-82
 Identities = 151/310 (48%), Positives = 215/310 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++  +D +++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYNLK---SREGNVKVSRELSAHTGYLSCCRFL--DDNNIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF      GHT D  S+++S  + N+F+SG+CD +A LWD R  +
Sbjct: 164  TTCALWDIETGQQKTVF-----VGHTGDCMSLAVS-PDFNLFISGACDASAKLWDVREGT 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R   +L  +S    ++ +  +
Sbjct: 218  -CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSH---ESIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS+SGRLLFAGY + +C VWD++ ++ V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSLSGRLLFAGYDDFNCNVWDSMKSERV----GILSGHDNRVSCLGVTADGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 55/218 (25%), Positives = 94/218 (43%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L  HTG +    +  + N IV++S D    +W+  T Q+           M+ A SP 
Sbjct: 137 RELSAHTGYLSCCRFLDDNN-IVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPD 195

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
                 G  D+   ++++          T  +T +GH+  ++A  + PN +A + T S D
Sbjct: 196 FNLFISGACDASAKLWDVR-------EGTCRQTFTGHESDINAICFFPNGEA-ICTGSDD 247

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            +C L+D+        F  E        ++SV+ S S   +F +G  D    +WD+  + 
Sbjct: 248 ASCRLFDLRADQELICFSHE---SIICGITSVAFSLSGRLLF-AGYDDFNCNVWDSMKSE 303

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
           R V    GH+  V  +    DG    TGS D   ++++
Sbjct: 304 R-VGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN 340



 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 56/238 (23%), Positives = 95/238 (39%), Gaps = 10/238 (4%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            RTL GH   + A  +  +    L+++S D    +WD  T  +           H   + S
Sbjct: 49   RTLRGHLAKIYAMHWATDSKL-LVSASQDGKLIVWDSYTTNKV----------HAIPLRS 97

Query: 756  VSIS----ASNTNMFVSGSCDTTACLWDTRVASRAV---RTFHGHEGDVIAVKFFPDGNR 914
              +     A + N    G  D    +++ +     V   R    H G +   +F  D N 
Sbjct: 98   SWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN- 156

Query: 915  FGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVW 1094
              T S D TC L+DI TG Q  V+     D       S+A S    L  +G  +    +W
Sbjct: 157  IVTSSGDTTCALWDIETGQQKTVFVGHTGD-----CMSLAVSPDFNLFISGACDASAKLW 211

Query: 1095 DTLLAKMVLNLGSLQNS---HDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQVI 1259
            D       +  G+ + +   H+  I+ +    +G A+CTGS D + +++     +++I
Sbjct: 212  D-------VREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELI 262



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 32/134 (23%), Positives = 58/134 (43%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +    ++H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN 156

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 157  -IVTSSGDTTCALW 169



>gb:AY205294_1309687 Sitobion avenae heterotrimeric guanine
            nucleotide-binding protein beta subunit mRNA, complete
            cds.
          Length = 340

 Score =  308 bits (790), Expect = 1e-82
 Identities = 155/310 (50%), Positives = 211/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GSFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             +C LWDI TG + S F      GHT DV S+S+S  +   FVSG+CD +A LWD R  +
Sbjct: 164  MSCALWDIETGQQCSSF-----IGHTGDVMSLSMS-PDMRTFVSGACDASAKLWDVRDGT 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFDIR+  +L +YS    DN +  +
Sbjct: 218  -CKQTFPGHESDINAVTFFPNGYAFATGSDDATCRLFDIRSDQELAMYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS++FS SGRLL AGY + +C VWD++ A+       +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVSFSKSGRLLLAGYDDFNCNVWDSMKAER----AGILAGHDNRVSCLGVTEDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ L+IW
Sbjct: 330  GSWDSFLRIW 339



 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 58/218 (26%), Positives = 101/218 (46%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L GHTG +    +  + N+IV++S D    +W+  T Q+  +       VM+ + SP 
Sbjct: 137 RELPGHTGYLSCCRFLDD-NQIVTSSGDMSCALWDIETGQQCSSFIGHTGDVMSLSMSPD 195

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            ++   G  D+   ++++        + T  +T  GH+  ++A  + PN  A   T S D
Sbjct: 196 MRTFVSGACDASAKLWDVR-------DGTCKQTFPGHESDINAVTFFPNGYA-FATGSDD 247

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            TC L+DI +    +++  +        ++SVS S S   + ++G  D    +WD+  A 
Sbjct: 248 ATCRLFDIRSDQELAMYSHD---NIICGITSVSFSKSG-RLLLAGYDDFNCNVWDSMKAE 303

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
           RA     GH+  V  +    DG    TGS D   R+++
Sbjct: 304 RA-GILAGHDNRVSCLGVTEDGMAVATGSWDSFLRIWN 340



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 38/178 (21%), Positives = 67/178 (37%), Gaps = 2/178 (1%)
 Frame = +3

Query: 300 CRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSP 479
           C +  GHTG V SL  +P+    VS + D    +W+              + +    F P
Sbjct: 177 CSSFIGHTGDVMSLSMSPDMRTFVSGACDASAKLWDVRDGTCKQTFPGHESDINAVTFFP 236

Query: 480 TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG 659
            G + A G  D+ C +F++         S     +  H   +     V    +  +  +G
Sbjct: 237 NGYAFATGSDDATCRLFDI--------RSDQELAMYSHDNIICGITSVSFSKSGRLLLAG 288

Query: 660 --DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
             D  C +WD     R  +      +GH   VS + ++     +  +GS D+   +W+
Sbjct: 289 YDDFNCNVWDSMKAERAGIL-----AGHDNRVSCLGVTEDGMAV-ATGSWDSFLRIWN 340



 Score = 38.1 bits (87), Expect = 0.45
 Identities = 33/151 (21%), Positives = 60/151 (39%), Gaps = 6/151 (3%)
 Frame = +3

Query: 798  SCDTTACLWDT------RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
            +CDT+     T      R+  R  RT  GH   + A+ +  D     + S DG   ++D 
Sbjct: 25   ACDTSLSQATTSMEPVGRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDS 84

Query: 960  RTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ 1139
             T +++       S      V + A++ SG  +  G  +  C ++     +  + +    
Sbjct: 85   YTTNKVHAIPLRSS-----WVMTCAYAPSGSFVACGGLDNICSIYSLKTREGNVRVSREL 139

Query: 1140 NSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              H G +SC     D + + T S D +  +W
Sbjct: 140  PGHTGYLSCCRFL-DDNQIVTSSGDMSCALW 169



>sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T)
            beta subunit 3 (Transducin beta chain
            3).>pir|I53871|I53871 G-protein beta-subunit -
            rat>gb:BC086422_2109606 Rattus norvegicus G protein
            beta-subunit gene, mRNA (cDNA clone MGC:105437
            IMAGE:7193131), complete cds.>gb:RATGPROBET_2132386 Rat G
            protein beta-subunit gene, complete cds.
          Length = 340

 Score =  307 bits (786), Expect = 4e-82
 Identities = 151/310 (48%), Positives = 212/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR LS H GY+S C+++  +D +++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYSLK---SREGNVKVSRELSAHTGYLSCCRFL--DDNNIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF      GHT D  S+++S  +  +F+SG+CD +A LWD R  +
Sbjct: 164  TTCALWDIETGQQKTVF-----VGHTGDCMSLAVS-PDYKLFISGACDASAKLWDVREGT 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R   +L  YS    ++ +  +
Sbjct: 218  -CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELTAYSH---ESIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS+SGRLLFAGY + +C VWD+L  + V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSLSGRLLFAGYDDFNCNVWDSLKCERV----GVLSGHDNRVSCLGVTADGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 32/134 (23%), Positives = 57/134 (42%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +    ++H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYSLKSREGNVKVSRELSAHTGYLSCCRFLDDNN 156

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 157  -IVTSSGDTTCALW 169



>gb:AY524667_1333026 Pinctada fucata G protein beta subunit mRNA,
            complete cds.
          Length = 341

 Score =  306 bits (785), Expect = 5e-82
 Identities = 152/310 (49%), Positives = 207/310 (66%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS 109

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct: 110  GSYVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DDNQIVTSSGD 164

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             +C LWDI TG +T+ F     +GHT DV S+S+S  +   FVSG+CD +A LWD R   
Sbjct: 165  MSCALWDIETGQQTTAF-----TGHTGDVMSLSLS-PDMRTFVSGACDASAKLWDIR-DG 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ +FP+G  F TGSDD TCRLFDIR   ++ +YS    DN +  +
Sbjct: 218  MCKQTFSGHESDINAITYFPNGYAFATGSDDATCRLFDIRADQEIGMYSH---DNIICGI 274

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL  GY + +C VWD L  +       +   HD R+SCLG++ DG A+ T
Sbjct: 275  TSVAFSKSGRLLLGGYDDFNCNVWDVLRQER----AGVLAGHDNRVSCLGVTEDGMAVAT 330

Query: 1203 GSWDTTLKIW 1232
            GSWD+ L+IW
Sbjct: 331  GSWDSFLRIW 340



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 29/134 (21%), Positives = 54/134 (40%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 43   RIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSS--- 99

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 100  --WVMTCAYAPSGSYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFL-DDN 156

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S D +  +W
Sbjct: 157  QIVTSSGDMSCALW 170



>sp|P79147|GBB3_CANFA Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 3 (Transducin beta chain
            3).>gb:AY751537_1433695 Canis familiaris GTP-binding
            protein beta-3 subunit (GNB3) gene, complete
            cds.>gb:CFU52916_1438781 Canis familiaris transducin
            beta-3-subunit (GNB3) mRNA, complete cds.
          Length = 340

 Score =  306 bits (783), Expect = 9e-82
 Identities = 148/310 (47%), Positives = 212/310 (68%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR LS H GY+S C+++  +D +++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYSLK---SREGNVKVSRELSAHTGYLSCCRFL--DDNNIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF      GHT D  S+++S  +  +F+SG+CD +A LWD R  +
Sbjct: 164  TTCALWDIETGQQKTVF-----VGHTGDCMSLAVS-PDFKLFISGACDASAKLWDVREGT 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R   +L  YS    ++ +  +
Sbjct: 218  -CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELTAYS---DESIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS+SGRLLFAGY + +C +WD++  + V     + + HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSLSGRLLFAGYDDFNCNIWDSMKGERV----GILSGHDNRVSCLGVTADGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LK+W
Sbjct: 330  GSWDSFLKVW 339



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 32/134 (23%), Positives = 57/134 (42%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDTYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +    ++H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYSLKSREGNVKVSRELSAHTGYLSCCRFLDDNN 156

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 157  -IVTSSGDTTCALW 169



>sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein beta
            subunit.>pir|S69891|S34348 GTP-binding regulatory protein
            beta chain - great pond snail>gb:LSGPBS_1389148
            L.stagnalis mRNA for G protein beta subunit.
          Length = 341

 Score =  305 bits (782), Expect = 1e-81
 Identities = 153/310 (49%), Positives = 207/310 (66%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS 109

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct: 110  GNFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFI--DDNSIVTSSGD 164

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             +C LWDI TG +T+ F     +GHT DV S+S S  +   FVSG+CD +A LWD R   
Sbjct: 165  MSCALWDIETGQQTTSF-----TGHTGDVMSLSTS-PDFRTFVSGACDASAKLWDVR-DG 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ +FP+G+ F TGSDD TCRLFDIR   ++ +YS    DN +  +
Sbjct: 218  MCKQTFSGHESDINAITYFPNGHAFATGSDDATCRLFDIRADQEIGMYSH---DNIICGI 274

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL   Y + +C VWD L  +       +   HD R+SCLG++ DGSA+ T
Sbjct: 275  TSVAFSKSGRLLLGRYDDFNCNVWDVLKQE----THGVLAGHDNRVSCLGVTEDGSAVAT 330

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 331  GSWDSFLKIW 340



 Score = 38.9 bits (89), Expect = 0.26
 Identities = 30/134 (22%), Positives = 54/134 (40%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 43   RIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSS--- 99

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D S
Sbjct: 100  --WVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNS 157

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S D +  +W
Sbjct: 158  -IVTSSGDMSCALW 170



>sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein beta subunit
            4 (Transducin beta chain 4).>gb:AX877760_1477147 Sequence
            12665 from Patent EP1074617.>gb:AF300648_1895722 Homo
            sapiens guanine nucleotide binding protein beta subunit 4
            (GNB4) mRNA, complete cds.>gb:BC000873_1967090 Homo
            sapiens guanine nucleotide binding protein (G protein),
            beta polypeptide 4, mRNA (cDNA clone MGC:5262
            IMAGE:3460570), complete cds.
          Length = 340

 Score =  305 bits (780), Expect = 2e-81
 Identities = 154/320 (48%), Positives = 212/320 (66%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSIYNLK---TREGNVRVSRELPGHTGYLSCCRFL--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D+ ++TSSGD TC LWDI T  +T+ F     +GH+ DV S+S+S  +   FVSG+CD +
Sbjct: 154  DSQIVTSSGDTTCALWDIETAQQTTTF-----TGHSGDVMSLSLS-PDMRTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            + LWD R      ++F GH  D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS 
Sbjct: 208  SKLWDIR-DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSH 266

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
               DN +  +TS+AFS SGRLL AGY + +C VWDTL      +   +   HD R+SCLG
Sbjct: 267  ---DNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKG----DRAGVLAGHDNRVSCLG 319

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++ DG A+ TGSWD+ L+IW
Sbjct: 320  VTDDGMAVATGSWDSFLRIW 339



>pir|A26617|RGBOB2 GTP-binding regulatory protein beta-2 chain -
            bovine  (fragment)
          Length = 326

 Score =  304 bits (779), Expect = 3e-81
 Identities = 154/310 (49%), Positives = 208/310 (67%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 35   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 94

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct: 95   GNFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DDNQIITSSGD 149

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T  F     +GH+ DV S+S+ A +   FVSG+CD +  LWD R  S
Sbjct: 150  TTCALWDIETGQQTVGF-----AGHSGDVMSLSL-APDGRTFVSGACDASIKLWDVR-DS 202

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS    DN +  +
Sbjct: 203  MCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSH---DNIICGI 259

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C +WD +      +   +   HD R+SCLG++ DG A+ T
Sbjct: 260  TSVAFSRSGRLLLAGYDDFNCNIWDAMKG----DRAGVLAGHDNRVSCLGVTDDGMAVAT 315

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 316  GSWDSFLKIW 325



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 55/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 28   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 84

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 85   --WVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFL-DDN 141

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 142  QIITSSGDTTCALW 155



>sp|P11016|GBB2_HUMAN Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2)
            (G protein beta 2 subunit).>pir|B26617|RGHUB2 GTP-binding
            regulatory protein beta-2 chain -
            human>gb:AF053356_1879358 Homo sapiens chromosome 7q22
            sequence, complete sequence.>gb:AF501883_1905402 Homo
            sapiens guanine nucleotide binding protein beta 2 (GNB2)
            mRNA, complete cds.>gb:BC010073_1972465 Homo sapiens
            guanine nucleotide binding protein (G protein), beta
            polypeptide 2, mRNA (cDNA clone MGC:19573 IMAGE:4300639),
            complete cds.>gb:BC012348_1973562 Homo sapiens guanine
            nucleotide binding protein (G protein), beta polypeptide
            2, mRNA (cDNA clone MGC:20143 IMAGE:4556119), complete
            cds.>gb:BC068003_1987555 Homo sapiens cDNA clone
            MGC:70586 IMAGE:6055863, complete
            cds.>gb:CR541729_1993959 Homo sapiens full open reading
            frame cDNA clone RZPDo834A1129D for gene GNB2, guanine
            nucleotide binding protein (G protein), beta polypeptide
            2; complete cds, incl. stopcodon.>gb:HUMGPA_2031612 Human
            guanine nucleotide-binding regulatory protein (G protein)
            gene, 3' end.>gb:HUMTRNB_2037887 Human transducin beta-2
            subunit mRNA, complete cds.>gb:AB045007_2046001 Mus
            musculus GNB2 gene for guanine nucleotide binding protein
            beta2 subunit, complete cds.>gb:AF277892_2061274 Rattus
            norvegicus G-protein beta-2 subunit mRNA, complete
            cds.>gb:AF312033_2062446 Mus musculus
            acetylcholinesterase (Ache) and D5Ertd655e genes,
            complete cds; ASR2 (Asr2) gene, complete cds,
            alternatively spliced; TRIP6 (Trip6), CIP1 (Cip1), EPHB4
            (Ephb4), ZAN (Zan), EPO (Epo), RPP20 (Rpp20), PERQ1
            (Perq1), GNB2 (Gnb2), and BAF53B (Baf53b) genes, complete
            cds; and TFR2 (Tfr2) gene, partial
            cds.>gb:BC029077_2096463 Mus musculus guanine nucleotide
            binding protein, beta 2, mRNA (cDNA clone MGC:25597
            IMAGE:4019292), complete cds.>gb:BC059942_2103842 Mus
            musculus guanine nucleotide binding protein, beta 2, mRNA
            (cDNA clone MGC:67952 IMAGE:6529685), complete
            cds.>gb:BC062178_2104926 Mus musculus guanine nucleotide
            binding protein, beta 2, mRNA (cDNA clone MGC:70139
            IMAGE:6330944), complete cds.>gb:BC065579_2105608 Rattus
            norvegicus guanine nucleotide binding protein, beta
            polypeptide 2, mRNA (cDNA clone MGC:72266 IMAGE:5598923),
            complete cds.
          Length = 340

 Score =  304 bits (779), Expect = 3e-81
 Identities = 154/310 (49%), Positives = 208/310 (67%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T  F     +GH+ DV S+S+ A +   FVSG+CD +  LWD R  S
Sbjct: 164  TTCALWDIETGQQTVGF-----AGHSGDVMSLSL-APDGRTFVSGACDASIKLWDVR-DS 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS    DN +  +
Sbjct: 217  MCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C +WD +      +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSRSGRLLLAGYDDFNCNIWDAMKG----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 55/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein
            G(I)/G(S)/G(T) beta subunit 2 (Transducin beta chain 2)
            (G protein beta 2 subunit) (Fragment).>gb:BOVGPA_1435481
            Bovine guanine nucleotide-binding regulatory protein (G
            protein) mRNA, 3' end, clone
            lambda-BH309.>gb:BOVTRNB2A_1435927 Bovine transducin
            beta-2 subunit mRNA, 3' end.
          Length = 326

 Score =  304 bits (779), Expect = 3e-81
 Identities = 154/310 (49%), Positives = 208/310 (67%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 35   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 94

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct: 95   GNFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DDNQIITSSGD 149

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T  F     +GH+ DV S+S+ A +   FVSG+CD +  LWD R  S
Sbjct: 150  TTCALWDIETGQQTVGF-----AGHSGDVMSLSL-APDGRTFVSGACDASIKLWDVR-DS 202

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS    DN +  +
Sbjct: 203  MCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSH---DNIICGI 259

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C +WD +      +   +   HD R+SCLG++ DG A+ T
Sbjct: 260  TSVAFSRSGRLLLAGYDDFNCNIWDAMKG----DRAGVLAGHDNRVSCLGVTDDGMAVAT 315

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 316  GSWDSFLKIW 325



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 55/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 28   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 84

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 85   --WVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFL-DDN 141

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 142  QIITSSGDTTCALW 155



>gb:MMU34960_2120934 Mouse G protein beta 2 subunit mRNA, complete
            cds.
          Length = 340

 Score =  304 bits (778), Expect = 3e-81
 Identities = 154/310 (49%), Positives = 207/310 (66%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA+ P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYGPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T  F     +GH+ DV S+S+ A +   FVSG+CD +  LWD R  S
Sbjct: 164  TTCALWDIETGQQTVGF-----AGHSGDVMSLSL-APDGRTFVSGACDASIKLWDVR-DS 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS    DN +  +
Sbjct: 217  MCRQTFIGHESDINAVAFFPNGYAFTTGSDDSTCRLFDLRADQELLMYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C +WD +      +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSRSGRLLLAGYDDFNCNIWDAMKG----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 40.8 bits (94), Expect = 0.070
 Identities = 31/134 (23%), Positives = 54/134 (40%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A+  SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYGPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>gb:AY552804_2086499 Rattus norvegicus G-protein beta 4 subunit (Gnb4)
            mRNA, complete cds.
          Length = 340

 Score =  304 bits (778), Expect = 3e-81
 Identities = 155/320 (48%), Positives = 209/320 (65%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSIYNLK---TREGNVRVSRELPGHTGYLSCCRFL--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV S+S+S  +   FVSG+CD +
Sbjct: 154  DGQIITSSGDTTCALWDIETGQQTTTF-----TGHSGDVMSLSLS-PDLKTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            + LWD R      ++F GH  D+ AV FFP G  F TGSDD TCRLFD+R   +L +YS 
Sbjct: 208  SKLWDIR-DGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRLFDLRADQELLLYSH 266

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
               DN +  +TS+AFS SGRLL AGY + +C VWD L          +   HD R+SCLG
Sbjct: 267  ---DNIICGITSVAFSKSGRLLLAGYDDFNCSVWDALKG----GRAGVLAGHDNRVSCLG 319

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++ DG A+ TGSWD+ L+IW
Sbjct: 320  VTDDGMAVATGSWDSFLRIW 339



>sp|P29387|GBB4_MOUSE Guanine nucleotide-binding protein beta subunit
            4 (Transducin beta chain 4).>gb:AK036816_1164634 Mus
            musculus adult female vagina cDNA, RIKEN full-length
            enriched library, clone:9930014I19 product:guanine
            nucleotide binding protein, beta 4, full insert
            sequence.>gb:AF277893_2061275 Mus musculus G-protein
            beta-4 subunit mRNA, complete cds.>gb:BC028753_2096286
            Mus musculus guanine nucleotide binding protein, beta 4,
            mRNA (cDNA clone MGC:41124 IMAGE:1348753), complete
            cds.>gb:BC087197_2565054 Xenopus laevis hypothetical
            LOC495873, mRNA (cDNA clone MGC:98092 IMAGE:7199868),
            complete cds.
          Length = 340

 Score =  304 bits (778), Expect = 3e-81
 Identities = 155/320 (48%), Positives = 209/320 (65%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSIYNLK---TREGNVRVSRELPGHTGYLSCCRFL--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV S+S+S  +   FVSG+CD +
Sbjct: 154  DGQIITSSGDTTCALWDIETGQQTTTF-----TGHSGDVMSLSLS-PDLKTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            + LWD R      ++F GH  D+ AV FFP G  F TGSDD TCRLFD+R   +L +YS 
Sbjct: 208  SKLWDIR-DGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRLFDLRADQELLLYSH 266

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
               DN +  +TS+AFS SGRLL AGY + +C VWD L          +   HD R+SCLG
Sbjct: 267  ---DNIICGITSVAFSKSGRLLLAGYDDFNCSVWDALKG----GRSGVLAGHDNRVSCLG 319

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++ DG A+ TGSWD+ L+IW
Sbjct: 320  VTDDGMAVATGSWDSFLRIW 339



>gb:HUMGP_2031605 Human signal-transducing guanine nucleotide-binding
            regulatory (G) protein beta subunit mRNA, complete cds.
          Length = 340

 Score =  303 bits (775), Expect = 8e-81
 Identities = 154/310 (49%), Positives = 207/310 (66%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++ +
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAXS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNFVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFL--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T  F     +GH+ DV S+S+ A N   FVSG+CD +  LWD R  S
Sbjct: 164  TTCALWDIETGQQTVGF-----AGHSGDVMSLSL-APNGRTFVSGACDASIKLWDVR-DS 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS    DN +  +
Sbjct: 217  MCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C +WD +      +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSRSGRLLLAGYDDFNCNIWDAMKG----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 42.0 bits (97), Expect = 0.031
 Identities = 31/134 (23%), Positives = 55/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAXSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>pir|JS0669|RGMSB4 GTP-binding regulatory protein beta-4 chain -
            mouse>gb:CQ871848_1454716 Sequence 21 from Patent
            WO2004079007.>gb:MUSGB4A_2125949 M.musculus G protein
            beta-subunit mRNA, complete cds.>gb:MUSGTPBETA_2126105
            Mus musculus GTP-binding protein beta subunit (G-beta 4)
            mRNA, complete cds.>gb:S86124_2139838 GTP-binding protein
            beta-subunit 4 [mice, brain, mRNA, 1135 nt].
          Length = 340

 Score =  303 bits (775), Expect = 8e-81
 Identities = 154/320 (48%), Positives = 210/320 (65%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CSI+NL      +G+  VSR L+GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSIYNLK---TREGDVRVSRELAGHTGYLSCCRFL--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV S+S+S  +   FVSG+CD +
Sbjct: 154  DGQIITSSGDTTCALWDIETGQQTTTF-----TGHSGDVMSLSLS-PDLKTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            + LWD R      ++F GH  D+ AV FFP G  F TGSDD TCRLFD+R   +L +YS 
Sbjct: 208  SKLWDIR-DGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRLFDLRADQELLLYSH 266

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
               DN +  +TS+AFS SGRLL AGY + +C VWD L          +   HD R+SCLG
Sbjct: 267  ---DNIICGITSVAFSKSGRLLLAGYDDFNCSVWDALKG----GRSGVLAGHDNRVSCLG 319

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++ DG A+ TGSWD+ L+IW
Sbjct: 320  VTDDGMAVATGSWDSFLRIW 339



>gb:AF277162_2483899 Ambystoma tigrinum G-protein B3 subunit mRNA,
            complete cds.
          Length = 340

 Score =  301 bits (771), Expect = 2e-80
 Identities = 150/310 (48%), Positives = 210/310 (67%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W+ +   +VSASQDG+LIVW+  ++ K HAI L  +WVMTC+++P+
Sbjct: 49   RTLRGHLAKIYAMHWSNDSRLLVSASQDGKLIVWDTYSTNKVHAIPLRSSWVMTCSYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+ H GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNFVACGGLDNMCSIYNLK---TREGNVKVSRELAAHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG + +VF      GHT D  S+++S  +  +FVSG+CD TA LWD R  +
Sbjct: 164  TTCALWDIETGTQKTVF-----MGHTGDCMSLAVS-PDFRIFVSGACDATAKLWDIREGT 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+G    TGSDD TCRLFD+R   +L VYS    ++ +  +
Sbjct: 218  -CRQTFTGHESDINAICFFPNGEAVCTGSDDATCRLFDLRADQELTVYSH---ESIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C +WD++  + V     + + HD R+SCLG++ DG A  T
Sbjct: 274  TSVAFSRSGRLLLAGYDDFNCNMWDSMKGERV----GVLSGHDNRVSCLGVTTDGMAAAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 54/218 (24%), Positives = 96/218 (44%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L  HTG +    +  + N+IV++S D    +W+  T  +           M+ A SP 
Sbjct: 137 RELAAHTGYLSCCRFLDD-NQIVTSSGDTTCALWDIETGTQKTVFMGHTGDCMSLAVSPD 195

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            +    G  D+   ++++          T  +T +GH+  ++A  + PN +A + T S D
Sbjct: 196 FRIFVSGACDATAKLWDIR-------EGTCRQTFTGHESDINAICFFPNGEA-VCTGSDD 247

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            TC L+D+      +V+  E        ++SV+ S S   + ++G  D    +WD+    
Sbjct: 248 ATCRLFDLRADQELTVYSHE---SIICGITSVAFSRSG-RLLLAGYDDFNCNMWDSMKGE 303

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
           R V    GH+  V  +    DG    TGS D   ++++
Sbjct: 304 R-VGVLSGHDNRVSCLGVTTDGMAAATGSWDSFLKIWN 340



 Score = 40.8 bits (94), Expect = 0.070
 Identities = 32/141 (22%), Positives = 58/141 (41%), Gaps = 7/141 (4%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D             +S N+
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWSNDSRLLVSASQDGKLIVWD------------TYSTNK 89

Query: 1011 VHR-------VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCL 1169
            VH        V + +++ SG  +  G  +  C +++    +  + +     +H G +SC 
Sbjct: 90   VHAIPLRSSWVMTCSYAPSGNFVACGGLDNMCSIYNLKTREGNVKVSRELAAHTGYLSCC 149

Query: 1170 GLSGDGSALCTGSWDTTLKIW 1232
                D + + T S DTT  +W
Sbjct: 150  RFL-DDNQIVTSSGDTTCALW 169



>gb:AY389499_1324996 Loligo pealei visual G-protein beta subunit mRNA,
            complete cds.
          Length = 341

 Score =  301 bits (771), Expect = 2e-80
 Identities = 152/310 (49%), Positives = 206/310 (66%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS 109

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct: 110  GNYVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFI--DDNQIVTSSGD 164

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LW+I TG + + FG     GHT DV S+S+ A +   FVSG+CD +A L+D R   
Sbjct: 165  MTCALWNIETGNQITSFG-----GHTGDVMSLSL-APDMRTFVSGACDASAKLFDIR-DG 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ +FP+G  F TGSDD TCRLFDIR   ++ +YS    DN +  +
Sbjct: 218  ICKQTFTGHESDINAITYFPNGFAFATGSDDATCRLFDIRADQEIGMYSH---DNIICGI 274

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL  GY + +C VWD L  +       +   HD R+SCLG++ DG A+ T
Sbjct: 275  TSVAFSKSGRLLLGGYDDFNCNVWDVLKQER----AGVLAGHDNRVSCLGVTEDGMAVAT 330

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 331  GSWDSFLKIW 340



 Score = 38.9 bits (89), Expect = 0.26
 Identities = 33/148 (22%), Positives = 59/148 (39%), Gaps = 9/148 (6%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 43   RIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSS--- 99

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 100  --WVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFI-DDN 156

Query: 1191 ALCTGSWDTTLKIW---------AFGGY 1247
             + T S D T  +W         +FGG+
Sbjct: 157  QIVTSSGDMTCALWNIETGNQITSFGGH 184



>sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein beta
            subunit.>pir|S13302|RGOOBE GTP-binding regulatory protein
            beta chain - northern European squid>gb:LFBGTPB_1387474
            L. forbesi mRNA for GTP-binding protein beta subunit.
          Length = 341

 Score =  301 bits (771), Expect = 2e-80
 Identities = 152/310 (49%), Positives = 206/310 (66%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW+  T+ K HAI L  +WVMTCA++P+
Sbjct: 50   RTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSSWVMTCAYAPS 109

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  ++TSSGD
Sbjct: 110  GNYVACGGLDNICSIYSLK---TREGNVRVSRELPGHTGYLSCCRFI--DDNQIVTSSGD 164

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LW+I TG + + FG     GHT DV S+S+ A +   FVSG+CD +A L+D R   
Sbjct: 165  MTCALWNIETGNQITSFG-----GHTGDVMSLSL-APDMRTFVSGACDASAKLFDIR-DG 217

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ +FP+G  F TGSDD TCRLFDIR   ++ +YS    DN +  +
Sbjct: 218  ICKQTFTGHESDINAITYFPNGFAFATGSDDATCRLFDIRADQEIGMYSH---DNIICGI 274

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL  GY + +C VWD L  +       +   HD R+SCLG++ DG A+ T
Sbjct: 275  TSVAFSKSGRLLLGGYDDFNCNVWDVLKQER----AGVLAGHDNRVSCLGVTEDGMAVAT 330

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 331  GSWDSFLKIW 340



 Score = 38.9 bits (89), Expect = 0.26
 Identities = 33/148 (22%), Positives = 59/148 (39%), Gaps = 9/148 (6%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 43   RIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDGYTTNKVHAIPLRSS--- 99

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C ++     +  + +      H G +SC     D +
Sbjct: 100  --WVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFI-DDN 156

Query: 1191 ALCTGSWDTTLKIW---------AFGGY 1247
             + T S D T  +W         +FGG+
Sbjct: 157  QIVTSSGDMTCALWNIETGNQITSFGGH 184



>gb:AF501886_2067152 Mus musculus guanine nucleotide binding protein
            beta 4 (Gnb4) mRNA, complete cds.
          Length = 340

 Score =  300 bits (769), Expect = 4e-80
 Identities = 154/320 (48%), Positives = 208/320 (65%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSIYNLK---TREGNVRVSRELPGHTGYLSCCRFL--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D  +ITSSGD TC LWDI TG +T+ F     +GH+ DV S+S+S  +   FVSG+CD +
Sbjct: 154  DGQIITSSGDTTCALWDIETGQQTTTF-----TGHSGDVMSLSLS-PDLKTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            + LWD R      ++F GH  D+ AV FFP    F TGSDD TCRLFD+R   +L +YS 
Sbjct: 208  SKLWDIR-DGMCRQSFTGHISDINAVSFFPSVYAFATGSDDATCRLFDLRADQELLLYSH 266

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
               DN +  +TS+AFS SGRLL AGY + +C VWD L          +   HD R+SCLG
Sbjct: 267  ---DNIICGITSVAFSKSGRLLLAGYDDFNCSVWDALKG----GRSGVLAGHDNRVSCLG 319

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++ DG A+ TGSWD+ L+IW
Sbjct: 320  VTDDGMAVATGSWDSFLRIW 339



>gb:AB047301_1195879 Halocynthia roretzi HrG-beta mRNA for G protein
            beta subunit, partial cds.
          Length = 285

 Score =  299 bits (765), Expect = 1e-79
 Identities = 148/302 (49%), Positives = 204/302 (67%)
 Frame = +3

Query: 327  KVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGG 506
            K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+G  VACGG
Sbjct: 2    KIYAMHWGTDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGG 61

Query: 507  LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI 686
            LD++CSI++L      +GN  VSR L GH GY+S C+++  +D+ ++TSSGD +C LW I
Sbjct: 62   LDNICSIYSLK---TREGNVKVSRELPGHTGYLSCCRFL--DDSRIVTSSGDMSCALWII 116

Query: 687  TTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHG 866
             TG +T+ +      GHT DV S+S+S  + N F+SG+CD +A LWD R      +TF G
Sbjct: 117  ETGQQTTAY-----IGHTGDVMSLSVS-EDKNTFISGACDASAKLWDIR-DGMCCQTFIG 169

Query: 867  HEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSIS 1046
            HE D+ AV FFP+   FGTGSDD TCRLFDIR   +L VY     DN +  +TS++FS S
Sbjct: 170  HESDINAVSFFPNNMAFGTGSDDATCRLFDIRADQELIVYQH---DNIICGITSVSFSKS 226

Query: 1047 GRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLK 1226
            GRLL AGY + +C VWD++      +   +   HD R+SCLG++ DG A+ TGSWD+ LK
Sbjct: 227  GRLLLAGYDDFNCNVWDSMKG----DRAGVLAGHDNRVSCLGITSDGMAVATGSWDSFLK 282

Query: 1227 IW 1232
            +W
Sbjct: 283  VW 284



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 43/180 (23%), Positives = 70/180 (38%), Gaps = 9/180 (5%)
 Frame = +3

Query: 315 GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
           GHTG V SL  + +KN  +S + D    +W+              + +   +F P   + 
Sbjct: 127 GHTGDVMSLSVSEDKNTFISGACDASAKLWDIRDGMCCQTFIGHESDINAVSFFPNNMAF 186

Query: 495 ACGGLDSVCSIFNLNLPP-------DN--DGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
             G  D+ C +F++           DN   G ++VS + SG                 L+
Sbjct: 187 GTGSDDATCRLFDIRADQELIVYQHDNIICGITSVSFSKSGRL---------------LL 231

Query: 648 TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
               D  C +WD   G R  V      +GH   VS + I+ S+     +GS D+   +W+
Sbjct: 232 AGYDDFNCNVWDSMKGDRAGVL-----AGHDNRVSCLGIT-SDGMAVATGSWDSFLKVWN 285



 Score = 33.9 bits (76), Expect = 8.5
 Identities = 28/135 (20%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
 Frame = +3

Query: 288 DLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIK---LPCAWV 458
           D +CC+   GH   + ++ + P      + S D    +++    Q+    +   + C  +
Sbjct: 160 DGMCCQTFIGHESDINAVSFFPNNMAFGTGSDDATCRLFDIRADQELIVYQHDNIICG-I 218

Query: 459 MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA 638
            + +FS +G+ +  G  D  C++++ ++  D  G       L+GH   VS C  + ++  
Sbjct: 219 TSVSFSKSGRLLLAGYDDFNCNVWD-SMKGDRAG------VLAGHDNRVS-CLGITSDGM 270

Query: 639 HLITSSGDKTCGLWD 683
            + T S D    +W+
Sbjct: 271 AVATGSWDSFLKVWN 285



>gb:AJ719919_2502106 Gallus gallus mRNA for hypothetical protein,
            clone 8d24.
          Length = 404

 Score =  298 bits (763), Expect = 2e-79
 Identities = 150/295 (50%), Positives = 200/295 (67%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 109  GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +   FVSG+CD +A LWD R   
Sbjct: 164  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDARCFVSGACDASAKLWDVR-EG 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP GN F TGSDD TCRLFD+R   +L VYS    DN +  +
Sbjct: 217  MCRQTFTGHESDINAICFFPKGNAFATGSDDATCRLFDLRADQELMVYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
            TS+AFS SGRLL AGY + +C VWDTL A    +   +   HD R+SCLG++ DG
Sbjct: 274  TSVAFSKSGRLLLAGYDDFNCNVWDTLKA----DRAGVLAGHDNRVSCLGVTDDG 324



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIVTSSGDTTCALW 169



 Score = 40.4 bits (93), Expect = 0.091
 Identities = 32/167 (19%), Positives = 65/167 (38%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH A + ++    +++ + VS S D    +WD+   ++ V         V+   + P GN
Sbjct: 53   GHLAKIYAMHWG-TDSRLLVSASQDGKLIIWDSYTTNK-VHAIPLRSSWVMTCAYAPSGN 110

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
                G  D  C +++++T       S+  + +  +   S    +    +     +  C +
Sbjct: 111  YVACGGLDNICSIYNLKTREGNVRVSRELAGHTGY--LSCCRFLDDNQIVTSSGDTTCAL 168

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            WD    +           H G +  L L+ D     +G+ D + K+W
Sbjct: 169  WDIETGQQTTTF----TGHTGDVMSLSLAPDARCFVSGACDASAKLW 211



>sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T)
            beta subunit 2 (Transducin beta chain 2) (G protein beta
            2 subunit).>gb:RRU34959_2138288 Rat G protein beta 2
            subunit mRNA, complete cds.
          Length = 340

 Score =  295 bits (756), Expect = 1e-78
 Identities = 150/310 (48%), Positives = 204/310 (65%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y + W  +   +VSA+QDG+LI+W++ T+ K H I L  +WV TCA++P+
Sbjct: 49   RTLRGHLAKIYDMHWGTDSRLLVSAAQDGKLIIWDSYTTNKVHVIPLRSSWVKTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD+ CSI++L      +GN  VS+ L GH GY+S C+++  +D  +ITSSGD
Sbjct: 109  GNFVACGGLDNNCSIYSLK---TREGNVRVSKKLPGHTGYLSCCRFL--DDNQIITSSGD 163

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T  F     +GH+ DV S+S+ A +   FVSG+CD +  LWD R  S
Sbjct: 164  TTCALWDIETGQQTVDF-----AGHSGDVMSLSL-APDGRTFVSGACDASIKLWDVR-ES 216

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS    DN +  +
Sbjct: 217  MCRQTFIGHESDINAVVFFPNGYAFTTGSDDATCRLFDLRADQELLMYSH---DNIICGI 273

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
            TS+AFS SGRLL AGY + +C +WD +      +   +   HD R+SCLG++ DG A+ T
Sbjct: 274  TSVAFSRSGRLLLAGYDDFNCNIWDAMKG----DRAGVLAGHDNRVSCLGVTDDGMAVAT 329

Query: 1203 GSWDTTLKIW 1232
            GSWD+ LKIW
Sbjct: 330  GSWDSFLKIW 339



 Score = 41.6 bits (96), Expect = 0.041
 Identities = 30/134 (22%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   +  + +  D     + + DG   ++D  T +++ V     S   
Sbjct: 42   RIQMRTRRTLRGHLAKIYDMHWGTDSRLLVSAAQDGKLIIWDSYTTNKVHVIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  + +C ++     +  + +      H G +SC     D +
Sbjct: 99   --WVKTCAYAPSGNFVACGGLDNNCSIYSLKTREGNVRVSKKLPGHTGYLSCCRFL-DDN 155

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 156  QIITSSGDTTCALW 169



>gb:BC076127_2559002 Danio rerio guanine nucleotide binding protein (G
            protein), beta polypeptide 3, like, mRNA (cDNA clone
            MGC:92641 IMAGE:7071724), complete cds.
          Length = 340

 Score =  295 bits (755), Expect = 2e-78
 Identities = 149/318 (46%), Positives = 211/318 (66%)
 Frame = +3

Query: 279  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV 458
            G   L   + L+GH  K+Y++ W  +    VSASQDG+LIVW++ T+ K HAI L  +WV
Sbjct: 41   GRVQLKTRKTLRGHLAKIYAMHWGTDSKLCVSASQDGKLIVWDSYTTNKVHAIPLKSSWV 100

Query: 459  MTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDA 638
            MTC+++P+G  VACGGLD++CSI+NL      DGN  V R L+ H GY+S C+++   D+
Sbjct: 101  MTCSYAPSGNMVACGGLDNMCSIYNLKA---KDGNVKVMRELAAHTGYLSCCRFL--SDS 155

Query: 639  HLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTAC 818
             +ITSSGD TC LWDI TG + +VF     +GH  D  S+++S  + N F+SG+CD TA 
Sbjct: 156  EIITSSGDCTCVLWDIETGSQKTVF-----AGHLGDCMSLAVS-PDFNTFISGACDFTAK 209

Query: 819  LWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPH 998
            LWD R   +  +TF GHE D+ A+ FFP+GN   TGSDD +C+L+D+R+  +L  Y    
Sbjct: 210  LWDIR-EGQCRQTFGGHESDINAIGFFPNGNAVITGSDDASCKLYDLRSDQELITY---Q 265

Query: 999  SDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLS 1178
              + +  VTSIA S+SGRL+ AGY + +C +WD+L ++ V     + + HD R+SC+G++
Sbjct: 266  DSSIMCGVTSIAPSLSGRLILAGYDDFNCNIWDSLKSERV----GVLSGHDNRVSCIGVT 321

Query: 1179 GDGSALCTGSWDTTLKIW 1232
             DG A CTGSWD+ LKIW
Sbjct: 322  PDGMACCTGSWDSFLKIW 339



>gb:AY050538_1562266 Phytophthora infestans isolate H30P04 G-protein
            beta subunit 1 (gpb1) mRNA, complete
            cds.>gb:AY204515_1589100 Phytophthora infestans isolate
            H30P04 G-protein beta subunit 1 (gpb1) gene, complete
            cds.
          Length = 344

 Score =  291 bits (745), Expect = 2e-77
 Identities = 151/314 (48%), Positives = 209/314 (66%), Gaps = 1/314 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L+GH GK+Y++ W  + + +VSASQDG+LIVWNA T+ K  AI L  +WVMTCAF 
Sbjct: 48   CRRLLKGHFGKIYAMQWGGDSSSLVSASQDGKLIVWNAQTTNKIQAIPLRSSWVMTCAFE 107

Query: 477  PTGQS-VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
               ++ VACGGLD++CSIF+L+           ++ L+ H GY+S C++V  ++A+++TS
Sbjct: 108  QKQRNMVACGGLDNLCSIFHLS----QAQVMRATKELAAHDGYLSCCRFV--DEANIVTS 161

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            SGD  C LWD+ +G   + F       H+ DV SVSI+  N +MF+SGSCD+TA +WD R
Sbjct: 162  SGDSNCILWDVESGEVKTTF-----REHSGDVMSVSINPHNPSMFISGSCDSTAKVWDIR 216

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               +   TF GHE D+ +V FFP GN  GTGSDD +CRLFD+R   +L  +S   +D  +
Sbjct: 217  -TGKTTHTFQGHESDINSVDFFPSGNALGTGSDDSSCRLFDLRAYGELNNFS---NDKIL 272

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
              +TS++FS SGR LFAGY + +CY WD +L+    ++  L   H+ R+SCLG++  G A
Sbjct: 273  CGITSVSFSKSGRFLFAGYDDYNCYCWD-VLSTSGAHIYQLA-GHENRVSCLGVNPAGQA 330

Query: 1194 LCTGSWDTTLKIWA 1235
            LCTGSWDT LKIWA
Sbjct: 331  LCTGSWDTLLKIWA 344



>gb:AF369757_2489646 Ambystoma tigrinum G-protein beta 5 mRNA,
            complete cds.
          Length = 353

 Score =  283 bits (723), Expect = 8e-75
 Identities = 136/312 (43%), Positives = 204/312 (65%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW+A T+ K HA+ +PC WVM CA++P+
Sbjct: 57   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPS 116

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  ++  ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 117  GCAIACGGLDNKCSVYPLTF-DKNENMASKKKSVAMHTNYLSACSFT-NSDMQILTASGD 174

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 175  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 228

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + +++F  HE D+ +V+++P G+ F +GSDD TCRLFD+R   ++ +Y++   ++ +  
Sbjct: 229  GQCIQSFETHESDINSVRYYPSGDAFASGSDDATCRLFDLRADREVAIYTK---ESIIFG 285

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 286  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRV----SILFGHENRVSTLRVSPDGTAFC 341

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL+IWA
Sbjct: 342  SGSWDHTLRIWA 353



>gb:BC059544_2552521 Danio rerio guanine nucleotide binding protein (G
            protein), beta 5, mRNA (cDNA clone MGC:73196
            IMAGE:4789097), complete cds.
          Length = 395

 Score =  282 bits (722), Expect = 1e-74
 Identities = 137/312 (43%), Positives = 208/312 (66%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW+A T+ K HA+ +PC WVM CA++P+
Sbjct: 99   RTLKGHGNKVLCMDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPS 158

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G +VACGGLD+ CS++ L+L   N+  ++  ++++ H  Y+S+C +    D  ++TSSGD
Sbjct: 159  GCAVACGGLDNKCSVYPLSL-DKNENLASKKKSVAMHTNYLSSCSFT-KSDMQILTSSGD 216

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH+ADV S+ ++ S T + FVSG CD  A +WD R +
Sbjct: 217  GTCALWDVESGQLLQSF-----HGHSADVLSLDLAPSETGSTFVSGGCDKKANVWDMR-S 270

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V++F  H+ D+ +VK++P G+ F +GSDD TCRL+D+R   ++ +YS+   D+ +  
Sbjct: 271  GQNVQSFETHDSDINSVKYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---DSIIFG 327

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY + +  VWD L    V    ++   H+ R+S + +S DG+A C
Sbjct: 328  ASSVDFSLSGRLLFAGYNDYNINVWDVLKGTRV----AILFGHENRVSTVRVSPDGTAFC 383

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL+IWA
Sbjct: 384  SGSWDNTLRIWA 395



>gb:AB070162_1871033 Macaca fascicularis testis cDNA clone:QtsA-15604,
            full insert sequence.
          Length = 276

 Score =  282 bits (722), Expect = 1e-74
 Identities = 139/269 (51%), Positives = 187/269 (69%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+
Sbjct: 18   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 77

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD
Sbjct: 78   GNYVACGGLDNICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGD 132

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+CD +A LWD R   
Sbjct: 133  TTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGACDASAKLWDVR-EG 185

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +
Sbjct: 186  MCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGI 242

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLA 1109
            TS++FS SGRLL AGY + +C VWD L A
Sbjct: 243  TSVSFSKSGRLLLAGYDDFNCNVWDALKA 271



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 31/134 (23%), Positives = 56/134 (41%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 11   RIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSS--- 67

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +      H G +SC     D +
Sbjct: 68   --WVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFL-DDN 124

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 125  QIVTSSGDTTCALW 138



 Score = 39.3 bits (90), Expect = 0.20
 Identities = 32/167 (19%), Positives = 65/167 (38%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH A + ++    +++ + VS S D    +WD+   ++ V         V+   + P GN
Sbjct: 22   GHLAKIYAMHWG-TDSRLLVSASQDGKLIIWDSYTTNK-VHAIPLRSSWVMTCAYAPSGN 79

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
                G  D  C +++++T       S+  + +  +   S    +    +     +  C +
Sbjct: 80   YVACGGLDNICSIYNLKTREGNVRVSRELAGHTGY--LSCCRFLDDNQIVTSSGDTTCAL 137

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            WD    +           H G +  L L+ D     +G+ D + K+W
Sbjct: 138  WDIETGQQTTTF----TGHTGDVMSLSLAPDTRLFVSGACDASAKLW 180



>pir|A54969|A54969 beta-5 GTP-binding protein -
            mouse>gb:AF001953_2050055 Rattus norvegicus G protein
            beta 5 subunit mRNA, partial cds.>gb:AY552803_2086498
            Rattus norvegicus G-protein beta 5 subunit (Gnb5) mRNA,
            complete cds.>gb:BC089221_2110752 Rattus norvegicus
            guanine nucleotide binding protein, beta 5, mRNA (cDNA
            clone MGC:105255 IMAGE:7320619), complete
            cds.>gb:MUSGNRPA_2126034 Mus musculus guanine nucleotide
            regulatory protein mRNA, complete cds.
          Length = 353

 Score =  281 bits (720), Expect = 2e-74
 Identities = 136/312 (43%), Positives = 202/312 (64%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 57   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 116

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 117  GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 174

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 175  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 228

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V+ F  HE DV +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+   ++ +  
Sbjct: 229  GQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---ESIIFG 285

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 286  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV----SILFGHENRVSTLRVSPDGTAFC 341

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL++WA
Sbjct: 342  SGSWDHTLRVWA 353



>sp|P54314|GBB5_MOUSE Guanine nucleotide-binding protein beta subunit
            5 (Transducin beta chain 5).>gb:BC016135_2092205 Mus
            musculus guanine nucleotide binding protein, beta 5, mRNA
            (cDNA clone MGC:28984 IMAGE:4506201), complete
            cds.>gb:MMU69145_2123221 Mus musculus retinal-specific
            heterotrimeric GTP-binding protein beta subunit, G
            beta5L, mRNA, complete cds.
          Length = 395

 Score =  281 bits (720), Expect = 2e-74
 Identities = 136/312 (43%), Positives = 202/312 (64%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 99   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 158

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 159  GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 216

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 217  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 270

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V+ F  HE DV +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+   ++ +  
Sbjct: 271  GQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---ESIIFG 327

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 328  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV----SILFGHENRVSTLRVSPDGTAFC 383

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL++WA
Sbjct: 384  SGSWDHTLRVWA 395



>gb:AF480880_2066808 Tamias striatus G protein beta subunit 5 short
            variant mRNA, complete cds, alternatively spliced.
          Length = 353

 Score =  281 bits (719), Expect = 2e-74
 Identities = 135/312 (43%), Positives = 202/312 (64%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 57   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 116

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 117  GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 174

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 175  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 228

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V+ F  HE D+ +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+   ++ +  
Sbjct: 229  GQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---ESIIFG 285

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 286  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV----SILFGHENRVSTLRVSPDGTAFC 341

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL++WA
Sbjct: 342  SGSWDHTLRVWA 353



>gb:AF017656_1876801 Homo sapiens G protein beta 5 subunit mRNA,
            complete cds.>gb:AF501885_1905404 Homo sapiens guanine
            nucleotide binding protein beta 5 (GNB5) mRNA, complete
            cds.>gb:BC013997_1974312 Homo sapiens guanine nucleotide
            binding protein (G protein), beta 5, transcript variant
            1, mRNA (cDNA clone MGC:20022 IMAGE:3621195), complete
            cds.
          Length = 353

 Score =  281 bits (719), Expect = 2e-74
 Identities = 135/312 (43%), Positives = 202/312 (64%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 57   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 116

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 117  GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 174

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 175  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 228

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V+ F  HE D+ +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+   ++ +  
Sbjct: 229  GQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---ESIIFG 285

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 286  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV----SILFGHENRVSTLRVSPDGTAFC 341

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL++WA
Sbjct: 342  SGSWDHTLRVWA 353



>gb:CR857754_1181968 Pongo pygmaeus mRNA; cDNA DKFZp469O0337 (from
            clone DKFZp469O0337).
          Length = 353

 Score =  281 bits (719), Expect = 2e-74
 Identities = 135/312 (43%), Positives = 202/312 (64%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 57   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 116

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 117  GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 174

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 175  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 228

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V+ F  HE D+ +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+   ++ +  
Sbjct: 229  GQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---ESIIFG 285

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 286  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV----SILFGHENRVSTLRVSPDGTAFC 341

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL++WA
Sbjct: 342  SGSWDHTLRVWA 353



>sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein beta subunit
            5 (Transducin beta chain 5).>gb:AF300650_1895724 Homo
            sapiens guanine nucleotide binding protein beta subunit
            5L (GNB5) mRNA, complete cds.
          Length = 395

 Score =  281 bits (719), Expect = 2e-74
 Identities = 135/312 (43%), Positives = 202/312 (64%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 99   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 158

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 159  GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 216

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 217  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 270

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V+ F  HE D+ +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+   ++ +  
Sbjct: 271  GQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---ESIIFG 327

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 328  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV----SILFGHENRVSTLRVSPDGTAFC 383

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL++WA
Sbjct: 384  SGSWDHTLRVWA 395



>gb:AY591252_1431703 Oryctolagus cuniculus guanine nucleotide binding
            protein beta 5 mRNA, complete cds.
          Length = 353

 Score =  281 bits (718), Expect = 3e-74
 Identities = 135/312 (43%), Positives = 202/312 (64%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 57   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 116

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 117  GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 174

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A +WD R +
Sbjct: 175  GTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-S 228

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V+ F  HE D+ +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+   ++ +  
Sbjct: 229  GQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK---ESIIFG 285

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S DG+A C
Sbjct: 286  ASSVDFSLSGRLLFAGYNDYTINVWDVLKGARV----SILFGHENRVSTLRVSPDGTAFC 341

Query: 1200 TGSWDTTLKIWA 1235
            +GSWD TL++WA
Sbjct: 342  SGSWDHTLRVWA 353



>gb:AE014298_1124760 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003443_1209942 Drosophila melanogaster
            chromosome X, section 27 of 74 of the complete
            sequence.>gb:BT004841_1357179 Drosophila melanogaster
            RH17413 full insert cDNA.
          Length = 358

 Score =  276 bits (707), Expect = 6e-73
 Identities = 133/310 (42%), Positives = 200/310 (64%), Gaps = 1/310 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  KV   DW+P+K  I+S+SQDGRLI+W+A T+ K HA+ +P  W+M CA++P+G 
Sbjct: 66   LKGHQAKVLCTDWSPDKRHIISSSQDGRLIIWDAFTTNKEHAVTMPTTWIMACAYAPSGN 125

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VACGGLD+  +++ +     ++  +   RT+  H  Y+S C Y PN D  ++T SGD T
Sbjct: 126  FVACGGLDNKVTVYPIT---SDEEMAAKKRTVGTHTSYMSCCIY-PNSDQQILTGSGDST 181

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVASR 845
            C LWD+ +G     F      GH+ DV ++ ++ + T N FVSGSCD  A +WD R +  
Sbjct: 182  CALWDVESGQLLQSF-----HGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMR-SGH 235

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             V++F GH+ DV +VKF P G+   TGSDD +CRL+D+R   ++ V+++   ++ +  V 
Sbjct: 236  VVQSFEGHQSDVNSVKFHPCGDAIATGSDDSSCRLYDMRADREVAVFAK---ESIIFGVN 292

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            S+ FS+SGRLLFAGY +    +WDTL ++ V     L   H+ ++SC+ +S DG+AL TG
Sbjct: 293  SVDFSVSGRLLFAGYNDYTVNLWDTLKSERV----CLLYGHENKVSCVQVSPDGTALSTG 348

Query: 1206 SWDTTLKIWA 1235
            SWD T+++WA
Sbjct: 349  SWDYTIRVWA 358



 Score = 37.0 bits (84), Expect = 1.0
 Identities = 25/127 (19%), Positives = 50/127 (39%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            +   GH+  V+   + PD     + S DG   ++D  T ++    + P +      + + 
Sbjct: 64   KVLKGHQAKVLCTDWSPDKRHIISSSQDGRLIIWDAFTTNKEHAVTMPTT-----WIMAC 118

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            A++ SG  +  G  +    V+     + +        +H   +SC         + TGS 
Sbjct: 119  AYAPSGNFVACGGLDNKVTVYPITSDEEMAAKKRTVGTHTSYMSCCIYPNSDQQILTGSG 178

Query: 1212 DTTLKIW 1232
            D+T  +W
Sbjct: 179  DSTCALW 185



>gb:BC059436_2552413 Danio rerio guanine nucleotide binding protein (G
            protein), beta polypeptide 3, mRNA (cDNA clone MGC:73058
            IMAGE:4144208), complete cds.>gb:BC065866_2554156 Danio
            rerio guanine nucleotide binding protein (G protein),
            beta polypeptide 3, mRNA (cDNA clone MGC:77780
            IMAGE:7001189), complete cds.
          Length = 338

 Score =  275 bits (704), Expect = 1e-72
 Identities = 138/336 (41%), Positives = 203/336 (60%)
 Frame = +3

Query: 225  DTDVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW 404
            DTD+A  A      P       L   + L+GH  K+Y++ W  +   +VSASQDG+L++W
Sbjct: 27   DTDMAAAAAGVAPAP----RVQLKTRKTLKGHLAKIYAMHWCTDNRLMVSASQDGKLLIW 82

Query: 405  NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL 584
            +A +  K +A+ L  +WVMTC+++P+G  VA GGLD++C+++NL  P          + L
Sbjct: 83   DAHSGNKVNAVPLKSSWVMTCSYAPSGNLVASGGLDNMCTVYNLKTPV-----IKTVKEL 137

Query: 585  SGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSI 764
              H GY+S C+++   D  ++TSSGD TC LWD+ TG + +VF       H  D   +S+
Sbjct: 138  DAHTGYLSCCRFI--SDTEIVTSSGDTTCALWDLETGKQKTVF-----LNHIGDCMCLSL 190

Query: 765  SASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTC 944
            S  N NMF+SG+CD+ A LWD R   +  +TF GH  D+ A+ F P    F TGSDD TC
Sbjct: 191  SPDN-NMFISGACDSLAKLWDIR-DGQCKQTFQGHTSDINAISFLPSATAFITGSDDCTC 248

Query: 945  RLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLN 1124
            +++DIR   ++  Y     ++    VTS+A S+SGRL+FAGY + +C +WD+L  + V  
Sbjct: 249  KMYDIRADQEVICYQDSALNS---GVTSVALSVSGRLIFAGYDDFNCNIWDSLKGEKV-- 303

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
               + + HD R+SC G+ GDG  +CTGSWD+ LKIW
Sbjct: 304  --GVLSGHDNRVSCTGVPGDGMCVCTGSWDSFLKIW 337



>gb:HUMTRNB1_2037888 Human transducin beta-1 subunit mRNA, 3' end.
          Length = 247

 Score =  268 bits (686), Expect = 2e-70
 Identities = 136/264 (51%), Positives = 180/264 (68%)
 Frame = +3

Query: 441  LPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQY 620
            L  +WVMTCA++P+G  VACGGLD++CSI+NL      +GN  VSR L+GH GY+S C++
Sbjct: 2    LRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKT---REGNVRVSRELAGHTGYLSCCRF 58

Query: 621  VPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGS 800
            +  +D  ++TSSGD TC LWDI TG +T+ F     +GHT DV S+S+ A +T +FVSG+
Sbjct: 59   L--DDNQIVTSSGDTTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APDTRLFVSGA 110

Query: 801  CDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQ 980
            CD +A LWD R      +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L 
Sbjct: 111  CDASAKLWDVR-EGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELM 169

Query: 981  VYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRI 1160
             YS    DN +  +TS++FS SGRLL AGY + +C VWD L A    +   +   HD R+
Sbjct: 170  TYSH---DNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRV 222

Query: 1161 SCLGLSGDGSALCTGSWDTTLKIW 1232
            SCLG++ DG A+ TGSWD+ LKIW
Sbjct: 223  SCLGVTDDGMAVATGSWDSFLKIW 246



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 43/180 (23%), Positives = 67/180 (37%), Gaps = 9/180 (5%)
 Frame = +3

Query: 315 GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
           GHTG V SL   P+    VS + D    +W+              + +    F P G + 
Sbjct: 89  GHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAF 148

Query: 495 ACGGLDSVCSIFNLNLPP-------DN--DGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
           A G  D+ C +F+L           DN   G ++VS + SG                 L+
Sbjct: 149 ATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRL---------------LL 193

Query: 648 TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
               D  C +WD     R  V      +GH   VS + ++     +  +GS D+   +W+
Sbjct: 194 AGYDDFNCNVWDALKADRAGVL-----AGHDNRVSCLGVTDDGMAV-ATGSWDSFLKIWN 247



>sp|Q20636|GBB2_CAEEL Guanine nucleotide-binding protein beta subunit
            2.>pir|T22478|T22478 hypothetical protein F52A8.2 -
            Caenorhabditis elegans>gb:AF291847_1259375 Caenorhabditis
            elegans heterotrimeric G protein beta subunit 2 (gpb-2)
            mRNA, complete cds.>gb:CEF52A8_1364219 Caenorhabditis
            elegans cosmid F52A8, complete sequence.
          Length = 356

 Score =  263 bits (672), Expect = 7e-69
 Identities = 133/312 (42%), Positives = 192/312 (61%), Gaps = 1/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH GKV  +DW+ +K  IVS+SQDG++IVW+  T+ K HA+ +P  WVM CAFSP+
Sbjct: 62   RILKGHVGKVLCMDWSLDKRHIVSSSQDGKVIVWDGFTTNKEHALTMPTTWVMACAFSPS 121

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
             Q +ACGGLD+ CS+  L+     D      R ++ H  Y+S C ++   D  ++T SGD
Sbjct: 122  SQMIACGGLDNKCSVVPLSF---EDDIIQKKRQVATHTSYMSCCTFL-RSDNLILTGSGD 177

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTACLWDTRVA 839
             TC +WD+ +G     F      GHT DV ++ +   +T N F+S   D  + +WD R +
Sbjct: 178  STCAIWDVESGQLIQNF-----HGHTGDVFAIDVPKCDTGNTFISAGADKHSLVWDIR-S 231

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V++F GHE D+  V+F P+G+ F TGSDD TCRLFD+R   Q+ VY +   ++ +  
Sbjct: 232  GQCVQSFEGHEADINTVRFHPNGDAFATGSDDATCRLFDLRADRQVCVYEK---ESILFP 288

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            V  + FS+SGR+LFAGY +    VWD+L         S+   H+ RISCL  S DG+A+C
Sbjct: 289  VNGVDFSLSGRILFAGYGDYRVGVWDSLKCAR----HSVLYGHENRISCLRTSPDGTAVC 344

Query: 1200 TGSWDTTLKIWA 1235
            + SWD T++IWA
Sbjct: 345  SASWDCTIRIWA 356



 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 54/234 (23%), Positives = 95/234 (40%), Gaps = 5/234 (2%)
 Frame = +3

Query: 267 PISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQ-----KTH 431
           P+SF    +   R +  HT  +    +    N I++ S D    +W+  + Q       H
Sbjct: 138 PLSFEDDIIQKKRQVATHTSYMSCCTFLRSDNLILTGSGDSTCAIWDVESGQLIQNFHGH 197

Query: 432 AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA 611
              +    V  C    TG +    G D    ++++        +    ++  GH+  ++ 
Sbjct: 198 TGDVFAIDVPKC---DTGNTFISAGADKHSLVWDIR-------SGQCVQSFEGHEADINT 247

Query: 612 CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFV 791
            ++ PN DA   T S D TC L+D+    +  V+  E        V+ V  S S   +F 
Sbjct: 248 VRFHPNGDA-FATGSDDATCRLFDLRADRQVCVYEKE---SILFPVNGVDFSLSGRILF- 302

Query: 792 SGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
           +G  D    +WD+   +R     +GHE  +  ++  PDG    + S D T R++
Sbjct: 303 AGYGDYRVGVWDSLKCARH-SVLYGHENRISCLRTSPDGTAVCSASWDCTIRIW 355



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 55/237 (23%), Positives = 91/237 (38%), Gaps = 10/237 (4%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWD-ITTGLRTSVFGGEYQSGHTADVS 752
            R L GH G V  C     +  H+++SS D    +WD  TT    ++      +  T  V 
Sbjct: 62   RILKGHVGKV-LCMDWSLDKRHIVSSSQDGKVIVWDGFTTNKEHAL------TMPTTWVM 114

Query: 753  SVSISASNTNMFVSG---SCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGT 923
            + + S S+  +   G    C      ++  +  +  R    H   +    F    N   T
Sbjct: 115  ACAFSPSSQMIACGGLDNKCSVVPLSFEDDIIQKK-RQVATHTSYMSCCTFLRSDNLILT 173

Query: 924  GSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSI------SGRLLFAGYTNGDC 1085
            GS D TC ++D+ +G  +Q +         H  T   F+I      +G    +   +   
Sbjct: 174  GSGDSTCAIWDVESGQLIQNF---------HGHTGDVFAIDVPKCDTGNTFISAGADKHS 224

Query: 1086 YVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
             VWD    + V +       H+  I+ +    +G A  TGS D T +++     RQV
Sbjct: 225  LVWDIRSGQCVQSF----EGHEADINTVRFHPNGDAFATGSDDATCRLFDLRADRQV 277



>gb:AB057374_2462759 Oryzias latipes Ol-Gb mRNA for
            guaninenucleotide-binding protein beta subunit, complete
            cds.
          Length = 342

 Score =  262 bits (670), Expect = 1e-68
 Identities = 130/321 (40%), Positives = 201/321 (62%), Gaps = 1/321 (0%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   L   +NL+GH  K+Y++ W+ +   +VSASQDG+L+VW+  T  K  A+ L  A
Sbjct: 43   SVGRVQLKLRKNLKGHLAKIYAMHWSADSRSMVSASQDGKLLVWDTFTGNKLVAVPLKSA 102

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVM+  F+P+G  VA GGLD++C+++N+        +    R L  H GY+S C+++   
Sbjct: 103  WVMSVDFAPSGNLVASGGLDNICTVYNIKA-----ASPKTLRELDAHTGYLSCCRFL--S 155

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D+ ++T+SGD TC LWD+ TG +  +F     + H  D  S+++S  + N F+SG+CD+ 
Sbjct: 156  DSEILTASGDTTCCLWDLETGKQKIIF-----TNHIGDCMSLALS-PDMNYFISGACDSL 209

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            A LWD R  +   +TF GH  D+ A+ FFP GN   TGSDD +C+++D+R   ++  Y  
Sbjct: 210  AKLWDVREGA-CKQTFSGHTSDINAIAFFPSGNAVITGSDDCSCKMYDLRADQEVLDY-- 266

Query: 993  PHSDNEVHR-VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCL 1169
              +D+ ++  VTS+A S SGRL+FAGY + +C++WD+L  + V     + + HD R+SC 
Sbjct: 267  --TDSSLNAGVTSLALSNSGRLIFAGYDDFNCHIWDSLKGEKV----GVLSGHDNRVSCT 320

Query: 1170 GLSGDGSALCTGSWDTTLKIW 1232
            G+  DG  +CTGSWD+ LK+W
Sbjct: 321  GVPEDGMGVCTGSWDSFLKLW 341



>gb:BC085387_2564338 Danio rerio zgc:101614, mRNA (cDNA clone
            MGC:101614 IMAGE:7224720), complete cds.
          Length = 279

 Score =  243 bits (619), Expect = 9e-63
 Identities = 123/256 (48%), Positives = 171/256 (66%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S G   +   R L+GH  K+Y++ W  +   +VSASQDG+LI+W+  T+ K HAI L  +
Sbjct: 39   SVGRIQMRTRRTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDGYTTNKMHAIPLRSS 98

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            WVMTCA++P+G  VACGGLD++CS ++L      +GN  V+R L+GH GY+S C+++  +
Sbjct: 99   WVMTCAYAPSGNYVACGGLDNICSTYSLK---TREGNVRVNRELAGHTGYLSCCRFL--D 153

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            D  +ITSSGD TC LWDI TG +T+ F     +GHT DV S+S+S  ++  FVSG+CD +
Sbjct: 154  DNQIITSSGDTTCALWDIETGQQTTSF-----TGHTGDVMSLSVS-PDSKTFVSGACDAS 207

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            A LWD R      ++F GH  D+ AV FFP+GN F TGSDD TCRLFD+R   +L +Y+ 
Sbjct: 208  AKLWDIR-DGMCRQSFTGHVSDINAVCFFPNGNAFTTGSDDATCRLFDLRADQELMMYTH 266

Query: 993  PHSDNEVHRVTSIAFS 1040
               DN +  +TS+AFS
Sbjct: 267  ---DNIICGITSVAFS 279



 Score = 38.9 bits (89), Expect = 0.26
 Identities = 34/169 (20%), Positives = 66/169 (39%), Gaps = 2/169 (1%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH A + ++    S++ + VS S D    +WD    ++ +         V+   + P GN
Sbjct: 53   GHLAKIYAMHWG-SDSRLLVSASQDGKLIIWDGYTTNK-MHAIPLRSSWVMTCAYAPSGN 110

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGD--C 1085
                G  D  C  + ++T  +  V            ++   F    +++ +   +GD  C
Sbjct: 111  YVACGGLDNICSTYSLKT-REGNVRVNRELAGHTGYLSCCRFLDDNQIITS---SGDTTC 166

Query: 1086 YVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             +WD    +   +       H G +  L +S D     +G+ D + K+W
Sbjct: 167  ALWDIETGQQTTSF----TGHTGDVMSLSVSPDSKTFVSGACDASAKLW 211



>gb:A92590_1451234 Sequence 1 from Patent WO9811212.
          Length = 299

 Score =  241 bits (615), Expect = 3e-62
 Identities = 129/311 (41%), Positives = 181/311 (58%), Gaps = 1/311 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++ +           
Sbjct: 109  GNFVACGGLDNMCSIYNLK---SREGNVKVSRELSAHTGYLSCCRFLDD----------- 154

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT-ACLWDTRVA 839
                                                   N  V+ S DTT A LWD R  
Sbjct: 155  ---------------------------------------NNIVTSSGDTTCAKLWDVREG 175

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            +   +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R   +L  +S    ++ +  
Sbjct: 176  T-CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSH---ESIICG 231

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            +TS+AFS+SGRLLFAGY + +C VWD++ ++ V     + + HD R+SCLG++ DG A+ 
Sbjct: 232  ITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERV----GILSGHDNRVSCLGVTADGMAVA 287

Query: 1200 TGSWDTTLKIW 1232
            TGSWD+ LKIW
Sbjct: 288  TGSWDSFLKIW 298



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 1/135 (0%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +    ++H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN 156

Query: 1191 ALCTGSWDTT-LKIW 1232
             + T S DTT  K+W
Sbjct: 157  -IVTSSGDTTCAKLW 170



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 38/180 (21%), Positives = 76/180 (42%), Gaps = 4/180 (2%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH A + ++   A+++ + VS S D    +WD+   ++ V         V+   + P GN
Sbjct: 53   GHLAKIYAMHW-ATDSKLLVSASQDGKLIVWDSYTTNK-VHAIPLRSSWVMTCAYAPSGN 110

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
                G  D  C ++++++            + +V R  S          F    N     
Sbjct: 111  FVACGGLDNMCSIYNLKSRE---------GNVKVSRELSAHTGYLSCCRFLDDNNIVTSS 161

Query: 1092 WDTLLAKMV-LNLGSLQNS---HDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQVI 1259
             DT  AK+  +  G+ + +   H+  I+ +    +G A+CTGS D + +++     +++I
Sbjct: 162  GDTTCAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELI 221



>gb:AF397193_2064860 Rattus norvegicus G-protein beta-2 subunit mRNA,
            partial cds.
          Length = 225

 Score =  238 bits (608), Expect = 2e-61
 Identities = 125/235 (53%), Positives = 163/235 (69%)
 Frame = +3

Query: 366  IVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLP 545
            +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+G  VACGGLD++CSI++L   
Sbjct: 6    LVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLK-- 63

Query: 546  PDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEY 725
               +GN  VSR L GH GY+S C+++  +D  +ITSSGD TC LWDI TG +T  F    
Sbjct: 64   -TREGNVRVSRELPGHTGYLSCCRFL--DDNQIITSSGDTTCALWDIETGQQTVGF---- 116

Query: 726  QSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPD 905
             +GH+ DV S+S+ A +   FVSG+CD +  LWD R  S   +TF GHE D+ AV FFP+
Sbjct: 117  -AGHSGDVMSLSL-APDGRTFVSGACDASIKLWDVR-DSMCRQTFIGHESDINAVAFFPN 173

Query: 906  GNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGY 1070
            G  F TGSDD TCRLFD+R   +L +YS    DN +  +TS+AFS SGRLL AGY
Sbjct: 174  GYAFTTGSDDATCRLFDLRADQELLMYSH---DNIICGITSVAFSRSGRLLLAGY 225



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 35/128 (27%), Positives = 63/128 (49%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L GHTG +    +  + N+I+++S D    +W+  T Q+T         VM+ + +P 
Sbjct: 73  RELPGHTGYLSCCRFLDD-NQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD 131

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G++   G  D+   ++++        +S   +T  GH+  ++A  + PN  A   T S D
Sbjct: 132 GRTFVSGACDASIKLWDVR-------DSMCRQTFIGHESDINAVAFFPNGYA-FTTGSDD 183

Query: 663 KTCGLWDI 686
            TC L+D+
Sbjct: 184 ATCRLFDL 191



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 32/156 (20%), Positives = 64/156 (41%), Gaps = 2/156 (1%)
 Frame = +3

Query: 771  SNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
            +++ + VS S D    +WD+   ++ V         V+   + P GN    G  D  C +
Sbjct: 1    TDSRLLVSASQDGKLIIWDSYTTNK-VHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSI 59

Query: 951  FDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGD--CYVWDTLLAKMVLN 1124
            + ++T  +  V            ++   F    +++ +   +GD  C +WD    +  + 
Sbjct: 60   YSLKT-REGNVRVSRELPGHTGYLSCCRFLDDNQIITS---SGDTTCALWDIETGQQTVG 115

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                   H G +  L L+ DG    +G+ D ++K+W
Sbjct: 116  FAG----HSGDVMSLSLAPDGRTFVSGACDASIKLW 147



>pir|S72457|S72457 GTP-binding regulatory protein beta chain - fission
            yeast  (Schizosaccharomyces pombe)>gb:YSPGPH_1731115
            Schizosaccharomyces pombe G protein beta subunit Gpb1
            gene, complete cds.
          Length = 317

 Score =  227 bits (579), Expect = 4e-58
 Identities = 125/314 (39%), Positives = 180/314 (57%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+   GK+  +D + +   ++SAS +  L+VW+  TS K    + P  W+MTCAFSP+
Sbjct: 27   RVLKNKLGKIPDIDISTDGKYLLSASTNDVLLVWDLHTSNKVAFFEAPSVWIMTCAFSPS 86

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
             +S+A GGL++ C +++ ++ PD D    V     GH G+VS C+YV  +D HL+T SGD
Sbjct: 87   TKSIAAGGLNNFCVVYDTSV-PDADPVELV-----GHAGFVSCCKYV--DDGHLLTGSGD 138

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KTC  WDI      SV       GH  D+ S+    SN N+FV+G CD  A LWD R A+
Sbjct: 139  KTCMFWDIEQAKAISVL-----KGHEMDIVSLDFLPSNPNLFVTGGCDKLAKLWDLR-AA 192

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
                TF G+  D+ ++ FFP    F TG++DG  R FDIR   ++  YS P S      +
Sbjct: 193  YCCATFPGNTSDINSISFFPSNADFVTGAEDGIARCFDIRASAEIFQYSSPSSS----PI 248

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+ FS SG+LLF    +  C VWD++ +K + +L      H+ RIS L L+ DG+ L T
Sbjct: 249  NSVLFSKSGKLLFIA-KDKTCEVWDSISSKTITSL----TGHENRISSLALTSDGTMLAT 303

Query: 1203 GSWDTTLKIWAFGG 1244
            GSWD  +++W+  G
Sbjct: 304  GSWDECVRLWSSSG 317



 Score = 35.8 bits (81), Expect = 2.2
 Identities = 28/129 (21%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW-VMTCAF 473
           CC    G+T  + S+ + P     V+ ++DG    ++   S +      P +  + +  F
Sbjct: 194 CCATFPGNTSDINSISFFPSNADFVTGAEDGIARCFDIRASAEIFQYSSPSSSPINSVLF 253

Query: 474 SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
           S +G+ +     D  C ++      D+  + T++ +L+GH+  +S+   + ++   L T 
Sbjct: 254 SKSGKLLFI-AKDKTCEVW------DSISSKTIT-SLTGHENRISSLA-LTSDGTMLATG 304

Query: 654 SGDKTCGLW 680
           S D+   LW
Sbjct: 305 SWDECVRLW 313



>sp|Q10282|GBB_SCHPO Guanine nucleotide-binding protein beta
            subunit.>pir|T50474|T50474 GTP-binding regulatory protein
            beta chain - fission yeast  (Schizosaccharomyces
            pombe)>gb:AB004535_1509094 Schizosaccharomyces pombe 42.8
            kb genomic DNA, clone c973.>gb:SPBC32H8_1719913 S.pombe
            chromosome II cosmid c32H8.>gb:AF092102_1767469
            Schizosaccharomyces pombe G-protein beta subunit git5p
            (git5) gene, complete cds.
          Length = 305

 Score =  227 bits (579), Expect = 4e-58
 Identities = 125/314 (39%), Positives = 180/314 (57%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+   GK+  +D + +   ++SAS +  L+VW+  TS K    + P  W+MTCAFSP+
Sbjct: 15   RVLKNKLGKIPDIDISTDGKYLLSASTNDVLLVWDLHTSNKVAFFEAPSVWIMTCAFSPS 74

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
             +S+A GGL++ C +++ ++ PD D    V     GH G+VS C+YV  +D HL+T SGD
Sbjct: 75   TKSIAAGGLNNFCVVYDTSV-PDADPVELV-----GHAGFVSCCKYV--DDGHLLTGSGD 126

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KTC  WDI      SV       GH  D+ S+    SN N+FV+G CD  A LWD R A+
Sbjct: 127  KTCMFWDIEQAKAISVL-----KGHEMDIVSLDFLPSNPNLFVTGGCDKLAKLWDLR-AA 180

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
                TF G+  D+ ++ FFP    F TG++DG  R FDIR   ++  YS P S      +
Sbjct: 181  YCCATFPGNTSDINSISFFPSNADFVTGAEDGIARCFDIRASAEIFQYSSPSSS----PI 236

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+ FS SG+LLF    +  C VWD++ +K + +L      H+ RIS L L+ DG+ L T
Sbjct: 237  NSVLFSKSGKLLFIA-KDKTCEVWDSISSKTITSL----TGHENRISSLALTSDGTMLAT 291

Query: 1203 GSWDTTLKIWAFGG 1244
            GSWD  +++W+  G
Sbjct: 292  GSWDECVRLWSSSG 305



 Score = 35.8 bits (81), Expect = 2.2
 Identities = 28/129 (21%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW-VMTCAF 473
           CC    G+T  + S+ + P     V+ ++DG    ++   S +      P +  + +  F
Sbjct: 182 CCATFPGNTSDINSISFFPSNADFVTGAEDGIARCFDIRASAEIFQYSSPSSSPINSVLF 241

Query: 474 SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
           S +G+ +     D  C ++      D+  + T++ +L+GH+  +S+   + ++   L T 
Sbjct: 242 SKSGKLLFI-AKDKTCEVW------DSISSKTIT-SLTGHENRISSLA-LTSDGTMLATG 292

Query: 654 SGDKTCGLW 680
           S D+   LW
Sbjct: 293 SWDECVRLW 301



>gb:GCY14250_1385215 Geodia cydonium mRNA for G protein beta subunit.
          Length = 371

 Score =  222 bits (566), Expect = 1e-56
 Identities = 116/329 (35%), Positives = 188/329 (57%), Gaps = 6/329 (1%)
 Frame = +3

Query: 267  PISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLP 446
            PI+    +L   + L+GH G++   DW+P+K  +V+A QDG+L +WN +T+QK   I+  
Sbjct: 58   PITSPVINLKVRKTLKGHRGRILHFDWSPDKYHVVTAGQDGQLFIWNGMTAQKEMVIQ-S 116

Query: 447  CAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGN-----STVSRTLSGHKGYVSA 611
              WV  C+FSP+   +AC G    C +F L++   +  +     +   +TLS H+ Y++ 
Sbjct: 117  SKWVCACSFSPSTTLLACAGTSCDCQVFQLDVGRVSTDSQLPRLTVPKKTLSAHQKYITN 176

Query: 612  CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMF 788
            C +    D  ++T+  DK C +WD+        F      GHT+D+  ++++  +   +F
Sbjct: 177  CLFF-GSDQQILTAGADKRCAMWDMEYHEPVKTF-----EGHTSDILGLALNPKDPFTVF 230

Query: 789  VSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG 968
             + SCD +AC+WD+R + + V  F GHEGDV +V+FFP G   GT  +DGT RLFD+R  
Sbjct: 231  ATASCDRSACIWDSR-SGQCVMRFEGHEGDVNSVRFFPTGEAIGTACNDGTIRLFDLRAD 289

Query: 969  HQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSH 1148
             +++ Y++      +   +++ FS SGR+LF GY +    VWD +    +    ++  +H
Sbjct: 290  QEIKFYTK---TGIIFGCSALDFSKSGRILFGGYNDYAIRVWDVIKGTHM----AMWLNH 342

Query: 1149 DGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
              R+S + LS DG+AL + SWD TLKIWA
Sbjct: 343  TDRVSNVALSPDGTALGSSSWDGTLKIWA 371



>gb:CVI250442_1376009 Calliphora vicina mRNA for guanine
            nucleotide-binding protein beta subunit.
          Length = 346

 Score =  221 bits (562), Expect = 4e-56
 Identities = 120/308 (38%), Positives = 184/308 (59%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  KV S+ +  +    V+ S DG+LI+W+  T+ K   I L  AWVMT AFSP+G 
Sbjct: 55   LKGHINKVNSVHFAGDSRHCVTGSLDGKLIIWDTWTANKVQVIPLRSAWVMTVAFSPSGN 114

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VACGG+D+ C+++++N   D  G + ++R L G++G++S+C+++  +D HLIT SGD  
Sbjct: 115  FVACGGMDNQCTVYDVN-NRDASGVAKMTRELLGYEGFLSSCRFL--DDTHLITGSGDMK 171

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
               WD+  G++T  F     +GH  D++ +S+S  + N +++GS D TA LWD R  +  
Sbjct: 172  ICHWDLEKGVKTMDF-----NGHAGDIAGLSLS-PDMNTYITGSVDKTAKLWDVREETHK 225

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             + F GHE DV +V + P GN F + S+D T RL+DIR   Q+ +Y  P  +      TS
Sbjct: 226  -QMFFGHEMDVNSVCYHPSGNGFASASEDQTARLYDIRADQQIALYEPPQKNT---GFTS 281

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
             A S SGR L      G+ + +DT+    V + G LQ  H+ RI+C+ LS +G  L + S
Sbjct: 282  CALSTSGRYLLCSGIEGNIHSFDTM---KVCHNGMLQ-GHENRITCISLSPNGMCLASTS 337

Query: 1209 WDTTLKIW 1232
            WD  +++W
Sbjct: 338  WDQQVRLW 345



>gb:AF070603_1880754 Homo sapiens clone 24584 beta-subunit signal
            transducing proteins GS/GI mRNA, partial cds.
          Length = 207

 Score =  220 bits (561), Expect = 5e-56
 Identities = 113/221 (51%), Positives = 149/221 (67%)
 Frame = +3

Query: 570  VSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV 749
            VSR L+GH GY+S C+++  +D  ++TSSGD TC LWDI TG +T+ F     +GHT DV
Sbjct: 2    VSRELAGHTGYLSCCRFL--DDNQIVTSSGDTTCALWDIETGQQTTTF-----TGHTGDV 54

Query: 750  SSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS 929
             S+S+ A +T +FVSG+CD +A LWD R      +TF GHE D+ A+ FFP+GN F TGS
Sbjct: 55   MSLSL-APDTRLFVSGACDASAKLWDVR-EGMCRQTFTGHESDINAICFFPNGNAFATGS 112

Query: 930  DDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLA 1109
            DD TCRLFD+R   +L  YS    DN +  +TS++FS SGRLL AGY + +C VWD L A
Sbjct: 113  DDATCRLFDLRADQELMTYSH---DNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKA 169

Query: 1110 KMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                +   +   HD R+SCLG++ DG A+ TGSWD+ LKIW
Sbjct: 170  ----DRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 206



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 43/180 (23%), Positives = 67/180 (37%), Gaps = 9/180 (5%)
 Frame = +3

Query: 315 GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
           GHTG V SL   P+    VS + D    +W+              + +    F P G + 
Sbjct: 49  GHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAF 108

Query: 495 ACGGLDSVCSIFNLNLPP-------DN--DGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
           A G  D+ C +F+L           DN   G ++VS + SG                 L+
Sbjct: 109 ATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRL---------------LL 153

Query: 648 TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
               D  C +WD     R  V      +GH   VS + ++     +  +GS D+   +W+
Sbjct: 154 AGYDDFNCNVWDALKADRAGVL-----AGHDNRVSCLGVTDDGMAV-ATGSWDSFLKIWN 207



>gb:BC015920_1975380 Homo sapiens guanine nucleotide binding protein
            (G protein), beta polypeptide 3, mRNA (cDNA clone
            MGC:20430 IMAGE:4648399), complete cds.
          Length = 297

 Score =  218 bits (555), Expect = 2e-55
 Identities = 119/311 (38%), Positives = 171/311 (54%), Gaps = 1/311 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+Y++ W  +   +VSASQDG+LIVW++ T+ K HAI L  +WVMTCA++P+
Sbjct: 49   RTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VACGGLD++CSI+NL      +GN  VSR LS H GY+S C+++ +           
Sbjct: 109  GNFVACGGLDNMCSIYNLK---SREGNVKVSRELSAHTGYLSCCRFLDD----------- 154

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
                                                   N  V+ S DTT  LWD     
Sbjct: 155  ---------------------------------------NNIVTSSGDTTCALWDIETGQ 175

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +    F GH GD +++   PD N F +G+ D + +L+D+R G   Q ++   SD     +
Sbjct: 176  QKT-VFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESD-----I 229

Query: 1023 TSIAF-SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
             +I F S+SGRLLFAGY + +C VWD++ ++ V     + + HD R+SCLG++ DG A+ 
Sbjct: 230  NAICFFSLSGRLLFAGYDDFNCNVWDSMKSERV----GILSGHDNRVSCLGVTADGMAVA 285

Query: 1200 TGSWDTTLKIW 1232
            TGSWD+ LKIW
Sbjct: 286  TGSWDSFLKIW 296



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 32/134 (23%), Positives = 58/134 (43%)
 Frame = +3

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            RV  R  RT  GH   + A+ +  D     + S DG   ++D  T +++       S   
Sbjct: 42   RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSS--- 98

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V + A++ SG  +  G  +  C +++    +  + +    ++H G +SC     D +
Sbjct: 99   --WVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNN 156

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S DTT  +W
Sbjct: 157  -IVTSSGDTTCALW 169



>gb:CR380958_1653187 Candida glabrata strain CBS138 chromosome L
            complete sequence.
          Length = 419

 Score =  212 bits (539), Expect = 2e-53
 Identities = 129/343 (37%), Positives = 177/343 (51%), Gaps = 35/343 (10%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GHT K+    W+ +   I+SASQDG +IVW++LT  K  AI L   WV+TCA SP+G 
Sbjct: 81   LKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCALSPSGA 140

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
              A  GL++ C+I+ +  P  +     V+    GH GY+S  ++V   ++ ++TSSGD T
Sbjct: 141  LAASAGLNNNCTIYRM--PRGSAVQQNVTSIFKGHTGYISGVEFV--SESRVVTSSGDMT 196

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASN---TNMFVSGSCDTTACLWDTRVA 839
            C LWDI    R   +     S H  DV ++SI  +N    NMF S   D    +WD R  
Sbjct: 197  CALWDIPKAKRVREY-----SDHLGDVLAISIPVTNLSKNNMFASCGSDGYTFIWDVRSP 251

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS---------- 989
            S AV+ F     D   +KFFPDGN    G+DDGT  LFD+R    + +YS          
Sbjct: 252  S-AVQQFSIGSCDSNCLKFFPDGNSVAVGNDDGTISLFDLRADCTIALYSINDRGSPLQK 310

Query: 990  ----------QPHSDN------------EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTL 1103
                      Q  S +            E   V S+ FS SGRL+++ Y N  C VWD L
Sbjct: 311  ENVFLNSNEYQSSSSSPKSPISLATNYFEDRGVISLDFSGSGRLMYSCYINLGCQVWDVL 370

Query: 1104 LAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              ++V +L      H  R++ +  S DG A+CTGSWD TLK+W
Sbjct: 371  KGEVVYSL----EGHGNRLAGVKCSPDGMAICTGSWDQTLKLW 409



>pir|JU0269|RGFFB GTP-binding regulatory protein beta chain - fruit
            fly  (Drosophila melanogaster)
          Length = 346

 Score =  212 bits (539), Expect = 2e-53
 Identities = 113/308 (36%), Positives = 180/308 (58%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  KV S+ +  +    V+ S DG+LI+W+  T+ K   I L  AWVMT AFSP+G 
Sbjct: 55   LKGHINKVNSVHFAGDSRHCVTGSLDGKLIIWDTWTANKVQIIPLRSAWVMTVAFSPSGN 114

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VACGG+D+ C+++++N   D  G + + + L G++G++S+C+++  +D HLIT SGD  
Sbjct: 115  FVACGGMDNQCTVYDVN-NRDASGVAKMVKELMGYEGFLSSCRFL--DDGHLITGSGDMK 171

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
               WD+  G++T  F     +GH  D++ +S+S  +   +++GS D TA LWD R     
Sbjct: 172  ICHWDLEKGVKTMDF-----NGHAGDIAGLSLS-PDMKTYITGSVDKTAKLWDVREEGHK 225

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             + F GH+ DV +V + P G  F + S+D T R++D+R   Q+  Y  P  +      TS
Sbjct: 226  -QMFFGHDMDVSSVCYHPSGFGFASASEDQTARMYDLRADQQIAQYEPPQKNT---GFTS 281

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
             A S SGR L  G   G+ + WDT+  +   + G+L + H+ RI+C+ L  +G  L + S
Sbjct: 282  CALSTSGRYLMCGGIEGNVHSWDTMKQR---HTGTL-SGHENRITCISLCPNGMCLASTS 337

Query: 1209 WDTTLKIW 1232
            WD  +++W
Sbjct: 338  WDQQVRLW 345



>sp|P29829|GBB2_DROME Guanine nucleotide-binding protein beta subunit
            2.>gb:AE014296_1137030 Drosophila melanogaster chromosome
            3L, complete sequence.>gb:AE003516_1213699 Drosophila
            melanogaster chromosome 3L, section 69 of 83 of the
            complete sequence.>gb:AY118886_1300608 Drosophila
            melanogaster HL07966 full insert cDNA.
          Length = 346

 Score =  211 bits (536), Expect = 4e-53
 Identities = 113/308 (36%), Positives = 180/308 (58%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  KV S+ +  +    V+ S DG+LI+W+  T+ K   I L  AWVMT AFSP+G 
Sbjct: 55   LKGHINKVNSVHFAGDSRHCVTGSLDGKLIIWDTWTANKVQIIPLRSAWVMTVAFSPSGN 114

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VACGG+D+ C+++++N   D  G + + + L G++G++S+C+++  +D HLIT SGD  
Sbjct: 115  FVACGGMDNQCTVYDVN-NRDASGVAKMVKELMGYEGFLSSCRFL--DDGHLITGSGDMK 171

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
               WD+  G++T  F     +GH  D++ +S+S  +   +++GS D TA LWD R     
Sbjct: 172  ICHWDLEKGVKTMDF-----NGHAGDIAGLSLS-PDMKTYITGSVDKTAKLWDVREEGHK 225

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             + F GH+ DV +V + P G  F + S+D T R++D+R   Q+  Y  P  +      TS
Sbjct: 226  -QMFFGHDMDVSSVCYHPSGFGFASCSEDQTARMYDLRADQQIAQYEPPQKNT---GFTS 281

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
             A S SGR L  G   G+ + WDT+  +   + G+L + H+ RI+C+ L  +G  L + S
Sbjct: 282  CALSTSGRYLMCGGIEGNVHSWDTMKQR---HTGTL-SGHENRITCISLCPNGMCLASTS 337

Query: 1209 WDTTLKIW 1232
            WD  +++W
Sbjct: 338  WDQQVRLW 345



>gb:HS283E3_1997889 Human DNA sequence from clone RP1-283E3 on
            chromosome 1p36.21-36.33 Contains the MMP23B gene for
            matrix metalloproteinase 23B, the CDC2L2 gene for cell
            division cycle 2-like 2, a novel gene, the SLC35E2 gene
            for solute carrier family 35 member E2, a ribosomal
            protein S7 (RPS7) pseudogene, the gene for an NAD kinase
            (FLJ13052), the 3' end of the GNB1 gene for guanine
            nucleotide binding protein (G protein) beta polypeptide 1
            and four CpG islands, complete sequence.
          Length = 197

 Score =  209 bits (531), Expect = 1e-52
 Identities = 107/212 (50%), Positives = 142/212 (66%)
 Frame = +3

Query: 597  GYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASN 776
            GY+S C+++  +D  ++TSSGD TC LWDI TG +T+ F     +GHT DV S+S+ A +
Sbjct: 1    GYLSCCRFL--DDNQIVTSSGDTTCALWDIETGQQTTTF-----TGHTGDVMSLSL-APD 52

Query: 777  TNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            T +FVSG+CD +A LWD R      +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD
Sbjct: 53   TRLFVSGACDASAKLWDVR-EGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 111

Query: 957  IRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSL 1136
            +R   +L  YS    DN +  +TS++FS SGRLL AGY + +C VWD L A    +   +
Sbjct: 112  LRADQELMTYSH---DNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKA----DRAGV 164

Query: 1137 QNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
               HD R+SCLG++ DG A+ TGSWD+ LKIW
Sbjct: 165  LAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 196



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 43/180 (23%), Positives = 67/180 (37%), Gaps = 9/180 (5%)
 Frame = +3

Query: 315 GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
           GHTG V SL   P+    VS + D    +W+              + +    F P G + 
Sbjct: 39  GHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAF 98

Query: 495 ACGGLDSVCSIFNLNLPP-------DN--DGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
           A G  D+ C +F+L           DN   G ++VS + SG                 L+
Sbjct: 99  ATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRL---------------LL 143

Query: 648 TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
               D  C +WD     R  V      +GH   VS + ++     +  +GS D+   +W+
Sbjct: 144 AGYDDFNCNVWDALKADRAGVL-----AGHDNRVSCLGVTDDGMAV-ATGSWDSFLKIWN 197



>gb:CR382135_1668471 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 408

 Score =  208 bits (529), Expect = 3e-52
 Identities = 128/351 (36%), Positives = 182/351 (51%), Gaps = 42/351 (11%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  K+  + W      I+SASQDG +I+W+ ++  K HAI L   WV+ CA +P G+
Sbjct: 66   LRGHQNKIAQIRWNSNSRHILSASQDGYMIIWDTVSGFKKHAISLENQWVLACAIAPNGE 125

Query: 489  SVACGGLDSVCSIFNLNLPPDN------DGNSTVSRTL-SGHKGYVSACQYVPNEDAHLI 647
            SVA GGLD+  +++N+   P N      D   T  R+L  GHK Y+S C Y+ NE   LI
Sbjct: 126  SVASGGLDNTLTVYNIK--PRNYQYGAHDQYQTSIRSLFKGHKAYISDCDYISNE--KLI 181

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASN--TNMFVSGSCDTTACL 821
            T+SGD TC +WDI  G +   F      G    ++  S +  N  + +FVSGS D  A +
Sbjct: 182  TASGDMTCIMWDINKGGKVRDFVDHI--GDVLVLAKFSDTQGNHESPIFVSGSSDGYAKI 239

Query: 822  WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS---- 989
            WD R    AV++F     D+  +K FPD + F TGSDDG  RLFD+R+  +L  YS    
Sbjct: 240  WDLR-CQFAVQSFPVSNSDINCIKVFPDNHSFMTGSDDGIIRLFDMRSDCELSNYSLSAN 298

Query: 990  -----------------------------QPHSDNEVHRVTSIAFSISGRLLFAGYTNGD 1082
                                           +S  +   V S+ FS SGRLL++ Y++  
Sbjct: 299  LHKLDLNNLRPSVSRSYPESPTDQISRVQSTNSSYDTPGVVSLDFSRSGRLLYSCYSDYG 358

Query: 1083 CYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
            C +WDTL   +V  LG     H  +++ +  S DG  +CT SWD T+K+W+
Sbjct: 359  CIIWDTLKGNIVGALG--MAGHLNKVNQVSSSPDGLIICTASWDQTIKVWS 407



>gb:BOVGP_1435480 Bovine signal-transducing guanine nucleotide-binding
            regulatory (G) protein beta subunit mRNA, partial cds.
          Length = 215

 Score =  208 bits (529), Expect = 3e-52
 Identities = 112/234 (47%), Positives = 151/234 (64%)
 Frame = +3

Query: 462  TCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAH 641
            TCA++P+G  VACGGLD++CSI++L      +GN  VSR L GH GY+S C+++  +D  
Sbjct: 1    TCAYAPSGNFVACGGLDNICSIYSLKT---REGNVRVSRELPGHTGYLSCCRFL--DDNQ 55

Query: 642  LITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACL 821
            +ITSSGD TC LWDI TG +T  F     +GH+ DV S+S+ A +   FVSG+CD +  L
Sbjct: 56   IITSSGDTTCALWDIETGQQTVGF-----AGHSGDVMSLSL-APDGRTFVSGACDASIKL 109

Query: 822  WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
            WD R  S   +TF GHE D+ AV FFP+G  F TGSDD TCRLFD+R   +L +YS    
Sbjct: 110  WDVR-DSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSH--- 165

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRIS 1163
            DN +  +TS+AFS SGRL+ AGY + +C +WD +      +   +   HD R+S
Sbjct: 166  DNIICGITSVAFSRSGRLVLAGYDDFNCNIWDAMKG----DRAGVLAGHDNRVS 215



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 48/193 (24%), Positives = 86/193 (44%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L GHTG +    +  + N+I+++S D    +W+  T Q+T         VM+ + +P 
Sbjct: 36  RELPGHTGYLSCCRFLDD-NQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD 94

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G++   G  D+   ++++        +S   +T  GH+  ++A  + PN  A   T S D
Sbjct: 95  GRTFVSGACDASIKLWDVR-------DSMCRQTFIGHESDINAVAFFPNGYA-FTTGSDD 146

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            TC L+D+       ++           ++SV+ S S   + ++G  D    +WD     
Sbjct: 147 ATCRLFDLRADQELLMYS---HDNIICGITSVAFSRSG-RLVLAGYDDFNCNIWDAMKGD 202

Query: 843 RAVRTFHGHEGDV 881
           RA     GH+  V
Sbjct: 203 RA-GVLAGHDNRV 214



 Score = 35.8 bits (81), Expect = 2.2
 Identities = 24/115 (20%), Positives = 47/115 (40%), Gaps = 2/115 (1%)
 Frame = +3

Query: 894  FFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYT 1073
            + P GN    G  D  C ++ ++T  +  V            ++   F    +++ +   
Sbjct: 4    YAPSGNFVACGGLDNICSIYSLKT-REGNVRVSRELPGHTGYLSCCRFLDDNQIITS--- 59

Query: 1074 NGD--CYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            +GD  C +WD    +  +        H G +  L L+ DG    +G+ D ++K+W
Sbjct: 60   SGDTTCALWDIETGQQTVGFAG----HSGDVMSLSLAPDGRTFVSGACDASIKLW 110



>gb:DROGNRPBS_1382073 Drosophila melanogaster guanine nucleotide
            regulatory protein beta subunit mRNA, complete cds.
          Length = 346

 Score =  208 bits (529), Expect = 3e-52
 Identities = 112/308 (36%), Positives = 179/308 (58%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  KV S+ +  +    V+ S DG+LI+W+  T+ K   I L  AWVMT AFSP+G 
Sbjct: 55   LKGHINKVNSVHFAGDSRHCVTGSLDGKLIIWDTWTANKVQIIPLRSAWVMTVAFSPSGN 114

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
              ACGG+D+ C+++++N   D  G + + + L G++G++S+C+++  +D HLIT SGD  
Sbjct: 115  FEACGGMDNQCTVYDVN-NRDAPGVAKMVKELMGYEGFLSSCRFL--DDGHLITGSGDMK 171

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
               WD+  G++T  F     +GH  D++ +S+S  +   +++GS D TA LWD R     
Sbjct: 172  ICHWDLEKGVKTMDF-----NGHAGDIAGLSLS-PDMKTYITGSVDKTAKLWDVREEGHK 225

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             + F GH+ DV +V + P G  F + S+D T R++D+R   Q+  Y  P  +      TS
Sbjct: 226  -QMFFGHDMDVSSVCYHPSGFGFASCSEDQTARMYDLRADQQIAQYEPPQKNT---GFTS 281

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
             A S SGR L  G   G+ + WDT+  +   + G+L + H+ RI+C+ L  +G  L + S
Sbjct: 282  CALSTSGRYLMCGGIEGNVHSWDTMKQR---HTGTL-SGHENRITCISLCPNGMCLASTS 337

Query: 1209 WDTTLKIW 1232
            WD  +++W
Sbjct: 338  WDQQVRLW 345



>gb:AE016816_1746787 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 467

 Score =  203 bits (517), Expect = 6e-51
 Identities = 126/357 (35%), Positives = 184/357 (51%), Gaps = 48/357 (13%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  KV S  W+ +   I+SASQDG +++W+A T  K++AI L   WV++CA  P G 
Sbjct: 123  LKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAICPNGN 182

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VA  GLD+ C+I+ ++       N  +     GH  Y+S  +++  +D  ++T+SGD T
Sbjct: 183  LVASAGLDNNCTIYRVSRKDRIQQN--IVSIFKGHTCYISEIEFL--DDNSILTASGDMT 238

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT----NMFVSGSCDTTACLWDTRV 836
            C LWDIT   R + F     + H  DV S+S + + T    N+F SG  D    +WD RV
Sbjct: 239  CALWDITKSKRINEF-----ADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRV 293

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS--------- 989
             + +V++F   + DV  VKFF +GN   TGSDDG   L+D+R+  ++  YS         
Sbjct: 294  PT-SVQSFFVSDSDVSKVKFFRNGNTIATGSDDGCTNLYDLRSDCRIANYSLSRSIHGAT 352

Query: 990  ------------------------QPHS-----------DNEVHRVTSIAFSISGRLLFA 1064
                                     P+S           DN+   V S+ FS SGRLL+ 
Sbjct: 353  PVQQQTYIMSNMDYTAPSGTLARASPYSPAIGTVSSSFIDNQ--GVISMDFSRSGRLLYV 410

Query: 1065 GYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
             YT   C VWD +  +++  L    + H  RIS +  S DG A+CTGSWD T+K+W+
Sbjct: 411  SYTEFGCAVWDLVKGEIIGKL----DGHSDRISGVATSPDGLAICTGSWDMTMKVWS 463



 Score = 37.0 bits (84), Expect = 1.0
 Identities = 36/139 (25%), Positives = 60/139 (43%), Gaps = 4/139 (2%)
 Frame = +3

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---HQLQVYSQPH 998
            T V  + V T  GH   V + ++  D     + S DG   L+D  TG   + + ++SQ  
Sbjct: 113  TSVNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQ-- 170

Query: 999  SDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWD-TLLAKMVLNLGSLQNSHDGRISCLGL 1175
                   V S A   +G L+ +   + +C ++  +   ++  N+ S+   H   IS +  
Sbjct: 171  ------WVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEF 224

Query: 1176 SGDGSALCTGSWDTTLKIW 1232
              D S L T S D T  +W
Sbjct: 225  LDDNSIL-TASGDMTCALW 242



>gb:CR382131_1663509 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 380

 Score =  199 bits (507), Expect = 9e-50
 Identities = 121/338 (35%), Positives = 179/338 (52%), Gaps = 17/338 (5%)
 Frame = +3

Query: 267  PISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLP 446
            PIS  P  L     L+GH GK+ S DW      ++S + DG  ++W+A +S K+    LP
Sbjct: 57   PISSTP--LKVRHKLKGHRGKINSCDWASNSQYVLSVAMDGLALMWDAYSSLKSRVFLLP 114

Query: 447  CAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDN--------DGNSTVSRTLS----- 587
              +V++CA  P+   +A GGLD+  SI ++    D          G+ST  + L+     
Sbjct: 115  SCYVLSCALPPSCGYLASGGLDNRVSIHSMTQSADETDPSVPYGSGSSTRMKGLTKSEPM 174

Query: 588  ----GHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
                GH  YV+   ++   D  +I++SGD TC +WD+ TG R S         H  DVSS
Sbjct: 175  AILKGHSAYVADLCFLT--DQQIISASGDMTCCIWDVNTGRRVSTL-----YDHLGDVSS 227

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
            V+   S   +  + S D T  +WD R+A R V+TF GH  DV +V FFPDGN   +G DD
Sbjct: 228  VTKHPSKMQIVATASNDKTVKIWDLRIA-RCVQTFQGHNKDVTSVDFFPDGNAVLSGGDD 286

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RLFD+RT  Q+ +YS P   + +  V S+A + SGR++F G+  G+   WDT+    
Sbjct: 287  STARLFDMRTDCQMNIYSAP---DIMSPVNSVAVTPSGRIMFCGHDTGEVVAWDTIKCTY 343

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKI 1229
               LG +   H G ++ + +S DG  + + SWD T+ +
Sbjct: 344  ---LGPI-TKHLGPVTKVKVSPDGVGVLSSSWDETMTV 377



>sp|P18851|GBB_YEAST Guanine nucleotide-binding protein beta
            subunit.>pir|S60939|S60939 GTP-binding protein beta chain
            STE4 - yeast (Saccharomyces cerevisiae)>gb:SC33KB_1705145
            S.cerevisiae 33kb fragment from the right arm of
            chromosome XV.>gb:SCYOR212W_1714450 S.cerevisiae
            chromosome XV reading frame ORF YOR212w.
          Length = 423

 Score =  199 bits (507), Expect = 9e-50
 Identities = 120/350 (34%), Positives = 191/350 (54%), Gaps = 39/350 (11%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  K+    W+ +  RI+SASQDG +++W++ +  K +AI L   WV++CA SP+  
Sbjct: 88   LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VA  GL++ C+I+ ++   +N     V+    GH  Y+S  ++  N  AH++T+SGD T
Sbjct: 148  LVASAGLNNNCTIYRVS--KENRVAQNVASIFKGHTCYISDIEFTDN--AHILTASGDMT 203

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSI-----SASNTNMFVSGSCDTTACLWDTR 833
            C LWDI    R   +     S H  DV +++I     S +++N F S   D    +WD+R
Sbjct: 204  CALWDIPKAKRVREY-----SDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSR 258

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-----------GHQ-- 974
              S AV++F+ ++ D+ A++FF DG     GSD+G   ++D+R+           G++  
Sbjct: 259  SPS-AVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEER 317

Query: 975  ---------------------LQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
                                 L+  S  + DN+   V S+ FS SGRL+++ YT+  C V
Sbjct: 318  TPTPTYMAANMEYNTAQSPQTLKSTSSSYLDNQ--GVVSLDFSASGRLMYSCYTDIGCVV 375

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFG 1241
            WD L  ++V   G L+  H GR++ +  S DG A+CTGSWD+T+KIW+ G
Sbjct: 376  WDVLKGEIV---GKLE-GHGGRVTGVRSSPDGLAVCTGSWDSTMKIWSPG 421



>gb:YSCSTE4_1730713 Saccharomyces cerevisiae mating factor
            receptor-coupled G protein (STE4) gene, complete cds.
          Length = 423

 Score =  197 bits (502), Expect = 3e-49
 Identities = 119/350 (34%), Positives = 190/350 (54%), Gaps = 39/350 (11%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  K+    W+ +  RI+SASQDG +++W++ +  K +AI L   WV++CA SP+  
Sbjct: 88   LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VA  GL++ C+I+ ++   +N     V+    GH  Y+S  ++  N  AH++T+SGD T
Sbjct: 148  LVASAGLNNNCTIYRVS--KENRVAQNVASIFKGHTCYISDIEFTDN--AHILTASGDMT 203

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSIS-----ASNTNMFVSGSCDTTACLWDTR 833
            C LWDI    R   +     S H  DV +++I       +++N F S   D    +WD+R
Sbjct: 204  CALWDIPKAKRVREY-----SDHLGDVLALAIPEEPNLENSSNTFASCGSDGYTYIWDSR 258

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-----------GHQ-- 974
              S AV++F+ ++ D+ A++FF DG     GSD+G   ++D+R+           G++  
Sbjct: 259  SPS-AVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEER 317

Query: 975  ---------------------LQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
                                 L+  S  + DN+   V S+ FS SGRL+++ YT+  C V
Sbjct: 318  TPTPTYMAANMEYNTAQSPQTLKSTSSSYLDNQ--GVVSLDFSASGRLMYSCYTDIGCVV 375

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFG 1241
            WD L  ++V   G L+  H GR++ +  S DG A+CTGSWD+T+KIW+ G
Sbjct: 376  WDVLKGEIV---GKLE-GHGGRVTGVRSSPDGLAVCTGSWDSTMKIWSPG 421



>gb:CR382124_1656626 Kluyveromyces lactis strain NRRL Y-1140
            chromosome D of strain NRRL Y-1140 of Kluyveromyces
            lactis.>gb:AF136180_1771138 Kluyveromyces lactis
            heterotrimeric G protein beta subunit (gpa1) gene,
            complete cds.
          Length = 436

 Score =  193 bits (490), Expect = 8e-48
 Identities = 119/366 (32%), Positives = 180/366 (49%), Gaps = 56/366 (15%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L+GH  K+  + W+ +   ++S+SQDG +I+W+  T  K  AI L   WV++ A SP+
Sbjct: 80   RTLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLSQWVLSSAISPS 139

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  VA  GLD+ CS++ ++   DN     V     GH  Y+SA +++  ++  ++T+SGD
Sbjct: 140  GNLVASAGLDNHCSVYRVS--RDNRIQQNVISIFKGHTCYISATEFL--DERTILTASGD 195

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT----NMFVSGSCDTTACLWDT 830
             TC +WDI    R + F       H  DV ++ +  +NT    + F++G  D  A LWD 
Sbjct: 196  MTCAMWDIPKSKRVTEF-----IDHLGDVLTMDLPPANTGRYGHNFITGGSDGYAYLWDV 250

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG-------------- 968
            R  + A ++F   + DV A+KFF +G  F  GSDDG+ RLFD+R+               
Sbjct: 251  RQPNSA-QSFFISDSDVSAIKFFNNGESFMAGSDDGSARLFDLRSDCQISTYSFSDGLLQ 309

Query: 969  -HQLQVYSQPHSDNEVHR-------------------------------------VTSIA 1034
             HQLQ    PH  +  +                                      V SI 
Sbjct: 310  QHQLQQQHHPHPHSHAYSRIQKNRYGSSSSSTSSYPIVKTPQSLNFKESCIEDQGVISID 369

Query: 1035 FSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWD 1214
            FS SGRL++A Y +  C VWD +  +M+  +    + H  RI+ +  S DG A+ + SWD
Sbjct: 370  FSSSGRLMYACYADYGCAVWDIIKGEMIGKV----DGHRNRINAVKTSPDGMAVVSSSWD 425

Query: 1215 TTLKIW 1232
             TLK+W
Sbjct: 426  MTLKVW 431



>gb:AK018747_1159733 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610030J18
           product:guanine nucleotide binding protein, beta 5, full
           insert sequence.
          Length = 204

 Score =  191 bits (486), Expect = 2e-47
 Identities = 88/206 (42%), Positives = 135/206 (65%), Gaps = 1/206 (0%)
 Frame = +3

Query: 378 SQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDND 557
           SQDG++IVW++ T+ K HA+ +PC WVM CA++P+G ++ACGGLD+ CS++ L     N+
Sbjct: 1   SQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTF-DKNE 59

Query: 558 GNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGH 737
             +   ++++ H  Y+SAC +  N D  ++T+SGD TC LWD+ +G     F      GH
Sbjct: 60  NMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGDGTCALWDVESGQLLQSF-----HGH 113

Query: 738 TADVSSVSISASNT-NMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNR 914
            ADV  + ++ S T N FVSG CD  A +WD R + + V+ F  HE DV +V+++P G+ 
Sbjct: 114 GADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-SGQCVQAFETHESDVNSVRYYPSGDA 172

Query: 915 FGTGSDDGTCRLFDIRTGHQLQVYSQ 992
           F +GSDD TCRL+D+R   ++ +YS+
Sbjct: 173 FASGSDDATCRLYDLRADREVAIYSK 198



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 33/156 (21%), Positives = 70/156 (44%), Gaps = 4/156 (2%)
 Frame = +3

Query: 267 PISFGPTDLVCCR--NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIK 440
           P++F   + +  +  ++  HT  + +  +T    +I++AS DG   +W+  + Q   +  
Sbjct: 52  PLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFH 111

Query: 441 LPCAWVMTCAFSP--TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSAC 614
              A V+    +P  TG +   GG D    ++++        +    +    H+  V++ 
Sbjct: 112 GHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMR-------SGQCVQAFETHESDVNSV 164

Query: 615 QYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGE 722
           +Y P+ DA   + S D TC L+D+      +++  E
Sbjct: 165 RYYPSGDA-FASGSDDATCRLYDLRADREVAIYSKE 199



>gb:AF044736_1236091 Homarus americanus G protein beta 2 subunit
           (Gbeta2) mRNA, partial cds.
          Length = 186

 Score =  186 bits (471), Expect = 1e-45
 Identities = 90/191 (47%), Positives = 129/191 (67%)
 Frame = +3

Query: 387 GRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNS 566
           G+L+VW+A+T+ K  AI L  +WVMTCA+SPTG  VACGG+D++CS+++L    D     
Sbjct: 2   GKLMVWDAMTTNKLFAIPLRSSWVMTCAYSPTGNYVACGGVDNICSVYSLRAKEDP---I 58

Query: 567 TVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTAD 746
            V+R L+ H GY+S C+++   ++ +ITSSGD +  LWDI T  + + F     + HT D
Sbjct: 59  KVTRELNAHTGYLSCCRFI--NESEIITSSGDMSLILWDIETVQQCTQF-----ADHTGD 111

Query: 747 VSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTG 926
           V S+++S  N   FVSG+CD TA +WD R   ++ +TF GH+ D+ AV +FPDGN F TG
Sbjct: 112 VMSLALSPENRATFVSGACDATAKVWDKRAKGKSQQTFTGHDSDINAVTYFPDGNAFATG 171

Query: 927 SDDGTCRLFDI 959
           SDD + RLFD+
Sbjct: 172 SDDASGRLFDL 182



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 39/158 (24%), Positives = 61/158 (38%), Gaps = 7/158 (4%)
 Frame = +3

Query: 780  NMFVSGSCDTTACLWDTRVAS---RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
            N    G  D    ++  R      +  R  + H G +   +F  +     T S D +  L
Sbjct: 35   NYVACGGVDNICSVYSLRAKEDPIKVTRELNAHTGYLSCCRFINESEII-TSSGDMSLIL 93

Query: 951  FDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLF-AGYTNGDCYVWDTLLAKMVLNL 1127
            +DI T  Q   ++    D     V S+A S   R  F +G  +    VWD          
Sbjct: 94   WDIETVQQCTQFADHTGD-----VMSLALSPENRATFVSGACDATAKVWDKRAK------ 142

Query: 1128 GSLQNS---HDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            G  Q +   HD  I+ +    DG+A  TGS D + +++
Sbjct: 143  GKSQQTFTGHDSDINAVTYFPDGNAFATGSDDASGRLF 180



>pir|T17256|T17256 hypothetical protein DKFZp586O1922.1 -
            human>gb:HSM800984_1186010 Homo sapiens mRNA; cDNA
            DKFZp586O1922 (from clone DKFZp586O1922).
          Length = 283

 Score =  169 bits (427), Expect = 2e-40
 Identities = 85/199 (42%), Positives = 125/199 (62%), Gaps = 1/199 (0%)
 Frame = +3

Query: 642  LITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNT-NMFVSGSCDTTAC 818
            ++T+SGD TC LWD+ +G     F      GH ADV  + ++ S T N FVSG CD  A 
Sbjct: 98   ILTASGDGTCALWDVESGQLLQSF-----HGHGADVLCLDLAPSETGNTFVSGGCDKKAM 152

Query: 819  LWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPH 998
            +WD R + + V+ F  HE D+ +V+++P G+ F +GSDD TCRL+D+R   ++ +YS+  
Sbjct: 153  VWDMR-SGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSK-- 209

Query: 999  SDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLS 1178
             ++ +   +S+ FS+SGRLLFAGY +    VWD L    V    S+   H+ R+S L +S
Sbjct: 210  -ESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV----SILFGHENRVSTLRVS 264

Query: 1179 GDGSALCTGSWDTTLKIWA 1235
             DG+A C+GSWD TL++WA
Sbjct: 265  PDGTAFCSGSWDHTLRVWA 283



 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 77/240 (32%), Positives = 111/240 (46%), Gaps = 23/240 (9%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF--- 473
           R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K     L  +   TCA    
Sbjct: 57  RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKI----LTASGDGTCALWDV 112

Query: 474 --SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVS------------------RTLSGH 593
                 QS    G D +C    L+L P   GN+ VS                  +    H
Sbjct: 113 ESGQLLQSFHGHGADVLC----LDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETH 168

Query: 594 KGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISAS 773
           +  +++ +Y P+ DA   + S D TC L+D+      +++  E         SSV  S S
Sbjct: 169 ESDINSVRYYPSGDA-FASGSDDATCRLYDLRADREVAIYSKE---SIIFGASSVDFSLS 224

Query: 774 NTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
              +F +G  D T  +WD    SR V    GHE  V  ++  PDG  F +GS D T R++
Sbjct: 225 GRLLF-AGYNDYTINVWDVLKGSR-VSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 282



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 35/129 (27%), Positives = 55/129 (42%)
 Frame = +3

Query: 870  EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISG 1049
            +G VI    F   N+  T S DGTC L+D+ +G  LQ +   H          +A S +G
Sbjct: 84   DGKVIVWDSFTT-NKILTASGDGTCALWDVESGQLLQSF---HGHGADVLCLDLAPSETG 139

Query: 1050 RLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKI 1229
                +G  +    VWD    + V        +H+  I+ +     G A  +GS D T ++
Sbjct: 140  NTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDINSVRYYPSGDAFASGSDDATCRL 195

Query: 1230 WAFGGYRQV 1256
            +     R+V
Sbjct: 196  YDLRADREV 204



>sp|Q00808|HET1_PODAN Vegetatible incompatibility protein
            HET-E-1.>pir|T18521|T18521 beta transducin-like protein -
            Podospora anserina>gb:FLABTLP_1679076 Podospora anserina
            beta transducin-like protein (het-e) gene, het-e-e1
            allele, complete cds.
          Length = 1356

 Score =  152 bits (383), Expect = 2e-35
 Identities = 100/310 (32%), Positives = 152/310 (49%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH G V+S+ ++P++ R+ S S D  + +W+A +   T  ++     V + AFSP 
Sbjct: 877  QTLEGHGGSVWSVAFSPDRERVASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPD 936

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            GQ VA G  D    I++         + T ++TL GH   V +  + P +   + + SGD
Sbjct: 937  GQRVASGSDDHTIKIWDA-------ASGTCTQTLEGHGSSVLSVAFSP-DGQRVASGSGD 988

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WDT  + 
Sbjct: 989  KTIKIWDTASGTCTQTL-----EGHGGSVWSVAFSPDGQRV-ASGSDDKTIKIWDT-ASG 1041

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +T  GH G V +V F PDG R  +GSDD T +++D  +G   Q   + H D+    V
Sbjct: 1042 TCTQTLEGHGGWVQSVVFSPDGQRVASGSDDHTIKIWDAVSGTCTQTL-EGHGDS----V 1096

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+AFS  G+ + +G  +G   +WD         L      H G +  +  S DG  + +
Sbjct: 1097 WSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL----EGHGGWVHSVAFSPDGQRVAS 1152

Query: 1203 GSWDTTLKIW 1232
            GS D T+KIW
Sbjct: 1153 GSIDGTIKIW 1162



 Score =  148 bits (373), Expect = 3e-34
 Identities = 98/312 (31%), Positives = 149/312 (47%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G+V S+ ++P+  R+ S S D  + +W+A +   T  ++   + V++ AFS
Sbjct: 917  CTQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFS 976

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D    I+       +  + T ++TL GH G V +  + P +   + + S
Sbjct: 977  PDGQRVASGSGDKTIKIW-------DTASGTCTQTLEGHGGSVWSVAFSP-DGQRVASGS 1028

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             DKT  +WD  +G  T         GH   V SV  S     +  SGS D T  +WD  V
Sbjct: 1029 DDKTIKIWDTASGTCTQTL-----EGHGGWVQSVVFSPDGQRV-ASGSDDHTIKIWDA-V 1081

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH   V +V F PDG R  +GS DGT +++D  +G   Q       +    
Sbjct: 1082 SGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGG 1136

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS  G+ + +G  +G   +WD         L      H G +  +  S DG  +
Sbjct: 1137 WVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL----EGHGGWVQSVAFSPDGQRV 1192

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+KIW
Sbjct: 1193 ASGSSDKTIKIW 1204



 Score =  142 bits (359), Expect = 1e-32
 Identities = 95/312 (30%), Positives = 146/312 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V S+ ++P+  R+ S S D  + +W+  +   T  ++     V + AFS
Sbjct: 959  CTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGSVWSVAFS 1018

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D    I++         + T ++TL GH G+V +  + P +   + + S
Sbjct: 1019 PDGQRVASGSDDKTIKIWDT-------ASGTCTQTLEGHGGWVQSVVFSP-DGQRVASGS 1070

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   
Sbjct: 1071 DDHTIKIWDAVSGTCTQTL-----EGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDA-A 1123

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH G V +V F PDG R  +GS DGT +++D  +G   Q       +    
Sbjct: 1124 SGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGG 1178

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS  G+ + +G ++    +WDT        L      H G +  +  S DG  +
Sbjct: 1179 WVQSVAFSPDGQRVASGSSDKTIKIWDTASGTCTQTL----EGHGGWVQSVAFSPDGQRV 1234

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+KIW
Sbjct: 1235 ASGSSDNTIKIW 1246



 Score =  133 bits (334), Expect = 1e-29
 Identities = 90/312 (28%), Positives = 142/312 (45%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V S+ ++ +  R+ S S D  + +W+  +   T  ++     V + AFS
Sbjct: 833  CTQTLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFS 892

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P  + VA G  D    I++         + T ++TL GH G V +  + P +   + + S
Sbjct: 893  PDRERVASGSDDKTIKIWDA-------ASGTCTQTLEGHGGRVQSVAFSP-DGQRVASGS 944

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +WD  +G  T         GH + V SV+ S     +  SGS D T  +WDT  
Sbjct: 945  DDHTIKIWDAASGTCTQTL-----EGHGSSVLSVAFSPDGQRV-ASGSGDKTIKIWDT-A 997

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH G V +V F PDG R  +GSDD T +++D  +G   Q       +    
Sbjct: 998  SGTCTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTL-----EGHGG 1052

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+ FS  G+ + +G  +    +WD +       L      H   +  +  S DG  +
Sbjct: 1053 WVQSVVFSPDGQRVASGSDDHTIKIWDAVSGTCTQTL----EGHGDSVWSVAFSPDGQRV 1108

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+KIW
Sbjct: 1109 ASGSIDGTIKIW 1120



 Score =  124 bits (312), Expect = 4e-27
 Identities = 85/281 (30%), Positives = 132/281 (46%), Gaps = 2/281 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G V+S+ ++P+  R+ S S D  + +W+  +   T  ++    WV +  FS
Sbjct: 1001 CTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFS 1060

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D    I++         + T ++TL GH   V +  + P +   + + S
Sbjct: 1061 PDGQRVASGSDDHTIKIWDA-------VSGTCTQTLEGHGDSVWSVAFSP-DGQRVASGS 1112

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   
Sbjct: 1113 IDGTIKIWDAASGTCTQTL-----EGHGGWVHSVAFSPDGQRV-ASGSIDGTIKIWDA-A 1165

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH G V +V F PDG R  +GS D T +++D  +G   Q       +    
Sbjct: 1166 SGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDKTIKIWDTASGTCTQTL-----EGHGG 1220

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTL--LAKMVLNLGS 1133
             V S+AFS  G+ + +G ++    +WDT        LN+GS
Sbjct: 1221 WVQSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGS 1261



>gb:BA000045_744431 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1188

 Score =  146 bits (369), Expect = 9e-34
 Identities = 101/317 (31%), Positives = 156/317 (49%), Gaps = 5/317 (1%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R   GH+G+V+S+ + P+   + S S D  + +W+A T Q    ++    W+ + AF+
Sbjct: 813  CLRTFTGHSGQVWSVSFAPDGQTLASGSLDQTVRIWDAATGQCLRTLQGNAGWIWSVAFA 872

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ++A G LD    I+++        +    RTL+GH  +V +  + P +   L + S
Sbjct: 873  PDGQTLASGSLDRTVRIWDV-------PSGRCVRTLTGHGSWVWSVAFSP-DGRTLASGS 924

Query: 657  GDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
             D+T  LWD  TG  LRT        SGH   V SV+ S     +  SGS D T  LW+ 
Sbjct: 925  FDQTIKLWDAATGQCLRT-------LSGHNNWVRSVAFSPDGRTL-ASGSHDQTVKLWEV 976

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---HQLQVYSQPHS 1001
              + + +RT  GH   V +V F PDG    +GS D T R+++  TG   H L+V S    
Sbjct: 977  S-SGQCLRTLTGHSSWVWSVAFSPDGRTVASGSFDQTVRVWNAATGECLHTLKVDSS--- 1032

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSG 1181
                 +V S+AFS  GR+L  G  N   ++WDT   + +  L      H  ++  +  S 
Sbjct: 1033 -----QVWSVAFSPDGRILAGGSGNYAVWLWDTATGECLRTL----TGHTSQVWSVAFSP 1083

Query: 1182 DGSALCTGSWDTTLKIW 1232
            D   + + S D T+++W
Sbjct: 1084 DSRTVVSSSHDQTVRLW 1100



 Score =  140 bits (353), Expect = 6e-32
 Identities = 95/313 (30%), Positives = 144/313 (46%), Gaps = 1/313 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLI-VWNALTSQKTHAIKLPCAWVMTCAF 473
            C R L GH G VYS+ ++P+   I S+S     + +W+A   Q T   K     + + AF
Sbjct: 644  CLRTLTGHGGWVYSVAFSPDGTLIASSSPSNETVRLWDAAGGQCTRTFKSRTGRMWSVAF 703

Query: 474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
            SP G ++A   LD    ++++              TL+GH   V +  + P +   L + 
Sbjct: 704  SPDGHTLAAASLDRTVKLWDVR-------TGERLGTLTGHTDQVLSVAFSP-DGGVLASG 755

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S D+T  LW++TTG   +       +GHT  + ++S S        S S D T  LWD  
Sbjct: 756  SHDQTLKLWEVTTGTCLTTL-----TGHTGRIRAISFSPDG-EWLASSSLDCTVKLWDA- 808

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
                 +RTF GH G V +V F PDG    +GS D T R++D  TG  L+           
Sbjct: 809  ATGECLRTFTGHSGQVWSVSFAPDGQTLASGSLDQTVRIWDAATGQCLRTL-----QGNA 863

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
              + S+AF+  G+ L +G  +    +WD    + V  L      H   +  +  S DG  
Sbjct: 864  GWIWSVAFAPDGQTLASGSLDRTVRIWDVPSGRCVRTL----TGHGSWVWSVAFSPDGRT 919

Query: 1194 LCTGSWDTTLKIW 1232
            L +GS+D T+K+W
Sbjct: 920  LASGSFDQTIKLW 932



 Score =  136 bits (343), Expect = 9e-31
 Identities = 93/312 (29%), Positives = 152/312 (48%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R  +  TG+++S+ ++P+ + + +AS D  + +W+  T ++   +      V++ AFS
Sbjct: 687  CTRTFKSRTGRMWSVAFSPDGHTLAAASLDRTVKLWDVRTGERLGTLTGHTDQVLSVAFS 746

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  +A G  D    ++ +          T   TL+GH G + A  + P+ +  L +SS
Sbjct: 747  PDGGVLASGSHDQTLKLWEVT-------TGTCLTTLTGHTGRIRAISFSPDGE-WLASSS 798

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  LWD  TG     F     +GH+  V SVS  A +     SGS D T  +WD   
Sbjct: 799  LDCTVKLWDAATGECLRTF-----TGHSGQVWSVSF-APDGQTLASGSLDQTVRIWDA-A 851

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
              + +RT  G+ G + +V F PDG    +GS D T R++D+ +G  ++  +   S     
Sbjct: 852  TGQCLRTLQGNAGWIWSVAFAPDGQTLASGSLDRTVRIWDVPSGRCVRTLTGHGS----- 906

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS  GR L +G  +    +WD    + +  L    + H+  +  +  S DG  L
Sbjct: 907  WVWSVAFSPDGRTLASGSFDQTIKLWDAATGQCLRTL----SGHNNWVRSVAFSPDGRTL 962

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+K+W
Sbjct: 963  ASGSHDQTVKLW 974



 Score =  114 bits (284), Expect = 6e-24
 Identities = 78/303 (25%), Positives = 130/303 (42%)
 Frame = +3

Query: 324  GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACG 503
            G +  + ++P+   +      G + +W     Q+  + +    W+   AFSP G  +A G
Sbjct: 569  GGILFVAYSPKGELLAIGDDSGEVRLWRVRDGQQQLSFRGHTDWISALAFSPDGSVLASG 628

Query: 504  GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWD 683
              D    ++       +       RTL+GH G+V +  + P+      +S  ++T  LWD
Sbjct: 629  SEDQTIKLW-------DTATGQCLRTLTGHGGWVYSVAFSPDGTLIASSSPSNETVRLWD 681

Query: 684  ITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFH 863
               G  T  F        T  + SV+ S    +   + S D T  LWD R   R + T  
Sbjct: 682  AAGGQCTRTF-----KSRTGRMWSVAFSPDG-HTLAAASLDRTVKLWDVRTGER-LGTLT 734

Query: 864  GHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSI 1043
            GH   V++V F PDG    +GS D T +L+++ TG  L   +         R+ +I+FS 
Sbjct: 735  GHTDQVLSVAFSPDGGVLASGSHDQTLKLWEVTTGTCLTTLT-----GHTGRIRAISFSP 789

Query: 1044 SGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTL 1223
             G  L +   +    +WD    + +         H G++  +  + DG  L +GS D T+
Sbjct: 790  DGEWLASSSLDCTVKLWDAATGECLRTF----TGHSGQVWSVSFAPDGQTLASGSLDQTV 845

Query: 1224 KIW 1232
            +IW
Sbjct: 846  RIW 848



 Score =  108 bits (270), Expect = 3e-22
 Identities = 79/277 (28%), Positives = 125/277 (45%), Gaps = 5/277 (1%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L GH   V+S+ ++P+   + S S D  + +W+A T Q    +     WV + AFS
Sbjct: 897  CVRTLTGHGSWVWSVAFSPDGRTLASGSFDQTIKLWDAATGQCLRTLSGHNNWVRSVAFS 956

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS- 653
            P G+++A G  D    ++ ++       +    RTL+GH  +V +  + P  D   + S 
Sbjct: 957  PDGRTLASGSHDQTVKLWEVS-------SGQCLRTLTGHSSWVWSVAFSP--DGRTVASG 1007

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSI----SASNTNMFVSGSCDTTACL 821
            S D+T  +W+  TG          +  HT  V S  +     + +  +   GS +    L
Sbjct: 1008 SFDQTVRVWNAATG----------ECLHTLKVDSSQVWSVAFSPDGRILAGGSGNYAVWL 1057

Query: 822  WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
            WDT      +RT  GH   V +V F PD     + S D T RL+D  TG  L+  +    
Sbjct: 1058 WDT-ATGECLRTLTGHTSQVWSVAFSPDSRTVVSSSHDQTVRLWDAATGECLRTLT---- 1112

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAK 1112
                 +V S+AFS  GR + +G  +    +WD+   K
Sbjct: 1113 -GHTSQVWSVAFSPDGRTVISGSQDETIRLWDSHTGK 1148



 Score =  105 bits (262), Expect = 2e-21
 Identities = 75/231 (32%), Positives = 105/231 (45%), Gaps = 2/231 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L GH   V S+ ++P+   + S S D  + +W   + Q    +    +WV + AFS
Sbjct: 939  CLRTLSGHNNWVRSVAFSPDGRTLASGSHDQTVKLWEVSSGQCLRTLTGHSSWVWSVAFS 998

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G++VA G  D    ++N               TL      V +  + P +   L   S
Sbjct: 999  PDGRTVASGSFDQTVRVWNA-------ATGECLHTLKVDSSQVWSVAFSP-DGRILAGGS 1050

Query: 657  GDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
            G+    LWD  TG  LRT        +GHT+ V SV+ S  +  + VS S D T  LWD 
Sbjct: 1051 GNYAVWLWDTATGECLRTL-------TGHTSQVWSVAFSPDSRTV-VSSSHDQTVRLWDA 1102

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQV 983
                  +RT  GH   V +V F PDG    +GS D T RL+D  TG  L++
Sbjct: 1103 -ATGECLRTLTGHTSQVWSVAFSPDGRTVISGSQDETIRLWDSHTGKPLEL 1152



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 15/48 (31%), Positives = 30/48 (62%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIK 440
            C R L GHT +V+S+ ++P+   ++S SQD  + +W++ T +    ++
Sbjct: 1107 CLRTLTGHTSQVWSVAFSPDGRTVISGSQDETIRLWDSHTGKPLELLR 1154



>gb:AF022086_2051145 Rattus norvegicus guanine nucleotide binding
           protein beta 5 subunit mRNA, partial cds.
          Length = 188

 Score =  146 bits (368), Expect = 1e-33
 Identities = 66/149 (44%), Positives = 98/149 (65%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L+GH  KV  +DW  +K RIVS+SQDG++IVW++ T+ K HA+ +PC WVM CA++P+
Sbjct: 47  RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPS 106

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G ++ACGGLD+ CS++ L     N+  +   ++++ H  Y+SAC +  N D  ++T+SGD
Sbjct: 107 GCAIACGGLDNKCSVYPLTF-DKNENMAAKKKSVAMHTNYLSACSFT-NSDMQILTASGD 164

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADV 749
            TC LWD+ +G     F      GH ADV
Sbjct: 165 GTCALWDVESGQLLQSF-----HGHGADV 188



 Score = 35.4 bits (80), Expect = 2.9
 Identities = 30/130 (23%), Positives = 53/130 (40%), Gaps = 3/130 (2%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            RT  GH   V+ + +  D  R  + S DG   ++D  T ++    + P +      V + 
Sbjct: 47   RTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCT-----WVMAC 101

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNS---HDGRISCLGLSGDGSALCT 1202
            A++ SG  +  G  +  C V+     K   N+ + + S   H   +S    +     + T
Sbjct: 102  AYAPSGCAIACGGLDNKCSVYPLTFDKNE-NMAAKKKSVAMHTNYLSACSFTNSDMQILT 160

Query: 1203 GSWDTTLKIW 1232
             S D T  +W
Sbjct: 161  ASGDGTCALW 170



>gb:AF323584_1786294 Podospora anserina beta transducin-like protein
            HET-E2C*40 (het-e) gene, het-e2C*40 allele, complete cds.
          Length = 1356

 Score =  146 bits (368), Expect = 1e-33
 Identities = 99/310 (31%), Positives = 151/310 (48%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH G V+S+ ++P+  R+ S S D  + +W+A +   T  ++   + V++ AFSP 
Sbjct: 877  QTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPD 936

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            GQ VA G  D    I+       +  + T ++TL GH G V +  + P +   + + SGD
Sbjct: 937  GQRVASGSGDKTIKIW-------DTASGTGTQTLEGHGGSVWSVAFSP-DGQRVASGSGD 988

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WDT  + 
Sbjct: 989  KTIKIWDTASGTCTQTL-----EGHGNSVWSVAFSPDGQRV-ASGSDDKTIKIWDT-ASG 1041

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +T  GH G V +V F PDG R  +GS DGT +++D  +G   Q   + H D     V
Sbjct: 1042 TCTQTLEGHGGWVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-EGHGD----WV 1096

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+AFS  G+ + +G  +    +WD         L      H   +  +  S DG  + +
Sbjct: 1097 QSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTL----EGHGDSVWSVAFSPDGQRVAS 1152

Query: 1203 GSWDTTLKIW 1232
            GS D T+KIW
Sbjct: 1153 GSIDGTIKIW 1162



 Score =  144 bits (364), Expect = 3e-33
 Identities = 96/312 (30%), Positives = 145/312 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V S+ ++P+  R+ S S D  + +W+A +   T  ++     V + AFS
Sbjct: 833  CTQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDAASGTGTQTLEGHGGSVWSVAFS 892

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D    I++         + T ++TL GH   V +  + P +   + + S
Sbjct: 893  PDGQRVASGSDDKTIKIWDA-------ASGTCTQTLEGHGSSVLSVAFSP-DGQRVASGS 944

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            GDKT  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WDT  
Sbjct: 945  GDKTIKIWDTASGTGTQTL-----EGHGGSVWSVAFSPDGQRV-ASGSGDKTIKIWDT-A 997

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH   V +V F PDG R  +GSDD T +++D  +G   Q       +    
Sbjct: 998  SGTCTQTLEGHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTL-----EGHGG 1052

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS  G+ + +G  +G   +WD         L      H   +  +  S DG  +
Sbjct: 1053 WVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL----EGHGDWVQSVAFSPDGQRV 1108

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+KIW
Sbjct: 1109 ASGSDDHTIKIW 1120



 Score =  137 bits (345), Expect = 5e-31
 Identities = 94/310 (30%), Positives = 145/310 (46%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH G V+S+ ++P+  R+ S S D  + +W+  +   T  ++     V + AFSP 
Sbjct: 961  QTLEGHGGSVWSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSVAFSPD 1020

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            GQ VA G  D    I++         + T ++TL GH G+V +  + P +   + + S D
Sbjct: 1021 GQRVASGSDDKTIKIWDT-------ASGTCTQTLEGHGGWVWSVAFSP-DGQRVASGSID 1072

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   + 
Sbjct: 1073 GTIKIWDAASGTCTQTL-----EGHGDWVQSVAFSPDGQRV-ASGSDDHTIKIWDA-ASG 1125

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +T  GH   V +V F PDG R  +GS DGT +++D  +G   Q       +     V
Sbjct: 1126 TCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGGWV 1180

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+AFS  G+ + +G  +G   +WD         L      H G +  +  S DG  + +
Sbjct: 1181 HSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL----EGHGGWVHSVAFSPDGQRVAS 1236

Query: 1203 GSWDTTLKIW 1232
            GS D T+KIW
Sbjct: 1237 GSSDNTIKIW 1246



 Score =  133 bits (334), Expect = 1e-29
 Identities = 86/281 (30%), Positives = 135/281 (48%), Gaps = 2/281 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V+S+ ++P+  R+ S S D  + +W+  +   T  ++    WV + AFS
Sbjct: 1001 CTQTLEGHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFS 1060

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G +D    I++         + T ++TL GH  +V +  + P +   + + S
Sbjct: 1061 PDGQRVASGSIDGTIKIWDA-------ASGTCTQTLEGHGDWVQSVAFSP-DGQRVASGS 1112

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   
Sbjct: 1113 DDHTIKIWDAASGTCTQTL-----EGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDA-A 1165

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH G V +V F PDG R  +GS DGT +++D  +G   Q       +    
Sbjct: 1166 SGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGG 1220

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTL--LAKMVLNLGS 1133
             V S+AFS  G+ + +G ++    +WDT        LN+GS
Sbjct: 1221 WVHSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGS 1261



 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 37/121 (30%), Positives = 64/121 (52%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G V+S+ ++P+  R+ S S DG + +W+A +   T  ++    WV + AFS
Sbjct: 1169 CTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFS 1228

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D+   I+       +  + T ++TL  + G  + C      +A++ T+ 
Sbjct: 1229 PDGQRVASGSSDNTIKIW-------DTASGTCTQTL--NVGSTATCLSFDYTNAYINTNI 1279

Query: 657  G 659
            G
Sbjct: 1280 G 1280



>gb:AF323582_1786292 Podospora anserina beta transducin-like protein
            HET-E2C (het-e) gene, het-e2C allele, complete cds.
          Length = 1356

 Score =  146 bits (368), Expect = 1e-33
 Identities = 99/310 (31%), Positives = 151/310 (48%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH G V+S+ ++P+  R+ S S D  + +W+A +   T  ++   + V++ AFSP 
Sbjct: 877  QTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPD 936

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            GQ VA G  D    I+       +  + T ++TL GH G V +  + P +   + + SGD
Sbjct: 937  GQRVASGSGDKTIKIW-------DTASGTGTQTLEGHGGSVWSVAFSP-DGQRVASGSGD 988

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WDT  + 
Sbjct: 989  KTIKIWDTASGTCTQTL-----EGHGNSVWSVAFSPDGQRV-ASGSDDKTIKIWDT-ASG 1041

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +T  GH G V +V F PDG R  +GS DGT +++D  +G   Q   + H D     V
Sbjct: 1042 TCTQTLEGHGGWVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-EGHGD----WV 1096

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+AFS  G+ + +G  +    +WD         L      H   +  +  S DG  + +
Sbjct: 1097 QSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTL----EGHGDSVWSVAFSPDGQRVAS 1152

Query: 1203 GSWDTTLKIW 1232
            GS D T+KIW
Sbjct: 1153 GSIDGTIKIW 1162



 Score =  143 bits (360), Expect = 1e-32
 Identities = 95/312 (30%), Positives = 144/312 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V S+ ++P+  R+ S S D  + +W+  +   T  ++     V + AFS
Sbjct: 833  CTQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFS 892

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D    I++         + T ++TL GH   V +  + P +   + + S
Sbjct: 893  PDGQRVASGSDDKTIKIWDA-------ASGTCTQTLEGHGSSVLSVAFSP-DGQRVASGS 944

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            GDKT  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WDT  
Sbjct: 945  GDKTIKIWDTASGTGTQTL-----EGHGGSVWSVAFSPDGQRV-ASGSGDKTIKIWDT-A 997

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH   V +V F PDG R  +GSDD T +++D  +G   Q       +    
Sbjct: 998  SGTCTQTLEGHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTL-----EGHGG 1052

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS  G+ + +G  +G   +WD         L      H   +  +  S DG  +
Sbjct: 1053 WVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL----EGHGDWVQSVAFSPDGQRV 1108

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+KIW
Sbjct: 1109 ASGSDDHTIKIW 1120



 Score =  137 bits (345), Expect = 5e-31
 Identities = 94/310 (30%), Positives = 145/310 (46%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH G V+S+ ++P+  R+ S S D  + +W+  +   T  ++     V + AFSP 
Sbjct: 961  QTLEGHGGSVWSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSVAFSPD 1020

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            GQ VA G  D    I++         + T ++TL GH G+V +  + P +   + + S D
Sbjct: 1021 GQRVASGSDDKTIKIWDT-------ASGTCTQTLEGHGGWVWSVAFSP-DGQRVASGSID 1072

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   + 
Sbjct: 1073 GTIKIWDAASGTCTQTL-----EGHGDWVQSVAFSPDGQRV-ASGSDDHTIKIWDA-ASG 1125

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +T  GH   V +V F PDG R  +GS DGT +++D  +G   Q       +     V
Sbjct: 1126 TCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGGWV 1180

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+AFS  G+ + +G  +G   +WD         L      H G +  +  S DG  + +
Sbjct: 1181 HSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL----EGHGGWVHSVAFSPDGQRVAS 1236

Query: 1203 GSWDTTLKIW 1232
            GS D T+KIW
Sbjct: 1237 GSSDNTIKIW 1246



 Score =  133 bits (334), Expect = 1e-29
 Identities = 86/281 (30%), Positives = 135/281 (48%), Gaps = 2/281 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V+S+ ++P+  R+ S S D  + +W+  +   T  ++    WV + AFS
Sbjct: 1001 CTQTLEGHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFS 1060

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G +D    I++         + T ++TL GH  +V +  + P +   + + S
Sbjct: 1061 PDGQRVASGSIDGTIKIWDA-------ASGTCTQTLEGHGDWVQSVAFSP-DGQRVASGS 1112

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   
Sbjct: 1113 DDHTIKIWDAASGTCTQTL-----EGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDA-A 1165

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH G V +V F PDG R  +GS DGT +++D  +G   Q       +    
Sbjct: 1166 SGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGG 1220

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTL--LAKMVLNLGS 1133
             V S+AFS  G+ + +G ++    +WDT        LN+GS
Sbjct: 1221 WVHSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGS 1261



 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 37/121 (30%), Positives = 64/121 (52%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G V+S+ ++P+  R+ S S DG + +W+A +   T  ++    WV + AFS
Sbjct: 1169 CTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFS 1228

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D+   I+       +  + T ++TL  + G  + C      +A++ T+ 
Sbjct: 1229 PDGQRVASGSSDNTIKIW-------DTASGTCTQTL--NVGSTATCLSFDYTNAYINTNI 1279

Query: 657  G 659
            G
Sbjct: 1280 G 1280



>gb:AF323583_1786293 Podospora anserina beta transducin-like protein
            HET-E2C*4 (het-e) gene, het-e2C*4 allele, complete cds.
          Length = 1356

 Score =  145 bits (367), Expect = 2e-33
 Identities = 98/310 (31%), Positives = 152/310 (49%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH G V+S+ ++P+  R+ S S D  + +W+A +   T  ++   + V++ AFSP 
Sbjct: 877  QTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPD 936

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            GQ VA G  D    I+       +  + T ++TL GH G V +  + P +   + + SGD
Sbjct: 937  GQRVASGSGDKTIKIW-------DTASGTGTQTLEGHGGSVWSVAFSP-DGQRVASGSGD 988

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WDT  + 
Sbjct: 989  KTIKIWDTASGTCTQTL-----EGHGNSVWSVAFSPDGQRV-ASGSDDKTIKIWDT-ASG 1041

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +T  GH G V +V F PDG R  +GS+D T +++D  +G   Q   + H D+    V
Sbjct: 1042 TCTQTLEGHGGWVQSVAFSPDGQRVASGSNDHTIKIWDAASGTCTQTL-EGHGDS----V 1096

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+AFS  G+ + +G  +    +WD         L      H   +  +  S DG  + +
Sbjct: 1097 WSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTL----EGHGDSVWSVAFSPDGQRVAS 1152

Query: 1203 GSWDTTLKIW 1232
            GS D T+KIW
Sbjct: 1153 GSIDGTIKIW 1162



 Score =  140 bits (354), Expect = 5e-32
 Identities = 94/310 (30%), Positives = 145/310 (46%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GH G V+S+ ++P+  R+ S S D  + +W+  +   T  ++     V + AFSP 
Sbjct: 961  QTLEGHGGSVWSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSVAFSPD 1020

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            GQ VA G  D    I++         + T ++TL GH G+V +  + P +   + + S D
Sbjct: 1021 GQRVASGSDDKTIKIWDT-------ASGTCTQTLEGHGGWVQSVAFSP-DGQRVASGSND 1072

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   + 
Sbjct: 1073 HTIKIWDAASGTCTQTL-----EGHGDSVWSVAFSPDGQRV-ASGSDDHTIKIWDA-ASG 1125

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +T  GH   V +V F PDG R  +GS DGT +++D  +G   Q       +     V
Sbjct: 1126 TCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGGWV 1180

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S+AFS  G+ + +G  +G   +WD         L      H G +  +  S DG  + +
Sbjct: 1181 HSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL----EGHGGWVHSVAFSPDGQRVAS 1236

Query: 1203 GSWDTTLKIW 1232
            GS D T+KIW
Sbjct: 1237 GSSDNTIKIW 1246



 Score =  140 bits (353), Expect = 6e-32
 Identities = 94/312 (30%), Positives = 143/312 (45%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V S+ ++P+  R+ S S D  + +W+  +   T  ++     V + AFS
Sbjct: 833  CTQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFS 892

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D    I++         + T ++TL GH   V +  + P +   + + S
Sbjct: 893  PDGQRVASGSDDKTIKIWDA-------ASGTCTQTLEGHGSSVLSVAFSP-DGQRVASGS 944

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            GDKT  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WDT  
Sbjct: 945  GDKTIKIWDTASGTGTQTL-----EGHGGSVWSVAFSPDGQRV-ASGSGDKTIKIWDT-A 997

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH   V +V F PDG R  +GSDD T +++D  +G   Q       +    
Sbjct: 998  SGTCTQTLEGHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTL-----EGHGG 1052

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS  G+ + +G  +    +WD         L      H   +  +  S DG  +
Sbjct: 1053 WVQSVAFSPDGQRVASGSNDHTIKIWDAASGTCTQTL----EGHGDSVWSVAFSPDGQRV 1108

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+KIW
Sbjct: 1109 ASGSDDHTIKIW 1120



 Score =  128 bits (322), Expect = 3e-28
 Identities = 86/281 (30%), Positives = 133/281 (47%), Gaps = 2/281 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V+S+ ++P+  R+ S S D  + +W+  +   T  ++    WV + AFS
Sbjct: 1001 CTQTLEGHGNSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVAFS 1060

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D    I++         + T ++TL GH   V +  + P +   + + S
Sbjct: 1061 PDGQRVASGSNDHTIKIWDA-------ASGTCTQTLEGHGDSVWSVAFSP-DGQRVASGS 1112

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +WD  +G  T         GH   V SV+ S     +  SGS D T  +WD   
Sbjct: 1113 DDHTIKIWDAASGTCTQTL-----EGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDA-A 1165

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +    +T  GH G V +V F PDG R  +GS DGT +++D  +G   Q       +    
Sbjct: 1166 SGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTL-----EGHGG 1220

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTL--LAKMVLNLGS 1133
             V S+AFS  G+ + +G ++    +WDT        LN+GS
Sbjct: 1221 WVHSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGS 1261



 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 37/121 (30%), Positives = 64/121 (52%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G V+S+ ++P+  R+ S S DG + +W+A +   T  ++    WV + AFS
Sbjct: 1169 CTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFS 1228

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ VA G  D+   I+       +  + T ++TL  + G  + C      +A++ T+ 
Sbjct: 1229 PDGQRVASGSSDNTIKIW-------DTASGTCTQTL--NVGSTATCLSFDYTNAYINTNI 1279

Query: 657  G 659
            G
Sbjct: 1280 G 1280



>gb:MMGPRBSU_2115087 M.musculus mRNA for G-protein beta-subunit.
          Length = 123

 Score =  145 bits (365), Expect = 3e-33
 Identities = 65/126 (51%), Positives = 92/126 (73%)
 Frame = +3

Query: 336 SLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDS 515
           ++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+G  VACGGLD+
Sbjct: 1   AMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDN 60

Query: 516 VCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTG 695
           +CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD TC LWDI TG
Sbjct: 61  ICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGDTTCALWDIETG 115

Query: 696 LRTSVF 713
            +T+ F
Sbjct: 116 QQTTTF 121



>pir|S29121|S29121 GTP-binding regulatory protein beta chain - mouse
           (fragment)
          Length = 123

 Score =  145 bits (365), Expect = 3e-33
 Identities = 65/126 (51%), Positives = 92/126 (73%)
 Frame = +3

Query: 336 SLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDS 515
           ++ W  +   +VSASQDG+LI+W++ T+ K HAI L  +WVMTCA++P+G  VACGGLD+
Sbjct: 1   AMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDN 60

Query: 516 VCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTG 695
           +CSI+NL      +GN  VSR L+GH GY+S C+++  +D  ++TSSGD TC LWDI TG
Sbjct: 61  ICSIYNLK---TREGNVRVSRELAGHTGYLSCCRFL--DDNQIVTSSGDTTCALWDIETG 115

Query: 696 LRTSVF 713
            +T+ F
Sbjct: 116 QQTTTF 121



>gb:BA000045_742040 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1197

 Score =  142 bits (358), Expect = 2e-32
 Identities = 98/316 (31%), Positives = 151/316 (47%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R LQGH   ++S+ +  +   + S S D  + +W+  T Q   +++   +WV T AFS
Sbjct: 853  CLRVLQGHGSGIWSVAFRGDGKTLASGSIDHSVRLWDFSTRQPMRSLQAHTSWVRTVAFS 912

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  +A  G D    +++    PD+       +TL GH G+V++  + PN  A L +SS
Sbjct: 913  PDGTLLASSGQDRTIKLWD----PDS---GRCLKTLRGHTGWVNSLAFSPN-GALLASSS 964

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D +  +W++ TG    +       GHT+ V SV+       +  S S D TA LWD   
Sbjct: 965  VDHSLRIWNVETGQCLGML-----QGHTSWVRSVAFHPDG-RVLASASQDKTARLWDIET 1018

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
              R + T  GH   V +V F PDG+   +GSDDGT +L+D++TG      S   S     
Sbjct: 1019 G-RCLWTLQGHTSWVRSVAFHPDGHTLASGSDDGTVKLWDVQTGRLADSLSGHGSG---- 1073

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+ F+  G+ L +G  +    +WDT   +    L    N H   + C+ +  D   L
Sbjct: 1074 -VWSVVFAADGKRLASGGDDKTVRLWDTTSMQCTHVL----NRHASGVLCVAIEADSRIL 1128

Query: 1197 CTGSWDTTLKIWAFGG 1244
             + S D T+ +W   G
Sbjct: 1129 ASSSADETITLWDLQG 1144



 Score =  124 bits (310), Expect = 6e-27
 Identities = 86/314 (27%), Positives = 149/314 (47%), Gaps = 2/314 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   L+GH+G ++++ ++P    + S+SQDG++ +W+  + +   A++    WV + AF+
Sbjct: 685  CLLTLRGHSGWIHAVRFSPNGQWLASSSQDGKIQLWHPESGEPLQAMQGHTGWVRSIAFA 744

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ++  G  D    ++++           + + L GH G+V +  +   +   L + S
Sbjct: 745  PDGQTLISGSDDQTLRLWDVQ-------RGLLLKCLQGHTGWVRSVDF-SADGRTLASGS 796

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+T  LWD  +GL   V       GH+  +SSV  S     +  SGS D +  +W+   
Sbjct: 797  DDQTVRLWDADSGLCFRV-----MHGHSNWISSVVFSPDG-RLLTSGSVDHSVRIWEIS- 849

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +   +R   GH   + +V F  DG    +GS D + RL+D  T        QP    + H
Sbjct: 850  SGHCLRVLQGHGSGIWSVAFRGDGKTLASGSIDHSVRLWDFST-------RQPMRSLQAH 902

Query: 1017 R--VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V ++AFS  G LL +   +    +WD    + +  L      H G ++ L  S +G+
Sbjct: 903  TSWVRTVAFSPDGTLLASSGQDRTIKLWDPDSGRCLKTL----RGHTGWVNSLAFSPNGA 958

Query: 1191 ALCTGSWDTTLKIW 1232
             L + S D +L+IW
Sbjct: 959  LLASSSVDHSLRIW 972



 Score =  121 bits (303), Expect = 4e-26
 Identities = 94/316 (29%), Positives = 146/316 (46%)
 Frame = +3

Query: 291  LVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCA 470
            L  CR   GHT  V+S+ ++P+   + S S D  + +W+  T Q     +    WV + A
Sbjct: 602  LAYCR---GHTSWVWSIAFSPDGRVLASGSADRTVRLWDYRTGQCLKVFQGHEGWVRSVA 658

Query: 471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT 650
            F P G  +A G  D+   ++ ++       +     TL GH G++ A ++ PN    L +
Sbjct: 659  FHPGGGILASGSEDAAVRLWEVD-------SGRCLLTLRGHSGWIHAVRFSPN-GQWLAS 710

Query: 651  SSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
            SS D    LW   +G        +   GHT  V S++  A +    +SGS D T  LWD 
Sbjct: 711  SSQDGKIQLWHPESGEPL-----QAMQGHTGWVRSIAF-APDGQTLISGSDDQTLRLWDV 764

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            +     ++   GH G V +V F  DG    +GSDD T RL+D  +G   +V    HS   
Sbjct: 765  Q-RGLLLKCLQGHTGWVRSVDFSADGRTLASGSDDQTVRLWDADSGLCFRV-MHGHS--- 819

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
             + ++S+ FS  GRLL +G  +    +W+      +  L      H   I  +   GDG 
Sbjct: 820  -NWISSVVFSPDGRLLTSGSVDHSVRIWEISSGHCLRVL----QGHGSGIWSVAFRGDGK 874

Query: 1191 ALCTGSWDTTLKIWAF 1238
             L +GS D ++++W F
Sbjct: 875  TLASGSIDHSVRLWDF 890



 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 72/242 (29%), Positives = 110/242 (45%), Gaps = 1/242 (0%)
 Frame = +3

Query: 255  QGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHA 434
            Q +T   + P    C + L+GHTG V SL ++P    + S+S D  L +WN  T Q    
Sbjct: 923  QDRTIKLWDPDSGRCLKTLRGHTGWVNSLAFSPNGALLASSSVDHSLRIWNVETGQCLGM 982

Query: 435  IKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSAC 614
            ++   +WV + AF P G+ +A    D    ++++              TL GH  +V + 
Sbjct: 983  LQGHTSWVRSVAFHPDGRVLASASQDKTARLWDIE-------TGRCLWTLQGHTSWVRSV 1035

Query: 615  QYVPNEDAHLITS-SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFV 791
             + P  D H + S S D T  LWD+ TG        +  SGH + V SV + A++     
Sbjct: 1036 AFHP--DGHTLASGSDDGTVKLWDVQTGRL-----ADSLSGHGSGVWSV-VFAADGKRLA 1087

Query: 792  SGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGH 971
            SG  D T  LWDT  + +     + H   V+ V    D     + S D T  L+D++ G+
Sbjct: 1088 SGGDDKTVRLWDT-TSMQCTHVLNRHASGVLCVAIEADSRILASSSADETITLWDLQGGN 1146

Query: 972  QL 977
             L
Sbjct: 1147 YL 1148



 Score = 41.6 bits (96), Expect = 0.041
 Identities = 24/85 (28%), Positives = 40/85 (47%)
 Frame = +3

Query: 984  YSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRIS 1163
            +SQ      +  V+S+AFS  G+LL     NG   +W    A+ +    +    H   + 
Sbjct: 558  FSQSIFTEALSTVSSVAFSPDGQLLATSEINGTIRLWQAADAQQL----AYCRGHTSWVW 613

Query: 1164 CLGLSGDGSALCTGSWDTTLKIWAF 1238
             +  S DG  L +GS D T+++W +
Sbjct: 614  SIAFSPDGRVLASGSADRTVRLWDY 638



>sp|Q8YRI1|YY46_ANASP Hypothetical WD-repeat protein
            alr3466.>pir|AC2239|AC2239 WD-40 repeat protein
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_684455 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1526

 Score =  139 bits (349), Expect = 2e-31
 Identities = 93/312 (29%), Positives = 153/312 (49%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   LQGHT  V ++ ++P+   + S S D  + +W+  +S+  + ++   +WV +  F+
Sbjct: 1150 CLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFN 1209

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G ++A G  D    ++ +N       +S    T  GH  +V++  + P + + L + S
Sbjct: 1210 PDGSTLASGSSDQTVRLWEIN-------SSKCLCTFQGHTSWVNSVVFNP-DGSMLASGS 1261

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             DKT  LWDI++      F      GHT  V+SV+ +    +M  SGS D T  LW+   
Sbjct: 1262 SDKTVRLWDISSSKCLHTF-----QGHTNWVNSVAFNPDG-SMLASGSGDQTVRLWEIS- 1314

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +S+ + TF GH   V +V F PDG    +GSDD T RL+ I +G  L  +         +
Sbjct: 1315 SSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFL-----GHTN 1369

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+ FS  G +L +G  +    +W     K +  L      H+  +  +  S DG+ L
Sbjct: 1370 WVGSVIFSPDGAILASGSGDQTVRLWSISSGKCLYTL----QGHNNWVGSIVFSPDGTLL 1425

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+++W
Sbjct: 1426 ASGSDDQTVRLW 1437



 Score =  136 bits (342), Expect = 1e-30
 Identities = 93/313 (29%), Positives = 158/313 (50%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   LQGHT  V S+ ++P+   + S   D  + +W+  +    + ++   +WV    FS
Sbjct: 1066 CLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFS 1125

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G ++A G  D +  +++++       +     TL GH  +V+A  + P + A L + S
Sbjct: 1126 PNGVTLANGSSDQIVRLWDIS-------SKKCLYTLQGHTNWVNAVAFSP-DGATLASGS 1177

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            GD+T  LWDI++     +       GHT+ V+SV  +   + +  SGS D T  LW+   
Sbjct: 1178 GDQTVRLWDISSSKCLYIL-----QGHTSWVNSVVFNPDGSTL-ASGSSDQTVRLWEIN- 1230

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            +S+ + TF GH   V +V F PDG+   +GS D T RL+DI +   L  + Q H+    +
Sbjct: 1231 SSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISSSKCLHTF-QGHT----N 1285

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AF+  G +L +G  +    +W+   +K +         H   +S +  S DG+ L
Sbjct: 1286 WVNSVAFNPDGSMLASGSGDQTVRLWEISSSKCLHTF----QGHTSWVSSVTFSPDGTML 1341

Query: 1197 CTGSWDTTLKIWA 1235
             +GS D T+++W+
Sbjct: 1342 ASGSDDQTVRLWS 1354



 Score =  131 bits (329), Expect = 4e-29
 Identities = 102/335 (30%), Positives = 157/335 (46%), Gaps = 1/335 (0%)
 Frame = +3

Query: 231  DVATYARSQGKTPISFGP-TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN 407
            D AT A   G   +     +   C   LQGHT  V S+ + P+ + + S S D  + +W 
Sbjct: 1169 DGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWE 1228

Query: 408  ALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLS 587
              +S+     +   +WV +  F+P G  +A G  D    +++++       +S    T  
Sbjct: 1229 INSSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDIS-------SSKCLHTFQ 1281

Query: 588  GHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSIS 767
            GH  +V++  + P + + L + SGD+T  LW+I++      F      GHT+ VSSV+ S
Sbjct: 1282 GHTNWVNSVAFNP-DGSMLASGSGDQTVRLWEISSSKCLHTF-----QGHTSWVSSVTFS 1335

Query: 768  ASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCR 947
               T M  SGS D T  LW    +   + TF GH   V +V F PDG    +GS D T R
Sbjct: 1336 PDGT-MLASGSDDQTVRLWSIS-SGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVR 1393

Query: 948  LFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            L+ I +G  L    Q H++     V SI FS  G LL +G  +    +W+    + +  L
Sbjct: 1394 LWSISSGKCLYTL-QGHNN----WVGSIVFSPDGTLLASGSDDQTVRLWNISSGECLYTL 1448

Query: 1128 GSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                + H   +  +  S DG  L +GS D T+K+W
Sbjct: 1449 ----HGHINSVRSVAFSSDGLILASGSDDETIKLW 1479



 Score =  118 bits (295), Expect = 3e-25
 Identities = 83/279 (29%), Positives = 129/279 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C    QGHT  V S+ + P+ + + S S D  + +W+  +S+  H  +    WV + AF+
Sbjct: 1234 CLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFN 1293

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  +A G  D    ++ ++       +S    T  GH  +VS+  + P +   L + S
Sbjct: 1294 PDGSMLASGSGDQTVRLWEIS-------SSKCLHTFQGHTSWVSSVTFSP-DGTMLASGS 1345

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+T  LW I++G     F      GHT  V SV  S     +  SGS D T  LW    
Sbjct: 1346 DDQTVRLWSISSGECLYTF-----LGHTNWVGSVIFSPDGA-ILASGSGDQTVRLWSIS- 1398

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            + + + T  GH   V ++ F PDG    +GSDD T RL++I +G  L           ++
Sbjct: 1399 SGKCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWNISSGECLYTL-----HGHIN 1453

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGS 1133
             V S+AFS  G +L +G  +    +WD    + +  L S
Sbjct: 1454 SVRSVAFSSDGLILASGSDDETIKLWDVKTGECIKTLKS 1492



 Score =  114 bits (284), Expect = 6e-24
 Identities = 91/319 (28%), Positives = 147/319 (46%), Gaps = 4/319 (1%)
 Frame = +3

Query: 288  DLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC 467
            +L+ C+   GH   V S+ ++ +   + S S D  + +W+  + Q     K   + V + 
Sbjct: 898  ELLTCK---GHNSWVNSVGFSQDGKMLASGSDDQTVRLWDISSGQCLKTFKGHTSRVRSV 954

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
             FSP    +A G  D    +++++       +        GH G+V +  +  N D  ++
Sbjct: 955  VFSPNSLMLASGSSDQTVRLWDIS-------SGECLYIFQGHTGWVYSVAF--NLDGSML 1005

Query: 648  -TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW 824
             T SGD+T  LWDI++     +F      GHT+ V SV + +S+  M  SGS D T  LW
Sbjct: 1006 ATGSGDQTVRLWDISSSQCFYIF-----QGHTSCVRSV-VFSSDGAMLASGSDDQTVRLW 1059

Query: 825  DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---HQLQVYSQP 995
            D   +   + T  GH   V +V F PDG    +G DD   RL+DI +G   + LQ Y+  
Sbjct: 1060 DIS-SGNCLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYTS- 1117

Query: 996  HSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGL 1175
                    V  + FS +G  L  G ++    +WD    K +  L      H   ++ +  
Sbjct: 1118 -------WVRFLVFSPNGVTLANGSSDQIVRLWDISSKKCLYTL----QGHTNWVNAVAF 1166

Query: 1176 SGDGSALCTGSWDTTLKIW 1232
            S DG+ L +GS D T+++W
Sbjct: 1167 SPDGATLASGSGDQTVRLW 1185



 Score =  109 bits (273), Expect = 1e-22
 Identities = 86/303 (28%), Positives = 137/303 (45%)
 Frame = +3

Query: 324  GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACG 503
            G V ++ ++P+     +    G +  W A T ++    K   +WV +  FS  G+ +A G
Sbjct: 865  GSVLTVAFSPDGKLFATGDSGGIVRFWEAATGKELLTCKGHNSWVNSVGFSQDGKMLASG 924

Query: 504  GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWD 683
              D    +++++       +    +T  GH   V +  + PN    L + S D+T  LWD
Sbjct: 925  SDDQTVRLWDIS-------SGQCLKTFKGHTSRVRSVVFSPN-SLMLASGSSDQTVRLWD 976

Query: 684  ITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFH 863
            I++G    +F      GHT  V SV+ +    +M  +GS D T  LWD   +S+    F 
Sbjct: 977  ISSGECLYIF-----QGHTGWVYSVAFNLDG-SMLATGSGDQTVRLWDIS-SSQCFYIFQ 1029

Query: 864  GHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSI 1043
            GH   V +V F  DG    +GSDD T RL+DI +G+ L    Q H+      V S+ FS 
Sbjct: 1030 GHTSCVRSVVFSSDGAMLASGSDDQTVRLWDISSGNCLYTL-QGHTS----CVRSVVFSP 1084

Query: 1044 SGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTL 1223
             G +L +G  +    +WD      +  L      +   +  L  S +G  L  GS D  +
Sbjct: 1085 DGAMLASGGDDQIVRLWDISSGNCLYTL----QGYTSWVRFLVFSPNGVTLANGSSDQIV 1140

Query: 1224 KIW 1232
            ++W
Sbjct: 1141 RLW 1143



 Score =  105 bits (263), Expect = 2e-21
 Identities = 88/348 (25%), Positives = 152/348 (43%), Gaps = 36/348 (10%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C +  +GHT +V S+ ++P    + S S D  + +W+  + +  +  +    WV + AF+
Sbjct: 940  CLKTFKGHTSRVRSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFN 999

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
              G  +A G  D    +++++       +S       GH   V +  +  ++ A L + S
Sbjct: 1000 LDGSMLATGSGDQTVRLWDIS-------SSQCFYIFQGHTSCVRSVVF-SSDGAMLASGS 1051

Query: 657  GDKTCGLWDITTG------------LRTSVF---------GGEYQSGHTADVSSVS---- 761
             D+T  LWDI++G            +R+ VF         GG+ Q     D+SS +    
Sbjct: 1052 DDQTVRLWDISSGNCLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISSGNCLYT 1111

Query: 762  -----------ISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDG 908
                       + + N     +GS D    LWD   + + + T  GH   V AV F PDG
Sbjct: 1112 LQGYTSWVRFLVFSPNGVTLANGSSDQIVRLWDIS-SKKCLYTLQGHTNWVNAVAFSPDG 1170

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
                +GS D T RL+DI +   L +  Q H+      V S+ F+  G  L +G ++    
Sbjct: 1171 ATLASGSGDQTVRLWDISSSKCLYIL-QGHTS----WVNSVVFNPDGSTLASGSSDQTVR 1225

Query: 1089 VWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            +W+   +K +         H   ++ +  + DGS L +GS D T+++W
Sbjct: 1226 LWEINSSKCLCTF----QGHTSWVNSVVFNPDGSMLASGSSDKTVRLW 1269



>gb:AF070597_1880751 Homo sapiens clone 24596 beta-subunit signal
            transducing proteins GS/GI mRNA, partial cds.
          Length = 127

 Score =  138 bits (347), Expect = 3e-31
 Identities = 67/127 (52%), Positives = 86/127 (67%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            +TF GHE D+ A+ FFP+GN F TGSDD TCRLFD+R   +L  YS    DN +  +TS+
Sbjct: 7    QTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSH---DNIICGITSV 63

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            +FS SGRLL AGY + +C VWD L A    +   +   HD R+SCLG++ DG A+ TGSW
Sbjct: 64   SFSKSGRLLLAGYDDFNCNVWDALKA----DRAGVLAGHDNRVSCLGVTDDGMAVATGSW 119

Query: 1212 DTTLKIW 1232
            D+ LKIW
Sbjct: 120  DSFLKIW 126



 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 35/127 (27%), Positives = 57/127 (44%)
 Frame = +3

Query: 576 RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
           +T +GH+  ++A  + PN +A   T S D TC L+D+        +           ++S
Sbjct: 7   QTFTGHESDINAICFFPNGNA-FATGSDDATCRLFDLRADQELMTYS---HDNIICGITS 62

Query: 756 VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
           VS S S   + ++G  D    +WD   A RA     GH+  V  +    DG    TGS D
Sbjct: 63  VSFSKSG-RLLLAGYDDFNCNVWDALKADRA-GVLAGHDNRVSCLGVTDDGMAVATGSWD 120

Query: 936 GTCRLFD 956
              ++++
Sbjct: 121 SFLKIWN 127



>gb:BA000045_744426 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1184

 Score =  137 bits (345), Expect = 5e-31
 Identities = 98/323 (30%), Positives = 152/323 (47%), Gaps = 3/323 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + LQ HT +V+S+ + P+ + + S S    + +W+  + Q    ++     V+  AFS
Sbjct: 809  CLKTLQEHTDQVFSIAFHPQGHTLASGSPTQTVKLWDTESGQCLRTLQGKTVTVLAVAFS 868

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ++  G  D +  ++++            +R L GH   V+     P  D   + S+
Sbjct: 869  PHGQTLVSGSDDRLVRLWDVR-------TGECTRVLRGHLRGVTTVAVAP--DGRTLASA 919

Query: 657  G-DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            G D +  +WD  +G  LRT          HT  + SV+  A +  +  SGS D TA LWD
Sbjct: 920  GADLSVKIWDALSGQCLRTL-------REHTGSIRSVAF-APDGRLLASGSQDGTAKLWD 971

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
                 R V T  GH   + +V F PDG    +GS DGT R++D RTG  LQ+ +      
Sbjct: 972  PGTG-RCVATLRGHTSWIRSVAFAPDGGLLASGSQDGTARIWDTRTGECLQILA-----G 1025

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
              + + S+AFS+ G+LL +G  +    +W+      +  L        G +  L  S DG
Sbjct: 1026 HTYLICSVAFSLDGQLLASGSQDQTIRLWEVQTGACLRTL----TEKTGMVFSLAFSPDG 1081

Query: 1188 SALCTGSWDTTLKIWAFGGYRQV 1256
              L +GS D T+K+W  G  R V
Sbjct: 1082 QILASGSNDMTVKLWQVGTGRCV 1104



 Score =  135 bits (341), Expect = 2e-30
 Identities = 100/322 (31%), Positives = 148/322 (45%), Gaps = 2/322 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   LQGHTG V+S+ + P+ + + SA QD  + +W+A T +    ++     + +  FS
Sbjct: 683  CLATLQGHTGVVHSVAFAPDGSLLASAGQDSTVKLWDAATGRCLATLQGHTEPIRSVVFS 742

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  +A    D    ++       N        TL+GH  +VSA  + P +   L T S
Sbjct: 743  PDGHRLASASHDRTVKLW-------NPATGRCLATLAGHGDWVSAVAFAP-DGRSLATGS 794

Query: 657  GDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
             D+T  LW+  TG  L+T          HT  V S++      +   SGS   T  LWDT
Sbjct: 795  LDRTVRLWETITGQCLKT-------LQEHTDQVFSIAFHPQG-HTLASGSPTQTVKLWDT 846

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
              + + +RT  G    V+AV F P G    +GSDD   RL+D+RTG   +V         
Sbjct: 847  E-SGQCLRTLQGKTVTVLAVAFSPHGQTLVSGSDDRLVRLWDVRTGECTRVLR-----GH 900

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
            +  VT++A +  GR L +   +    +WD L  + +  L      H G I  +  + DG 
Sbjct: 901  LRGVTTVAVAPDGRTLASAGADLSVKIWDALSGQCLRTL----REHTGSIRSVAFAPDGR 956

Query: 1191 ALCTGSWDTTLKIWAFGGYRQV 1256
             L +GS D T K+W  G  R V
Sbjct: 957  LLASGSQDGTAKLWDPGTGRCV 978



 Score =  127 bits (319), Expect = 6e-28
 Identities = 98/308 (31%), Positives = 136/308 (44%), Gaps = 1/308 (0%)
 Frame = +3

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            QGHT  V ++ + P      SASQDG + +W+A   Q    ++    WV + AF+P G  
Sbjct: 604  QGHTDWVCAVAFAPNGQTFASASQDGTVKLWDARIGQCLATLRGHIGWVRSAAFAPDGSL 663

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG-DKT 668
            +A  G DS   +++               TL GH G V +  + P  D  L+ S+G D T
Sbjct: 664  LASAGQDSTVKLWDA-------ATGRCLATLQGHTGVVHSVAFAP--DGSLLASAGQDST 714

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD  TG   +        GHT  + SV  S    +   S S D T  LW+     R 
Sbjct: 715  VKLWDAATGRCLATL-----QGHTEPIRSVVFSPDG-HRLASASHDRTVKLWNP-ATGRC 767

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T  GH   V AV F PDG    TGS D T RL++  TG  L+   Q H+D    +V S
Sbjct: 768  LATLAGHGDWVSAVAFAPDGRSLATGSLDRTVRLWETITGQCLKTL-QEHTD----QVFS 822

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            IAF   G  L +G       +WDT   + +  L          +  +  S  G  L +GS
Sbjct: 823  IAFHPQGHTLASGSPTQTVKLWDTESGQCLRTL----QGKTVTVLAVAFSPHGQTLVSGS 878

Query: 1209 WDTTLKIW 1232
             D  +++W
Sbjct: 879  DDRLVRLW 886



 Score =  125 bits (314), Expect = 2e-27
 Identities = 99/336 (29%), Positives = 156/336 (46%), Gaps = 10/336 (2%)
 Frame = +3

Query: 255  QGKTPISFGPTDLV---------CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN 407
            QG T  S  PT  V         C R LQG T  V ++ ++P    +VS S D  + +W+
Sbjct: 828  QGHTLASGSPTQTVKLWDTESGQCLRTLQGKTVTVLAVAFSPHGQTLVSGSDDRLVRLWD 887

Query: 408  ALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLS 587
              T + T  ++     V T A +P G+++A  G D    I++         +    RTL 
Sbjct: 888  VRTGECTRVLRGHLRGVTTVAVAPDGRTLASAGADLSVKIWDAL-------SGQCLRTLR 940

Query: 588  GHKGYVSACQYVPNEDAHLITS-SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSI 764
             H G + +  + P  D  L+ S S D T  LWD  TG   +        GHT+ + SV+ 
Sbjct: 941  EHTGSIRSVAFAP--DGRLLASGSQDGTAKLWDPGTGRCVATL-----RGHTSWIRSVAF 993

Query: 765  SASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTC 944
             A +  +  SGS D TA +WDTR     ++   GH   + +V F  DG    +GS D T 
Sbjct: 994  -APDGGLLASGSQDGTARIWDTRTGE-CLQILAGHTYLICSVAFSLDGQLLASGSQDQTI 1051

Query: 945  RLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLN 1124
            RL++++TG  L+  ++     +   V S+AFS  G++L +G  +    +W     + V  
Sbjct: 1052 RLWEVQTGACLRTLTE-----KTGMVFSLAFSPDGQILASGSNDMTVKLWQVGTGRCVKT 1106

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            LG     H   +  +  + DGS L + S D T++++
Sbjct: 1107 LG----PHTSLVVSIAYAPDGSTLASASLDETIRLF 1138



 Score =  124 bits (312), Expect = 4e-27
 Identities = 91/322 (28%), Positives = 147/322 (45%), Gaps = 1/322 (0%)
 Frame = +3

Query: 270  ISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            ++F  TDL  C   Q   G V+S+ ++P+  +I     +  + +W A   Q+  + +   
Sbjct: 549  VNFSHTDLARCVFAQNFGG-VFSVAFSPDGEQIAVGDDNSEIRLWRAADGQQQLSCQGHT 607

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
             WV   AF+P GQ+ A    D    +++  +            TL GH G+V +  + P 
Sbjct: 608  DWVCAVAFAPNGQTFASASQDGTVKLWDARI-------GQCLATLRGHIGWVRSAAFAP- 659

Query: 630  EDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
             D  L+ S+G D T  LWD  TG   +        GHT  V SV+  A + ++  S   D
Sbjct: 660  -DGSLLASAGQDSTVKLWDAATGRCLATL-----QGHTGVVHSVAF-APDGSLLASAGQD 712

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
            +T  LWD     R + T  GH   + +V F PDG+R  + S D T +L++  TG  L   
Sbjct: 713  STVKLWDA-ATGRCLATLQGHTEPIRSVVFSPDGHRLASASHDRTVKLWNPATGRCLATL 771

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
            +  H D     V+++AF+  GR L  G  +    +W+T+  + +  L      H  ++  
Sbjct: 772  A-GHGD----WVSAVAFAPDGRSLATGSLDRTVRLWETITGQCLKTL----QEHTDQVFS 822

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
            +     G  L +GS   T+K+W
Sbjct: 823  IAFHPQGHTLASGSPTQTVKLW 844



 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 70/234 (29%), Positives = 110/234 (47%), Gaps = 3/234 (1%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L+ HTG + S+ + P+   + S SQDG   +W+  T +    ++   +W+ + AF+
Sbjct: 935  CLRTLREHTGSIRSVAFAPDGRLLASGSQDGTAKLWDPGTGRCVATLRGHTSWIRSVAFA 994

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS- 653
            P G  +A G  D    I++              + L+GH   +  C    + D  L+ S 
Sbjct: 995  PDGGLLASGSQDGTARIWDTR-------TGECLQILAGHTYLI--CSVAFSLDGQLLASG 1045

Query: 654  SGDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            S D+T  LW++ TG  LRT        +  T  V S++ S     +  SGS D T  LW 
Sbjct: 1046 SQDQTIRLWEVQTGACLRT-------LTEKTGMVFSLAFSPDG-QILASGSNDMTVKLWQ 1097

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS 989
                 R V+T   H   V+++ + PDG+   + S D T RLFD  TG  L+ ++
Sbjct: 1098 VG-TGRCVKTLGPHTSLVVSIAYAPDGSTLASASLDETIRLFDPATGACLRRFT 1150



 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 51/192 (26%), Positives = 81/192 (42%)
 Frame = +3

Query: 252  SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTH 431
            SQ  T   + P    C   L+GHT  + S+ + P+   + S SQDG   +W+  T +   
Sbjct: 962  SQDGTAKLWDPGTGRCVATLRGHTSWIRSVAFAPDGGLLASGSQDGTARIWDTRTGECLQ 1021

Query: 432  AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA 611
             +      + + AFS  GQ +A G  D    ++ +             RTL+   G V +
Sbjct: 1022 ILAGHTYLICSVAFSLDGQLLASGSQDQTIRLWEVQ-------TGACLRTLTEKTGMVFS 1074

Query: 612  CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFV 791
              + P+    L + S D T  LW + TG      G      HT+ V S++ +   + +  
Sbjct: 1075 LAFSPDGQI-LASGSNDMTVKLWQVGTGRCVKTLG-----PHTSLVVSIAYAPDGSTL-A 1127

Query: 792  SGSCDTTACLWD 827
            S S D T  L+D
Sbjct: 1128 SASLDETIRLFD 1139



>gb:AF323585_1786295 Podospora anserina beta transducin-like protein
            HET-D2Y (het-d) gene, het-d2Y allele, complete cds.
          Length = 1376

 Score =  136 bits (342), Expect = 1e-30
 Identities = 93/312 (29%), Positives = 145/312 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G VYS+ ++P+   +VS S D  + +W A T   T  ++    WV + AFS
Sbjct: 907  CTQTLEGHGGWVYSVAFSPDSKWVVSGSADSTIKIWEAATGSCTQTLEGHGGWVWSVAFS 966

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P  + VA G  DS   I+            + ++TL GH G V++  + P +   + + S
Sbjct: 967  PDSKWVASGSADSTIKIWEA-------ATGSCTQTLEGHGGPVNSVAFSP-DSKWVASGS 1018

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +W+  TG  T         GH   V+SV+ S  ++    SGS D T  +W+   
Sbjct: 1019 DDHTIKIWEAATGSCTQTL-----EGHGGPVNSVTFS-PDSKWVASGSDDHTIKIWEAAT 1072

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
             S   +T  GH G V +V F PD     +GS D T ++++  TG   Q   + H  +   
Sbjct: 1073 GS-CTQTLEGHGGWVYSVAFSPDSKWVVSGSADSTIKIWEAATGSCTQTL-EGHGGS--- 1127

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS   + + +G T+    +W+         L      H G    +  S D   +
Sbjct: 1128 -VNSVAFSPDSKWVASGSTDRTIKIWEAATGSCTQTL----EGHGGWAWSVAFSPDSKWV 1182

Query: 1197 CTGSWDTTLKIW 1232
             +GS D+T+KIW
Sbjct: 1183 ASGSADSTIKIW 1194



 Score =  135 bits (341), Expect = 2e-30
 Identities = 88/312 (28%), Positives = 143/312 (45%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH+G V S+ ++P+   + S   D  + +W A T   T  ++    WV++ AFS
Sbjct: 823  CRQTLEGHSGSVNSVTFSPDSKWVASGLDDSTIKIWEAATGSCTQTLEGHGGWVLSVAFS 882

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P  + VA G  DS   I+            + ++TL GH G+V +  + P +   +++ S
Sbjct: 883  PDSKWVASGSADSTIKIWEA-------ATGSCTQTLEGHGGWVYSVAFSP-DSKWVVSGS 934

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +W+  TG  T         GH   V SV+ S  ++    SGS D+T  +W+   
Sbjct: 935  ADSTIKIWEAATGSCTQTL-----EGHGGWVWSVAFS-PDSKWVASGSADSTIKIWEAAT 988

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
             S   +T  GH G V +V F PD     +GSDD T ++++  TG   Q       +    
Sbjct: 989  GS-CTQTLEGHGGPVNSVAFSPDSKWVASGSDDHTIKIWEAATGSCTQTL-----EGHGG 1042

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+ FS   + + +G  +    +W+         L      H G +  +  S D   +
Sbjct: 1043 PVNSVTFSPDSKWVASGSDDHTIKIWEAATGSCTQTL----EGHGGWVYSVAFSPDSKWV 1098

Query: 1197 CTGSWDTTLKIW 1232
             +GS D+T+KIW
Sbjct: 1099 VSGSADSTIKIW 1110



 Score =  127 bits (319), Expect = 6e-28
 Identities = 86/307 (28%), Positives = 137/307 (44%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G V S+ ++P+   + S S D  + +W A T   T  ++    WV + AFS
Sbjct: 1033 CTQTLEGHGGPVNSVTFSPDSKWVASGSDDHTIKIWEAATGSCTQTLEGHGGWVYSVAFS 1092

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P  + V  G  DS   I+            + ++TL GH G V++  + P +   + + S
Sbjct: 1093 PDSKWVVSGSADSTIKIWEA-------ATGSCTQTLEGHGGSVNSVAFSP-DSKWVASGS 1144

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+T  +W+  TG  T         GH     SV+ S  ++    SGS D+T  +W+   
Sbjct: 1145 TDRTIKIWEAATGSCTQTL-----EGHGGWAWSVAFSP-DSKWVASGSADSTIKIWEAAT 1198

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
             S   +T  GH G V +V F PD     +GSDD T ++++  TG   Q       +    
Sbjct: 1199 GS-CTQTLEGHGGPVNSVAFSPDSKWVASGSDDHTIKIWEAATGSCTQTL-----EGHGR 1252

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS   + + +G T+    +W+         L      H G +  +  S D   +
Sbjct: 1253 SVKSVAFSPDSKWVASGSTDRTIKIWEAATGSCTQTL----EGHGGSVKSVASSLDSKLI 1308

Query: 1197 CTGSWDT 1217
             +GS DT
Sbjct: 1309 ASGSNDT 1315



 Score =  121 bits (303), Expect = 4e-26
 Identities = 84/312 (26%), Positives = 136/312 (43%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH G V S+ ++P+   + S S D  + +W A T   T  ++     V +  FS
Sbjct: 991  CTQTLEGHGGPVNSVAFSPDSKWVASGSDDHTIKIWEAATGSCTQTLEGHGGPVNSVTFS 1050

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P  + VA G  D    I+            + ++TL GH G+V +  + P +   +++ S
Sbjct: 1051 PDSKWVASGSDDHTIKIWEA-------ATGSCTQTLEGHGGWVYSVAFSP-DSKWVVSGS 1102

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  +W+  TG  T         GH   V+SV+ S  ++    SGS D T  +W+   
Sbjct: 1103 ADSTIKIWEAATGSCTQTL-----EGHGGSVNSVAFSP-DSKWVASGSTDRTIKIWEAAT 1156

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
             S   +T  GH G   +V F PD     +GS D T ++++  TG   Q       +    
Sbjct: 1157 GS-CTQTLEGHGGWAWSVAFSPDSKWVASGSADSTIKIWEAATGSCTQTL-----EGHGG 1210

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+AFS   + + +G  +    +W+         L      H   +  +  S D   +
Sbjct: 1211 PVNSVAFSPDSKWVASGSDDHTIKIWEAATGSCTQTL----EGHGRSVKSVAFSPDSKWV 1266

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+KIW
Sbjct: 1267 ASGSTDRTIKIW 1278



>gb:BA000045_742896 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1193

 Score =  130 bits (327), Expect = 7e-29
 Identities = 90/312 (28%), Positives = 142/312 (45%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L+GHT  ++S+ ++P+   I S   D  + +W A T +   +     + + + AFS
Sbjct: 727  CLRILRGHTDWIHSVVFSPDGRSIASGGADRTVRLWEAATGECRKSFPGHSSLIWSVAFS 786

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQS+A GG D++  ++++         +   R L GH   V A  + P+    L + S
Sbjct: 787  PDGQSLASGGQDALIKLWDV-------ATAQCRRILQGHTNLVYAVAFSPDGQT-LASGS 838

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+   LW   TG            G+T+ + SV+ S     +  S S D T  LWDT  
Sbjct: 839  ADQAVRLWKTDTGQCRKTI-----QGYTSGIYSVAFSPDGRTL-ASASTDHTVRLWDT-A 891

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
                 +T  GH   V AV F PDG    +GS D T  L++  TG   ++    HS     
Sbjct: 892  TGECRQTLEGHHSWVFAVAFSPDGQTLASGSVDHTVLLWETVTGRCRKILEGHHS----- 946

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V S+ FS  G  +  G  +    +W+    +    L ++  +H G +S +  S DG  L
Sbjct: 947  WVWSVVFSPDGTTIATGSADRTVRIWNAATGR----LSTVLQAHTGWVSAVAFSADGRIL 1002

Query: 1197 CTGSWDTTLKIW 1232
             + S D T+++W
Sbjct: 1003 ASASADGTVRLW 1014



 Score =  128 bits (321), Expect = 3e-28
 Identities = 89/313 (28%), Positives = 138/313 (44%), Gaps = 1/313 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R LQGH G V SL ++P+ + + S S D  + +W   T Q    ++    W+ +  FS
Sbjct: 685  CLRILQGHGGWVLSLAFSPDGSIVASGSSDQTVRLWETTTGQCLRILRGHTDWIHSVVFS 744

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G+S+A GG D    ++               ++  GH   + +  + P  D   + S 
Sbjct: 745  PDGRSIASGGADRTVRLWEA-------ATGECRKSFPGHSSLIWSVAFSP--DGQSLASG 795

Query: 657  G-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            G D    LWD+ T     +       GHT  V +V+ S     +  SGS D    LW T 
Sbjct: 796  GQDALIKLWDVATAQCRRIL-----QGHTNLVYAVAFSPDGQTL-ASGSADQAVRLWKTD 849

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               +  +T  G+   + +V F PDG    + S D T RL+D  TG   Q     HS    
Sbjct: 850  -TGQCRKTIQGYTSGIYSVAFSPDGRTLASASTDHTVRLWDTATGECRQTLEGHHS---- 904

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
              V ++AFS  G+ L +G  +    +W+T+  +       +   H   +  +  S DG+ 
Sbjct: 905  -WVFAVAFSPDGQTLASGSVDHTVLLWETVTGR----CRKILEGHHSWVWSVVFSPDGTT 959

Query: 1194 LCTGSWDTTLKIW 1232
            + TGS D T++IW
Sbjct: 960  IATGSADRTVRIW 972



 Score =  126 bits (317), Expect = 1e-27
 Identities = 89/312 (28%), Positives = 146/312 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C ++  GH+  ++S+ ++P+   + S  QD  + +W+  T+Q    ++     V   AFS
Sbjct: 769  CRKSFPGHSSLIWSVAFSPDGQSLASGGQDALIKLWDVATAQCRRILQGHTNLVYAVAFS 828

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ++A G  D    ++  +            +T+ G+   + +  + P +   L ++S
Sbjct: 829  PDGQTLASGSADQAVRLWKTD-------TGQCRKTIQGYTSGIYSVAFSP-DGRTLASAS 880

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  LWD  TG            GH + V +V+ S     +  SGS D T  LW+T V
Sbjct: 881  TDHTVRLWDTATGECRQTL-----EGHHSWVFAVAFSPDGQTL-ASGSVDHTVLLWET-V 933

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
              R  +   GH   V +V F PDG    TGS D T R+++  TG +L    Q H+     
Sbjct: 934  TGRCRKILEGHHSWVWSVVFSPDGTTIATGSADRTVRIWNAATG-RLSTVLQAHTG---- 988

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             V+++AFS  GR+L +   +G   +W+      V    +L   H   +  +  S DGS L
Sbjct: 989  WVSAVAFSADGRILASASADGTVRLWNVSNGLCV----ALLAEHSNWVHSVVFSPDGSLL 1044

Query: 1197 CTGSWDTTLKIW 1232
             +GS D T+++W
Sbjct: 1045 ASGSADGTVRLW 1056



 Score =  126 bits (316), Expect = 1e-27
 Identities = 94/313 (30%), Positives = 139/313 (44%), Gaps = 1/313 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R LQGH   ++S+ ++P+ + + S S D  + +W   T Q    ++    WV++ AFS
Sbjct: 643  CLRILQGHANSIWSVGFSPDGSIMASGSSDQTVRLWETTTGQCLRILQGHGGWVLSLAFS 702

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  VA G  D    ++               R L GH  ++ +  + P  D   I S 
Sbjct: 703  PDGSIVASGSSDQTVRLWETT-------TGQCLRILRGHTDWIHSVVFSP--DGRSIASG 753

Query: 657  G-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            G D+T  LW+  TG     F      GH++ + SV+ S    ++  SG  D    LWD  
Sbjct: 754  GADRTVRLWEAATGECRKSF-----PGHSSLIWSVAFSPDGQSL-ASGGQDALIKLWDVA 807

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
             A +  R   GH   V AV F PDG    +GS D   RL+   TG Q +   Q ++    
Sbjct: 808  TA-QCRRILQGHTNLVYAVAFSPDGQTLASGSADQAVRLWKTDTG-QCRKTIQGYTSG-- 863

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
              + S+AFS  GR L +  T+    +WDT   +    L      H   +  +  S DG  
Sbjct: 864  --IYSVAFSPDGRTLASASTDHTVRLWDTATGECRQTL----EGHHSWVFAVAFSPDGQT 917

Query: 1194 LCTGSWDTTLKIW 1232
            L +GS D T+ +W
Sbjct: 918  LASGSVDHTVLLW 930



 Score =  124 bits (312), Expect = 4e-27
 Identities = 93/338 (27%), Positives = 151/338 (44%), Gaps = 4/338 (1%)
 Frame = +3

Query: 231  DVATYARSQGKTPISFGPTDLVCCRN-LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN 407
            D  T A       +    TD   CR  +QG+T  +YS+ ++P+   + SAS D  + +W+
Sbjct: 830  DGQTLASGSADQAVRLWKTDTGQCRKTIQGYTSGIYSVAFSPDGRTLASASTDHTVRLWD 889

Query: 408  ALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLS 587
              T +    ++   +WV   AFSP GQ++A G +D    ++               + L 
Sbjct: 890  TATGECRQTLEGHHSWVFAVAFSPDGQTLASGSVDHTVLLWETV-------TGRCRKILE 942

Query: 588  GHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSIS 767
            GH  +V +  + P +   + T S D+T  +W+  TG  ++V        HT  VS+V+ S
Sbjct: 943  GHHSWVWSVVFSP-DGTTIATGSADRTVRIWNAATGRLSTVL-----QAHTGWVSAVAFS 996

Query: 768  ASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCR 947
            A    +  S S D T  LW+       V     H   V +V F PDG+   +GS DGT R
Sbjct: 997  ADG-RILASASADGTVRLWNVS-NGLCVALLAEHSNWVHSVVFSPDGSLLASGSADGTVR 1054

Query: 948  LFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            L+D+++    +V      +     V S+AFS  G LL +   +    +W T       + 
Sbjct: 1055 LWDLQSNRCTRVI-----EGHTSPVWSVAFSADGTLLASAGEDRIIRIWRT-------ST 1102

Query: 1128 GSLQNSHDGR---ISCLGLSGDGSALCTGSWDTTLKIW 1232
            G +  +  G    +  +  S DG  L +GS D ++ +W
Sbjct: 1103 GGIHRAFPGHSRPVWSVAFSPDGQTLASGSQDESIALW 1140



 Score =  111 bits (277), Expect = 4e-23
 Identities = 79/303 (26%), Positives = 133/303 (43%)
 Frame = +3

Query: 324  GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACG 503
            G + S+ ++P +N + +   DG++ +W      + +  +   AWV +  FSP G  VA G
Sbjct: 568  GNISSVQFSPNRNVLATGDADGKVCLWQLPHGIQINICEGHTAWVWSVGFSPDGSIVASG 627

Query: 504  GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWD 683
              D    ++               R L GH   + +  + P + + + + S D+T  LW+
Sbjct: 628  SSDQTVRLWETT-------TGQCLRILQGHANSIWSVGFSP-DGSIMASGSSDQTVRLWE 679

Query: 684  ITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFH 863
             TTG    +       GH   V S++ S    ++  SGS D T  LW+T    + +R   
Sbjct: 680  TTTGQCLRIL-----QGHGGWVLSLAFSPDG-SIVASGSSDQTVRLWET-TTGQCLRILR 732

Query: 864  GHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSI 1043
            GH   + +V F PDG    +G  D T RL++  TG   + +    S      + S+AFS 
Sbjct: 733  GHTDWIHSVVFSPDGRSIASGGADRTVRLWEAATGECRKSFPGHSS-----LIWSVAFSP 787

Query: 1044 SGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTL 1223
             G+ L +G  +    +WD   A+       +   H   +  +  S DG  L +GS D  +
Sbjct: 788  DGQSLASGGQDALIKLWDVATAQ----CRRILQGHTNLVYAVAFSPDGQTLASGSADQAV 843

Query: 1224 KIW 1232
            ++W
Sbjct: 844  RLW 846



 Score =  110 bits (275), Expect = 7e-23
 Identities = 88/322 (27%), Positives = 143/322 (44%), Gaps = 6/322 (1%)
 Frame = +3

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            +GHT  V+S+ ++P+ + + S S D  + +W   T Q    ++     + +  FSP G  
Sbjct: 606  EGHTAWVWSVGFSPDGSIVASGSSDQTVRLWETTTGQCLRILQGHANSIWSVGFSPDGSI 665

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SGDKT 668
            +A G  D    ++               R L GH G+V +  + P  D  ++ S S D+T
Sbjct: 666  MASGSSDQTVRLWETT-------TGQCLRILQGHGGWVLSLAFSP--DGSIVASGSSDQT 716

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW+ TTG    +       GHT  + SV  S    ++  SG  D T  LW+       
Sbjct: 717  VRLWETTTGQCLRIL-----RGHTDWIHSVVFSPDGRSI-ASGGADRTVRLWEA-ATGEC 769

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
             ++F GH   + +V F PDG    +G  D   +L+D+ T  Q +   Q H+    + V +
Sbjct: 770  RKSFPGHSSLIWSVAFSPDGQSLASGGQDALIKLWDVATA-QCRRILQGHT----NLVYA 824

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRIS---CLGLSGDGSALC 1199
            +AFS  G+ L +G  +    +W T       + G  + +  G  S    +  S DG  L 
Sbjct: 825  VAFSPDGQTLASGSADQAVRLWKT-------DTGQCRKTIQGYTSGIYSVAFSPDGRTLA 877

Query: 1200 TGSWDTTLKIW--AFGGYRQVI 1259
            + S D T+++W  A G  RQ +
Sbjct: 878  SASTDHTVRLWDTATGECRQTL 899



 Score =  107 bits (267), Expect = 6e-22
 Identities = 76/269 (28%), Positives = 128/269 (47%), Gaps = 1/269 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V+++ ++P+   + S S D  +++W  +T +    ++   +WV +  FS
Sbjct: 895  CRQTLEGHHSWVFAVAFSPDGQTLASGSVDHTVLLWETVTGRCRKILEGHHSWVWSVVFS 954

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS- 653
            P G ++A G  D    I+N            +S  L  H G+VSA  +  + D  ++ S 
Sbjct: 955  PDGTTIATGSADRTVRIWNA-------ATGRLSTVLQAHTGWVSAVAF--SADGRILASA 1005

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S D T  LW+++ GL  ++      + H+  V SV  S    ++  SGS D T  LWD +
Sbjct: 1006 SADGTVRLWNVSNGLCVALL-----AEHSNWVHSVVFSPDG-SLLASGSADGTVRLWDLQ 1059

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
             ++R  R   GH   V +V F  DG    +  +D   R++   TG   + +   HS    
Sbjct: 1060 -SNRCTRVIEGHTSPVWSVAFSADGTLLASAGEDRIIRIWRTSTGGIHRAF-PGHS---- 1113

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDT 1100
              V S+AFS  G+ L +G  +    +W+T
Sbjct: 1114 RPVWSVAFSPDGQTLASGSQDESIALWET 1142



 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 66/233 (28%), Positives = 108/233 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GH   V+S+ ++P+   I + S D  + +WNA T + +  ++    WV   AFS
Sbjct: 937  CRKILEGHHSWVWSVVFSPDGTTIATGSADRTVRIWNAATGRLSTVLQAHTGWVSAVAFS 996

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
              G+ +A    D    ++N++       N      L+ H  +V +  + P + + L + S
Sbjct: 997  ADGRILASASADGTVRLWNVS-------NGLCVALLAEHSNWVHSVVFSP-DGSLLASGS 1048

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  LWD+ +   T V       GHT+ V SV+ SA  T +  +G  D    +W T  
Sbjct: 1049 ADGTVRLWDLQSNRCTRVI-----EGHTSPVWSVAFSADGTLLASAGE-DRIIRIWRTST 1102

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQP 995
                 R F GH   V +V F PDG    +GS D +  L++  +  + +V   P
Sbjct: 1103 GG-IHRAFPGHSRPVWSVAFSPDGQTLASGSQDESIALWETHSAERSRVLRNP 1154



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 34/139 (24%), Positives = 66/139 (47%)
 Frame = +3

Query: 294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
            +C   L  H+  V+S+ ++P+ + + S S DG + +W+  +++ T  I+   + V + AF
Sbjct: 1020 LCVALLAEHSNWVHSVVFSPDGSLLASGSADGTVRLWDLQSNRCTRVIEGHTSPVWSVAF 1079

Query: 474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
            S  G  +A  G D +  I+  +          + R   GH   V +  + P+    L + 
Sbjct: 1080 SADGTLLASAGEDRIIRIWRTS-------TGGIHRAFPGHSRPVWSVAFSPDGQT-LASG 1131

Query: 654  SGDKTCGLWDITTGLRTSV 710
            S D++  LW+  +  R+ V
Sbjct: 1132 SQDESIALWETHSAERSRV 1150



>gb:BA000045_742963 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1081

 Score =  127 bits (319), Expect = 6e-28
 Identities = 89/313 (28%), Positives = 144/313 (46%), Gaps = 1/313 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   L GHTG VY++ + P+   + S S DG + +W+  T      +  P     + AF+
Sbjct: 540  CLATLTGHTGWVYAVAFAPDGRTLASGSVDGTVRLWDVGTGLCLKILCEPGGQFWSVAFA 599

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ++A  G      ++ ++       +   + +L GH   V +  + P  D   + S+
Sbjct: 600  PDGQTLATAGHGHAIKLWQVS-------SGACALSLEGHTAQVRSVAFSP--DGRTLASA 650

Query: 657  G-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            G D T  LWD+  G    V       GHT+ V +V+ S    ++  SG  D T  LW+ R
Sbjct: 651  GVDGTVRLWDVPLGACLMVL-----EGHTSRVRTVAFSPGG-HLLASGGHDQTVRLWEVR 704

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
             + R +R   GH G V ++ F P+G    +GS D T RL+++ +G  L+ +         
Sbjct: 705  -SGRCLRVLPGHTGQVWSLAFHPNGRTLASGSMDQTVRLWEVDSGRSLKTF-----QGNS 758

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
              + S+AF   G LL +G  +    +WDT   + +  L      H   +  L     G  
Sbjct: 759  GWIWSVAFHPGGHLLASGSMDRLVRLWDTRTGQCLKTLA----GHGCWVWSLAFHPGGEI 814

Query: 1194 LCTGSWDTTLKIW 1232
            L +GS+D T+K+W
Sbjct: 815  LASGSFDQTVKLW 827



 Score =  106 bits (265), Expect = 1e-21
 Identities = 81/315 (25%), Positives = 135/315 (42%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L GHTG+V+SL + P    + S S D  + +W   + +     +    W+ + AF 
Sbjct: 708  CLRVLPGHTGQVWSLAFHPNGRTLASGSMDQTVRLWEVDSGRSLKTFQGNSGWIWSVAFH 767

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  +A G +D +  +++              +TL+GH  +V +  + P  +  L + S
Sbjct: 768  PGGHLLASGSMDRLVRLWDTR-------TGQCLKTLAGHGCWVWSLAFHPGGEI-LASGS 819

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+T  LW++ TG        +  +GHT  + +V+ S     +  S   D T  LW    
Sbjct: 820  FDQTVKLWEVDTGRCI-----QSLAGHTNWIRAVAFSPDGAQI-ASAGVDQTIRLW-AWP 872

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            A        GH G V  V F PDG +  +GS D T +++D  TG  +             
Sbjct: 873  AGNCTAVLTGHTGWVRCVAFGPDGRQLASGSLDRTIKIWDAATGECVATLGGHRG----- 927

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
            ++ ++AFS  G LL +   +    +W+    + V  L      H G +  +  + DG  L
Sbjct: 928  QICAVAFSPDGSLLASAAEDHLVKLWNLATGECVATLA----GHCGPVWSVAFAPDGLHL 983

Query: 1197 CTGSWDTTLKIWAFG 1241
             +   D  ++ W  G
Sbjct: 984  ASCGHDQVVRFWDAG 998



 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 74/267 (27%), Positives = 115/267 (43%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L GH   V+SL + P    + S S D  + +W   T +   ++     W+   AFS
Sbjct: 792  CLKTLAGHGCWVWSLAFHPGGEILASGSFDQTVKLWEVDTGRCIQSLAGHTNWIRAVAFS 851

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  +A  G+D    ++         GN T    L+GH G+V    + P +   L + S
Sbjct: 852  PDGAQIASAGVDQTIRLWAWPA-----GNCTA--VLTGHTGWVRCVAFGP-DGRQLASGS 903

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+T  +WD  TG   +  GG     H   + +V+ S   + +  S + D    LW+   
Sbjct: 904  LDRTIKIWDAATGECVATLGG-----HRGQICAVAFSPDGS-LLASAAEDHLVKLWNL-A 956

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
                V T  GH G V +V F PDG    +   D   R +D  +G  L    + HSD    
Sbjct: 957  TGECVATLAGHCGPVWSVAFAPDGLHLASCGHDQVVRFWDAGSG-ALTATLRGHSD---- 1011

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWD 1097
            +V S+A+   G  L +G  +    +W+
Sbjct: 1012 QVWSVAYDPRGETLASGSQDKTIRLWN 1038



 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 55/205 (26%), Positives = 85/205 (41%), Gaps = 37/205 (18%)
 Frame = +3

Query: 729  SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDG 908
            +GHT  + +++      N+  SGS D +  LW    + + + T  GH G V AV F PDG
Sbjct: 503  TGHTDALCAMAFHPEG-NLLASGSEDLSVKLWAAG-SGQCLATLTGHTGWVYAVAFAPDG 560

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS----------------------------- 1001
                +GS DGT RL+D+ TG  L++  +P                               
Sbjct: 561  RTLASGSVDGTVRLWDVGTGLCLKILCEPGGQFWSVAFAPDGQTLATAGHGHAIKLWQVS 620

Query: 1002 --------DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
                    +    +V S+AFS  GR L +   +G   +WD  L   ++ L      H  R
Sbjct: 621  SGACALSLEGHTAQVRSVAFSPDGRTLASAGVDGTVRLWDVPLGACLMVL----EGHTSR 676

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            +  +  S  G  L +G  D T+++W
Sbjct: 677  VRTVAFSPGGHLLASGGHDQTVRLW 701



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 39/133 (29%), Positives = 66/133 (49%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   L GH G++ ++ ++P+ + + SA++D  + +WN  T +    +   C  V + AF+
Sbjct: 918  CVATLGGHRGQICAVAFSPDGSLLASAAEDHLVKLWNLATGECVATLAGHCGPVWSVAFA 977

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G  +A  G D V   ++        G+  ++ TL GH   V +  Y P  +  L + S
Sbjct: 978  PDGLHLASCGHDQVVRFWDA-------GSGALTATLRGHSDQVWSVAYDPRGET-LASGS 1029

Query: 657  GDKTCGLWDITTG 695
             DKT  LW+  TG
Sbjct: 1030 QDKTIRLWNPATG 1042



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 36/130 (27%), Positives = 56/130 (43%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            +TF G    ++ V F P+G     G D G  RL     G Q Q     H+D     + ++
Sbjct: 462  QTFAG----ILLVAFNPEGTVLAIGDDSGEIRLLRAADGQQ-QARCTGHTD----ALCAM 512

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            AF   G LL +G  +    +W     + +  L      H G +  +  + DG  L +GS 
Sbjct: 513  AFHPEGNLLASGSEDLSVKLWAAGSGQCLATL----TGHTGWVYAVAFAPDGRTLASGSV 568

Query: 1212 DTTLKIWAFG 1241
            D T+++W  G
Sbjct: 569  DGTVRLWDVG 578



>pir|AE1810|AE1810 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681021 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1227

 Score =  127 bits (318), Expect = 7e-28
 Identities = 97/352 (27%), Positives = 156/352 (44%), Gaps = 40/352 (11%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L+GHT +V+S+ ++P+   + S+ +D  + +W+  T Q     +     V +  FS
Sbjct: 766  CLKTLKGHTREVHSVSFSPDGQTLASSGEDSTVRLWDVKTGQCWQIFEGHSKKVYSVRFS 825

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ++A  G D    ++++              TL GH   V A  + P +   LI+ S
Sbjct: 826  PDGQTLASCGEDRSIKLWDIQ-------RGECVNTLWGHSSQVWAIAFSP-DGRTLISCS 877

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+T  LWD+ TG   ++       G+T DV SV+ S  ++ +  SG  D T  LW+ + 
Sbjct: 878  DDQTARLWDVITGNSLNIL-----RGYTRDVYSVAFS-PDSQILASGRDDYTIGLWNLKT 931

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR-----------TGHQLQV 983
                     GH+G + +V F PDG    +GS D T +L+DI            TGH   V
Sbjct: 932  GE--CHPLRGHQGRIRSVAFHPDGKILASGSADNTIKLWDISDTNHSKYIRTLTGHTNWV 989

Query: 984  YSQPHSDNE-----------------------------VHRVTSIAFSISGRLLFAGYTN 1076
            ++   S ++                              H V ++AFS  GR+L +G  +
Sbjct: 990  WTVVFSPDKHTLASSSEDRTIRLWDKDTGDCLQKLKGHSHWVWTVAFSPDGRILASGSAD 1049

Query: 1077 GDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             +  +WD    K +  L   Q    G I  +  S DG+ L + S D T+K+W
Sbjct: 1050 SEIKIWDVASGKCLQTLTDPQ----GMIWSVAFSLDGTLLASASEDQTVKLW 1097



 Score =  123 bits (309), Expect = 8e-27
 Identities = 95/319 (29%), Positives = 139/319 (43%), Gaps = 7/319 (2%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L  +T KVYS+ ++P+   + SASQD  + +W+  T      +     WV +  FS
Sbjct: 678  CLKTLSKNTNKVYSVAFSPDGRILASASQDQTIKLWDIATGNCQQTLIGHDDWVWSVTFS 737

Query: 477  PTGQS----VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL 644
            P        +A    D    ++++             +TL GH   V +  + P  D   
Sbjct: 738  PVTDDRPLLLASSSADQHIKLWDV-------ATGKCLKTLKGHTREVHSVSFSP--DGQT 788

Query: 645  ITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACL 821
            + SSG D T  LWD+ TG    +F      GH+  V SV  S     +   G  D +  L
Sbjct: 789  LASSGEDSTVRLWDVKTGQCWQIF-----EGHSKKVYSVRFSPDGQTLASCGE-DRSIKL 842

Query: 822  WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
            WD +     V T  GH   V A+ F PDG    + SDD T RL+D+ TG+ L +      
Sbjct: 843  WDIQ-RGECVNTLWGHSSQVWAIAFSPDGRTLISCSDDQTARLWDVITGNSLNILRGYTR 901

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ--NSHDGRISCLGL 1175
            D     V S+AFS   ++L +G  +    +W+       L  G       H GRI  +  
Sbjct: 902  D-----VYSVAFSPDSQILASGRDDYTIGLWN-------LKTGECHPLRGHQGRIRSVAF 949

Query: 1176 SGDGSALCTGSWDTTLKIW 1232
              DG  L +GS D T+K+W
Sbjct: 950  HPDGKILASGSADNTIKLW 968



 Score =  116 bits (291), Expect = 1e-24
 Identities = 83/312 (26%), Positives = 144/312 (46%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   L GH+ +V+++ ++P+   ++S S D    +W+ +T    + ++     V + AFS
Sbjct: 850  CVNTLWGHSSQVWAIAFSPDGRTLISCSDDQTARLWDVITGNSLNILRGYTRDVYSVAFS 909

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P  Q +A G  D    ++NL         +     L GH+G + +  + P +   L + S
Sbjct: 910  PDSQILASGRDDYTIGLWNL--------KTGECHPLRGHQGRIRSVAFHP-DGKILASGS 960

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D T  LWDI+    +        +GHT  V +V + + + +   S S D T  LWD + 
Sbjct: 961  ADNTIKLWDISDTNHSKYI--RTLTGHTNWVWTV-VFSPDKHTLASSSEDRTIRLWD-KD 1016

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
                ++   GH   V  V F PDG    +GS D   +++D+ +G  LQ  + P       
Sbjct: 1017 TGDCLQKLKGHSHWVWTVAFSPDGRILASGSADSEIKIWDVASGKCLQTLTDPQG----- 1071

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             + S+AFS+ G LL +   +    +W+    + V  L      H+ ++  +  S +G   
Sbjct: 1072 MIWSVAFSLDGTLLASASEDQTVKLWNLKTGECVHTL----KGHEKQVYSVAFSPNGQIA 1127

Query: 1197 CTGSWDTTLKIW 1232
             +GS DTT+K+W
Sbjct: 1128 ASGSEDTTVKLW 1139



 Score =  107 bits (268), Expect = 5e-22
 Identities = 82/304 (26%), Positives = 137/304 (45%), Gaps = 3/304 (0%)
 Frame = +3

Query: 330  VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGL 509
            V S+ ++P+     +   +G + +W    +++    K   AWV   AFSP  + +A G  
Sbjct: 605  VVSVKFSPDGKYFATGLMNGEIRLWQTSDNKQLRIYKGHTAWVWAFAFSPDSRMLASGSA 664

Query: 510  DSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDIT 689
            DS   +++++            +TLS +   V +  + P +   L ++S D+T  LWDI 
Sbjct: 665  DSTIKLWDVH-------TGECLKTLSKNTNKVYSVAFSP-DGRILASASQDQTIKLWDIA 716

Query: 690  TGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRAVRTF 860
            TG            GH   V SV+ S    +   +  S S D    LWD     + ++T 
Sbjct: 717  TGNCQQTL-----IGHDDWVWSVTFSPVTDDRPLLLASSSADQHIKLWDV-ATGKCLKTL 770

Query: 861  HGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFS 1040
             GH  +V +V F PDG    +  +D T RL+D++TG   Q++ + HS     +V S+ FS
Sbjct: 771  KGHTREVHSVSFSPDGQTLASSGEDSTVRLWDVKTGQCWQIF-EGHS----KKVYSVRFS 825

Query: 1041 ISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTT 1220
              G+ L +   +    +WD    + V  L      H  ++  +  S DG  L + S D T
Sbjct: 826  PDGQTLASCGEDRSIKLWDIQRGECVNTLW----GHSSQVWAIAFSPDGRTLISCSDDQT 881

Query: 1221 LKIW 1232
             ++W
Sbjct: 882  ARLW 885



 Score =  106 bits (265), Expect = 1e-21
 Identities = 74/257 (28%), Positives = 124/257 (48%), Gaps = 2/257 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L GHT  V+++ ++P+K+ + S+S+D  + +W+  T      +K    WV T AFSP 
Sbjct: 980  RTLTGHTNWVWTVVFSPDKHTLASSSEDRTIRLWDKDTGDCLQKLKGHSHWVWTVAFSPD 1039

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G+ +A G  DS   I+++        +    +TL+  +G + +  +   +   L ++S D
Sbjct: 1040 GRILASGSADSEIKIWDV-------ASGKCLQTLTDPQGMIWSVAF-SLDGTLLASASED 1091

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            +T  LW++ TG            GH   V SV+ S  N  +  SGS DTT  LWD    S
Sbjct: 1092 QTVKLWNLKTGECVHTL-----KGHEKQVYSVAFS-PNGQIAASGSEDTTVKLWDISTGS 1145

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQP--HSDNEVH 1016
                  HGH   + +V F PDG    +GS+D   +L+D++   +L+    P  + + ++ 
Sbjct: 1146 CVDTLKHGHTAAIRSVAFSPDGRLLASGSEDEKIQLWDMQNCSRLKTLKSPRLYENMDIT 1205

Query: 1017 RVTSIAFSISGRLLFAG 1067
             +T I  +    L   G
Sbjct: 1206 DITGITDAEKASLKMLG 1222



 Score =  104 bits (259), Expect = 5e-21
 Identities = 84/300 (28%), Positives = 136/300 (45%), Gaps = 37/300 (12%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+G+T  VYS+ ++P+   + S   D  + +WN  T +  H ++     + + AF P G+
Sbjct: 896  LRGYTRDVYSVAFSPDSQILASGRDDYTIGLWNLKTGE-CHPLRGHQGRIRSVAFHPDGK 954

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A G  D+   +++++    +  +S   RTL+GH  +V    + P++   L +SS D+T
Sbjct: 955  ILASGSADNTIKLWDIS----DTNHSKYIRTLTGHTNWVWTVVFSPDKHT-LASSSEDRT 1009

Query: 669  CGLWDITTG------------LRTSVFG--GEYQSGHTAD-------------------- 746
              LWD  TG            + T  F   G   +  +AD                    
Sbjct: 1010 IRLWDKDTGDCLQKLKGHSHWVWTVAFSPDGRILASGSADSEIKIWDVASGKCLQTLTDP 1069

Query: 747  ---VSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRF 917
               + SV+ S   T +  S S D T  LW+ +     V T  GHE  V +V F P+G   
Sbjct: 1070 QGMIWSVAFSLDGT-LLASASEDQTVKLWNLKTGE-CVHTLKGHEKQVYSVAFSPNGQIA 1127

Query: 918  GTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWD 1097
             +GS+D T +L+DI TG  +      H+      + S+AFS  GRLL +G  +    +WD
Sbjct: 1128 ASGSEDTTVKLWDISTGSCVDTLKHGHTA----AIRSVAFSPDGRLLASGSEDEKIQLWD 1183



 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 40/158 (25%), Positives = 74/158 (46%), Gaps = 3/158 (1%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L    G ++S+ ++ +   + SAS+D  + +WN  T +  H +K     V + AFS
Sbjct: 1062 CLQTLTDPQGMIWSVAFSLDGTLLASASEDQTVKLWNLKTGECVHTLKGHEKQVYSVAFS 1121

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS- 653
            P GQ  A G  D+   +++++        S V     GH   + +  + P  D  L+ S 
Sbjct: 1122 PNGQIAASGSEDTTVKLWDIST------GSCVDTLKHGHTAAIRSVAFSP--DGRLLASG 1173

Query: 654  SGDKTCGLWDI--TTGLRTSVFGGEYQSGHTADVSSVS 761
            S D+   LWD+   + L+T      Y++    D++ ++
Sbjct: 1174 SEDEKIQLWDMQNCSRLKTLKSPRLYENMDITDITGIT 1211



>sp|Q8YTC2|YS00_ANASP Hypothetical WD-repeat protein
            alr2800.>pir|AI2155|AI2155 WD-repeat protein [imported] -
            Nostoc sp. (strain PCC 7120)>gb:BA000019_683789 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 1258

 Score =  125 bits (313), Expect = 3e-27
 Identities = 89/317 (28%), Positives = 147/317 (46%), Gaps = 2/317 (0%)
 Frame = +3

Query: 288  DLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC 467
            D VC + L GH  +V+S+ + P+   + SAS D  + +W+         +     WV   
Sbjct: 715  DGVCIKTLTGHEHEVFSVAFHPDGETLASASGDKTIKLWDIQDGTCLQTLTGHTDWVRCV 774

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            AFSP G ++A    D    +++++            RTL  H G+V +  +  +    L 
Sbjct: 775  AFSPDGNTLASSAADHTIKLWDVS-------QGKCLRTLKSHTGWVRSVAFSADGQT-LA 826

Query: 648  TSSGDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACL 821
            + SGD+T  +W+  TG  L+T +       GHT  V S++ S  ++ + VSGS D T  L
Sbjct: 827  SGSGDRTIKIWNYHTGECLKTYI-------GHTNSVYSIAYS-PDSKILVSGSGDRTIKL 878

Query: 822  WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
            WD +     ++T HGH  +V +V F PDG      S D + RL++ RTG  L+ +     
Sbjct: 879  WDCQ-THICIKTLHGHTNEVCSVAFSPDGQTLACVSLDQSVRLWNCRTGQCLKAWY---- 933

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSG 1181
                     +AFS   ++L +G  +    +WD    K + +L      H   I  +  S 
Sbjct: 934  -GNTDWALPVAFSPDRQILASGSNDKTVKLWDWQTGKYISSL----EGHTDFIYGIAFSP 988

Query: 1182 DGSALCTGSWDTTLKIW 1232
            D   L + S D+++++W
Sbjct: 989  DSQTLASASTDSSVRLW 1005



 Score =  115 bits (288), Expect = 2e-24
 Identities = 90/321 (28%), Positives = 141/321 (43%)
 Frame = +3

Query: 270  ISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            + F  +DL CC   +   G + S  ++PE   + +   D  + VW   + +     +   
Sbjct: 626  VDFANSDLSCCVFTET-LGNILSAAFSPEGQLLATCDTDCHVRVWEVKSGKLLLICRGHS 684

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
             WV    FSP G+ +A  G D      N+ L    DG     +TL+GH+  V +  + P+
Sbjct: 685  NWVRFVVFSPDGEILASCGADE-----NVKLWSVRDG--VCIKTLTGHEHEVFSVAFHPD 737

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             +  L ++SGDKT  LWDI  G           +GHT  V  V+ S    N   S + D 
Sbjct: 738  GET-LASASGDKTIKLWDIQDGTCLQTL-----TGHTDWVRCVAFSPDG-NTLASSAADH 790

Query: 810  TACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS 989
            T  LWD     + +RT   H G V +V F  DG    +GS D T ++++  TG  L+ Y 
Sbjct: 791  TIKLWDVS-QGKCLRTLKSHTGWVRSVAFSADGQTLASGSGDRTIKIWNYHTGECLKTYI 849

Query: 990  QPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCL 1169
                    + V SIA+S   ++L +G  +    +WD      +  L    + H   +  +
Sbjct: 850  -----GHTNSVYSIAYSPDSKILVSGSGDRTIKLWDCQTHICIKTL----HGHTNEVCSV 900

Query: 1170 GLSGDGSALCTGSWDTTLKIW 1232
              S DG  L   S D ++++W
Sbjct: 901  AFSPDGQTLACVSLDQSVRLW 921



 Score =  114 bits (284), Expect = 6e-24
 Identities = 89/335 (26%), Positives = 149/335 (44%), Gaps = 1/335 (0%)
 Frame = +3

Query: 231  DVATYARSQG-KTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN 407
            D  T A + G KT   +   D  C + L GHT  V  + ++P+ N + S++ D  + +W+
Sbjct: 737  DGETLASASGDKTIKLWDIQDGTCLQTLTGHTDWVRCVAFSPDGNTLASSAADHTIKLWD 796

Query: 408  ALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLS 587
                +    +K    WV + AFS  GQ++A G  D    I+N +            +T  
Sbjct: 797  VSQGKCLRTLKSHTGWVRSVAFSADGQTLASGSGDRTIKIWNYH-------TGECLKTYI 849

Query: 588  GHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSIS 767
            GH   V +  Y P+    L++ SGD+T  LWD  T +           GHT +V SV+ S
Sbjct: 850  GHTNSVYSIAYSPDSKI-LVSGSGDRTIKLWDCQTHICIKTL-----HGHTNEVCSVAFS 903

Query: 768  ASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCR 947
                 +    S D +  LW+ R   + ++ ++G+    + V F PD     +GS+D T +
Sbjct: 904  PDGQTL-ACVSLDQSVRLWNCR-TGQCLKAWYGNTDWALPVAFSPDRQILASGSNDKTVK 961

Query: 948  LFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            L+D +TG  +    + H+D     +  IAFS   + L +  T+    +W+    +     
Sbjct: 962  LWDWQTGKYISSL-EGHTD----FIYGIAFSPDSQTLASASTDSSVRLWNISTGQCF--- 1013

Query: 1128 GSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              +   H   +  +     G  + TGS D T+K+W
Sbjct: 1014 -QILLEHTDWVYAVVFHPQGKIIATGSADCTVKLW 1047



 Score =  109 bits (273), Expect = 1e-22
 Identities = 72/266 (27%), Positives = 123/266 (46%), Gaps = 2/266 (0%)
 Frame = +3

Query: 306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            +L+GHT  +Y + ++P+   + SAS D  + +WN  T Q    +     WV    F P G
Sbjct: 973  SLEGHTDFIYGIAFSPDSQTLASASTDSSVRLWNISTGQCFQILLEHTDWVYAVVFHPQG 1032

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
            + +A G  D    ++N++            +TLS H   +    + P+    L ++S D+
Sbjct: 1033 KIIATGSADCTVKLWNIS-------TGQCLKTLSEHSDKILGMAWSPDGQL-LASASADQ 1084

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            +  LWD  TG    +       GH+  V S +I + N  +  + S D T  +WD +   +
Sbjct: 1085 SVRLWDCCTGRCVGIL-----RGHSNRVYS-AIFSPNGEIIATCSTDQTVKIWDWQ-QGK 1137

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG--HQLQVYSQPHSDNEVHR 1019
             ++T  GH   V  + F PDG    + S D T R++D+ TG  H + +          H 
Sbjct: 1138 CLKTLTGHTNWVFDIAFSPDGKILASASHDQTVRIWDVNTGKCHHICI-------GHTHL 1190

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWD 1097
            V+S+AFS  G ++ +G  +    +W+
Sbjct: 1191 VSSVAFSPDGEVVASGSQDQTVRIWN 1216



 Score =  101 bits (252), Expect = 3e-20
 Identities = 86/353 (24%), Positives = 141/353 (39%), Gaps = 40/353 (11%)
 Frame = +3

Query: 294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
            +C + L GHT +V S+ ++P+   +   S D  + +WN  T Q   A      W +  AF
Sbjct: 885  ICIKTLHGHTNEVCSVAFSPDGQTLACVSLDQSVRLWNCRTGQCLKAWYGNTDWALPVAF 944

Query: 474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
            SP  Q +A G  D    +++               +L GH  ++    + P+    L ++
Sbjct: 945  SPDRQILASGSNDKTVKLWDWQ-------TGKYISSLEGHTDFIYGIAFSPDSQT-LASA 996

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S D +  LW+I+TG    +        HT  V +V        +  +GS D T  LW+  
Sbjct: 997  STDSSVRLWNISTGQCFQIL-----LEHTDWVYAVVFHPQG-KIIATGSADCTVKLWNIS 1050

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG--------HQLQVYS 989
               + ++T   H   ++ + + PDG    + S D + RL+D  TG        H  +VYS
Sbjct: 1051 TG-QCLKTLSEHSDKILGMAWSPDGQLLASASADQSVRLWDCCTGRCVGILRGHSNRVYS 1109

Query: 990  QPHSDN-----------------------------EVHRVTSIAFSISGRLLFAGYTNGD 1082
               S N                               + V  IAFS  G++L +   +  
Sbjct: 1110 AIFSPNGEIIATCSTDQTVKIWDWQQGKCLKTLTGHTNWVFDIAFSPDGKILASASHDQT 1169

Query: 1083 CYVWDTLLAKMVLNLGSLQN---SHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              +WD       +N G   +    H   +S +  S DG  + +GS D T++IW
Sbjct: 1170 VRIWD-------VNTGKCHHICIGHTHLVSSVAFSPDGEVVASGSQDQTVRIW 1215



 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 63/214 (29%), Positives = 93/214 (43%)
 Frame = +3

Query: 597  GYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASN 776
            G + +  + P E   L T   D    +W++ +G    +       GH+  V  V  S   
Sbjct: 643  GNILSAAFSP-EGQLLATCDTDCHVRVWEVKSGKLLLIC-----RGHSNWVRFVVFSPDG 696

Query: 777  TNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
              +  S   D    LW  R     ++T  GHE +V +V F PDG    + S D T +L+D
Sbjct: 697  -EILASCGADENVKLWSVRDGV-CIKTLTGHEHEVFSVAFHPDGETLASASGDKTIKLWD 754

Query: 957  IRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSL 1136
            I+ G  LQ  +  H+D     V  +AFS  G  L +   +    +WD    K +  L   
Sbjct: 755  IQDGTCLQTLT-GHTD----WVRCVAFSPDGNTLASSAADHTIKLWDVSQGKCLRTL--- 806

Query: 1137 QNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
              SH G +  +  S DG  L +GS D T+KIW +
Sbjct: 807  -KSHTGWVRSVAFSADGQTLASGSGDRTIKIWNY 839



 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 52/195 (26%), Positives = 87/195 (44%), Gaps = 5/195 (2%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L  H+ K+  + W+P+   + SAS D  + +W+  T +    ++     V +  FS
Sbjct: 1054 CLKTLSEHSDKILGMAWSPDGQLLASASADQSVRLWDCCTGRCVGILRGHSNRVYSAIFS 1113

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G+ +A    D    I++              +TL+GH  +V    + P +   L ++S
Sbjct: 1114 PNGEIIATCSTDQTVKIWDWQ-------QGKCLKTLTGHTNWVFDIAFSP-DGKILASAS 1165

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D+T  +WD+ TG    +       GHT  VSSV+ S     +  SGS D T  +W+ + 
Sbjct: 1166 HDQTVRIWDVNTGKCHHIC-----IGHTHLVSSVAFSPDG-EVVASGSQDQTVRIWNVKT 1219

Query: 837  AS-----RAVRTFHG 866
                   RA R + G
Sbjct: 1220 GECLQILRAKRLYEG 1234



>gb:BA000045_741250 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1183

 Score =  122 bits (305), Expect = 2e-26
 Identities = 98/348 (28%), Positives = 141/348 (40%), Gaps = 36/348 (10%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L+GHT +V+S+ + P+   ++S S DG L +W+        A+      V T A+S
Sbjct: 726  CLRTLRGHTDEVWSVAFGPDSRTLLSGSSDGTLRMWDTHGGTCKQALSGHQDKVRTVAWS 785

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
              GQ +A G  D+   ++N         +      L GH G + +  + P +   L T S
Sbjct: 786  LDGQRLASGSWDATVRVWN--------ADGRCQSILRGHSGIIRSVAFAP-DGGLLATGS 836

Query: 657  GDKTCGLWDITTGLRTSVFGG------------------------------------EYQ 728
             D+T  LWD+ +G     F G                                       
Sbjct: 837  IDQTVKLWDLQSGQCVYSFKGHSGGVAAVAVGGHGTLASGDADHRVRIWSTEDGRCTRVL 896

Query: 729  SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDG 908
            SGHT  + SV+ +     +  S S D    LWD   + R      GH   V +V F PDG
Sbjct: 897  SGHTHPIWSVAFAPGGATL-ASASADHAVRLWD-GASGRCTHILQGHTSWVWSVAFSPDG 954

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
             R  +G  D T RL+D  TG  L+      S    HRV ++AF   G L  AG  +    
Sbjct: 955  RRLASGGADRTVRLWDTATGQCLRT-----STEADHRVLAVAFMPDG-LTLAGSVDQTVR 1008

Query: 1089 VWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            +WD    + +  L      H   I  L  S DG  + TGS D +++IW
Sbjct: 1009 LWDAATGRCLRTLA----GHTSWIWSLAASADGRLMATGSADRSVRIW 1052



 Score =  113 bits (283), Expect = 8e-24
 Identities = 83/268 (30%), Positives = 129/268 (48%), Gaps = 2/268 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R L GHT  ++S+ + P    + SAS D  + +W+  + + TH ++   +WV + AFS
Sbjct: 892  CTRVLSGHTHPIWSVAFAPGGATLASASADHAVRLWDGASGRCTHILQGHTSWVWSVAFS 951

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G+ +A GG D    +++        G    + T + H+  V A  ++P  D   +  S
Sbjct: 952  PDGRRLASGGADRTVRLWD-----TATGQCLRTSTEADHR--VLAVAFMP--DGLTLAGS 1002

Query: 657  GDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
             D+T  LWD  TG  LRT        +GHT+ + S++ SA    +  +GS D +  +W+ 
Sbjct: 1003 VDQTVRLWDAATGRCLRT-------LAGHTSWIWSLAASADG-RLMATGSADRSVRIWEV 1054

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
                R ++    H G V +V F PD  R   GS DGT RL+    G  L+  +   +   
Sbjct: 1055 -ATGRCLKHLEEHGGWVWSVAFSPDERRLAVGSMDGTIRLWSFPEGELLRSMACESA--- 1110

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVW 1094
               V SIAF   G++L AG  +G    W
Sbjct: 1111 ---VRSIAFESHGQVLIAGCEDGTIRFW 1135



 Score =  111 bits (278), Expect = 3e-23
 Identities = 95/350 (27%), Positives = 146/350 (41%), Gaps = 36/350 (10%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + L GH  KV ++ W+ +  R+ S S D  + VWNA   +    ++     + + AF+
Sbjct: 768  CKQALSGHQDKVRTVAWSLDGQRLASGSWDATVRVWNA-DGRCQSILRGHSGIIRSVAFA 826

Query: 477  PTGQSVACGGLDSVCSIFNLN------------------------------------LPP 548
            P G  +A G +D    +++L                                     +  
Sbjct: 827  PDGGLLATGSIDQTVKLWDLQSGQCVYSFKGHSGGVAAVAVGGHGTLASGDADHRVRIWS 886

Query: 549  DNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ 728
              DG  T  R LSGH   + +  + P   A L ++S D    LWD  +G  T +      
Sbjct: 887  TEDGRCT--RVLSGHTHPIWSVAFAPG-GATLASASADHAVRLWDGASGRCTHIL----- 938

Query: 729  SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDG 908
             GHT+ V SV+ S     +  SG  D T  LWDT    + +RT    +  V+AV F PDG
Sbjct: 939  QGHTSWVWSVAFSPDGRRL-ASGGADRTVRLWDT-ATGQCLRTSTEADHRVLAVAFMPDG 996

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
                 GS D T RL+D  TG  L+  +          + S+A S  GRL+  G  +    
Sbjct: 997  LTLA-GSVDQTVRLWDAATGRCLRTLA-----GHTSWIWSLAASADGRLMATGSADRSVR 1050

Query: 1089 VWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            +W+    + + +L      H G +  +  S D   L  GS D T+++W+F
Sbjct: 1051 IWEVATGRCLKHL----EEHGGWVWSVAFSPDERRLAVGSMDGTIRLWSF 1096



 Score =  107 bits (267), Expect = 6e-22
 Identities = 89/306 (29%), Positives = 135/306 (44%), Gaps = 1/306 (0%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H   V +L ++P+   +  A   G + +    + ++         WV   AFSP  + +A
Sbjct: 565  HFCGVLALAFSPDGRWLAMADTRGEVRLCLVQSREQRFVCAGHSGWVEGLAFSPDSEILA 624

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG-DKTCG 674
              GLD    ++ +        +  +  TL+GH   V +  + P  D HLI S   D T  
Sbjct: 625  SAGLDGTIRLWQVV-------SGQLQATLTGHNKGVRSVAFAP--DGHLIASGSLDGTIK 675

Query: 675  LWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVR 854
            LWD  +G           +GH   V+SV + + +     SGS D T   W   V  R +R
Sbjct: 676  LWDAQSGQCRLTL-----TGHRNVVASV-VWSPDGQYLASGSNDGTVKFWRP-VGGRCLR 728

Query: 855  TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIA 1034
            T  GH  +V +V F PD     +GS DGT R++D   G   Q  S  H D    +V ++A
Sbjct: 729  TLRGHTDEVWSVAFGPDSRTLLSGSSDGTLRMWDTHGGTCKQALS-GHQD----KVRTVA 783

Query: 1035 FSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWD 1214
            +S+ G+ L +G  +    VW+           S+   H G I  +  + DG  L TGS D
Sbjct: 784  WSLDGQRLASGSWDATVRVWNA-----DGRCQSILRGHSGIIRSVAFAPDGGLLATGSID 838

Query: 1215 TTLKIW 1232
             T+K+W
Sbjct: 839  QTVKLW 844



 Score =  104 bits (260), Expect = 4e-21
 Identities = 87/310 (28%), Positives = 141/310 (45%), Gaps = 3/310 (0%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH+G V  L ++P+   + SA  DG + +W  ++ Q    +      V + AF+P G  +
Sbjct: 606  GHSGWVEGLAFSPDSEILASAGLDGTIRLWQVVSGQLQATLTGHNKGVRSVAFAPDGHLI 665

Query: 495  ACGGLDSVCSIFNLNLPPDNDGNSTVSR-TLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            A G LD    ++        D  S   R TL+GH+  V++  + P +  +L + S D T 
Sbjct: 666  ASGSLDGTIKLW--------DAQSGQCRLTLTGHRNVVASVVWSP-DGQYLASGSNDGTV 716

Query: 672  GLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
              W    G  LRT         GHT +V SV+    +  + +SGS D T  +WDT     
Sbjct: 717  KFWRPVGGRCLRT-------LRGHTDEVWSVAFGPDSRTL-LSGSSDGTLRMWDTH-GGT 767

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
              +   GH+  V  V +  DG R  +GS D T R+++     + Q   + HS      + 
Sbjct: 768  CKQALSGHQDKVRTVAWSLDGQRLASGSWDATVRVWN--ADGRCQSILRGHSG----IIR 821

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            S+AF+  G LL  G  +    +WD    + V +       H G ++ + + G G+ L +G
Sbjct: 822  SVAFAPDGGLLATGSIDQTVKLWDLQSGQCVYSF----KGHSGGVAAVAVGGHGT-LASG 876

Query: 1206 SWDTTLKIWA 1235
              D  ++IW+
Sbjct: 877  DADHRVRIWS 886



 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 71/228 (31%), Positives = 111/228 (48%), Gaps = 3/228 (1%)
 Frame = +3

Query: 585  SGHKGYVSACQYVPNEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVS 761
            +GH G+V    + P  D+ ++ S+G D T  LW + +G   +       +GH   V SV+
Sbjct: 605  AGHSGWVEGLAFSP--DSEILASAGLDGTIRLWQVVSGQLQATL-----TGHNKGVRSVA 657

Query: 762  ISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGT 941
              A + ++  SGS D T  LWD + + +   T  GH   V +V + PDG    +GS+DGT
Sbjct: 658  F-APDGHLIASGSLDGTIKLWDAQ-SGQCRLTLTGHRNVVASVVWSPDGQYLASGSNDGT 715

Query: 942  CRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTL--LAKM 1115
             + +    G  L+   + H+D     V S+AF    R L +G ++G   +WDT     K 
Sbjct: 716  VKFWRPVGGRCLRTL-RGHTDE----VWSVAFGPDSRTLLSGSSDGTLRMWDTHGGTCKQ 770

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQVI 1259
             L+       H  ++  +  S DG  L +GSWD T+++W   G  Q I
Sbjct: 771  ALS------GHQDKVRTVAWSLDGQRLASGSWDATVRVWNADGRCQSI 812



 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 84/344 (24%), Positives = 134/344 (38%), Gaps = 36/344 (10%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH   V S+ + P+ + I S S DG + +W+A + Q    +      V +  +SP GQ
Sbjct: 646  LTGHNKGVRSVAFAPDGHLIASGSLDGTIKLWDAQSGQCRLTLTGHRNVVASVVWSPDGQ 705

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A G  D     +               RTL GH   V +  + P +   L++ S D T
Sbjct: 706  YLASGSNDGTVKFW-------RPVGGRCLRTLRGHTDEVWSVAFGP-DSRTLLSGSSDGT 757

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              +WD   G           SGH   V +V+ S     +  SGS D T  +W+     R 
Sbjct: 758  LRMWDTHGGTCKQAL-----SGHQDKVRTVAWSLDGQRL-ASGSWDATVRVWN--ADGRC 809

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG-------------------- 968
                 GH G + +V F PDG    TGS D T +L+D+++G                    
Sbjct: 810  QSILRGHSGIIRSVAFAPDGGLLATGSIDQTVKLWDLQSGQCVYSFKGHSGGVAAVAVGG 869

Query: 969  ----------HQLQVYSQPHS------DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDT 1100
                      H+++++S              H + S+AF+  G  L +   +    +WD 
Sbjct: 870  HGTLASGDADHRVRIWSTEDGRCTRVLSGHTHPIWSVAFAPGGATLASASADHAVRLWDG 929

Query: 1101 LLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
               +       +   H   +  +  S DG  L +G  D T+++W
Sbjct: 930  ASGRCT----HILQGHTSWVWSVAFSPDGRRLASGGADRTVRLW 969



>pir|AE1861|AE1861 serine/threonine kinase with WD-40 repeat
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_681430 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 677

 Score =  120 bits (300), Expect = 9e-26
 Identities = 84/302 (27%), Positives = 135/302 (44%)
 Frame = +3

Query: 336  SLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDS 515
            SL  +P    I S   D  + +W   T +   ++K     V    FSP G+++  GG D+
Sbjct: 399  SLAISPNGQIIASCGSDRTIKIWQLATGEDISSLKGHSRKVNAVVFSPDGKTLVSGGDDN 458

Query: 516  VCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTG 695
               I+NL           V RT++GH   V      PN    L++ S D T  +W++ TG
Sbjct: 459  TIKIWNLK-------TGKVIRTITGHSDAVHTLAISPNGKT-LVSGSDDNTVKVWNLNTG 510

Query: 696  LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEG 875
               +       +GHT  V SV+IS    N+  SGS D T  +W+    +    T  G+  
Sbjct: 511  RLINTL-----TGHTFWVRSVAISPDGVNI-ASGSFDKTVKIWNLETGT-LTHTLAGNGE 563

Query: 876  DVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRL 1055
             V ++ F PDGN   + S D T +++ +  G +++             +TSIAFS  G  
Sbjct: 564  TVTSIAFNPDGNTLASASRDRTIKIWKVGAGTRVRTLK-----GSTETITSIAFSPDGNT 618

Query: 1056 LFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
            L +   +    +W+    K +  L      H+  ++ +  + DG+ L +GS D T++IW 
Sbjct: 619  LASASRDQTIKLWNLETGKEIRTL----EGHENTVTTVAFTPDGANLVSGSGDNTMRIWR 674

Query: 1236 FG 1241
             G
Sbjct: 675  IG 676



 Score =  110 bits (274), Expect = 9e-23
 Identities = 73/263 (27%), Positives = 128/263 (48%)
 Frame = +3

Query: 306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            +L+GH+ KV ++ ++P+   +VS   D  + +WN  T +    I      V T A SP G
Sbjct: 431  SLKGHSRKVNAVVFSPDGKTLVSGGDDNTIKIWNLKTGKVIRTITGHSDAVHTLAISPNG 490

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
            +++  G  D+   ++NLN          +  TL+GH  +V +    P +  ++ + S DK
Sbjct: 491  KTLVSGSDDNTVKVWNLN-------TGRLINTLTGHTFWVRSVAISP-DGVNIASGSFDK 542

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  +W++ TG  T    G   +G T  V+S++ +    N   S S D T  +W     +R
Sbjct: 543  TVKIWNLETGTLTHTLAG---NGET--VTSIAFNPDG-NTLASASRDRTIKIWKVGAGTR 596

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             VRT  G    + ++ F PDGN   + S D T +L+++ TG +++       +   + VT
Sbjct: 597  -VRTLKGSTETITSIAFSPDGNTLASASRDQTIKLWNLETGKEIRTL-----EGHENTVT 650

Query: 1026 SIAFSISGRLLFAGYTNGDCYVW 1094
            ++AF+  G  L +G  +    +W
Sbjct: 651  TVAFTPDGANLVSGSGDNTMRIW 673



 Score =  106 bits (265), Expect = 1e-21
 Identities = 73/243 (30%), Positives = 114/243 (46%), Gaps = 9/243 (3%)
 Frame = +3

Query: 258  GKTPISFGPTDLVCCRNLQ---------GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNA 410
            GKT +S G  + +   NL+         GH+  V++L  +P    +VS S D  + VWN 
Sbjct: 448  GKTLVSGGDDNTIKIWNLKTGKVIRTITGHSDAVHTLAISPNGKTLVSGSDDNTVKVWNL 507

Query: 411  LTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSG 590
             T +  + +     WV + A SP G ++A G  D    I+NL          T++ TL+G
Sbjct: 508  NTGRLINTLTGHTFWVRSVAISPDGVNIASGSFDKTVKIWNLE-------TGTLTHTLAG 560

Query: 591  HKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISA 770
            +   V++  + P+ +  L ++S D+T  +W +  G R          G T  ++S++ S 
Sbjct: 561  NGETVTSIAFNPDGNT-LASASRDRTIKIWKVGAGTRVRTL-----KGSTETITSIAFSP 614

Query: 771  SNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
               N   S S D T  LW+     + +RT  GHE  V  V F PDG    +GS D T R+
Sbjct: 615  DG-NTLASASRDQTIKLWNLE-TGKEIRTLEGHENTVTTVAFTPDGANLVSGSGDNTMRI 672

Query: 951  FDI 959
            + I
Sbjct: 673  WRI 675



 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 62/243 (25%), Positives = 107/243 (44%), Gaps = 3/243 (1%)
 Frame = +3

Query: 537  NLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFG 716
            N  PD D N+ VS  +S +   +++C               D+T  +W + TG   S   
Sbjct: 388  NTLPD-DENAFVSLAISPNGQIIASC-------------GSDRTIKIWQLATGEDISSL- 432

Query: 717  GEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKF 896
                 GH+  V++V  S     + VSG  D T  +W+ +   + +RT  GH   V  +  
Sbjct: 433  ----KGHSRKVNAVVFSPDGKTL-VSGGDDNTIKIWNLKTG-KVIRTITGHSDAVHTLAI 486

Query: 897  FPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTN 1076
             P+G    +GSDD T +++++ TG  +   +          V S+A S  G  + +G  +
Sbjct: 487  SPNGKTLVSGSDDNTVKVWNLNTGRLINTLT-----GHTFWVRSVAISPDGVNIASGSFD 541

Query: 1077 GDCYVWDTLLAKMVLNLGSLQNSHDGR---ISCLGLSGDGSALCTGSWDTTLKIWAFGGY 1247
                +W+       L  G+L ++  G    ++ +  + DG+ L + S D T+KIW  G  
Sbjct: 542  KTVKIWN-------LETGTLTHTLAGNGETVTSIAFNPDGNTLASASRDRTIKIWKVGAG 594

Query: 1248 RQV 1256
             +V
Sbjct: 595  TRV 597



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 56/184 (30%), Positives = 87/184 (47%), Gaps = 3/184 (1%)
 Frame = +3

Query: 690  TGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGH 869
            T LRT            A VS ++IS  N  +  S   D T  +W        + +  GH
Sbjct: 379  TTLRTISLANTLPDDENAFVS-LAISP-NGQIIASCGSDRTIKIWQL-ATGEDISSLKGH 435

Query: 870  EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISG 1049
               V AV F PDG    +G DD T ++++++TG  ++  +  HSD     V ++A S +G
Sbjct: 436  SRKVNAVVFSPDGKTLVSGGDDNTIKIWNLKTGKVIRTIT-GHSD----AVHTLAISPNG 490

Query: 1050 RLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR---ISCLGLSGDGSALCTGSWDTT 1220
            + L +G  +    VW+       LN G L N+  G    +  + +S DG  + +GS+D T
Sbjct: 491  KTLVSGSDDNTVKVWN-------LNTGRLINTLTGHTFWVRSVAISPDGVNIASGSFDKT 543

Query: 1221 LKIW 1232
            +KIW
Sbjct: 544  VKIW 547



>gb:MMU38505_2121134 Mus musculus G protein beta 2 subunit mRNA,
            partial cds.
          Length = 116

 Score =  119 bits (299), Expect = 1e-25
 Identities = 63/121 (52%), Positives = 81/121 (66%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH+ DV S+S+ A +   FVSG+CD +  LWD R  S   +TF GHE D+ AV FFP+G 
Sbjct: 1    GHSGDVMSLSL-APDGRTFVSGACDASIKLWDVR-DSMCRQTFIGHESDINAVAFFPNGY 58

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
             F TGSDD TCRLFD+R   +L +YS    DN +  +TS+AFS SGRLL AGY + +C +
Sbjct: 59   AFTTGSDDATCRLFDLRADQELLMYSH---DNIICGITSVAFSRSGRLLLAGYDDFNCNI 115

Query: 1092 W 1094
            W
Sbjct: 116  W 116



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 21/74 (28%), Positives = 33/74 (44%)
 Frame = +3

Query: 315 GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
           GH+G V SL   P+    VS + D  + +W+   S          + +   AF P G + 
Sbjct: 1   GHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAF 60

Query: 495 ACGGLDSVCSIFNL 536
             G  D+ C +F+L
Sbjct: 61  TTGSDDATCRLFDL 74



>pir|AI2493|AI2493 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120) plasmid pCC7120alpha>gb:BA000020_686489 Nostoc
            sp. PCC 7120 plasmid pCC7120alpha DNA, complete genome.
          Length = 1189

 Score =  118 bits (296), Expect = 3e-25
 Identities = 89/319 (27%), Positives = 148/319 (46%), Gaps = 6/319 (1%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   L GHT  V S+ ++PE   + S+S D  + VW+  T +         A V +  F 
Sbjct: 638  CFNTLHGHTSIVTSVAFSPEGKLLASSSYDHSVKVWDLDTGECLQTFLGHDACVWSVVFH 697

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS- 653
            P GQ +A  G D+   ++ L        +    +TL GH+ +V    +  N    ++ S 
Sbjct: 698  PVGQILATAGEDNTIKLWELQ-------SGCCLKTLQGHQHWVKTIAF--NSGGRILASG 748

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S D+   LWDI TG            GHT  V+SV+ +  + N+ +SGS D +  +WD R
Sbjct: 749  SFDQNVKLWDIHTGKCVMTL-----QGHTGVVTSVAFNPKD-NLLLSGSYDQSVKVWD-R 801

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               R + T   H   + +V F P G+ F +G DD   +++++ TG  ++ + Q HS    
Sbjct: 802  KTGRCLDTLKKHTNRIWSVAFHPQGHLFVSGGDDHAAKIWELGTGQCIKTF-QGHS---- 856

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLL-----AKMVLNLGSLQNSHDGRISCLGLS 1178
            +   +IA +    LL +G+ +    +WD  L     + +  +   +   H  R+  +  S
Sbjct: 857  NATYTIAHNWEHSLLASGHEDQTIKLWDLNLHSPHKSNVNTHPFRILQGHSNRVFSVVFS 916

Query: 1179 GDGSALCTGSWDTTLKIWA 1235
              G  L +GS D T+K+W+
Sbjct: 917  STGQLLASGSADRTIKLWS 935



 Score =  114 bits (284), Expect = 6e-24
 Identities = 91/323 (28%), Positives = 140/323 (43%), Gaps = 8/323 (2%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   LQGHTG V S+ + P+ N ++S S D  + VW+  T +    +K     + + AF 
Sbjct: 764  CVMTLQGHTGVVTSVAFNPKDNLLLSGSYDQSVKVWDRKTGRCLDTLKKHTNRIWSVAFH 823

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G     GG D    I+ L       G     +T  GH    +A   + +   H + +S
Sbjct: 824  PQGHLFVSGGDDHAAKIWEL-------GTGQCIKTFQGHS---NATYTIAHNWEHSLLAS 873

Query: 657  G--DKTCGLWDIT------TGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            G  D+T  LWD+       + + T  F      GH+  V SV + +S   +  SGS D T
Sbjct: 874  GHEDQTIKLWDLNLHSPHKSNVNTHPF--RILQGHSNRVFSV-VFSSTGQLLASGSADRT 930

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
              LW      + + T HGH   V A+ F  D     +GS D T +++D+ +G  LQ   Q
Sbjct: 931  IKLWSPH-TGQCLHTLHGHGSWVWAIAFSLDDKLLASGSYDHTVKIWDVSSGQCLQTL-Q 988

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
             H  +    V ++AFS  G+ LF+         WD      +        +   R+  + 
Sbjct: 989  GHPGS----VLAVAFSCDGKTLFSSGYEKLVKQWDVETGYCL----QTWEADSNRVWAVA 1040

Query: 1173 LSGDGSALCTGSWDTTLKIWAFG 1241
            +S D   L TG  D+ +++W  G
Sbjct: 1041 VSRDNQYLATGGDDSVVRLWDIG 1063



 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 81/311 (26%), Positives = 127/311 (40%), Gaps = 1/311 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R LQGH+ +V+S+ ++     + S S D  + +W+  T Q  H +    +WV   AFS  
Sbjct: 901  RILQGHSNRVFSVVFSSTGQLLASGSADRTIKLWSPHTGQCLHTLHGHGSWVWAIAFSLD 960

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
             + +A G  D    I++++       +    +TL GH G V A  +  + D   + SSG 
Sbjct: 961  DKLLASGSYDHTVKIWDVS-------SGQCLQTLQGHPGSVLAVAF--SCDGKTLFSSGY 1011

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            +K    WD+ TG     +  +        V +V++S  N  +   G  D+   LWD    
Sbjct: 1012 EKLVKQWDVETGYCLQTWEADSNR-----VWAVAVSRDNQYLATGGD-DSVVRLWDIGKG 1065

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
               VRTF GH   VI + F  DG R  + S D T +++++ T                  
Sbjct: 1066 V-CVRTFSGHTSQVICILFTKDGRRMISSSSDRTIKIWNVST------------------ 1106

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
                               G+C             L +LQ +HD  +  L L+ D   L 
Sbjct: 1107 -------------------GEC-------------LATLQ-AHDHWVWSLYLTPDEKTLL 1133

Query: 1200 TGSWDTTLKIW 1232
            + SWD T+K W
Sbjct: 1134 SSSWDETIKCW 1144



 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 77/306 (25%), Positives = 126/306 (41%)
 Frame = +3

Query: 324  GKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACG 503
            G + S+ ++ +  ++ ++   G + +W+    ++    +   +W+   AFS     +A  
Sbjct: 563  GGITSVAFSRDGCQLATSDTSGVINIWDVNNGKQLFNCQEHNSWIWDVAFSSVAPVLASC 622

Query: 504  GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWD 683
            G D    ++N               TL GH   V++  + P E   L +SS D +  +WD
Sbjct: 623  GQDHTIKLWNTT-------TGECFNTLHGHTSIVTSVAFSP-EGKLLASSSYDHSVKVWD 674

Query: 684  ITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFH 863
            + TG     F      GH A V SV        +  +G  D T  LW+ + +   ++T  
Sbjct: 675  LDTGECLQTF-----LGHDACVWSVVFHPVGQILATAGE-DNTIKLWELQ-SGCCLKTLQ 727

Query: 864  GHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSI 1043
            GH+  V  + F   G    +GS D   +L+DI TG  +    Q H+      VTS+AF+ 
Sbjct: 728  GHQHWVKTIAFNSGGRILASGSFDQNVKLWDIHTGKCVMTL-QGHTG----VVTSVAFNP 782

Query: 1044 SGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTL 1223
               LL +G  +    VWD    + +  L      H  RI  +     G    +G  D   
Sbjct: 783  KDNLLLSGSYDQSVKVWDRKTGRCLDTL----KKHTNRIWSVAFHPQGHLFVSGGDDHAA 838

Query: 1224 KIWAFG 1241
            KIW  G
Sbjct: 839  KIWELG 844



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 20/82 (24%), Positives = 40/82 (48%)
 Frame = +3

Query: 294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
            VC R   GHT +V  + +T +  R++S+S D  + +WN  T +    ++    WV +   
Sbjct: 1066 VCVRTFSGHTSQVICILFTKDGRRMISSSSDRTIKIWNVSTGECLATLQAHDHWVWSLYL 1125

Query: 474  SPTGQSVACGGLDSVCSIFNLN 539
            +P  +++     D     +N++
Sbjct: 1126 TPDEKTLLSSSWDETIKCWNIS 1147



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 38/168 (22%), Positives = 65/168 (38%), Gaps = 35/168 (20%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C + LQGH G V ++ ++ +   + S+  +  +  W+  T       +     V   A S
Sbjct: 983  CLQTLQGHPGSVLAVAFSCDGKTLFSSGYEKLVKQWDVETGYCLQTWEADSNRVWAVAVS 1042

Query: 477  PTGQSVACGGLDSVCSIFNLN-----------------LPPDNDGNSTVSR--------- 578
               Q +A GG DSV  ++++                  +    DG   +S          
Sbjct: 1043 RDNQYLATGGDDSVVRLWDIGKGVCVRTFSGHTSQVICILFTKDGRRMISSSSDRTIKIW 1102

Query: 579  ---------TLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTG 695
                     TL  H  +V +    P+E   L++SS D+T   W+I+TG
Sbjct: 1103 NVSTGECLATLQAHDHWVWSLYLTPDEKT-LLSSSWDETIKCWNISTG 1149



>pir|AD1842|AD1842 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681276 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1711

 Score =  117 bits (292), Expect = 8e-25
 Identities = 98/317 (30%), Positives = 151/317 (47%), Gaps = 4/317 (1%)
 Frame = +3

Query: 306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            +L GH+  V S+ ++PE + I SAS DG + +W +L  +    I      V+   FSP G
Sbjct: 1224 SLNGHSQGVNSIKFSPEGDTIASASDDGTIRLW-SLDGRPLITIPSHTKQVLAVTFSPDG 1282

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TSSGD 662
            Q++   G D+   +++         N T+  TL GH   V   Q + + D  LI T+S D
Sbjct: 1283 QTIVSAGADNTVKLWS--------RNGTLLTTLEGHNEAV--WQVIFSPDGRLIATASAD 1332

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  LW      R     G + +GH  +V+S+S S    N+  SGS D T  LW   V  
Sbjct: 1333 KTITLWS-----RDGNILGTF-AGHNHEVNSLSFSPDG-NILASGSDDNTVRLW--TVNR 1383

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
               +TF+GH+G V  V+F  DG +  + S D T + + +  G  LQ  S P  D     V
Sbjct: 1384 TLPKTFYGHKGSVSYVRFSNDGKKITSLSTDSTMKTWSL-DGKLLQTLSSPLPD-----V 1437

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNS---HDGRISCLGLSGDGSA 1193
            TSI+F+   +++     +   ++++          G L  S   H+  I+ L  S +   
Sbjct: 1438 TSISFTPDNKIVALASPDHTIHLYN--------RQGGLLRSLPGHNHWITSLSFSPNKQI 1489

Query: 1194 LCTGSWDTTLKIWAFGG 1244
            L +GS D T+K+W+  G
Sbjct: 1490 LASGSADKTIKLWSVNG 1506



 Score =  110 bits (275), Expect = 7e-23
 Identities = 81/314 (25%), Positives = 139/314 (44%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            +   GH G V  + ++ +  +I S S D  +  W+ L  +    +  P   V + +F+P 
Sbjct: 1387 KTFYGHKGSVSYVRFSNDGKKITSLSTDSTMKTWS-LDGKLLQTLSSPLPDVTSISFTPD 1445

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
             + VA    D    ++N            + R+L GH  ++++  + PN+   L + S D
Sbjct: 1446 NKIVALASPDHTIHLYNRQ--------GGLLRSLPGHNHWITSLSFSPNKQI-LASGSAD 1496

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  LW +   L  ++ G      H   V+ +  SA   N+ VS S D T  +W   +  
Sbjct: 1497 KTIKLWSVNGRLLKTLLG------HNGWVTDIKFSADGKNI-VSASADKTIKIWS--LDG 1547

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            R +RT  GH   V +V   PDG    + S D T +L+++    +L    + HSD     V
Sbjct: 1548 RLIRTLQGHSASVWSVNLSPDGQTLASTSQDETIKLWNLNG--ELIYTLRGHSDV----V 1601

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             +++FS  G+ + +   +G   +W+     ++         H G +  +  S DG  L +
Sbjct: 1602 YNLSFSPDGKTIASASDDGTIKLWNVPNGTLLKTF----QGHRGGVRSVSFSPDGKILAS 1657

Query: 1203 GSWDTTLKIWAFGG 1244
            G  DTT+K+W   G
Sbjct: 1658 GGHDTTVKVWNLEG 1671



 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 77/276 (27%), Positives = 130/276 (47%), Gaps = 5/276 (1%)
 Frame = +3

Query: 330  VYSLDWTPEKNRIVSASQDGRLIVWNA----LTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            V S+ +TP+   +  AS D  + ++N     L S   H       W+ + +FSP  Q +A
Sbjct: 1437 VTSISFTPDNKIVALASPDHTIHLYNRQGGLLRSLPGHN-----HWITSLSFSPNKQILA 1491

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
             G  D    ++++N          + +TL GH G+V+  ++   +  +++++S DKT  +
Sbjct: 1492 SGSADKTIKLWSVN--------GRLLKTLLGHNGWVTDIKFSA-DGKNIVSASADKTIKI 1542

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            W +   L  ++       GH+A V SV++S     +  S S D T  LW+       + T
Sbjct: 1543 WSLDGRLIRTL------QGHSASVWSVNLSPDGQTL-ASTSQDETIKLWNLN--GELIYT 1593

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAF 1037
              GH   V  + F PDG    + SDDGT +L+++  G  L+ + Q H       V S++F
Sbjct: 1594 LRGHSDVVYNLSFSPDGKTIASASDDGTIKLWNVPNGTLLKTF-QGHRGG----VRSVSF 1648

Query: 1038 SISGRLLFAGYTNGDCYVWDTL-LAKMVLNLGSLQN 1142
            S  G++L +G  +    VW+   +    LNL  L N
Sbjct: 1649 SPDGKILASGGHDTTVKVWNLEGIELQTLNLDELLN 1684



 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 84/312 (26%), Positives = 134/312 (42%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH   V S+ ++P+   + SAS D  + +W     Q    +K     V + +FSP G+
Sbjct: 1143 LTGHNDGVNSVSFSPDGEILASASADSTIKLWQR-NGQLITTLKGHDQGVKSVSFSPNGE 1201

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A G  D   ++++        G   +S  L+GH   V++ ++ P  D  + ++S D T
Sbjct: 1202 IIASGSSDHTINLWS------RAGKLLLS--LNGHSQGVNSIKFSPEGDT-IASASDDGT 1252

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW +      ++        HT  V +V+ S     + VS   D T  LW        
Sbjct: 1253 IRLWSLDGRPLITI------PSHTKQVLAVTFSPDGQTI-VSAGADNTVKLWSRN--GTL 1303

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T  GH   V  V F PDG    T S D T  L+  R G+ L  ++        H V S
Sbjct: 1304 LTTLEGHNEAVWQVIFSPDGRLIATASADKTITLWS-RDGNILGTFA-----GHNHEVNS 1357

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            ++FS  G +L +G  +    +W      +   L      H G +S +  S DG  + + S
Sbjct: 1358 LSFSPDGNILASGSDDNTVRLW-----TVNRTLPKTFYGHKGSVSYVRFSNDGKKITSLS 1412

Query: 1209 WDTTLKIWAFGG 1244
             D+T+K W+  G
Sbjct: 1413 TDSTMKTWSLDG 1424



 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 74/268 (27%), Positives = 124/268 (46%), Gaps = 3/268 (1%)
 Frame = +3

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
            AWV + ++SP G+ +A G +D+   ++        DG   +  TL+GH   V++  + P+
Sbjct: 1107 AWVTSVSYSPDGEVIASGSVDNTIHLWR------RDGK--LLTTLTGHNDGVNSVSFSPD 1158

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             +  L ++S D T  LW     L T++       GH   V SVS S  N  +  SGS D 
Sbjct: 1159 GEI-LASASADSTIKLWQRNGQLITTL------KGHDQGVKSVSFS-PNGEIIASGSSDH 1210

Query: 810  TACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS 989
            T  LW    A + + + +GH   V ++KF P+G+   + SDDGT RL+ +     + + S
Sbjct: 1211 TINLWSR--AGKLLLSLNGHSQGVNSIKFSPEGDTIASASDDGTIRLWSLDGRPLITIPS 1268

Query: 990  QPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWD---TLLAKMVLNLGSLQNSHDGRI 1160
                     +V ++ FS  G+ + +   +    +W    TLL  +          H+  +
Sbjct: 1269 ------HTKQVLAVTFSPDGQTIVSAGADNTVKLWSRNGTLLTTL--------EGHNEAV 1314

Query: 1161 SCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
              +  S DG  + T S D T+ +W+  G
Sbjct: 1315 WQVIFSPDGRLIATASADKTITLWSRDG 1342



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 67/248 (27%), Positives = 109/248 (43%), Gaps = 10/248 (4%)
 Frame = +3

Query: 531  NLNLPPDNDGNS----------TVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLW 680
            +L +PPD    +          T  R    H  +V++  Y P+ +  + + S D T  LW
Sbjct: 1075 SLGIPPDTRTQTATILQQAVYNTQERNRLLHNAWVTSVSYSPDGEV-IASGSVDNTIHLW 1133

Query: 681  DITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTF 860
                 L T++      +GH   V+SVS S     +  S S D+T  LW      + + T 
Sbjct: 1134 RRDGKLLTTL------TGHNDGVNSVSFSPDG-EILASASADSTIKLWQRN--GQLITTL 1184

Query: 861  HGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFS 1040
             GH+  V +V F P+G    +GS D T  L+  R G +L +    HS      V SI FS
Sbjct: 1185 KGHDQGVKSVSFSPNGEIIASGSSDHTINLWS-RAG-KLLLSLNGHSQG----VNSIKFS 1238

Query: 1041 ISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTT 1220
              G  + +   +G   +W +L  + ++ +     SH  ++  +  S DG  + +   D T
Sbjct: 1239 PEGDTIASASDDGTIRLW-SLDGRPLITI----PSHTKQVLAVTFSPDGQTIVSAGADNT 1293

Query: 1221 LKIWAFGG 1244
            +K+W+  G
Sbjct: 1294 VKLWSRNG 1301



>pir|AH2195|AH2195 hypothetical protein alr3119 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_684108 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 676

 Score =  116 bits (291), Expect = 1e-24
 Identities = 89/310 (28%), Positives = 142/310 (45%), Gaps = 2/310 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH   V S+ ++P    + S S D  + VWN    QK H +     WV   AFSP G+
Sbjct: 387  LKGHASDVNSVAFSPNGEFLASGSDDKTIKVWNLKNKQKIHTLPGHSGWVWAIAFSPDGK 446

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            ++A  G D    ++NL             R L GH   V++  + P +   L + S DKT
Sbjct: 447  TLASTGADKTIKLWNL-------ATGKEIRHLKGHSQGVASVAFSP-DGKTLASGSLDKT 498

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW+  TG             H++ V++V+ S     +  SGS D T  LW+    S+ 
Sbjct: 499  IKLWNPATGKEIRTL-----QEHSSGVANVAFSPDGKTL-ASGSWDKTIKLWNL-TTSKV 551

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T  GH   V++V F  D     +GS D T +L+++ TG  ++   + HSD    +V S
Sbjct: 552  IHTLKGHSDLVMSVAFNSDSQTLASGSKDKTIKLWNLSTGKTIRTL-RGHSD----KVNS 606

Query: 1029 IAF-SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT- 1202
            +A+      +L +G  +    +W+    +++  L        G I  + +S DG  L + 
Sbjct: 607  VAYVPRDSTVLASGSNDNTIKLWNLTTGEIIRTL----KRDSGYIYSIVISPDGRNLASG 662

Query: 1203 GSWDTTLKIW 1232
            GS +  +KIW
Sbjct: 663  GSAENIIKIW 672



 Score =  107 bits (268), Expect = 5e-22
 Identities = 81/274 (29%), Positives = 128/274 (46%), Gaps = 2/274 (0%)
 Frame = +3

Query: 417  SQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHK 596
            S + + +K   + V + AFSP G+ +A G  D    ++NL        N     TL GH 
Sbjct: 381  STQPYTLKGHASDVNSVAFSPNGEFLASGSDDKTIKVWNLK-------NKQKIHTLPGHS 433

Query: 597  GYVSACQYVPNEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISAS 773
            G+V A  + P  D   + S+G DKT  LW++ TG         +  GH+  V+SV+ S  
Sbjct: 434  GWVWAIAFSP--DGKTLASTGADKTIKLWNLATGKEI-----RHLKGHSQGVASVAFSPD 486

Query: 774  NTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
               +  SGS D T  LW+     + +RT   H   V  V F PDG    +GS D T +L+
Sbjct: 487  GKTL-ASGSLDKTIKLWNP-ATGKEIRTLQEHSSGVANVAFSPDGKTLASGSWDKTIKLW 544

Query: 954  DIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGS 1133
            ++ T   +    + HSD     V S+AF+   + L +G  +    +W+    K +  L  
Sbjct: 545  NLTTSKVIHTL-KGHSD----LVMSVAFNSDSQTLASGSKDKTIKLWNLSTGKTIRTL-- 597

Query: 1134 LQNSHDGRISCLG-LSGDGSALCTGSWDTTLKIW 1232
                H  +++ +  +  D + L +GS D T+K+W
Sbjct: 598  --RGHSDKVNSVAYVPRDSTVLASGSNDNTIKLW 629



 Score = 94.0 bits (232), Expect = 7e-18
 Identities = 63/211 (29%), Positives = 103/211 (48%), Gaps = 3/211 (1%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R+L+GH+  V S+ ++P+   + S S D  + +WN  T ++   ++   + V   AFSP 
Sbjct: 469  RHLKGHSQGVASVAFSPDGKTLASGSLDKTIKLWNPATGKEIRTLQEHSSGVANVAFSPD 528

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
            G+++A G  D    ++NL         S V  TL GH   V +  +  N D+  + S S 
Sbjct: 529  GKTLASGSWDKTIKLWNLT-------TSKVIHTLKGHSDLVMSVAF--NSDSQTLASGSK 579

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            DKT  LW+++TG  +RT         GH+  V+SV+    ++ +  SGS D T  LW+  
Sbjct: 580  DKTIKLWNLSTGKTIRT-------LRGHSDKVNSVAYVPRDSTVLASGSNDNTIKLWNL- 631

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTG 926
                 +RT     G + ++   PDG    +G
Sbjct: 632  TTGEIIRTLKRDSGYIYSIVISPDGRNLASG 662



>pir|AG1889|AG1889 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681656 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 934

 Score =  116 bits (291), Expect = 1e-24
 Identities = 88/317 (27%), Positives = 150/317 (47%), Gaps = 2/317 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH   V  + ++P+   + +AS D  + +W+    +  H ++     V +  FSP GQ
Sbjct: 405  LDGHKEAVLEVAFSPDSQLLATASWDNTVKLWSR-EGKLLHTLEGHKDKVNSITFSPDGQ 463

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A  G D+   ++NL      DG     RT  GH+  + +  + P +   + T+SGD+T
Sbjct: 464  LIATVGWDNTMKLWNL------DGKEL--RTFRGHQDMIWSVSFSP-DGKQIATASGDRT 514

Query: 669  CGLWDITTGLRTSVFGGEYQS--GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              LW        S+ G E Q+  GH   V+SV+ S     +  + S D T  LW+++   
Sbjct: 515  VKLW--------SLDGKELQTLRGHQNGVNSVTFSPDG-KLIATASGDRTVKLWNSK--G 563

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            + + T +GH   V +V F PDG    T  +D T +++ + + + + V  + H D     V
Sbjct: 564  QELETLYGHTDAVNSVAFSPDGTSIATAGNDKTAKIWKLNSPNSIIV--RGHEDE----V 617

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
              + FS +G+ +     +    +W +++   +  L +  N H GR++ L  S DG  + T
Sbjct: 618  FDLVFSPNGKYIATASWDKTAKLW-SIVGDKLQELRTF-NGHQGRVNKLSFSPDGKYIAT 675

Query: 1203 GSWDTTLKIWAFGGYRQ 1253
             SWD T K+W   G  Q
Sbjct: 676  TSWDKTAKLWNLDGTLQ 692



 Score =  113 bits (283), Expect = 8e-24
 Identities = 100/340 (29%), Positives = 150/340 (44%), Gaps = 7/340 (2%)
 Frame = +3

Query: 246  ARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQK 425
            A + G   +     D    + L+GH   V S+ ++P+   I +AS D  + +WN+   Q+
Sbjct: 507  ATASGDRTVKLWSLDGKELQTLRGHQNGVNSVTFSPDGKLIATASGDRTVKLWNS-KGQE 565

Query: 426  THAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYV 605
               +      V + AFSP G S+A  G D    I+ LN P     NS + R   GH+  V
Sbjct: 566  LETLYGHTDAVNSVAFSPDGTSIATAGNDKTAKIWKLNSP-----NSIIVR---GHEDEV 617

Query: 606  SACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ-----SGHTADVSSVSISA 770
                + PN   ++ T+S DKT  LW        S+ G + Q     +GH   V+ +S S 
Sbjct: 618  FDLVFSPN-GKYIATASWDKTAKLW--------SIVGDKLQELRTFNGHQGRVNKLSFSP 668

Query: 771  SNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
                   + S D TA LW+  +     +T  GH+  V +V F PDG    T S+D T +L
Sbjct: 669  DG-KYIATTSWDKTAKLWN--LDGTLQKTLTGHKDTVWSVNFSPDGQLIATASEDKTVKL 725

Query: 951  FDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVW--DTLLAKMVLN 1124
            ++ R G  L+   +  S      V S  FS  G+L+     +    +W  D  L K +  
Sbjct: 726  WN-RDGELLKTLPRQSSV-----VNSAVFSPDGKLIATAGWDKTVKIWSIDGRLQKTL-- 777

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
                   H   I+ +  S DG  + + SWD T+KIW   G
Sbjct: 778  -----TGHTSGINSVTFSPDGKLIASASWDNTVKIWNLDG 812



 Score =  100 bits (250), Expect = 6e-20
 Identities = 87/320 (27%), Positives = 139/320 (43%), Gaps = 3/320 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R  +GH   ++S+ ++P+  +I +AS D  + +W+ L  ++   ++     V +  FSP 
Sbjct: 485  RTFRGHQDMIWSVSFSPDGKQIATASGDRTVKLWS-LDGKELQTLRGHQNGVNSVTFSPD 543

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G+ +A    D    ++N               TL GH   V++  + P +   + T+  D
Sbjct: 544  GKLIATASGDRTVKLWN--------SKGQELETLYGHTDAVNSVAFSP-DGTSIATAGND 594

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD-TRVA 839
            KT  +W + +     V       GH  +V  +  S  N     + S D TA LW      
Sbjct: 595  KTAKIWKLNSPNSIIV------RGHEDEVFDLVFSP-NGKYIATASWDKTAKLWSIVGDK 647

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + +RTF+GH+G V  + F PDG    T S D T +L+++     LQ     H D     
Sbjct: 648  LQELRTFNGHQGRVNKLSFSPDGKYIATTSWDKTAKLWNL--DGTLQKTLTGHKDT---- 701

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVW--DTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
            V S+ FS  G+L+     +    +W  D  L K +    S+ NS          S DG  
Sbjct: 702  VWSVNFSPDGQLIATASEDKTVKLWNRDGELLKTLPRQSSVVNS-------AVFSPDGKL 754

Query: 1194 LCTGSWDTTLKIWAFGGYRQ 1253
            + T  WD T+KIW+  G  Q
Sbjct: 755  IATAGWDKTVKIWSIDGRLQ 774



 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 82/318 (25%), Positives = 142/318 (44%), Gaps = 1/318 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA-WVMTCAFSPTG 485
            L  H G + S+ ++P+   I +AS+D  + +W+    ++   ++        + AFSP G
Sbjct: 321  LAEHDGMLESVSFSPDSKFIATASRDKTVKIWSLDGKKQLVVLREEKGEGFNSVAFSPDG 380

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
              +A G  D+   I++       +G      TL GHK  V    + P+    L T+S D 
Sbjct: 381  TLMATGSWDNTAKIWS------REGKRL--HTLDGHKEAVLEVAFSPDSQL-LATASWDN 431

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  LW     L  ++       GH   V+S++ S     +  +   D T  LW+  +  +
Sbjct: 432  TVKLWSREGKLLHTL------EGHKDKVNSITFSPDG-QLIATVGWDNTMKLWN--LDGK 482

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             +RTF GH+  + +V F PDG +  T S D T +L+ +  G +LQ   + H +     V 
Sbjct: 483  ELRTFRGHQDMIWSVSFSPDGKQIATASGDRTVKLWSL-DGKELQTL-RGHQNG----VN 536

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            S+ FS  G+L+     +    +W++   ++    G     H   ++ +  S DG+++ T 
Sbjct: 537  SVTFSPDGKLIATASGDRTVKLWNSKGQELETLYG-----HTDAVNSVAFSPDGTSIATA 591

Query: 1206 SWDTTLKIWAFGGYRQVI 1259
              D T KIW       +I
Sbjct: 592  GNDKTAKIWKLNSPNSII 609



 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 81/270 (30%), Positives = 126/270 (46%), Gaps = 2/270 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL-TSQKTHAIKLPCAWVMTCAFSP 479
            R   GH G+V  L ++P+   I + S D    +WN   T QKT        W +   FSP
Sbjct: 652  RTFNGHQGRVNKLSFSPDGKYIATTSWDKTAKLWNLDGTLQKTLTGHKDTVWSVN--FSP 709

Query: 480  TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG 659
             GQ +A    D    ++N       DG   + +TL      V++  + P  D  LI ++G
Sbjct: 710  DGQLIATASEDKTVKLWN------RDGE--LLKTLPRQSSVVNSAVFSP--DGKLIATAG 759

Query: 660  -DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             DKT  +W I   L+ ++      +GHT+ ++SV+ S     +  S S D T  +W+  +
Sbjct: 760  WDKTVKIWSIDGRLQKTL------TGHTSGINSVTFSPDG-KLIASASWDNTVKIWN--L 810

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
              + +RT  GH+  V  V F PDG    T S D T ++++I  G +L+   + + D    
Sbjct: 811  DGKELRTLRGHKNVVHNVTFSPDGKLIATASGDNTVKIWNI-NGQELRTL-RGYKD---- 864

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLL 1106
             V S+ FS+ G+ L  G +  D  VW   L
Sbjct: 865  AVWSLRFSLDGKTLATG-SRYDIVVWHLYL 893



>gb:BA000045_742730 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1193

 Score =  116 bits (290), Expect = 1e-24
 Identities = 86/322 (26%), Positives = 143/322 (44%), Gaps = 2/322 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA-WVMTCAF 473
            C R+ + HTG + +L  + +   + S   DG++ +W          + +  +  +   AF
Sbjct: 655  CLRSHKVHTGTIPTLAISADGEYLASGGADGQIHLWRRADGYGNSCVLVGLSRTIYGLAF 714

Query: 474  SPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
            SP G+ +   G D +  ++++        +S   R L GH  ++ +  + P+   HL+ S
Sbjct: 715  SPDGRWLVSAGADCLLRVWDVE-------SSVCLRVLGGHTDWIKSVAFSPS--GHLVAS 765

Query: 654  SG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
            +G D+T  LWD   G   +V       GHT    SV      T    SGS D +   WD 
Sbjct: 766  AGIDRTVRLWDPAGGECVAVL-----EGHTGPTLSVLFIDDTT--VASGSTDRSIRFWDV 818

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
                R  R    H+ +V+A+   P G R  +GSDD   RL+++ TG  L+          
Sbjct: 819  -ATGRCTRLIAAHDNNVMALALSPCGTRLASGSDDQAIRLWEVSTGRLLRTIC-----GR 872

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
            ++ +TS  FS  GR + AG       +WD +  +    +G     H G +  +  S D  
Sbjct: 873  INWLTSGTFSPDGRFVAAGGEYDLVLLWDRIADRQWRLVG-----HTGAVGAVVFSPDRE 927

Query: 1191 ALCTGSWDTTLKIWAFGGYRQV 1256
             L + S D T+++W+   +RQV
Sbjct: 928  HLASASADGTIRLWSLTSHRQV 949



 Score =  105 bits (262), Expect = 2e-21
 Identities = 91/349 (26%), Positives = 139/349 (39%), Gaps = 37/349 (10%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C R +  H   V +L  +P   R+ S S D  + +W   T +    I     W+ +  FS
Sbjct: 823  CTRLIAAHDNNVMALALSPCGTRLASGSDDQAIRLWEVSTGRLLRTICGRINWLTSGTFS 882

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G+ VA GG   +  ++        D  +     L GH G V A  + P+ + HL ++S
Sbjct: 883  PDGRFVAAGGEYDLVLLW--------DRIADRQWRLVGHTGAVGAVVFSPDRE-HLASAS 933

Query: 657  GDKTCGLWDITTGLRTSVFGGE-----------------------------------YQS 731
             D T  LW +T+  + ++F G                                     +S
Sbjct: 934  ADGTIRLWSLTSHRQVAIFEGHTAAIRGLAFSPDGALLVSCGYDSGVRVWQVSTGHLLRS 993

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            G    V SV++++    + V G  D  A +WD     + ++ F GH      V F PDG 
Sbjct: 994  GGEQLVDSVAVASDGKRLAV-GLIDDRAEIWDLETFEK-LQIFPGHREWAWQVAFSPDGR 1051

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR--VTSIAFSISGRLLFAGYTNGDC 1085
               +GS DGT RL+D   G  L          E HR  V  +AFS  G+ L +  T+   
Sbjct: 1052 ILASGSHDGTVRLWDSAEGKLLHTL-------EAHRGWVWRVAFSPDGQFLASAGTDAKA 1104

Query: 1086 YVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             VW+    + +        +H+  +  +  S DG  L T   D  LK+W
Sbjct: 1105 AVWEVATGRRL----RAWQAHNSWVISVAFSPDGRILLTAGIDVMLKLW 1149



 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 87/350 (24%), Positives = 143/350 (40%), Gaps = 42/350 (12%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L G +  +Y L ++P+   +VSA  D  L VW+  +S     +     W+ + AFSP+G 
Sbjct: 702  LVGLSRTIYGLAFSPDGRWLVSAGADCLLRVWDVESSVCLRVLGGHTDWIKSVAFSPSGH 761

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VA  G+D    ++      D  G   V+  L GH G   +  ++  +D  + + S D++
Sbjct: 762  LVASAGIDRTVRLW------DPAGGECVA-VLEGHTGPTLSVLFI--DDTTVASGSTDRS 812

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT------ 830
               WD+ TG  T +      + H  +V ++++S   T +  SGS D    LW+       
Sbjct: 813  IRFWDVATGRCTRLI-----AAHDNNVMALALSPCGTRL-ASGSDDQAIRLWEVSTGRLL 866

Query: 831  -----------------------------------RVASRAVRTFHGHEGDVIAVKFFPD 905
                                               R+A R  R   GH G V AV F PD
Sbjct: 867  RTICGRINWLTSGTFSPDGRFVAAGGEYDLVLLWDRIADRQWRLV-GHTGAVGAVVFSPD 925

Query: 906  GNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFA-GYTNGD 1082
                 + S DGT RL+ + +  Q+ ++     +     +  +AFS  G LL + GY +G 
Sbjct: 926  REHLASASADGTIRLWSLTSHRQVAIF-----EGHTAAIRGLAFSPDGALLVSCGYDSG- 979

Query: 1083 CYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              VW      +      L++  +  +  + ++ DG  L  G  D   +IW
Sbjct: 980  VRVWQVSTGHL------LRSGGEQLVDSVAVASDGKRLAVGLIDDRAEIW 1023



 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 70/263 (26%), Positives = 115/263 (43%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHTG V ++ ++P++  + SAS DG + +W+  + ++    +   A +   AFSP G 
Sbjct: 910  LVGHTGAVGAVVFSPDREHLASASADGTIRLWSLTSHRQVAIFEGHTAAIRGLAFSPDGA 969

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +   G DS   ++ +         ST     SG +  V +   V ++   L     D  
Sbjct: 970  LLVSCGYDSGVRVWQV---------STGHLLRSGGEQLVDSVA-VASDGKRLAVGLIDDR 1019

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              +WD+ T  +  +F      GH      V+ S     +  SGS D T  LWD+    + 
Sbjct: 1020 AEIWDLETFEKLQIF-----PGHREWAWQVAFSPDG-RILASGSHDGTVRLWDS-AEGKL 1072

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H G V  V F PDG    +   D    ++++ TG +L+ +   +S      V S
Sbjct: 1073 LHTLEAHRGWVWRVAFSPDGQFLASAGTDAKAAVWEVATGRRLRAWQAHNS-----WVIS 1127

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            +AFS  GR+L     +    +WD
Sbjct: 1128 VAFSPDGRILLTAGIDVMLKLWD 1150



 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 32/127 (25%), Positives = 57/127 (44%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH    + + ++P+   + S S DG + +W++   +  H ++    WV   AFSP GQ +
Sbjct: 1036 GHREWAWQVAFSPDGRILASGSHDGTVRLWDSAEGKLLHTLEAHRGWVWRVAFSPDGQFL 1095

Query: 495  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG 674
            A  G D+  +++ +             R    H  +V +  + P +   L+T+  D    
Sbjct: 1096 ASAGTDAKAAVWEV-------ATGRRLRAWQAHNSWVISVAFSP-DGRILLTAGIDVMLK 1147

Query: 675  LWDITTG 695
            LWD  TG
Sbjct: 1148 LWDRETG 1154



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 72/301 (23%), Positives = 110/301 (36%), Gaps = 40/301 (13%)
 Frame = +3

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
            A ++  AF P G  +ACG  DS   I+   L   ++G              V    + P 
Sbjct: 577  ALIVVLAFHPRGHLLACG--DSTGKIY---LWQTDNGRQVA--CFEAQPEAVWGLVFTPK 629

Query: 630  EDAHLITSSG---DKTCGLWDITTG--LRTSVF------------GGEYQSGHTAD---- 746
             D  L++++G   D     WD+ +G  LR+                GEY +   AD    
Sbjct: 630  GDT-LVSAAGRGVDAAIQFWDVESGRCLRSHKVHTGTIPTLAISADGEYLASGGADGQIH 688

Query: 747  ---------VSSVSISASNT----------NMFVSGSCDTTACLWDTRVASRAVRTFHGH 869
                      S V +  S T             VS   D    +WD   +S  +R   GH
Sbjct: 689  LWRRADGYGNSCVLVGLSRTIYGLAFSPDGRWLVSAGADCLLRVWDVE-SSVCLRVLGGH 747

Query: 870  EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISG 1049
               + +V F P G+   +   D T RL+D   G  + V      +       S+ F I  
Sbjct: 748  TDWIKSVAFSPSGHLVASAGIDRTVRLWDPAGGECVAVL-----EGHTGPTLSVLF-IDD 801

Query: 1050 RLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKI 1229
              + +G T+     WD    +       L  +HD  +  L LS  G+ L +GS D  +++
Sbjct: 802  TTVASGSTDRSIRFWDVATGRCT----RLIAAHDNNVMALALSPCGTRLASGSDDQAIRL 857

Query: 1230 W 1232
            W
Sbjct: 858  W 858



>gb:MMU38494_2121123 Mus musculus G protein beta 3 subunit mRNA,
            partial cds.
          Length = 103

 Score =  114 bits (285), Expect = 5e-24
 Identities = 55/106 (51%), Positives = 75/106 (70%)
 Frame = +3

Query: 786  FVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT 965
            F+SG+CD +A LWD R  +   +TF GHE D+ A+ FFP+G    TGSDD +CRLFD+R 
Sbjct: 1    FISGACDASAKLWDVREGT-CRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRA 59

Query: 966  GHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTL 1103
              +L  YSQ   ++ +  +TS+AFS+SGRLLFAGY + +C VWD+L
Sbjct: 60   DQELTAYSQ---ESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSL 102



 Score = 38.1 bits (87), Expect = 0.45
 Identities = 24/88 (27%), Positives = 44/88 (50%)
 Frame = +3

Query: 567 TVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTAD 746
           T  +T +GH+  ++A  + PN +A + T S D +C L+D+      + +    Q      
Sbjct: 19  TCRQTFTGHESDINAICFFPNGEA-ICTGSDDASCRLFDLRADQELTAYS---QESIICG 74

Query: 747 VSSVSISASNTNMFVSGSCDTTACLWDT 830
           ++SV+ S S   +F +G  D    +WD+
Sbjct: 75  ITSVAFSLSGRLLF-AGYDDFNCNVWDS 101



>pir|AC1842|AC1842 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681275 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1747

 Score =  113 bits (282), Expect = 1e-23
 Identities = 79/305 (25%), Positives = 138/305 (45%), Gaps = 4/305 (1%)
 Frame = +3

Query: 330  VYSLDWTPEKNRIVSASQDGRLIVWN--ALTSQKTHAIKLPCAWVMTCAFSPTGQSVACG 503
            V S+ + P+     SA  DG + +W    L       I+     + T ++SP G+++A  
Sbjct: 1435 VNSVSFNPDGKTFASAGWDGNITIWQRETLAHSSLSTIQKNQNIITTVSYSPDGKTIATA 1494

Query: 504  GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWD 683
              D+   +++            + +TL+GHK  ++   + P+    + + S DKT  +W 
Sbjct: 1495 SADNTIKLWDSQ-------TQQLIKTLTGHKDRITTLSFHPDNQT-IASGSADKTIKIWR 1546

Query: 684  ITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            +  G  LRT        +GH  +V+SV+ S        SGS D T  +W T    R ++ 
Sbjct: 1547 VNDGQLLRTL-------TGHNDEVTSVNFSPDG-QFLASGSTDNTVKIWQTD--GRLIKN 1596

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAF 1037
              GH   + +VKF PD +   + S D T +L+ +  G  +      + +  +  VTS++F
Sbjct: 1597 ITGHGLAIASVKFSPDSHTLASASWDNTIKLWQVTDGKLIN-----NLNGHIDGVTSLSF 1651

Query: 1038 SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDT 1217
            S  G +L +G  +    +W+   A ++  L      H G+I+ L  S DG  L +G  D 
Sbjct: 1652 SPDGEILASGSADNTIKLWNLPNATLLKTL----LGHPGKINTLAFSPDGKTLLSGGEDA 1707

Query: 1218 TLKIW 1232
             + +W
Sbjct: 1708 GVMVW 1712



 Score =  103 bits (256), Expect = 1e-20
 Identities = 77/312 (24%), Positives = 142/312 (45%), Gaps = 2/312 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            +   GHT  V  + ++P+   IVS+S D  + +W  +     +       WV + +FSP 
Sbjct: 1225 KTFPGHTDIVTDVVFSPDSKTIVSSSLDKTIKLWR-IDGSIINTWNAHNGWVNSISFSPD 1283

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G+ +A GG D++  ++          N  + +TL+GHK  +++ ++ P +   L ++SGD
Sbjct: 1284 GKMIASGGEDNLVKLWQAT-------NGHLIKTLTGHKERITSVKFSP-DGKILASASGD 1335

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT   W+       ++      + H   V+S++ S S++   VS   D+T  +W  ++  
Sbjct: 1336 KTIKFWNTDGKFLKTI------AAHNQQVNSINFS-SDSKTLVSAGADSTMKVW--KIDG 1386

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
              ++T  G    +  V F PD     + S D T R+  +        Y +    N    V
Sbjct: 1387 TLIKTISGRGEQIRDVTFSPDNKVIASASSDKTVRIRQLN-------YQKSQKSN----V 1435

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVW--DTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             S++F+  G+   +   +G+  +W  +TL    +  +   QN     I+ +  S DG  +
Sbjct: 1436 NSVSFNPDGKTFASAGWDGNITIWQRETLAHSSLSTIQKNQNI----ITTVSYSPDGKTI 1491

Query: 1197 CTGSWDTTLKIW 1232
             T S D T+K+W
Sbjct: 1492 ATASADNTIKLW 1503



 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 65/263 (24%), Positives = 120/263 (45%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            +Q +   + ++ ++P+   I +AS D  + +W++ T Q    +      + T +F P  Q
Sbjct: 1472 IQKNQNIITTVSYSPDGKTIATASADNTIKLWDSQTQQLIKTLTGHKDRITTLSFHPDNQ 1531

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            ++A G  D    I+ +N     DG   + RTL+GH   V++  + P +   L + S D T
Sbjct: 1532 TIASGSADKTIKIWRVN-----DGQ--LLRTLTGHNDEVTSVNFSP-DGQFLASGSTDNT 1583

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              +W     L  ++      +GH   ++SV  S  +++   S S D T  LW      + 
Sbjct: 1584 VKIWQTDGRLIKNI------TGHGLAIASVKFSP-DSHTLASASWDNTIKLWQV-TDGKL 1635

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            +   +GH   V ++ F PDG    +GS D T +L+++     L+            ++ +
Sbjct: 1636 INNLNGHIDGVTSLSFSPDGEILASGSADNTIKLWNLPNATLLKTLL-----GHPGKINT 1690

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            +AFS  G+ L +G  +    VW+
Sbjct: 1691 LAFSPDGKTLLSGGEDAGVMVWN 1713



 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 60/220 (27%), Positives = 102/220 (46%), Gaps = 1/220 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L GH  ++ +L + P+   I S S D  + +W     Q    +      V +  FSP 
Sbjct: 1512 KTLTGHKDRITTLSFHPDNQTIASGSADKTIKIWRVNDGQLLRTLTGHNDEVTSVNFSPD 1571

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
            GQ +A G  D+   I+        DG   + + ++GH   +++ ++ P  D+H + S S 
Sbjct: 1572 GQFLASGSTDNTVKIWQ------TDGR--LIKNITGHGLAIASVKFSP--DSHTLASASW 1621

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D T  LW +T G   +       +GH   V+S+S S     +  SGS D T  LW+   A
Sbjct: 1622 DNTIKLWQVTDGKLINNL-----NGHIDGVTSLSFSPDG-EILASGSADNTIKLWNLPNA 1675

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
            +  ++T  GH G +  + F PDG    +G +D    ++++
Sbjct: 1676 T-LLKTLLGHPGKINTLAFSPDGKTLLSGGEDAGVMVWNL 1714



 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 64/269 (23%), Positives = 121/269 (44%), Gaps = 6/269 (2%)
 Frame = +3

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED 635
            V   +FSP G+ +A    D    +++++          +  T++  +  V+A  +  N  
Sbjct: 1140 VNAVSFSPDGKVLASASDDRTVKLWDIH--------GQLITTITASQKRVTAIAFSHN-G 1190

Query: 636  AHLITSSGDKTCGLWDITTG------LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSG 797
             +L T++ D T  L+ + T       L+  +   +   GHT  V+ V  S  +  + VS 
Sbjct: 1191 KYLATANADYTIKLYALDTSCLIVNNLQKCIQLIKTFPGHTDIVTDVVFSPDSKTI-VSS 1249

Query: 798  SCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQL 977
            S D T  LW  R+    + T++ H G V ++ F PDG    +G +D   +L+    GH +
Sbjct: 1250 SLDKTIKLW--RIDGSIINTWNAHNGWVNSISFSPDGKMIASGGEDNLVKLWQATNGHLI 1307

Query: 978  QVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            +  +         R+TS+ FS  G++L +   +     W+T   K +  +     +H+ +
Sbjct: 1308 KTLT-----GHKERITSVKFSPDGKILASASGDKTIKFWNT-DGKFLKTIA----AHNQQ 1357

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
            ++ +  S D   L +   D+T+K+W   G
Sbjct: 1358 VNSINFSSDSKTLVSAGADSTMKVWKIDG 1386



 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 79/343 (23%), Positives = 134/343 (39%), Gaps = 35/343 (10%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            LQGH  +V ++ ++P+   + SAS D  + +W+ +  Q    I      V   AFS  G+
Sbjct: 1133 LQGHAQQVNAVSFSPDGKVLASASDDRTVKLWD-IHGQLITTITASQKRVTAIAFSHNGK 1191

Query: 489  SVACGGLDSVCSIFNLN----LPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             +A    D    ++ L+    +  +      + +T  GH   V+   + P+    +++SS
Sbjct: 1192 YLATANADYTIKLYALDTSCLIVNNLQKCIQLIKTFPGHTDIVTDVVFSPDSKT-IVSSS 1250

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             DKT  LW I   +  +       + H   V+S+S S     M  SG  D    LW    
Sbjct: 1251 LDKTIKLWRIDGSIINT------WNAHNGWVNSISFSPDG-KMIASGGEDNLVKLWQA-T 1302

Query: 837  ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
                ++T  GH+  + +VKF PDG    + S D T + ++   G  L+  +  +      
Sbjct: 1303 NGHLIKTLTGHKERITSVKFSPDGKILASASGDKTIKFWN-TDGKFLKTIAAHN-----Q 1356

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVW--DTLLAKMVLNLG-------------------- 1130
            +V SI FS   + L +   +    VW  D  L K +   G                    
Sbjct: 1357 QVNSINFSSDSKTLVSAGADSTMKVWKIDGTLIKTISGRGEQIRDVTFSPDNKVIASASS 1416

Query: 1131 ---------SLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                     + Q S    ++ +  + DG    +  WD  + IW
Sbjct: 1417 DKTVRIRQLNYQKSQKSNVNSVSFNPDGKTFASAGWDGNITIW 1459



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 33/134 (24%), Positives = 66/134 (49%)
 Frame = +3

Query: 285  TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT 464
            TD    +N+ GH   + S+ ++P+ + + SAS D  + +W     +  + +      V +
Sbjct: 1589 TDGRLIKNITGHGLAIASVKFSPDSHTLASASWDNTIKLWQVTDGKLINNLNGHIDGVTS 1648

Query: 465  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL 644
             +FSP G+ +A G  D+   ++NL        N+T+ +TL GH G ++   + P +   L
Sbjct: 1649 LSFSPDGEILASGSADNTIKLWNL-------PNATLLKTLLGHPGKINTLAFSP-DGKTL 1700

Query: 645  ITSSGDKTCGLWDI 686
            ++   D    +W++
Sbjct: 1701 LSGGEDAGVMVWNL 1714



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 43/155 (27%), Positives = 64/155 (41%), Gaps = 9/155 (5%)
 Frame = +3

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
            T A        ++ +    GH   V AV F PDG    + SDD T +L+DI  G  +   
Sbjct: 1116 TVATFQQAIANTQEINRLQGHAQQVNAVSFSPDGKVLASASDDRTVKLWDIH-GQLITTI 1174

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQN-------- 1142
            +         RVT+IAFS +G+ L     N D  +    L    L + +LQ         
Sbjct: 1175 TASQK-----RVTAIAFSHNGKYL--ATANADYTIKLYALDTSCLIVNNLQKCIQLIKTF 1227

Query: 1143 -SHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
              H   ++ +  S D   + + S D T+K+W   G
Sbjct: 1228 PGHTDIVTDVVFSPDSKTIVSSSLDKTIKLWRIDG 1262



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 27/86 (31%), Positives = 43/86 (50%)
 Frame = +3

Query: 285  TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT 464
            TD     NL GH   V SL ++P+   + S S D  + +WN   +     +      + T
Sbjct: 1631 TDGKLINNLNGHIDGVTSLSFSPDGEILASGSADNTIKLWNLPNATLLKTLLGHPGKINT 1690

Query: 465  CAFSPTGQSVACGGLDSVCSIFNLNL 542
             AFSP G+++  GG D+   ++NL+L
Sbjct: 1691 LAFSPDGKTLLSGGEDAGVMVWNLDL 1716



>gb:AK016201_1158645 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4930563E19
            product:hypothetical G-protein beta WD-40 repeats
            containing protein, full insert sequence.
          Length = 304

 Score =  111 bits (278), Expect = 3e-23
 Identities = 71/267 (26%), Positives = 123/267 (46%), Gaps = 1/267 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C    +GHT ++  L + P+   + + S D    +W+    ++   +    A +++ +F 
Sbjct: 58   CYHTFRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVVTLTGHLAEIISLSFD 117

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TS 653
             +G  +  G  D    +++ +             TL GH   +S+  +  N D  LI T 
Sbjct: 118  TSGDRIITGSFDHTVVVWDAS-------TGRKVHTLIGHCAEISSALF--NWDCSLILTG 168

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S DKTC LWD T+G   +       +GH  ++       +   +  + S D TA +++  
Sbjct: 169  SMDKTCMLWDATSGKYVATL-----TGHDDEILDSCFDYTG-KLIATASADGTARVYNA- 221

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               + V    GHEG++  + F P GNR  TGS D T R++D++TG  LQV  + H+D   
Sbjct: 222  TTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVL-EGHTD--- 277

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVW 1094
              + S AF+  G ++  G  +  C +W
Sbjct: 278  -EIFSCAFNYKGNIVITGSKDNSCRIW 303



 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 74/256 (28%), Positives = 104/256 (40%), Gaps = 38/256 (14%)
 Frame = +3

Query: 579  TLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSV 758
            TL GHK  V A  +       + T S DKTC LW   TG     F      GHTA++  +
Sbjct: 18   TLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTF-----RGHTAEIVCL 72

Query: 759  SISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDG 938
            S +  +T +  +GS DTTA LWD +     V T  GH  ++I++ F   G+R  TGS D 
Sbjct: 73   SFNPQST-VVATGSMDTTAKLWDIQNGEEVV-TLTGHLAEIISLSFDTSGDRIITGSFDH 130

Query: 939  TCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMV 1118
            T  ++D  TG ++              ++S  F+    L+  G  +  C +WD    K V
Sbjct: 131  TVVVWDASTGRKVHTLI-----GHCAEISSALFNWDCSLILTGSMDKTCMLWDATSGKYV 185

Query: 1119 LNL---------------GSL-----------------------QNSHDGRISCLGLSGD 1184
              L               G L                          H+G IS +  +  
Sbjct: 186  ATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQ 245

Query: 1185 GSALCTGSWDTTLKIW 1232
            G+ L TGS D T +IW
Sbjct: 246  GNRLLTGSSDKTARIW 261



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 48/185 (25%), Positives = 76/185 (41%)
 Frame = +3

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            WD  +G            GH   V +++ +    +   +GS D T  LW      +   T
Sbjct: 8    WDTASGEELHTL-----EGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETG-KCYHT 61

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAF 1037
            F GH  +++ + F P      TGS D T +L+DI+ G ++   +       +  + S++F
Sbjct: 62   FRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVVTLT-----GHLAEIISLSF 116

Query: 1038 SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDT 1217
              SG  +  G  +    VWD    + V  L      H   IS    + D S + TGS D 
Sbjct: 117  DTSGDRIITGSFDHTVVVWDASTGRKVHTL----IGHCAEISSALFNWDCSLILTGSMDK 172

Query: 1218 TLKIW 1232
            T  +W
Sbjct: 173  TCMLW 177



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 38/146 (26%), Positives = 62/146 (42%), Gaps = 1/146 (0%)
 Frame = +3

Query: 822  WDTRVASRAVRTFHGHEGDVIAVKFF-PDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPH 998
            WDT  +   + T  GH+  V A+ F  P G++  TGS D TC+L+   TG     +    
Sbjct: 8    WDT-ASGEELHTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFR--- 63

Query: 999  SDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLS 1178
                   +  ++F+    ++  G  +    +WD    + V+ L      H   I  L   
Sbjct: 64   --GHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVVTL----TGHLAEIISLSFD 117

Query: 1179 GDGSALCTGSWDTTLKIWAFGGYRQV 1256
              G  + TGS+D T+ +W     R+V
Sbjct: 118  TSGDRIITGSFDHTVVVWDASTGRKV 143



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 23/85 (27%), Positives = 42/85 (49%)
 Frame = +3

Query: 276 FGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW 455
           +  T   C   L+GH G++  + + P+ NR+++ S D    +W+  T Q    ++     
Sbjct: 219 YNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGHTDE 278

Query: 456 VMTCAFSPTGQSVACGGLDSVCSIF 530
           + +CAF+  G  V  G  D+ C I+
Sbjct: 279 IFSCAFNYKGNIVITGSKDNSCRIW 303



 Score = 39.3 bits (90), Expect = 0.20
 Identities = 32/143 (22%), Positives = 57/143 (39%)
 Frame = +3

Query: 252 SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTH 431
           S  KT + +  T       L GH  ++    +      I +AS DG   V+NA T +   
Sbjct: 169 SMDKTCMLWDATSGKYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCVT 228

Query: 432 AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA 611
            ++     +   +F+P G  +  G  D    I+++             + L GH   + +
Sbjct: 229 KLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQ-------TGQCLQVLEGHTDEIFS 281

Query: 612 CQYVPNEDAHLITSSGDKTCGLW 680
           C +    +  +IT S D +C +W
Sbjct: 282 CAFNYKGNI-VITGSKDNSCRIW 303



>sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase pkwA
            (EC 2.7.1.37).>gb:AF115313_480098 Thermomonospora curvata
            PkwR (pkwR) and PkwA (pkwA) genes, complete cds.
          Length = 742

 Score =  111 bits (277), Expect = 4e-23
 Identities = 80/255 (31%), Positives = 118/255 (46%)
 Frame = +3

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            AFSP G  +A G  D +  ++++        +     TL GH  +V A  + P + A L 
Sbjct: 466  AFSPGGSLLAGGSGDKLIHVWDV-------ASGDELHTLEGHTDWVRAVAFSP-DGALLA 517

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            + S D T  LWD+      +VF      GHT  V  ++ S   + M  SGS D TA LW+
Sbjct: 518  SGSDDATVRLWDVAAAEERAVF-----EGHTHYVLDIAFSPDGS-MVASGSRDGTARLWN 571

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
                +       GH   V AV F PDG+   +GS DGT RL+D+ TG +  V   P    
Sbjct: 572  VATGTEHA-VLKGHTDYVYAVAFSPDGSMVASGSRDGTIRLWDVATGKERDVLQAP---- 626

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                V S+AFS  G +L  G ++   ++WD    + +         H   +  +  S DG
Sbjct: 627  -AENVVSLAFSPDGSMLVHG-SDSTVHLWDVASGEALHTF----EGHTDWVRAVAFSPDG 680

Query: 1188 SALCTGSWDTTLKIW 1232
            + L +GS D T+++W
Sbjct: 681  ALLASGSDDRTIRLW 695



 Score =  110 bits (275), Expect = 7e-23
 Identities = 81/264 (30%), Positives = 122/264 (46%), Gaps = 2/264 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GHT  V ++ ++P+   + S S D  + +W+   +++    +    +V+  AFSP G 
Sbjct: 497  LEGHTDWVRAVAFSPDGALLASGSDDATVRLWDVAAAEERAVFEGHTHYVLDIAFSPDGS 556

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             VA G  D    ++N+          T    L GH  YV A  + P + + + + S D T
Sbjct: 557  MVASGSRDGTARLWNV-------ATGTEHAVLKGHTDYVYAVAFSP-DGSMVASGSRDGT 608

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+ TG    V           +V S++ S    +M V GS D+T  LWD   +  A
Sbjct: 609  IRLWDVATGKERDVL-----QAPAENVVSLAFSPDG-SMLVHGS-DSTVHLWDV-ASGEA 660

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR--V 1022
            + TF GH   V AV F PDG    +GSDD T RL+D+          + H+  E H   V
Sbjct: 661  LHTFEGHTDWVRAVAFSPDGALLASGSDDRTIRLWDVAA-------QEEHTTLEGHTEPV 713

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVW 1094
             S+AF   G  L +   +G   +W
Sbjct: 714  HSVAFHPEGTTLASASEDGTIRIW 737



 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 78/296 (26%), Positives = 131/296 (44%)
 Frame = +3

Query: 345  WTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCS 524
            ++P  + +   S D  + VW+  +  + H ++    WV   AFSP G  +A G  D+   
Sbjct: 467  FSPGGSLLAGGSGDKLIHVWDVASGDELHTLEGHTDWVRAVAFSPDGALLASGSDDATVR 526

Query: 525  IFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRT 704
            ++++    +            GH  YV    + P + + + + S D T  LW++ TG   
Sbjct: 527  LWDVAAAEER-------AVFEGHTHYVLDIAFSP-DGSMVASGSRDGTARLWNVATGTEH 578

Query: 705  SVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVI 884
            +V       GHT  V +V+ S    +M  SGS D T  LWD     +          +V+
Sbjct: 579  AVL-----KGHTDYVYAVAFSPDG-SMVASGSRDGTIRLWDV-ATGKERDVLQAPAENVV 631

Query: 885  AVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFA 1064
            ++ F PDG+    GS D T  L+D+ +G  L  + + H+D     V ++AFS  G LL +
Sbjct: 632  SLAFSPDGSMLVHGS-DSTVHLWDVASGEALHTF-EGHTD----WVRAVAFSPDGALLAS 685

Query: 1065 GYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            G  +    +WD    +    L      H   +  +    +G+ L + S D T++IW
Sbjct: 686  GSDDRTIRLWDVAAQEEHTTL----EGHTEPVHSVAFHPEGTTLASASEDGTIRIW 737



 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 65/218 (29%), Positives = 97/218 (44%)
 Frame = +3

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            +GHT  V  + ++P+ + + S S+DG   +WN  T  +   +K    +V   AFSP G  
Sbjct: 540  EGHTHYVLDIAFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPDGSM 599

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            VA G  D    ++++    + D        L      V +  + P  D  ++    D T 
Sbjct: 600  VASGSRDGTIRLWDVATGKERD-------VLQAPAENVVSLAFSP--DGSMLVHGSDSTV 650

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LWD+ +G     F      GHT  V +V+ S     +  SGS D T  LWD   A    
Sbjct: 651  HLWDVASGEALHTF-----EGHTDWVRAVAFSPDGA-LLASGSDDRTIRLWDV-AAQEEH 703

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT 965
             T  GH   V +V F P+G    + S+DGT R++ I T
Sbjct: 704  TTLEGHTEPVHSVAFHPEGTTLASASEDGTIRIWPIAT 741



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 6/88 (6%)
 Frame = +3

Query: 987  SQPHSDNEVHRVTS------IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSH 1148
            + PH  NE   +T+      +AFS  G LL  G  +   +VWD      +  L      H
Sbjct: 445  ADPHELNEPRILTTDREAVAVAFSPGGSLLAGGSGDKLIHVWDVASGDELHTL----EGH 500

Query: 1149 DGRISCLGLSGDGSALCTGSWDTTLKIW 1232
               +  +  S DG+ L +GS D T+++W
Sbjct: 501  TDWVRAVAFSPDGALLASGSDDATVRLW 528



 Score = 35.4 bits (80), Expect = 2.9
 Identities = 15/36 (41%), Positives = 23/36 (63%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALT 416
           L+GHT  V+S+ + PE   + SAS+DG + +W   T
Sbjct: 706 LEGHTEPVHSVAFHPEGTTLASASEDGTIRIWPIAT 741



>gb:BC089247_2566129 Xenopus laevis cDNA clone MGC:85213
            IMAGE:3378142, complete cds.
          Length = 415

 Score =  110 bits (276), Expect = 5e-23
 Identities = 74/267 (27%), Positives = 126/267 (47%), Gaps = 1/267 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C    +GHT ++  L + P+   I + S D    +W+  + ++   +    A +++ +F+
Sbjct: 169  CYHTFRGHTAEIVCLVFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFN 228

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TS 653
             TG  +  G  D   S++ +        +     TL GH+G +S+ Q+  N D  LI T+
Sbjct: 229  TTGDRLITGSFDHTVSVWEIP-------SGRRIHTLIGHRGEISSAQF--NWDCSLIATA 279

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S DK+C LWD   G   +       +GH  +V  V+  ++   +  + S D TA ++   
Sbjct: 280  SMDKSCKLWDSLNGKCVATL-----TGHDDEVLDVTFDSTG-QLVATASADGTARVYSAS 333

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
             + + +    GHEG++  + F   GNR  T S D T RL+D  TG  LQV  + H+D   
Sbjct: 334  -SRKCLAKLEGHEGEISKICFNAQGNRIVTASSDKTSRLWDPHTGECLQVL-KGHTD--- 388

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVW 1094
              + S AF+  G  +  G  +  C +W
Sbjct: 389  -EIFSCAFNYEGNTIITGSKDNTCRIW 414



 Score =  102 bits (254), Expect = 2e-20
 Identities = 71/256 (27%), Positives = 115/256 (44%)
 Frame = +3

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            AF+ +G S   G  D  C +++         +     TL GH+  V A Q+       + 
Sbjct: 99   AFNKSGSSFITGSYDRTCKVWDT-------ASGEELHTLEGHRNVVYAIQFNNPYGDKIA 151

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T S DKTC LW   TG     F      GHTA++  +  +  +T +  +GS DTTA LWD
Sbjct: 152  TGSFDKTCKLWSAETGKCYHTF-----RGHTAEIVCLVFNPQST-LIATGSMDTTAKLWD 205

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
             +    A+ T  GH  ++I++ F   G+R  TGS D T  +++I +G ++        + 
Sbjct: 206  IQSGEEAL-TLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGE- 263

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                ++S  F+    L+     +  C +WD+L  K V  L      HD  +  +     G
Sbjct: 264  ----ISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATL----TGHDDEVLDVTFDSTG 315

Query: 1188 SALCTGSWDTTLKIWA 1235
              + T S D T ++++
Sbjct: 316  QLVATASADGTARVYS 331



 Score =  102 bits (253), Expect = 3e-20
 Identities = 74/309 (23%), Positives = 136/309 (44%), Gaps = 1/309 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            L+GH   VY++ +  P  ++I + S D    +W+A T +  H  +   A ++   F+P  
Sbjct: 130  LEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLVFNPQS 189

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
              +A G +D+   ++++        +   + TLSGH   + +  +    D  LIT S D 
Sbjct: 190  TLIATGSMDTTAKLWDIQ-------SGEEALTLSGHAAEIISLSFNTTGD-RLITGSFDH 241

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  +W+I +G R          GH  ++SS   +  + ++  + S D +  LWD+ +  +
Sbjct: 242  TVSVWEIPSGRRIHTL-----IGHRGEISSAQFN-WDCSLIATASMDKSCKLWDS-LNGK 294

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             V T  GH+ +V+ V F   G    T S DGT R++   +   L        +     ++
Sbjct: 295  CVATLTGHDDEVLDVTFDSTGQLVATASADGTARVYSASSRKCL-----AKLEGHEGEIS 349

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
             I F+  G  +    ++    +WD    + +     +   H   I     + +G+ + TG
Sbjct: 350  KICFNAQGNRIVTASSDKTSRLWDPHTGECL----QVLKGHTDEIFSCAFNYEGNTIITG 405

Query: 1206 SWDTTLKIW 1232
            S D T +IW
Sbjct: 406  SKDNTCRIW 414



 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 47/175 (26%), Positives = 80/175 (45%), Gaps = 1/175 (0%)
 Frame = +3

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFF-PDGN 911
            H   +++V+ + S ++ F++GS D T  +WDT  +   + T  GH   V A++F  P G+
Sbjct: 91   HILPLTNVAFNKSGSS-FITGSYDRTCKVWDT-ASGEELHTLEGHRNVVYAIQFNNPYGD 148

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
            +  TGS D TC+L+   TG     +           +  + F+    L+  G  +    +
Sbjct: 149  KIATGSFDKTCKLWSAETGKCYHTFR-----GHTAEIVCLVFNPQSTLIATGSMDTTAKL 203

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            WD    +  L L    + H   I  L  +  G  L TGS+D T+ +W     R++
Sbjct: 204  WDIQSGEEALTL----SGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRI 254



 Score = 33.9 bits (76), Expect = 8.5
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +3

Query: 252 SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW 404
           S  KT   + P    C + L+GHT +++S  +  E N I++ S+D    +W
Sbjct: 364 SSDKTSRLWDPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIW 414



>gb:AE010946_267844 Methanosarcina acetivorans str. C2A, section 291
            of 534 of the complete genome.>gb:AE010299_908403
            Methanosarcina acetivorans str. C2A, complete genome.
          Length = 1233

 Score =  110 bits (276), Expect = 5e-23
 Identities = 90/338 (26%), Positives = 138/338 (40%), Gaps = 33/338 (9%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G V ++ ++P+   I +AS D    +W+  T +K   +     WV T  FSP G+ VA
Sbjct: 791  HDGSVNTVVFSPDGKYIATASADNTSRLWDTATGEKIFFLN-HYGWVNTVVFSPDGKYVA 849

Query: 498  CGGLDSVCSIF------------------NLNLPPDN--------DGNSTVSRTLSG--- 590
                D    ++                  N+   PD         D  + V  T +G   
Sbjct: 850  TASADKTAHLWDVSTGKQISYLRHDSGVNNVVFGPDGKYVVTASADKTADVWNTTTGEKI 909

Query: 591  ----HKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSV 758
                H G V+   + P +  ++ T+S D T  LWD TTG +  V         T  V +V
Sbjct: 910  FVLNHTGRVNNAVFSP-DGKYIATASADNTSRLWDTTTGKQIFVLN------QTDPVRNV 962

Query: 759  SISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDG 938
              S        + S D T+ LWDT    + +     H+G V  V F  DG    T SDD 
Sbjct: 963  VFSPDR-KYIATASDDNTSRLWDTATGKQILVL--NHDGPVNTVVFSSDGKYIATASDDN 1019

Query: 939  TCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMV 1118
            T RL+D  TG ++ V       N   RV ++ FS  G+ +     +    +W T   + +
Sbjct: 1020 TSRLWDTATGEEIFVL------NHTDRVNNVVFSPDGKYIATAGDDNTSRLWGTATGEKI 1073

Query: 1119 LNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             ++      HDG ++ +  S DG  + T  +D T  +W
Sbjct: 1074 FDM-----KHDGPVNNVVFSPDGKYVATAGYDNTACLW 1106



 Score =  100 bits (249), Expect = 7e-20
 Identities = 78/305 (25%), Positives = 129/305 (42%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H   V ++ ++P+   + +AS D    +W+  T ++   +      V    FSP G+ VA
Sbjct: 545  HYSDVNNVVFSPDGKYVATASNDNTSRLWDVSTGKQIFVLNHTDP-VRNVVFSPDGKYVA 603

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
                D    ++N       +G S ++     H G V+   + P +  ++ T+S D T  L
Sbjct: 604  TASADKTAGVWNTTT---GEGISVLN-----HTGRVNNVVFSP-DGKYIATASDDNTSRL 654

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            WD  TG +  V         T  V +V  S        + S D T+ LWDT    +    
Sbjct: 655  WDTATGKQIFVLN------QTDPVRNVVFSPDG-KYIATASADNTSRLWDTTTGKQIFDM 707

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAF 1037
               H+G V  V F PDG    T S D   RL++  TG   +++   H       + ++ F
Sbjct: 708  --KHDGPVNIVVFSPDGKYVATASADKKARLWNATTGK--KIFDMKHDSG----INTVVF 759

Query: 1038 SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDT 1217
            S  G+ +     +    VW+T   K + ++      HDG ++ +  S DG  + T S D 
Sbjct: 760  SPDGKYIVTASDDKTAGVWNTTTGKKIFDM-----KHDGSVNTVVFSPDGKYIATASADN 814

Query: 1218 TLKIW 1232
            T ++W
Sbjct: 815  TSRLW 819



 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 86/338 (25%), Positives = 134/338 (39%), Gaps = 33/338 (9%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H   V ++ + P+   +V+AS D    VWN  T +K   +      V    FSP G+ +A
Sbjct: 873  HDSGVNNVVFGPDGKYVVTASADKTADVWNTTTGEKIFVLN-HTGRVNNAVFSPDGKYIA 931

Query: 498  CGGLDSVCSIF------------------NLNLPPD--------NDGNSTVSRTLSG--- 590
                D+   ++                  N+   PD        +D  S +  T +G   
Sbjct: 932  TASADNTSRLWDTTTGKQIFVLNQTDPVRNVVFSPDRKYIATASDDNTSRLWDTATGKQI 991

Query: 591  ----HKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSV 758
                H G V+   +  ++  ++ T+S D T  LWD  TG    V        HT  V++V
Sbjct: 992  LVLNHDGPVNTVVF-SSDGKYIATASDDNTSRLWDTATGEEIFVLN------HTDRVNNV 1044

Query: 759  SISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDG 938
              S     +  +G  D T+ LW T    +       H+G V  V F PDG    T   D 
Sbjct: 1045 VFSPDGKYIATAGD-DNTSRLWGTATGEKIFDM--KHDGPVNNVVFSPDGKYVATAGYDN 1101

Query: 939  TCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMV 1118
            T  L+D  TG ++ V       N   RV ++ FS  G+ + A  +     +W+    K +
Sbjct: 1102 TACLWDTATGEKIFVL------NHAGRVNTVVFSPDGKYI-ATASADKARLWNATTGKQI 1154

Query: 1119 LNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              L      HD  ++ +  S DG  + T S D T ++W
Sbjct: 1155 SYL-----RHDSGVNNVVFSPDGKYIATASVDKTARLW 1187



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 41/130 (31%), Positives = 64/130 (49%)
 Frame = +3

Query: 867  HEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSIS 1046
            H  DV  V F PDG    T S+D T RL+D+ TG Q+ V +  H+D     V ++ FS  
Sbjct: 545  HYSDVNNVVFSPDGKYVATASNDNTSRLWDVSTGKQIFVLN--HTDP----VRNVVFSPD 598

Query: 1047 GRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLK 1226
            G+ +     +    VW+T   + +  L     +H GR++ +  S DG  + T S D T +
Sbjct: 599  GKYVATASADKTAGVWNTTTGEGISVL-----NHTGRVNNVVFSPDGKYIATASDDNTSR 653

Query: 1227 IWAFGGYRQV 1256
            +W     +Q+
Sbjct: 654  LWDTATGKQI 663



>gb:AK097409_1914851 Homo sapiens cDNA FLJ40090 fis, clone
            TESTI2003596, weakly similar to VEGETATIBLE
            INCOMPATIBILITY PROTEIN HET-E-1.>gb:BC036377_1981915 Homo
            sapiens hypothetical protein FLJ25955, mRNA (cDNA clone
            MGC:26723 IMAGE:4824989), complete cds.
          Length = 415

 Score =  110 bits (275), Expect = 7e-23
 Identities = 71/267 (26%), Positives = 123/267 (46%), Gaps = 1/267 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C    +GHT ++  L + P+   + + S D    +W+    ++ + ++   A +++ +F+
Sbjct: 169  CYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFN 228

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TS 653
             +G  +  G  D    ++      D D    V+  L GH   +S+  +  N D  LI T 
Sbjct: 229  TSGDRIITGSFDHTVVVW------DADTGRKVN-ILIGHCAEISSASF--NWDCSLILTG 279

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S DKTC LWD T G   +       +GH  ++       +   +  + S D TA ++   
Sbjct: 280  SMDKTCKLWDATNGKCVATL-----TGHDDEILDSCFDYTG-KLIATASADGTARIFSA- 332

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               + +    GHEG++  + F P GN   TGS D T R++D +TG  LQV  + H+D   
Sbjct: 333  ATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVL-EGHTD--- 388

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVW 1094
              + S AF+  G ++  G  +  C +W
Sbjct: 389  -EIFSCAFNYKGNIVITGSKDNTCRIW 414



 Score =  108 bits (269), Expect = 4e-22
 Identities = 78/309 (25%), Positives = 138/309 (44%), Gaps = 1/309 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            L+GH   VY++ +  P  ++I + S D    +W+  T +  H  +   A ++  +F+P  
Sbjct: 130  LEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQS 189

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
              VA G +D+   ++++        N     TL GH   + +  +  + D  +IT S D 
Sbjct: 190  TLVATGSMDTTAKLWDIQ-------NGEEVYTLRGHSAEIISLSFNTSGD-RIITGSFDH 241

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  +WD  TG + ++       GH A++SS S +  + ++ ++GS D T  LWD     +
Sbjct: 242  TVVVWDADTGRKVNIL-----IGHCAEISSASFN-WDCSLILTGSMDKTCKLWDA-TNGK 294

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             V T  GH+ +++   F   G    T S DGT R+F   T   +        +     ++
Sbjct: 295  CVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCI-----AKLEGHEGEIS 349

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
             I+F+  G  L  G ++    +WD    + +     +   H   I     +  G+ + TG
Sbjct: 350  KISFNPQGNHLLTGSSDKTARIWDAQTGQCL----QVLEGHTDEIFSCAFNYKGNIVITG 405

Query: 1206 SWDTTLKIW 1232
            S D T +IW
Sbjct: 406  SKDNTCRIW 414



 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 72/256 (28%), Positives = 111/256 (43%)
 Frame = +3

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            A + +G     G  D  C +++         +     TL GH+  V A  +       + 
Sbjct: 99   ALNKSGSCFITGSYDRTCKLWDT-------ASGEELNTLEGHRNVVYAIAFNNPYGDKIA 151

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T S DKTC LW + TG     F      GHTA++  +S +  +T +  +GS DTTA LWD
Sbjct: 152  TGSFDKTCKLWSVETGKCYHTF-----RGHTAEIVCLSFNPQST-LVATGSMDTTAKLWD 205

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
             +     V T  GH  ++I++ F   G+R  TGS D T  ++D  TG ++ +        
Sbjct: 206  IQ-NGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILI-----G 259

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                ++S +F+    L+  G  +  C +WD    K V  L      HD  I        G
Sbjct: 260  HCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATL----TGHDDEILDSCFDYTG 315

Query: 1188 SALCTGSWDTTLKIWA 1235
              + T S D T +I++
Sbjct: 316  KLIATASADGTARIFS 331



>gb:AK098821_1915232 Homo sapiens cDNA FLJ25955 fis, clone TST03904.
          Length = 415

 Score =  110 bits (274), Expect = 9e-23
 Identities = 71/267 (26%), Positives = 122/267 (45%), Gaps = 1/267 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C    +GHT ++  L + P+   + + S D    +W+    ++ + ++   A +++ +F+
Sbjct: 169  CYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFN 228

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TS 653
             +G  +  G  D    ++      D D    V+  L GH   +S+  +  N D  LI T 
Sbjct: 229  TSGDRIITGSFDHTVVVW------DADTGRKVN-ILIGHCAEISSASF--NWDCSLILTG 279

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S DKTC LWD T G   +       +GH  ++       +   +  + S D TA ++   
Sbjct: 280  SMDKTCKLWDATNGKCVATL-----TGHDDEILDSCFDYTG-KLIATASADGTARIFSA- 332

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               + +    GHEG++  + F P GN   TGS D T R++D +TG  LQV  + H+D   
Sbjct: 333  ATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVL-EGHTD--- 388

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVW 1094
              + S AF+  G ++  G     C +W
Sbjct: 389  -EIFSCAFNYKGNIVITGSKGNTCRIW 414



 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 72/256 (28%), Positives = 111/256 (43%)
 Frame = +3

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            A + +G     G  D  C +++         +     TL GH+  V A  +       + 
Sbjct: 99   ALNKSGSCFITGSYDRTCKLWD-------SASGEELNTLEGHRNVVYAIAFNNPYGDKIA 151

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T S DKTC LW + TG     F      GHTA++  +S +  +T +  +GS DTTA LWD
Sbjct: 152  TGSFDKTCKLWSVETGKCYHTF-----RGHTAEIVCLSFNPQST-LVATGSMDTTAKLWD 205

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
             +     V T  GH  ++I++ F   G+R  TGS D T  ++D  TG ++ +        
Sbjct: 206  IQ-NGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILI-----G 259

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                ++S +F+    L+  G  +  C +WD    K V  L      HD  I        G
Sbjct: 260  HCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATL----TGHDDEILDSCFDYTG 315

Query: 1188 SALCTGSWDTTLKIWA 1235
              + T S D T +I++
Sbjct: 316  KLIATASADGTARIFS 331



>gb:BA000045_740981 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 551

 Score =  109 bits (273), Expect = 1e-22
 Identities = 85/269 (31%), Positives = 124/269 (46%), Gaps = 2/269 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L+GHTG V ++ +TP+   + SA  D R+ +W+  T +  H +K     V T A +P 
Sbjct: 306  QTLEGHTGTVRAVVFTPDGRALASAGSDRRVRLWDVGTGKLRHTLKGHSQPVWTLAMAPD 365

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
            G+ +A G  D    ++++        +      L GH  +V A  + P  D   + S+G 
Sbjct: 366  GRILASGSGDRSVRLWDI-------ASGRQLYRLRGHGDWVFAVAFSP--DGRTLASAGK 416

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D+T  LW+   G   +        GH+A V ++  S     +  S S D T  LWD  V 
Sbjct: 417  DETIRLWNSADGKLLATL-----RGHSAPVRALDWSKDGRTL-ASASWDKTVALWD--VP 468

Query: 840  SRAVRT-FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
             R VRT   GH G V AV   PDG    +GS DGT RL+   T  Q+  +  P       
Sbjct: 469  GRTVRTRLSGHTGRVTAVSLAPDGQLVASGSIDGTVRLWRPDTRRQIHRFDLP------D 522

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTL 1103
             V S+ FS  GR+L AG  +    +W  L
Sbjct: 523  WVLSLGFSPDGRMLIAGGKDSTLRLWQHL 551



 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 76/268 (28%), Positives = 122/268 (45%), Gaps = 1/268 (0%)
 Frame = +3

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED 635
            V   A  P G+  A G  D    +++           T+ +TL GH G V A  + P+  
Sbjct: 274  VWASAVRPDGRMYASGDDDGAIRLWS--------PAGTLLQTLEGHTGTVRAVVFTPDGR 325

Query: 636  AHLITSSGDKTCGLWDITTG-LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            A L ++  D+   LWD+ TG LR ++       GH+  V ++++ A +  +  SGS D +
Sbjct: 326  A-LASAGSDRRVRLWDVGTGKLRHTL------KGHSQPVWTLAM-APDGRILASGSGDRS 377

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
              LWD   + R +    GH   V AV F PDG    +   D T RL++   G  L    +
Sbjct: 378  VRLWDI-ASGRQLYRLRGHGDWVFAVAFSPDGRTLASAGKDETIRLWNSADGKLLATL-R 435

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
             HS      V ++ +S  GR L +   +    +WD     +   L    + H GR++ + 
Sbjct: 436  GHSAP----VRALDWSKDGRTLASASWDKTVALWDVPGRTVRTRL----SGHTGRVTAVS 487

Query: 1173 LSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            L+ DG  + +GS D T+++W     RQ+
Sbjct: 488  LAPDGQLVASGSIDGTVRLWRPDTRRQI 515



 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 78/311 (25%), Positives = 134/311 (43%), Gaps = 1/311 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R +  H G V++    P+     S   DG + +W+         ++     V    F+P 
Sbjct: 265  RTVGAHPGPVWASAVRPDGRMYASGDDDGAIRLWSP-AGTLLQTLEGHTGTVRAVVFTPD 323

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
            G+++A  G D    ++++       G   +  TL GH   V      P  D  ++ S SG
Sbjct: 324  GRALASAGSDRRVRLWDV-------GTGKLRHTLKGHSQPVWTLAMAP--DGRILASGSG 374

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D++  LWDI +G +          GH   V +V+ S     +  +G  D T  LW++   
Sbjct: 375  DRSVRLWDIASGRQLYRL-----RGHGDWVFAVAFSPDGRTLASAGK-DETIRLWNS-AD 427

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + + T  GH   V A+ +  DG    + S D T  L+D+  G  ++     H+     R
Sbjct: 428  GKLLATLRGHSAPVRALDWSKDGRTLASASWDKTVALWDV-PGRTVRTRLSGHTG----R 482

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            VT+++ +  G+L+ +G  +G   +W     + +       +  D  +S LG S DG  L 
Sbjct: 483  VTAVSLAPDGQLVASGSIDGTVRLWRPDTRRQIHRF----DLPDWVLS-LGFSPDGRMLI 537

Query: 1200 TGSWDTTLKIW 1232
             G  D+TL++W
Sbjct: 538  AGGKDSTLRLW 548



 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 38/135 (28%), Positives = 59/135 (43%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            RT   H G V A    PDG  + +G DDG  RL+    G  LQ       +     V ++
Sbjct: 265  RTVGAHPGPVWASAVRPDGRMYASGDDDGAIRLWS-PAGTLLQTL-----EGHTGTVRAV 318

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
             F+  GR L +  ++    +WD    K+   L      H   +  L ++ DG  L +GS 
Sbjct: 319  VFTPDGRALASAGSDRRVRLWDVGTGKLRHTL----KGHSQPVWTLAMAPDGRILASGSG 374

Query: 1212 DTTLKIWAFGGYRQV 1256
            D ++++W     RQ+
Sbjct: 375  DRSVRLWDIASGRQL 389



>gb:BC064252_2553805 Xenopus tropicalis hypothetical protein MGC76247,
            mRNA (cDNA clone MGC:76247 IMAGE:5378990), complete cds.
          Length = 415

 Score =  108 bits (271), Expect = 2e-22
 Identities = 74/267 (27%), Positives = 125/267 (46%), Gaps = 1/267 (0%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C    +GHT ++  L + P+   I + S D    +W+  + ++   +    A +++ +F+
Sbjct: 169  CYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFN 228

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TS 653
             TG  +  G  D   S++ +        +     TL GH+G +S+ Q+  N D  LI T+
Sbjct: 229  TTGDRLITGSFDHTVSVWEI-------PSGRRIHTLIGHRGEISSAQF--NWDCSLIATA 279

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S DK+C LWD   G   +       +GH  +V  V+   S   +  + S D TA ++   
Sbjct: 280  SMDKSCKLWDSLNGKCVATL-----TGHEDEVLDVTFD-STGQLVATASADGTARVYSAS 333

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
             + + +    GHEG++  + F   GNR  T S D T RL++  TG  LQV  + H+D   
Sbjct: 334  -SRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVL-KGHTD--- 388

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVW 1094
              + S AF+  G  +  G  +  C +W
Sbjct: 389  -EIFSCAFNYEGNTIITGSKDNTCRIW 414



 Score =  103 bits (256), Expect = 1e-20
 Identities = 75/309 (24%), Positives = 137/309 (44%), Gaps = 1/309 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            L+GH   VY++ +  P  ++I + S D    +W+A T +  H  +   A ++  AF+P  
Sbjct: 130  LEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQS 189

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
              +A G +D+   ++++        +   + TLSGH   + +  +    D  LIT S D 
Sbjct: 190  TLIATGSMDTTAKLWDIQ-------SGEEALTLSGHAAEIISLSFNTTGD-RLITGSFDH 241

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  +W+I +G R          GH  ++SS   +  + ++  + S D +  LWD+ +  +
Sbjct: 242  TVSVWEIPSGRRIHTL-----IGHRGEISSAQFN-WDCSLIATASMDKSCKLWDS-LNGK 294

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             V T  GHE +V+ V F   G    T S DGT R++   +   L        +     ++
Sbjct: 295  CVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCL-----AKLEGHEGEIS 349

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
             I F+  G  +    ++    +W+    + +     +   H   I     + +G+ + TG
Sbjct: 350  KICFNAQGNRILTASSDKTSRLWNPHTGECL----QVLKGHTDEIFSCAFNYEGNTIITG 405

Query: 1206 SWDTTLKIW 1232
            S D T +IW
Sbjct: 406  SKDNTCRIW 414



 Score =  102 bits (253), Expect = 3e-20
 Identities = 70/256 (27%), Positives = 116/256 (45%)
 Frame = +3

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            AF+ +G S   G  D  C +++         +     TL GH+  V A Q+       + 
Sbjct: 99   AFNKSGSSFITGSYDRTCKVWDT-------ASGEELHTLEGHRNVVYAIQFNNPYGDKIA 151

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T S DKTC LW   TG     F      GHTA++  ++ +  +T +  +GS DTTA LWD
Sbjct: 152  TGSFDKTCKLWSAETGKCYHTF-----RGHTAEIVCLAFNPQST-LIATGSMDTTAKLWD 205

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
             +    A+ T  GH  ++I++ F   G+R  TGS D T  +++I +G ++        + 
Sbjct: 206  IQSGEEAL-TLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGE- 263

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                ++S  F+    L+     +  C +WD+L  K V  L      H+  +  +     G
Sbjct: 264  ----ISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATL----TGHEDEVLDVTFDSTG 315

Query: 1188 SALCTGSWDTTLKIWA 1235
              + T S D T ++++
Sbjct: 316  QLVATASADGTARVYS 331



 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 48/175 (27%), Positives = 81/175 (46%), Gaps = 1/175 (0%)
 Frame = +3

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFF-PDGN 911
            H   +++V+ + S ++ F++GS D T  +WDT  +   + T  GH   V A++F  P G+
Sbjct: 91   HILPLTNVAFNKSGSS-FITGSYDRTCKVWDT-ASGEELHTLEGHRNVVYAIQFNNPYGD 148

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
            +  TGS D TC+L+   TG     +           +  +AF+    L+  G  +    +
Sbjct: 149  KIATGSFDKTCKLWSAETGKCYHTFR-----GHTAEIVCLAFNPQSTLIATGSMDTTAKL 203

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            WD    +  L L    + H   I  L  +  G  L TGS+D T+ +W     R++
Sbjct: 204  WDIQSGEEALTL----SGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRI 254



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +3

Query: 252 SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW 404
           S  KT   + P    C + L+GHT +++S  +  E N I++ S+D    +W
Sbjct: 364 SSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIW 414



>gb:BA000039_726273 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 349

 Score =  108 bits (271), Expect = 2e-22
 Identities = 83/308 (26%), Positives = 140/308 (45%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH  +V ++  +P+ N +VSA  D RL  WN  T       K    W+     +P GQ
Sbjct: 62   LRGHEDEVNAIALSPDGNFLVSAGDDRRLYFWNLATGTALGQAKGHTDWIYALVMTPDGQ 121

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            +V  G  D    ++ +       G+  +  TLSGH+ +V+     P +   L ++S D T
Sbjct: 122  TVISGSKDKTIKLWGV-------GDRQLQATLSGHQDFVNGLALSP-DGRTLASASYDHT 173

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW++ +    +         +   + SV+IS        +G  D    +WD   + R 
Sbjct: 174  VKLWNVPSRQEITTL-----KANEGIMLSVAISRDG-RFLATGGVDKLIRIWDL-PSRRL 226

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            +RT  GH  DV ++ F PD ++  +GSD    +L+++ TG   Q +       E  +V S
Sbjct: 227  LRTLEGHTSDVNSLAFTPDSSQLVSGSDKDGIKLWNLTTGELQQQFG-----TEGGQVFS 281

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            +A S  G  L +G+ +    +W +L  +++ NL      H G +  +    D   L + S
Sbjct: 282  VAVSPDGSTLASGHGDQTVKLW-SLSGQLLRNL----KGHSGAVYSVVFGQD--QLISAS 334

Query: 1209 WDTTLKIW 1232
             D T+K+W
Sbjct: 335  EDKTIKVW 342



 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 66/234 (28%), Positives = 111/234 (47%)
 Frame = +3

Query: 252 SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTH 431
           S+ KT   +G  D      L GH   V  L  +P+   + SAS D  + +WN  + Q+  
Sbjct: 127 SKDKTIKLWGVGDRQLQATLSGHQDFVNGLALSPDGRTLASASYDHTVKLWNVPSRQEIT 186

Query: 432 AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA 611
            +K     +++ A S  G+ +A GG+D +  I++L        +  + RTL GH   V++
Sbjct: 187 TLKANEGIMLSVAISRDGRFLATGGVDKLIRIWDL-------PSRRLLRTLEGHTSDVNS 239

Query: 612 CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFV 791
             + P + + L++ S      LW++TTG     FG E        V SV++S   + +  
Sbjct: 240 LAFTP-DSSQLVSGSDKDGIKLWNLTTGELQQQFGTE-----GGQVFSVAVSPDGSTL-A 292

Query: 792 SGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
           SG  D T  LW   ++ + +R   GH G V +V F  D  +  + S+D T +++
Sbjct: 293 SGHGDQTVKLWS--LSGQLLRNLKGHSGAVYSVVFGQD--QLISASEDKTIKVW 342



 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 66/263 (25%), Positives = 109/263 (41%)
 Frame = +3

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED 635
            V   A SP G  +   G D     +NL          T      GH  ++ A    P+  
Sbjct: 69   VNAIALSPDGNFLVSAGDDRRLYFWNL-------ATGTALGQAKGHTDWIYALVMTPDGQ 121

Query: 636  AHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTA 815
              +I+ S DKT  LW +      +       SGH   V+ +++S     +  S S D T 
Sbjct: 122  T-VISGSKDKTIKLWGVGDRQLQATL-----SGHQDFVNGLALSPDGRTL-ASASYDHTV 174

Query: 816  CLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQP 995
             LW+   + + + T   +EG +++V    DG    TG  D   R++D+ +   L+     
Sbjct: 175  KLWNVP-SRQEITTLKANEGIMLSVAISRDGRFLATGGVDKLIRIWDLPSRRLLRTLEGH 233

Query: 996  HSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGL 1175
             SD     V S+AF+     L +G       +W+    ++    G+      G++  + +
Sbjct: 234  TSD-----VNSLAFTPDSSQLVSGSDKDGIKLWNLTTGELQQQFGT----EGGQVFSVAV 284

Query: 1176 SGDGSALCTGSWDTTLKIWAFGG 1244
            S DGS L +G  D T+K+W+  G
Sbjct: 285  SPDGSTLASGHGDQTVKLWSLSG 307



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 33/126 (26%), Positives = 60/126 (47%)
 Frame = +3

Query: 855  TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIA 1034
            T  GHE +V A+   PDGN   +  DD     +++ TG  L   ++ H+D     + ++ 
Sbjct: 61   TLRGHEDEVNAIALSPDGNFLVSAGDDRRLYFWNLATGTALG-QAKGHTD----WIYALV 115

Query: 1035 FSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWD 1214
             +  G+ + +G  +    +W     ++   L    + H   ++ L LS DG  L + S+D
Sbjct: 116  MTPDGQTVISGSKDKTIKLWGVGDRQLQATL----SGHQDFVNGLALSPDGRTLASASYD 171

Query: 1215 TTLKIW 1232
             T+K+W
Sbjct: 172  HTVKLW 177



 Score = 35.0 bits (79), Expect = 3.8
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +3

Query: 231 DVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW 404
           D +T A   G   +          RNL+GH+G VYS+ +   +++++SAS+D  + VW
Sbjct: 287 DGSTLASGHGDQTVKLWSLSGQLLRNLKGHSGAVYSVVF--GQDQLISASEDKTIKVW 342



>gb:SCO939118_177541 Streptomyces coelicolor A3(2) complete genome;
            segment 15/29.
          Length = 1676

 Score =  108 bits (270), Expect = 3e-22
 Identities = 91/317 (28%), Positives = 135/317 (42%), Gaps = 9/317 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKL---PCAWVMTCAFSP 479
            L GH G VY L ++P+   + SA  D  + +WN    +   A+         V + AFSP
Sbjct: 1112 LDGHGGTVYLLAFSPDGRTLASAHDDHAVRLWNVADRRAPEALDTLTGSTGAVRSVAFSP 1171

Query: 480  TGQSVACGGLDSVCSIFNLNLP--PDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
             G ++A GG D    +++++ P  P+  G       L+GH G V +  + P  D H + S
Sbjct: 1172 DGDTLASGGDDDKVRLWDVSDPRRPEPAG-----APLAGHSGLVHSVAFSP--DGHTLAS 1224

Query: 654  -SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW-- 824
             S D T  LWD+T        G    +GH+  V +V+ S     + VS S D+TA LW  
Sbjct: 1225 GSADDTVQLWDVTDPAGAKPVGAPL-TGHSGPVWAVAFSPDGAMLAVS-SADSTASLWNV 1282

Query: 825  -DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
             D    S+      G  G++ A+ F PDG+   TGS D   RL+ + T   +        
Sbjct: 1283 SDPAYPSQVGVPLAGGSGEMYALGFSPDGHTLATGSGDSKVRLWSLPTSEMIGRIG---- 1338

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSG 1181
                      AF   G +L     +G   +WD       ++L +     DG I  L  S 
Sbjct: 1339 ----------AFRPDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPGDGDIRSLVFSP 1388

Query: 1182 DGSALCTGSWDTTLKIW 1232
            DG  L        L++W
Sbjct: 1389 DGGTLAVLVGGRALQLW 1405



 Score =  105 bits (263), Expect = 2e-21
 Identities = 84/316 (26%), Positives = 136/316 (43%), Gaps = 7/316 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC----AWVMTCAFS 476
            L GHTG VY   ++P+   + +AS D  + +W+     +   +  P     +WV T  FS
Sbjct: 1020 LLGHTGAVYLTSFSPDGRILATASYDRTVRLWDVSDPGRPQQLGKPLTGHTSWVSTAVFS 1079

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G+++A    D    ++++    D      +   L GH G V    + P +   L ++ 
Sbjct: 1080 PDGRTLASASDDGTIRLWDVT---DPGRPRPLGAPLDGHGGTVYLLAFSP-DGRTLASAH 1135

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D    LW++    R +    +  +G T  V SV+ S     +  SG  D    LWD   
Sbjct: 1136 DDHAVRLWNVAD--RRAPEALDTLTGSTGAVRSVAFSPDGDTL-ASGGDDDKVRLWDVSD 1192

Query: 837  ASR---AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
              R   A     GH G V +V F PDG+   +GS D T +L+D+      +    P + +
Sbjct: 1193 PRRPEPAGAPLAGHSGLVHSVAFSPDGHTLASGSADDTVQLWDVTDPAGAKPVGAPLTGH 1252

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                V ++AFS  G +L     +    +W+         +G       G +  LG S DG
Sbjct: 1253 S-GPVWAVAFSPDGAMLAVSSADSTASLWNVSDPAYPSQVGVPLAGGSGEMYALGFSPDG 1311

Query: 1188 SALCTGSWDTTLKIWA 1235
              L TGS D+ +++W+
Sbjct: 1312 HTLATGSGDSKVRLWS 1327



 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 95/353 (26%), Positives = 143/353 (40%), Gaps = 45/353 (12%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW----VMTCAFS 476
            L GH+G V+S+ ++P+ + + S S D  + +W+         +  P       V   AFS
Sbjct: 1203 LAGHSGLVHSVAFSPDGHTLASGSADDTVQLWDVTDPAGAKPVGAPLTGHSGPVWAVAFS 1262

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAH-LITS 653
            P G  +A    DS  S++N++ P      S V   L+G  G + A  + P  D H L T 
Sbjct: 1263 PDGAMLAVSSADSTASLWNVSDPAYP---SQVGVPLAGGSGEMYALGFSP--DGHTLATG 1317

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTA------------DVSSVSISASNTNMFVSG 797
            SGD    LW + T       G     GH              DV+      S +  F  G
Sbjct: 1318 SGDSKVRLWSLPTSEMIGRIGAFRPDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPG 1377

Query: 798  SCDTTAC-------------------LWDTRVASRAVRTFHG--------HEG-DVIAVK 893
              D  +                    LWD  V   A  T HG        + G D +A  
Sbjct: 1378 DGDIRSLVFSPDGGTLAVLVGGRALQLWD--VTDPAGPTAHGPPVALSTRYAGPDTLA-- 1433

Query: 894  FFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYT 1073
            F PDG    T  DD T +L++     + +   +P + +  + V ++AFS  GR L +G  
Sbjct: 1434 FSPDGRTLATAHDDRTIQLWNADDPSRPRRLGKPLAGHSGY-VNTLAFSPDGRTLASGGA 1492

Query: 1074 NGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            +    +WD         LG+ +  H G ++ L  S DG  L +GS D T+++W
Sbjct: 1493 DDAVRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPDGHTLASGSDDGTVRLW 1545



 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 65/227 (28%), Positives = 96/227 (42%), Gaps = 3/227 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHT 740
            N+ ++  L GH G V    + P +   L T+S D+T  LWD++   R    G    +GHT
Sbjct: 1013 NAPLATPLLGHTGAVYLTSFSP-DGRILATASYDRTVRLWDVSDPGRPQQLGKPL-TGHT 1070

Query: 741  ADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV---RTFHGHEGDVIAVKFFPDGN 911
            + VS+   S     +  S S D T  LWD     R         GH G V  + F PDG 
Sbjct: 1071 SWVSTAVFSPDGRTL-ASASDDGTIRLWDVTDPGRPRPLGAPLDGHGGTVYLLAFSPDGR 1129

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +  DD   RL+++      +             V S+AFS  G  L +G  +    +
Sbjct: 1130 TLASAHDDHAVRLWNVADRRAPEALDT--LTGSTGAVRSVAFSPDGDTLASGGDDDKVRL 1187

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            WD    +     G+    H G +  +  S DG  L +GS D T+++W
Sbjct: 1188 WDVSDPRRPEPAGAPLAGHSGLVHSVAFSPDGHTLASGSADDTVQLW 1234



 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 70/307 (22%), Positives = 126/307 (41%), Gaps = 10/307 (3%)
 Frame = +3

Query: 351  PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC----AWVMTCAFSPTGQSVACGGLDSV 518
            P+ + + +A++DGR+ +W+     +  ++  P       + +  FSP G ++A       
Sbjct: 1342 PDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPGDGDIRSLVFSPDGGTLAVLVGGRA 1401

Query: 519  CSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGL 698
              ++++  P     +       + + G      + P +   L T+  D+T  LW+     
Sbjct: 1402 LQLWDVTDPAGPTAHGPPVALSTRYAG-PDTLAFSP-DGRTLATAHDDRTIQLWNADDPS 1459

Query: 699  RTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVR---TFHGH 869
            R    G    +GH+  V++++ S     +  SG  D    LWD    + A R      GH
Sbjct: 1460 RPRRLGKPL-AGHSGYVNTLAFSPDGRTL-ASGGADDAVRLWDVTDPAHATRLGAARTGH 1517

Query: 870  EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR---TGHQLQVYSQPHSDNEVHRVTSIAFS 1040
             G V  + + PDG+   +GSDDGT RL+D+     G         H+D+    V S+ FS
Sbjct: 1518 LGPVNVLAYSPDGHTLASGSDDGTVRLWDVTEPGEGSGGGTTLAGHTDS----VVSLTFS 1573

Query: 1041 ISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTT 1220
              G  L +G  +    +W          +G   + +    + L  S     L   S   T
Sbjct: 1574 QDGDTLASGANDNTVRLWSVTDPAEAAPIGRAMSPNAKTGNFLSFSPVSHMLGVSSGTDT 1633

Query: 1221 LKIWAFG 1241
            +++W+ G
Sbjct: 1634 VRLWSLG 1640



 Score = 37.4 bits (85), Expect = 0.77
 Identities = 30/129 (23%), Positives = 59/129 (45%), Gaps = 5/129 (3%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW----VMTCAFSPT 482
            GH G V  L ++P+ + + S S DG + +W+     +        A     V++  FS  
Sbjct: 1516 GHLGPVNVLAYSPDGHTLASGSDDGTVRLWDVTEPGEGSGGGTTLAGHTDSVVSLTFSQD 1575

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TSSG 659
            G ++A G  D+   ++++  P +    + + R +S +    +   + P   +H++  SSG
Sbjct: 1576 GDTLASGANDNTVRLWSVTDPAE---AAPIGRAMSPNAKTGNFLSFSP--VSHMLGVSSG 1630

Query: 660  DKTCGLWDI 686
              T  LW +
Sbjct: 1631 TDTVRLWSL 1639



>pir|T42045|T42045 beta transducin-like protein homolog - Streptomyces
            coelicolor>gb:SCO131817_173255 Streptomyces coelicolor
            wdpA gene.
          Length = 1049

 Score =  108 bits (270), Expect = 3e-22
 Identities = 95/317 (29%), Positives = 139/317 (43%), Gaps = 9/317 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKL---PCAWVMTCAFSP 479
            L GH G VY L ++P+   + SA  D  + +WN    +   A+         V + AFSP
Sbjct: 485  LDGHGGTVYLLAFSPDGRTLASAHDDHAVRLWNVADRRAPEALDTLTGSTGAVRSVAFSP 544

Query: 480  TGQSVACGGLDSVCSIFNLNLP--PDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
             G ++A GG D    +++++ P  P+  G       L+GH G V +  + P  D H + S
Sbjct: 545  DGDTLASGGDDDKVRLWDVSDPRRPEPAG-----APLAGHSGLVHSVAFSP--DGHTLAS 597

Query: 654  -SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW-- 824
             S D T  LWD+T        G    +GH+  V +V+ S     + VS S D+TA LW  
Sbjct: 598  GSADDTVQLWDVTDPAGAKPVGAPL-TGHSGPVWAVAFSPDGAMLAVS-SADSTASLWNV 655

Query: 825  -DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
             D    S+      G  G++ A+ F PDG+   TGS D   RL           +S P S
Sbjct: 656  SDPAYPSQVGVPLAGGSGEMYALGFSPDGHTLATGSGDSKVRL-----------WSLPTS 704

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSG 1181
            D  + R+   AF   G +L     +G   +WD       ++L +     DG I  L  S 
Sbjct: 705  D-MIGRIG--AFRPDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPGDGDIRSLVFSP 761

Query: 1182 DGSALCTGSWDTTLKIW 1232
            DG  L        L++W
Sbjct: 762  DGGTLAVLVGGRALQLW 778



 Score =  105 bits (263), Expect = 2e-21
 Identities = 84/316 (26%), Positives = 136/316 (43%), Gaps = 7/316 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC----AWVMTCAFS 476
            L GHTG VY   ++P+   + +AS D  + +W+     +   +  P     +WV T  FS
Sbjct: 393  LLGHTGAVYLTSFSPDGRILATASYDRTVRLWDVSDPGRPQQLGKPLTGHTSWVSTAVFS 452

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P G+++A    D    ++++    D      +   L GH G V    + P +   L ++ 
Sbjct: 453  PDGRTLASASDDGTIRLWDVT---DPGRPRPLGAPLDGHGGTVYLLAFSP-DGRTLASAH 508

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
             D    LW++    R +    +  +G T  V SV+ S     +  SG  D    LWD   
Sbjct: 509  DDHAVRLWNVAD--RRAPEALDTLTGSTGAVRSVAFSPDGDTL-ASGGDDDKVRLWDVSD 565

Query: 837  ASR---AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
              R   A     GH G V +V F PDG+   +GS D T +L+D+      +    P + +
Sbjct: 566  PRRPEPAGAPLAGHSGLVHSVAFSPDGHTLASGSADDTVQLWDVTDPAGAKPVGAPLTGH 625

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                V ++AFS  G +L     +    +W+         +G       G +  LG S DG
Sbjct: 626  S-GPVWAVAFSPDGAMLAVSSADSTASLWNVSDPAYPSQVGVPLAGGSGEMYALGFSPDG 684

Query: 1188 SALCTGSWDTTLKIWA 1235
              L TGS D+ +++W+
Sbjct: 685  HTLATGSGDSKVRLWS 700



 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 95/353 (26%), Positives = 143/353 (40%), Gaps = 45/353 (12%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW----VMTCAFS 476
            L GH+G V+S+ ++P+ + + S S D  + +W+         +  P       V   AFS
Sbjct: 576  LAGHSGLVHSVAFSPDGHTLASGSADDTVQLWDVTDPAGAKPVGAPLTGHSGPVWAVAFS 635

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAH-LITS 653
            P G  +A    DS  S++N++ P      S V   L+G  G + A  + P  D H L T 
Sbjct: 636  PDGAMLAVSSADSTASLWNVSDPAYP---SQVGVPLAGGSGEMYALGFSP--DGHTLATG 690

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTA------------DVSSVSISASNTNMFVSG 797
            SGD    LW + T       G     GH              DV+      S +  F  G
Sbjct: 691  SGDSKVRLWSLPTSDMIGRIGAFRPDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPG 750

Query: 798  SCDTTAC-------------------LWDTRVASRAVRTFHG--------HEG-DVIAVK 893
              D  +                    LWD  V   A  T HG        + G D +A  
Sbjct: 751  DGDIRSLVFSPDGGTLAVLVGGRALQLWD--VTDPAGPTAHGPPVALSTRYAGPDTLA-- 806

Query: 894  FFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYT 1073
            F PDG    T  DD T +L++     + +   +P + +  + V ++AFS  GR L +G  
Sbjct: 807  FSPDGRTLATAHDDRTIQLWNADDPSRPRRLGKPLAGHSGY-VNTLAFSPDGRTLASGGA 865

Query: 1074 NGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            +    +WD         LG+ +  H G ++ L  S DG  L +GS D T+++W
Sbjct: 866  DDAVRLWDVTDPAHATRLGAARTGHLGPVNVLAYSPDGHTLASGSDDGTVRLW 918



 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 65/227 (28%), Positives = 96/227 (42%), Gaps = 3/227 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHT 740
            N+ ++  L GH G V    + P +   L T+S D+T  LWD++   R    G    +GHT
Sbjct: 386  NAPLATPLLGHTGAVYLTSFSP-DGRILATASYDRTVRLWDVSDPGRPQQLGKPL-TGHT 443

Query: 741  ADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV---RTFHGHEGDVIAVKFFPDGN 911
            + VS+   S     +  S S D T  LWD     R         GH G V  + F PDG 
Sbjct: 444  SWVSTAVFSPDGRTL-ASASDDGTIRLWDVTDPGRPRPLGAPLDGHGGTVYLLAFSPDGR 502

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +  DD   RL+++      +             V S+AFS  G  L +G  +    +
Sbjct: 503  TLASAHDDHAVRLWNVADRRAPEALDT--LTGSTGAVRSVAFSPDGDTLASGGDDDKVRL 560

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            WD    +     G+    H G +  +  S DG  L +GS D T+++W
Sbjct: 561  WDVSDPRRPEPAGAPLAGHSGLVHSVAFSPDGHTLASGSADDTVQLW 607



 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 70/307 (22%), Positives = 126/307 (41%), Gaps = 10/307 (3%)
 Frame = +3

Query: 351  PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC----AWVMTCAFSPTGQSVACGGLDSV 518
            P+ + + +A++DGR+ +W+     +  ++  P       + +  FSP G ++A       
Sbjct: 715  PDGHVLATAARDGRVRLWDVTDPGRPVSLSAPFEPGDGDIRSLVFSPDGGTLAVLVGGRA 774

Query: 519  CSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGL 698
              ++++  P     +       + + G      + P +   L T+  D+T  LW+     
Sbjct: 775  LQLWDVTDPAGPTAHGPPVALSTRYAG-PDTLAFSP-DGRTLATAHDDRTIQLWNADDPS 832

Query: 699  RTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVR---TFHGH 869
            R    G    +GH+  V++++ S     +  SG  D    LWD    + A R      GH
Sbjct: 833  RPRRLGKPL-AGHSGYVNTLAFSPDGRTL-ASGGADDAVRLWDVTDPAHATRLGAARTGH 890

Query: 870  EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR---TGHQLQVYSQPHSDNEVHRVTSIAFS 1040
             G V  + + PDG+   +GSDDGT RL+D+     G         H+D+    V S+ FS
Sbjct: 891  LGPVNVLAYSPDGHTLASGSDDGTVRLWDVTEPGEGSGGGTTLAGHTDS----VVSLTFS 946

Query: 1041 ISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTT 1220
              G  L +G  +    +W          +G   + +    + L  S     L   S   T
Sbjct: 947  QDGDTLASGANDNTVRLWSVTDPAEAAPIGRAMSPNAKTGNFLSFSPVSHMLGVSSGTDT 1006

Query: 1221 LKIWAFG 1241
            +++W+ G
Sbjct: 1007 VRLWSLG 1013



 Score = 37.4 bits (85), Expect = 0.77
 Identities = 30/129 (23%), Positives = 59/129 (45%), Gaps = 5/129 (3%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW----VMTCAFSPT 482
            GH G V  L ++P+ + + S S DG + +W+     +        A     V++  FS  
Sbjct: 889  GHLGPVNVLAYSPDGHTLASGSDDGTVRLWDVTEPGEGSGGGTTLAGHTDSVVSLTFSQD 948

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TSSG 659
            G ++A G  D+   ++++  P +    + + R +S +    +   + P   +H++  SSG
Sbjct: 949  GDTLASGANDNTVRLWSVTDPAE---AAPIGRAMSPNAKTGNFLSFSP--VSHMLGVSSG 1003

Query: 660  DKTCGLWDI 686
              T  LW +
Sbjct: 1004 TDTVRLWSL 1012



>sp|Q8YV57|YL24_ANASP Hypothetical WD-repeat protein
            all2124.>pir|AF2071|AF2071 WD-40 repeat protein
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_683113 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1683

 Score =  108 bits (269), Expect = 4e-22
 Identities = 87/318 (27%), Positives = 142/318 (44%), Gaps = 2/318 (0%)
 Frame = +3

Query: 285  TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT 464
            +D    + + GH   V ++ ++P+   + SAS D  + +W+  + Q    +    A V+T
Sbjct: 1143 SDGTLLKTITGHEQTVNNVYFSPDGKNLASASSDHSIKLWDTTSGQLLMTLTGHSAGVIT 1202

Query: 465  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL 644
              FSP GQ++A G  D    +++       DG   + +TL+GH+ +V++  + P +   L
Sbjct: 1203 VRFSPDGQTIAAGSEDKTVKLWH-----RQDGK--LLKTLNGHQDWVNSLSFSP-DGKTL 1254

Query: 645  ITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW 824
             ++S DKT  LW I  G            GH   V  V+ S S+     S S D T  LW
Sbjct: 1255 ASASADKTIKLWRIADGKLVKTL-----KGHNDSVWDVNFS-SDGKAIASASRDNTIKLW 1308

Query: 825  DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
            +       + TF GH G V AV F PD N   + S D T RL+       L+V +     
Sbjct: 1309 NRH--GIELETFTGHSGGVYAVNFLPDSNIIASASLDNTIRLWQRPLISPLEVLAGNSG- 1365

Query: 1005 NEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLS-- 1178
                 V +++F   G ++     +G+  +W +         GSL  +  G  +  G+S  
Sbjct: 1366 -----VYAVSFLHDGSIIATAGADGNIQLWHS-------QDGSLLKTLPGNKAIYGISFT 1413

Query: 1179 GDGSALCTGSWDTTLKIW 1232
              G  + + + D T+KIW
Sbjct: 1414 PQGDLIASANADKTVKIW 1431



 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 86/364 (23%), Positives = 155/364 (42%), Gaps = 35/364 (9%)
 Frame = +3

Query: 246  ARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQK 425
            A S+ KT   +   D    + L GH   V SL ++P+   + SAS D  + +W     + 
Sbjct: 1214 AGSEDKTVKLWHRQDGKLLKTLNGHQDWVNSLSFSPDGKTLASASADKTIKLWRIADGKL 1273

Query: 426  THAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYV 605
               +K     V    FS  G+++A    D+   ++N         +     T +GH G V
Sbjct: 1274 VKTLKGHNDSVWDVNFSSDGKAIASASRDNTIKLWN--------RHGIELETFTGHSGGV 1325

Query: 606  SACQYVPNEDAHLITSSG-DKTCGLW--------DITTG---------------LRTSVF 713
             A  ++P  D+++I S+  D T  LW        ++  G               + T+  
Sbjct: 1326 YAVNFLP--DSNIIASASLDNTIRLWQRPLISPLEVLAGNSGVYAVSFLHDGSIIATAGA 1383

Query: 714  GGEYQSGHTADVSSVSISASNT-----------NMFVSGSCDTTACLWDTRVASRAVRTF 860
             G  Q  H+ D S +     N            ++  S + D T  +W  R   +A++T 
Sbjct: 1384 DGNIQLWHSQDGSLLKTLPGNKAIYGISFTPQGDLIASANADKTVKIWRVR-DGKALKTL 1442

Query: 861  HGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFS 1040
             GH+ +V  V F PDG    + S D T +L+++  G + +   + H+D     V  ++FS
Sbjct: 1443 IGHDNEVNKVNFSPDGKTLASASRDNTVKLWNVSDG-KFKKTLKGHTD----EVFWVSFS 1497

Query: 1041 ISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTT 1220
              G+++ +   +    +WD+    ++ +L     +H+  +  +  + DGS L + S D T
Sbjct: 1498 PDGKIIASASADKTIRLWDSFSGNLIKSL----PAHNDLVYSVNFNPDGSMLASTSADKT 1553

Query: 1221 LKIW 1232
            +K+W
Sbjct: 1554 VKLW 1557



 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 85/310 (27%), Positives = 139/310 (44%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L G++G VY++ +  + + I +A  DG + +W++        +    A +   +F+P G 
Sbjct: 1360 LAGNSG-VYAVSFLHDGSIIATAGADGNIQLWHSQDGSLLKTLPGNKA-IYGISFTPQGD 1417

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A    D    I+ +      DG +   +TL GH   V+   + P+    L ++S D T
Sbjct: 1418 LIASANADKTVKIWRVR-----DGKAL--KTLIGHDNEVNKVNFSPDGKT-LASASRDNT 1469

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW+++ G            GHT +V  VS S     +  S S D T  LWD+  +   
Sbjct: 1470 VKLWNVSDGKFKKTL-----KGHTDEVFWVSFSPDG-KIIASASADKTIRLWDS-FSGNL 1522

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            +++   H   V +V F PDG+   + S D T +L+    GH L  +S  HS    + V S
Sbjct: 1523 IKSLPAHNDLVYSVNFNPDGSMLASTSADKTVKLWRSHDGHLLHTFS-GHS----NVVYS 1577

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
             +FS  GR + +   +    +W     ++  +L +    H   +     S DG  L +GS
Sbjct: 1578 SSFSPDGRYIASASEDKTVKIW-----QIDGHLLTTLPQHQAGVMSAIFSPDGKTLISGS 1632

Query: 1209 WDTTLKIWAF 1238
             DTT KIW F
Sbjct: 1633 LDTTTKIWRF 1642



 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 76/308 (24%), Positives = 143/308 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH   V S+  + +   I S S D  + +W+    +    +      V + +FSP GQ
Sbjct: 1068 LEGHKDGVISISISRDGQTIASGSLDKTIKLWSR-DGRLFRTLNGHEDAVYSVSFSPDGQ 1126

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            ++A GG D    ++  +       + T+ +T++GH+  V+   + P +  +L ++S D +
Sbjct: 1127 TIASGGSDKTIKLWQTS-------DGTLLKTITGHEQTVNNVYFSP-DGKNLASASSDHS 1178

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD T+G           +GH+A V +V  S     +  +GS D T  LW  R   + 
Sbjct: 1179 IKLWDTTSGQLLMTL-----TGHSAGVITVRFSPDGQTI-AAGSEDKTVKLWH-RQDGKL 1231

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            ++T +GH+  V ++ F PDG    + S D T +L+ I  G  ++   + H+D+    V  
Sbjct: 1232 LKTLNGHQDWVNSLSFSPDGKTLASASADKTIKLWRIADGKLVKTL-KGHNDS----VWD 1286

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            + FS  G+ + +   +    +W+    ++    G     H G +  +    D + + + S
Sbjct: 1287 VNFSSDGKAIASASRDNTIKLWNRHGIELETFTG-----HSGGVYAVNFLPDSNIIASAS 1341

Query: 1209 WDTTLKIW 1232
             D T+++W
Sbjct: 1342 LDNTIRLW 1349



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 55/217 (25%), Positives = 96/217 (44%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L GH  +V  ++++P+   + SAS+D  + +WN    +    +K     V   +FSP 
Sbjct: 1440 KTLIGHDNEVNKVNFSPDGKTLASASRDNTVKLWNVSDGKFKKTLKGHTDEVFWVSFSPD 1499

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G+ +A    D    ++       +  +  + ++L  H   V +  + P + + L ++S D
Sbjct: 1500 GKIIASASADKTIRLW-------DSFSGNLIKSLPAHNDLVYSVNFNP-DGSMLASTSAD 1551

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  LW    G     F     SGH+  V S S S        S S D T  +W  ++  
Sbjct: 1552 KTVKLWRSHDGHLLHTF-----SGHSNVVYSSSFSPDG-RYIASASEDKTVKIW--QIDG 1603

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
              + T   H+  V++  F PDG    +GS D T +++
Sbjct: 1604 HLLTTLPQHQAGVMSAIFSPDGKTLISGSLDTTTKIW 1640



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 37/158 (23%), Positives = 69/158 (43%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            ++L  H   VYS+++ P+ + + S S D  + +W +      H        V + +FSP 
Sbjct: 1524 KSLPAHNDLVYSVNFNPDGSMLASTSADKTVKLWRSHDGHLLHTFSGHSNVVYSSSFSPD 1583

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G+ +A    D    I+ +      DG+  +  TL  H+  V +  + P +   LI+ S D
Sbjct: 1584 GRYIASASEDKTVKIWQI------DGH--LLTTLPQHQAGVMSAIFSP-DGKTLISGSLD 1634

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASN 776
             T  +W             + Q   T+ ++++ +SA N
Sbjct: 1635 TTTKIWRF-----------DSQQAKTSQMNTLVMSACN 1661



>pir|AH2154|AH2154 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120)>gb:BA000019_683780 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1189

 Score =  107 bits (267), Expect = 6e-22
 Identities = 86/320 (26%), Positives = 152/320 (47%), Gaps = 5/320 (1%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQ----KTHAIKLPCAWVMTCAFSPT 482
            GHT  V+ ++ + +   +VS+ +DG + +WN    +    ++ +  L  A   T +FSP 
Sbjct: 822  GHTDAVWGVNLSKDGKLLVSSGEDGTVRLWNMENGEAGKFQSLSFNLGEAAAGTISFSPD 881

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G+ +   G  ++  ++N      + G   V  TL+GH   + + Q+ P+    + T+S D
Sbjct: 882  GKILGTTGRYTMAKLWN------HQGQELV--TLNGHSDTLRSLQFSPDGQI-IATASRD 932

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  LW++    R ++ G      H ADV S + S  +  +  S S DTT  LW+     
Sbjct: 933  KTVKLWNLNGKERATLHG------HQADVRSATFSPDSKTI-ASASWDTTVKLWNLN--G 983

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            R + T  GH+  V  V F PD     T S+DGT +L++ R G +L V  + H       +
Sbjct: 984  REIMTLRGHQAGVRNVSFSPDDQIIATASEDGTAKLWN-RQGQEL-VTLKGHQAG----I 1037

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             +++FS   +++     +    +W+    +++  LG     H G ++ +  S +   + T
Sbjct: 1038 QAVSFSPDSQVIATASKDKTVKLWNRQGKELLTLLG-----HRGEVNAVSFSPNRETIAT 1092

Query: 1203 GSWDTTLKIWAF-GGYRQVI 1259
             S D T+K+W   GG  Q +
Sbjct: 1093 ASEDMTVKLWNLKGGQMQTL 1112



 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 90/347 (25%), Positives = 145/347 (41%), Gaps = 35/347 (10%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GHT  V+S++++P+   +VSAS+D  + VW     Q+  A      WV    FSP  +
Sbjct: 615  LRGHTDAVWSVNFSPDGKMLVSASRDKTVKVWRVEDGQEI-ATLTHQNWVACIGFSPDSK 673

Query: 489  SVACGGLDSVCSIFNL------------------NLPPDNDGNSTVSR------------ 578
            +VA    +    ++NL                  +  P  +  +T SR            
Sbjct: 674  TVASMEWNGTMRLWNLQGQELKSFPTHKAPVVAVHFSPKGNMIATASRDGTAKVWSLDGK 733

Query: 579  ---TLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQS--GHTA 743
               +L GHK +V    +   +  +L+T+S DKT  +WD+         G E  +  GH+ 
Sbjct: 734  ELLSLGGHKNWVMYVNF-SEDGKNLVTASRDKTAKIWDLQ--------GKELATLRGHSD 784

Query: 744  DVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGT 923
             V+S   S     +  + S D T  LW+ +     ++ F GH   V  V    DG    +
Sbjct: 785  TVASAVFSRDGQTI-ATASSDKTVRLWNRK--GEELQVFWGHTDAVWGVNLSKDGKLLVS 841

Query: 924  GSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTL 1103
              +DGT RL+++  G   +  S   +  E    T I+FS  G++L          +W+  
Sbjct: 842  SGEDGTVRLWNMENGEAGKFQSLSFNLGEAAAGT-ISFSPDGKILGTTGRYTMAKLWNHQ 900

Query: 1104 LAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
              ++V       N H   +  L  S DG  + T S D T+K+W   G
Sbjct: 901  GQELV-----TLNGHSDTLRSLQFSPDGQIIATASRDKTVKLWNLNG 942



 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 74/263 (28%), Positives = 130/263 (49%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+  + SL ++P+   I +AS+D  + +WN L  ++   +    A V +  FSP  +
Sbjct: 907  LNGHSDTLRSLQFSPDGQIIATASRDKTVKLWN-LNGKERATLHGHQADVRSATFSPDSK 965

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            ++A    D+   ++NLN      G   +  TL GH+  V    + P +D  + T+S D T
Sbjct: 966  TIASASWDTTVKLWNLN------GREIM--TLRGHQAGVRNVSFSP-DDQIIATASEDGT 1016

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW+       ++       GH A + +VS S  ++ +  + S D T  LW+ +   + 
Sbjct: 1017 AKLWNRQGQELVTL------KGHQAGIQAVSFS-PDSQVIATASKDKTVKLWNRQ--GKE 1067

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T  GH G+V AV F P+     T S+D T +L++++ G Q+Q  S   +      V S
Sbjct: 1068 LLTLLGHRGEVNAVSFSPNRETIATASEDMTVKLWNLK-GGQMQTLSGLDAG-----VKS 1121

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            ++FS  G++L +  + G   +W+
Sbjct: 1122 VSFSPDGKVLASSDSLGKVTLWN 1144



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 60/217 (27%), Positives = 96/217 (44%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH   V S  ++P+   I SAS D  + +WN L  ++   ++   A V   +FSP  Q
Sbjct: 948  LHGHQADVRSATFSPDSKTIASASWDTTVKLWN-LNGREIMTLRGHQAGVRNVSFSPDDQ 1006

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A    D    ++N        G   V  TL GH+  + A  + P+    + T+S DKT
Sbjct: 1007 IIATASEDGTAKLWN------RQGQELV--TLKGHQAGIQAVSFSPDSQV-IATASKDKT 1057

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW+       ++       GH  +V++VS S  N     + S D T  LW+ +     
Sbjct: 1058 VKLWNRQGKELLTLL------GHRGEVNAVSFS-PNRETIATASEDMTVKLWNLK--GGQ 1108

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
            ++T  G +  V +V F PDG    +    G   L+++
Sbjct: 1109 MQTLSGLDAGVKSVSFSPDGKVLASSDSLGKVTLWNL 1145



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 77/350 (22%), Positives = 136/350 (38%), Gaps = 41/350 (11%)
 Frame = +3

Query: 306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            +L GH   V  ++++ +   +V+AS+D    +W+ L  ++   ++     V +  FS  G
Sbjct: 737  SLGGHKNWVMYVNFSEDGKNLVTASRDKTAKIWD-LQGKELATLRGHSDTVASAVFSRDG 795

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG-D 662
            Q++A    D    ++N              +   GH   V       ++D  L+ SSG D
Sbjct: 796  QTIATASSDKTVRLWN--------RKGEELQVFWGHTDAVWGVNL--SKDGKLLVSSGED 845

Query: 663  KTCGLWDI---------------------------------TTGLRTSVFGGEYQ----- 728
             T  LW++                                 TTG  T      +Q     
Sbjct: 846  GTVRLWNMENGEAGKFQSLSFNLGEAAAGTISFSPDGKILGTTGRYTMAKLWNHQGQELV 905

Query: 729  --SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFP 902
              +GH+  + S+  S     +  + S D T  LW+     RA  T HGH+ DV +  F P
Sbjct: 906  TLNGHSDTLRSLQFSPDG-QIIATASRDKTVKLWNLNGKERA--TLHGHQADVRSATFSP 962

Query: 903  DGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGD 1082
            D     + S D T +L+++  G ++       +      V +++FS   +++     +G 
Sbjct: 963  DSKTIASASWDTTVKLWNL-NGREIMTLRGHQAG-----VRNVSFSPDDQIIATASEDGT 1016

Query: 1083 CYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              +W+    ++V   G     H   I  +  S D   + T S D T+K+W
Sbjct: 1017 AKLWNRQGQELVTLKG-----HQAGIQAVSFSPDSQVIATASKDKTVKLW 1061



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 63/254 (24%), Positives = 106/254 (41%)
 Frame = +3

Query: 471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT 650
            FSP G+ +A    D    I+        DG   +  TL GH   V +  + P +   L++
Sbjct: 586  FSPDGEKLASASWDKTVKIWQ------RDGK--LLHTLRGHTDAVWSVNFSP-DGKMLVS 636

Query: 651  SSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
            +S DKT  +W +  G   +         H   V+ +  S  +  +  S   + T  LW+ 
Sbjct: 637  ASRDKTVKVWRVEDGQEIATLT------HQNWVACIGFSPDSKTV-ASMEWNGTMRLWNL 689

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            +   + +++F  H+  V+AV F P GN   T S DGT +++ +     L +         
Sbjct: 690  Q--GQELKSFPTHKAPVVAVHFSPKGNMIATASRDGTAKVWSLDGKELLSL------GGH 741

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
             + V  + FS  G+ L     +    +WD L  K +  L      H   ++    S DG 
Sbjct: 742  KNWVMYVNFSEDGKNLVTASRDKTAKIWD-LQGKELATL----RGHSDTVASAVFSRDGQ 796

Query: 1191 ALCTGSWDTTLKIW 1232
             + T S D T+++W
Sbjct: 797  TIATASSDKTVRLW 810



 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 35/127 (27%), Positives = 59/127 (46%)
 Frame = +3

Query: 864  GHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSI 1043
            GH   V  VKF PDG +  + S D T +++  R G  L    + H+D     V S+ FS 
Sbjct: 576  GHGDVVTRVKFSPDGEKLASASWDKTVKIWQ-RDGKLLHTL-RGHTD----AVWSVNFSP 629

Query: 1044 SGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTL 1223
             G++L +   +    VW     + +  L     +H   ++C+G S D   + +  W+ T+
Sbjct: 630  DGKMLVSASRDKTVKVWRVEDGQEIATL-----THQNWVACIGFSPDSKTVASMEWNGTM 684

Query: 1224 KIWAFGG 1244
            ++W   G
Sbjct: 685  RLWNLQG 691



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 27/99 (27%), Positives = 50/99 (50%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH G+V ++ ++P +  I +AS+D  + +WN    Q      L  A V + +FSP G+
Sbjct: 1071 LLGHRGEVNAVSFSPNRETIATASEDMTVKLWNLKGGQMQTLSGLD-AGVKSVSFSPDGK 1129

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYV 605
             +A    DS+  +   NL  D+     +++  +  + Y+
Sbjct: 1130 VLASS--DSLGKVTLWNLDFDSSPEKLLAQACNCVRDYL 1166



>pir|AB2410|AB2410 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120)>gb:BA000019_685823 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1551

 Score =  107 bits (266), Expect = 8e-22
 Identities = 85/314 (27%), Positives = 142/314 (45%), Gaps = 4/314 (1%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLP----CAWVMTCAFSPT 482
            GH G V+ + ++P+   I +A+ D  + +WN    +    ++ P    C W ++  FSP 
Sbjct: 1074 GHQGTVWCISFSPDGKHIATAADDRIVRLWNL---KGKLLVRFPGHQDCVWDVS--FSPD 1128

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
             Q +A    D    ++NL           ++R   GH+G V + ++ PN   ++ T+S D
Sbjct: 1129 SQYIATASSDGTSRLWNL-------AGEQITR-FRGHQGVVWSVRFSPNGQ-YIATTSSD 1179

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            +T  +W++  G + + F     SGH   V SVS S        + S D T  LW   +  
Sbjct: 1180 RTARVWNLN-GQQLAQF-----SGHQDYVRSVSFSPDG-KYIATASSDRTVRLW--HLNK 1230

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
            +    F GH+  V +V F PDG +  T +DD T RL++I+    LQ            +V
Sbjct: 1231 QQFSAFQGHQSTVRSVDFSPDGQKVVTAADDRTVRLWNIKGEELLQFLGHR------GKV 1284

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             S++FS  G+ +    ++    +WD     +   L      H G +  +  S DG  + T
Sbjct: 1285 WSVSFSPDGKYIATTSSDRTVRLWD-----ITGQLLQQFPGHQGTVWSVSFSPDGQHIAT 1339

Query: 1203 GSWDTTLKIWAFGG 1244
             S D T ++W+  G
Sbjct: 1340 ASSDLTTRLWSLDG 1353



 Score =  102 bits (254), Expect = 2e-20
 Identities = 82/313 (26%), Positives = 143/313 (45%)
 Frame = +3

Query: 306  NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
            +LQGH   ++S +++P+   I +AS D    +WN  + Q+    +    +V + +FSP G
Sbjct: 989  SLQGHEDTIWSANFSPDGKYIATASSDRTARLWN-FSGQQLAKFQGHQGYVRSVSFSPDG 1047

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
            + +A  G D    +++ +      G   V     GH+G V    + P +  H+ T++ D+
Sbjct: 1048 KHIATAGDDHTARLWSFS------GQQLVQ--FPGHQGTVWCISFSP-DGKHIATAADDR 1098

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
               LW++   L           GH   V  VS S  ++    + S D T+ LW+  +A  
Sbjct: 1099 IVRLWNLKGKLLVRF------PGHQDCVWDVSFS-PDSQYIATASSDGTSRLWN--LAGE 1149

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             +  F GH+G V +V+F P+G    T S D T R++++  G QL  +S  H D     V 
Sbjct: 1150 QITRFRGHQGVVWSVRFSPNGQYIATTSSDRTARVWNL-NGQQLAQFS-GHQD----YVR 1203

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            S++FS  G+ +    ++    +W     +      S    H   +  +  S DG  + T 
Sbjct: 1204 SVSFSPDGKYIATASSDRTVRLWHLNKQQF-----SAFQGHQSTVRSVDFSPDGQKVVTA 1258

Query: 1206 SWDTTLKIWAFGG 1244
            + D T+++W   G
Sbjct: 1259 ADDRTVRLWNIKG 1271



 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 82/320 (25%), Positives = 138/320 (43%), Gaps = 4/320 (1%)
 Frame = +3

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            QGH   V S+D++P+  ++V+A+ D  + +WN +  ++          V + +FSP G+ 
Sbjct: 1237 QGHQSTVRSVDFSPDGQKVVTAADDRTVRLWN-IKGEELLQFLGHRGKVWSVSFSPDGKY 1295

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            +A    D    ++++           + +   GH+G V +  + P +  H+ T+S D T 
Sbjct: 1296 IATTSSDRTVRLWDI--------TGQLLQQFPGHQGTVWSVSFSP-DGQHIATASSDLTT 1346

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LW +  G     F      GH   V  VS S  N     + + D TA LW+  +A R V
Sbjct: 1347 RLWSL-DGQELMQF-----KGHDKWVRYVSFSC-NGQHIATAADDCTARLWN--LAGRQV 1397

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
              F GH+  V +V F PD     T S+D T +L+ +    Q+    + H       V S 
Sbjct: 1398 GQFLGHQSIVWSVNFSPDCQYLVTASEDHTAKLWTL--DGQIVTEFRGHQ----APVKSA 1451

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ----NSHDGRISCLGLSGDGSALC 1199
             FS +G+ +     +    +W         NL   Q      H G +  + +S D   + 
Sbjct: 1452 VFSHNGQYIATSSDDRTARLW---------NLNGQQLAQFKGHKGAVRSISISPDDQYIA 1502

Query: 1200 TGSWDTTLKIWAFGGYRQVI 1259
            T S D T+++W      Q++
Sbjct: 1503 TASDDRTVRLWPIENLDQLL 1522



 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 83/332 (25%), Positives = 141/332 (42%), Gaps = 12/332 (3%)
 Frame = +3

Query: 312  QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            QGH   V S+ ++ +   I++AS D    +WN L  ++  +++     + +  FSP G+ 
Sbjct: 950  QGHQAWVRSVSFSRDGQYILTASDDCTARLWN-LQGKQLISLQGHEDTIWSANFSPDGKY 1008

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
            +A    D    ++N +      G         GH+GYV +  + P +  H+ T+  D T 
Sbjct: 1009 IATASSDRTARLWNFS------GQQLAK--FQGHQGYVRSVSFSP-DGKHIATAGDDHTA 1059

Query: 672  GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAV 851
             LW   +G +   F      GH   V  +S S    ++  + + D    LW+ +   + +
Sbjct: 1060 RLWSF-SGQQLVQF-----PGHQGTVWCISFSPDGKHI-ATAADDRIVRLWNLK--GKLL 1110

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
              F GH+  V  V F PD     T S DGT RL+++  G Q+  +           V S+
Sbjct: 1111 VRFPGHQDCVWDVSFSPDSQYIATASSDGTSRLWNL-AGEQITRFR-----GHQGVVWSV 1164

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ----NSHDGRISCLGLSGDGSALC 1199
             FS +G+ +    ++    VW         NL   Q    + H   +  +  S DG  + 
Sbjct: 1165 RFSPNGQYIATTSSDRTARVW---------NLNGQQLAQFSGHQDYVRSVSFSPDGKYIA 1215

Query: 1200 TGSWDTTLKIW--------AFGGYRQVI*VVD 1271
            T S D T+++W        AF G++  +  VD
Sbjct: 1216 TASSDRTVRLWHLNKQQFSAFQGHQSTVRSVD 1247



 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 70/238 (29%), Positives = 107/238 (44%), Gaps = 4/238 (1%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH G V+S+ ++P+   I +AS D    +W+ L  Q+    K    WV   +FS  GQ +
Sbjct: 1320 GHQGTVWSVSFSPDGQHIATASSDLTTRLWS-LDGQELMQFKGHDKWVRYVSFSCNGQHI 1378

Query: 495  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG 674
            A    D    ++NL           V + L GH+  V +  + P +  +L+T+S D T  
Sbjct: 1379 ATAADDCTARLWNL-------AGRQVGQFL-GHQSIVWSVNFSP-DCQYLVTASEDHTAK 1429

Query: 675  LWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVR 854
            LW +   + T         GH A V S ++ + N     + S D TA LW+     + + 
Sbjct: 1430 LWTLDGQIVTEF------RGHQAPVKS-AVFSHNGQYIATSSDDRTARLWNLN--GQQLA 1480

Query: 855  TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQV----YSQPHSDNEVH 1016
             F GH+G V ++   PD     T SDD T RL+ I    QL      + Q + +N  H
Sbjct: 1481 QFKGHKGAVRSISISPDDQYIATASDDRTVRLWPIENLDQLLARGCNWLQDYLENNPH 1538



 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 41/136 (30%), Positives = 62/136 (45%), Gaps = 3/136 (2%)
 Frame = +3

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAF 1037
            F GH+  V +V F  DG    T SDD T RL++++ G QL +  Q H D     + S  F
Sbjct: 949  FQGHQAWVRSVSFSRDGQYILTASDDCTARLWNLQ-GKQL-ISLQGHEDT----IWSANF 1002

Query: 1038 SISGRLLFAGYTNGDCYVWD---TLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            S  G+ +    ++    +W+     LAK           H G +  +  S DG  + T  
Sbjct: 1003 SPDGKYIATASSDRTARLWNFSGQQLAKF--------QGHQGYVRSVSFSPDGKHIATAG 1054

Query: 1209 WDTTLKIWAFGGYRQV 1256
             D T ++W+F G + V
Sbjct: 1055 DDHTARLWSFSGQQLV 1070



>pir|S33263|S33263 transcription initiation factor IID-associated
            protein, 80K - fruit fly (Drosophila melanogaster)
          Length = 704

 Score =  106 bits (265), Expect = 1e-21
 Identities = 79/244 (32%), Positives = 114/244 (46%)
 Frame = +3

Query: 507  LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI 686
            LD   +  N+ +  D  G   V+R+L GH G V  C + P  +  L++ S D T  LW +
Sbjct: 423  LDKESADINVRMLDDRSGE--VTRSLMGHTGPVYRCAFAPEMNL-LLSCSEDSTIRLWSL 479

Query: 687  TTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHG 866
             T      +      GH   V  V   A +   FVS S D TA LW T  +++A+R F G
Sbjct: 480  LTWSCVVTY-----RGHVYPVWDVRF-APHGYYFVSCSYDKTARLWATD-SNQALRVFVG 532

Query: 867  HEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSIS 1046
            H  DV  V+F P+ N   TGS D T RL+D  TG  +++ +          V+S+AFS  
Sbjct: 533  HLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMT-----GHKGSVSSLAFSAC 587

Query: 1047 GRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLK 1226
            GR L +G  + +  +WD     +V  L      H   ++ +  S DG+ L     D  L 
Sbjct: 588  GRYLASGSVDHNIIIWDLSNGSLVTTL----LRHTSTVTTITFSRDGTVLAAAGLDNNLT 643

Query: 1227 IWAF 1238
            +W F
Sbjct: 644  LWDF 647



 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 68/245 (27%), Positives = 98/245 (40%), Gaps = 7/245 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R+L GHTG VY   + PE N ++S S+D  + +W+ LT       +     V    F+P 
Sbjct: 444  RSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPH 503

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G        D    ++        D N  + R   GH   V   Q+ PN + ++ T S D
Sbjct: 504  GYYFVSCSYDKTARLW------ATDSNQAL-RVFVGHLSDVDCVQFHPNSN-YVATGSSD 555

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            +T  LWD  TG    +      +GH   VSS++ SA       SGS D    +WD    S
Sbjct: 556  RTVRLWDNMTGQSVRL-----MTGHKGSVSSLAFSACG-RYLASGSVDHNIIIWDLSNGS 609

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR-------TGHQLQVYSQPHS 1001
              V T   H   V  + F  DG        D    L+D         + H    + Q  +
Sbjct: 610  -LVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVTEDYISNHITVSHHQDEN 668

Query: 1002 DNEVH 1016
            D +V+
Sbjct: 669  DEDVY 673



>sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5
            (Transcription initiation factor TFIID 85 kDa subunit)
            (p85) (TAFII-80).>gb:AE013599_1131167 Drosophila
            melanogaster chromosome 2R, complete
            sequence.>gb:AE003828_1226555 Drosophila melanogaster
            chromosome 2R, section 22 of 74 of the complete
            sequence.>gb:AY051960_1290554 Drosophila melanogaster
            LD42828 full length cDNA.>gb:DMU06460_1380369 Drosophila
            melanogaster transcription initiation factor TFIID 85 kDa
            subunit mRNA, complete cds.
          Length = 704

 Score =  106 bits (265), Expect = 1e-21
 Identities = 79/244 (32%), Positives = 114/244 (46%)
 Frame = +3

Query: 507  LDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI 686
            LD   +  N+ +  D  G   V+R+L GH G V  C + P  +  L++ S D T  LW +
Sbjct: 423  LDKESADINVRMLDDRSGE--VTRSLMGHTGPVYRCAFAPEMNL-LLSCSEDSTIRLWSL 479

Query: 687  TTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHG 866
             T      +      GH   V  V   A +   FVS S D TA LW T  +++A+R F G
Sbjct: 480  LTWSCVVTY-----RGHVYPVWDVRF-APHGYYFVSCSYDKTARLWATD-SNQALRVFVG 532

Query: 867  HEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSIS 1046
            H  DV  V+F P+ N   TGS D T RL+D  TG  +++ +          V+S+AFS  
Sbjct: 533  HLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMT-----GHKGSVSSLAFSAC 587

Query: 1047 GRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLK 1226
            GR L +G  + +  +WD     +V  L      H   ++ +  S DG+ L     D  L 
Sbjct: 588  GRYLASGSVDHNIIIWDLSNGSLVTTL----LRHTSTVTTITFSRDGTVLAAAGLDNNLT 643

Query: 1227 IWAF 1238
            +W F
Sbjct: 644  LWDF 647



 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 68/245 (27%), Positives = 98/245 (40%), Gaps = 7/245 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R+L GHTG VY   + PE N ++S S+D  + +W+ LT       +     V    F+P 
Sbjct: 444  RSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPH 503

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G        D    ++        D N  + R   GH   V   Q+ PN + ++ T S D
Sbjct: 504  GYYFVSCSYDKTARLW------ATDSNQAL-RVFVGHLSDVDCVQFHPNSN-YVATGSSD 555

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            +T  LWD  TG    +      +GH   VSS++ SA       SGS D    +WD    S
Sbjct: 556  RTVRLWDNMTGQSVRL-----MTGHKGSVSSLAFSACG-RYLASGSVDHNIIIWDLSNGS 609

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR-------TGHQLQVYSQPHS 1001
              V T   H   V  + F  DG        D    L+D         + H    + Q  +
Sbjct: 610  -LVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVTEDYISNHITVSHHQDEN 668

Query: 1002 DNEVH 1016
            D +V+
Sbjct: 669  DEDVY 673



>gb:BC067651_2554823 Danio rerio cDNA clone IMAGE:6963216, partial
            cds.
          Length = 745

 Score =  104 bits (260), Expect = 4e-21
 Identities = 74/227 (32%), Positives = 111/227 (48%)
 Frame = +3

Query: 552  NDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQS 731
            ++  S+ S+ L GH G V    + P+ + +L++SS D T  LW + T   T + G     
Sbjct: 474  DEKTSSESKILHGHSGPVYGVSFSPDRN-YLLSSSEDGTIRLWSLQTF--TCLVG---YK 527

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   V     S      FVSG  D  A LW T    + +R F GH  DV   +F P+ N
Sbjct: 528  GHNYPVWDTQFSPFGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVTCTRFHPNSN 585

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               TGS D T RL+D+  G+ +++++          + S+AFS +G+ L +G T+G   +
Sbjct: 586  YVATGSSDRTVRLWDVLNGNCVRIFT-----GHKGPIHSLAFSPNGKFLASGSTDGRVLL 640

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            WD     M+  L      H G I  L  S DG  + +GS D T+++W
Sbjct: 641  WDIGHGLMIAEL----KGHTGTIYALKFSRDGEIIASGSIDNTVRLW 683



 Score =  100 bits (248), Expect = 1e-19
 Identities = 66/217 (30%), Positives = 103/217 (47%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY + ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 484  LHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQFSPFGY 543

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  ++ PN + ++ T S D+T
Sbjct: 544  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVTCTRFHPNSN-YVATGSSDRT 595

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     SGS D    LWD       
Sbjct: 596  VRLWDVLNGNCVRIF-----TGHKGPIHSLAFS-PNGKFLASGSTDGRVLLWDIG-HGLM 648

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
            +    GH G + A+KF  DG    +GS D T RL+D+
Sbjct: 649  IAELKGHTGTIYALKFSRDGEIIASGSIDNTVRLWDV 685



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 1/129 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + + AFSP 
Sbjct: 566 RIFAGHLADVTCTRFHPNSNYVATGSSDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPN 625

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH G + A ++  + D  +I S S 
Sbjct: 626 GKFLASGSTDGRVLLWDI-------GHGLMIAELKGHTGTIYALKF--SRDGEIIASGSI 676

Query: 660 DKTCGLWDI 686
           D T  LWD+
Sbjct: 677 DNTVRLWDV 685



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 21/80 (26%), Positives = 40/80 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + S S DGR+++W+         +K     +    FS
Sbjct: 606 CVRIFTGHKGPIHSLAFSPNGKFLASGSTDGRVLLWDIGHGLMIAELKGHTGTIYALKFS 665

Query: 477 PTGQSVACGGLDSVCSIFNL 536
             G+ +A G +D+   ++++
Sbjct: 666 RDGEIIASGSIDNTVRLWDV 685



>pir|AB2202|AB2202 hypothetical protein all3169 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_684158 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 559

 Score =  104 bits (259), Expect = 5e-21
 Identities = 75/264 (28%), Positives = 112/264 (42%)
 Frame = +3

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            A SP G  +A GG D +  ++ LN          +    SGH   V++  + P  +  L 
Sbjct: 276  AISPDGNKLASGGDDKIIRLWELN-------TQKLLACFSGHSQAVTSVSFSPQGEI-LA 327

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T+S DKT  LW + T            +GHT  V SVS S  N  +  SGS D    LWD
Sbjct: 328  TASDDKTIKLWHLPTSSEVFTL-----NGHTNPVKSVSFSP-NGQILASGSWDKQVKLWD 381

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
                 + +     H+  V AV F P G    + S D T RL+ I   H      +  S +
Sbjct: 382  V-TTGKEIYALKAHQLQVSAVAFSPQGEILASASFDRTIRLWQITQNHPRYTLIKTLSGH 440

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                V +IAFS  G++L  G  +    +WD    +++  L      H   +  +  + D 
Sbjct: 441  -TRAVLAIAFSPDGKILATGSDDNTIKLWDINTGQLIATL----LGHSWSVVAVTFTADN 495

Query: 1188 SALCTGSWDTTLKIWAFGGYRQVI 1259
              L + SWD T+K+W      +++
Sbjct: 496  KTLISASWDKTIKLWKVSTTEEIV 519



 Score =  104 bits (259), Expect = 5e-21
 Identities = 85/320 (26%), Positives = 135/320 (42%), Gaps = 3/320 (0%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVM 461
            P+   C   L G++    SL  +P+ N++ S   D  + +W   T +           V 
Sbjct: 258  PSPWQCLHTLTGYSTN--SLAISPDGNKLASGGDDKIIRLWELNTQKLLACFSGHSQAVT 315

Query: 462  TCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAH 641
            + +FSP G+ +A    D    +++L         S+   TL+GH   V +  + PN    
Sbjct: 316  SVSFSPQGEILATASDDKTIKLWHLP-------TSSEVFTLNGHTNPVKSVSFSPNGQI- 367

Query: 642  LITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACL 821
            L + S DK   LWD+TTG             H   VS+V+ S     +  S S D T  L
Sbjct: 368  LASGSWDKQVKLWDVTTGKEIYAL-----KAHQLQVSAVAFSPQG-EILASASFDRTIRL 421

Query: 822  WD---TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQ 992
            W           ++T  GH   V+A+ F PDG    TGSDD T +L+DI TG QL     
Sbjct: 422  WQITQNHPRYTLIKTLSGHTRAVLAIAFSPDGKILATGSDDNTIKLWDINTG-QLIATLL 480

Query: 993  PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLG 1172
             HS      V ++ F+   + L +   +    +W     + ++ L     SH   +  + 
Sbjct: 481  GHS----WSVVAVTFTADNKTLISASWDKTIKLWKVSTTEEIVTLA----SHLDSVCAVA 532

Query: 1173 LSGDGSALCTGSWDTTLKIW 1232
            ++     + + S D T+K+W
Sbjct: 533  VNPVTQVIASSSRDKTIKLW 552



 Score = 34.7 bits (78), Expect = 5.0
 Identities = 18/76 (23%), Positives = 35/76 (46%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
           L GH+  V ++ +T +   ++SAS D  + +W   T+++   +      V   A +P  Q
Sbjct: 479 LLGHSWSVVAVTFTADNKTLISASWDKTIKLWKVSTTEEIVTLASHLDSVCAVAVNPVTQ 538

Query: 489 SVACGGLDSVCSIFNL 536
            +A    D    ++ L
Sbjct: 539 VIASSSRDKTIKLWQL 554



>gb:AE016818_1747903 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 815

 Score =  103 bits (258), Expect = 7e-21
 Identities = 83/267 (31%), Positives = 125/267 (46%), Gaps = 9/267 (3%)
 Frame = +3

Query: 459  MTCA-FSPTGQSVACGGLDSVCSIFNLNLPP--------DNDGNSTVSRTLSGHKGYVSA 611
            MTC  FS   + VA G  DS   +++L+  P          D ++TV  TL GH G V +
Sbjct: 490  MTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTV--TLIGHSGPVYS 547

Query: 612  CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFV 791
              + P ++ +L+++S DKT  LW + T      +      GH   V  V  S    + F 
Sbjct: 548  VSFSP-DNRYLVSASEDKTVRLWSLDTYTCLVSY-----KGHNHPVWDVKFSPLG-HYFA 600

Query: 792  SGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGH 971
            +GS D TA LW        +R F GH  DV  V F P+G    TGS D TCR++DI+TG 
Sbjct: 601  TGSHDQTARLWSCDHIY-PLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD 659

Query: 972  QLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHD 1151
             ++++           V S+A S  GR L  G  +G   VWD    K    +  ++    
Sbjct: 660  SVRLFL-----GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGK---RIKQMRGHGK 711

Query: 1152 GRISCLGLSGDGSALCTGSWDTTLKIW 1232
              +  L  + +G+ L +G  D ++++W
Sbjct: 712  SAVYSLSFNKEGNILVSGGADQSVRVW 738



 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 66/219 (30%), Positives = 105/219 (47%), Gaps = 1/219 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VYS+ ++P+   +VSAS+D  + +W+  T     + K     V    FSP G 
Sbjct: 538  LIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGH 597

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
              A G  D    +++ +       +    R  +GH   V    + PN   +++T S DKT
Sbjct: 598  YFATGSHDQTARLWSCD-------HIYPLRIFAGHLNDVDCVTFHPN-GTYVLTGSSDKT 649

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C +WDI TG    +F      GHTA V SV++S        +GS D    +WD     R 
Sbjct: 650  CRMWDIQTGDSVRLF-----LGHTASVVSVAVSPDG-RWLTTGSEDGVIIVWDIGTGKR- 702

Query: 849  VRTFHGH-EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
            ++   GH +  V ++ F  +GN   +G  D + R++D++
Sbjct: 703  IKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741



 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 56/176 (31%), Positives = 83/176 (47%), Gaps = 1/176 (0%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH+  V SVS S  N  + VS S D T  LW     +  V ++ GH   V  VKF P G+
Sbjct: 540  GHSGPVYSVSFSPDNRYL-VSASEDKTVRLWSLDTYTCLV-SYKGHNHPVWDVKFSPLGH 597

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
             F TGS D T RL+     + L++++   +D     V  + F  +G  +  G ++  C +
Sbjct: 598  YFATGSHDQTARLWSCDHIYPLRIFAGHLND-----VDCVTFHPNGTYVLTGSSDKTCRM 652

Query: 1092 WDTLLAKMV-LNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            WD      V L LG     H   +  + +S DG  L TGS D  + +W  G  +++
Sbjct: 653  WDIQTGDSVRLFLG-----HTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI 703



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 50/199 (25%), Positives = 78/199 (39%), Gaps = 5/199 (2%)
 Frame = +3

Query: 252  SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNA-----LT 416
            S+ KT   +      C  + +GH   V+ + ++P  +   + S D    +W+      L 
Sbjct: 561  SEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLR 620

Query: 417  SQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHK 596
                H   + C       F P G  V  G  D  C ++++       G+S   R   GH 
Sbjct: 621  IFAGHLNDVDCV-----TFHPNGTYVLTGSSDKTCRMWDI-----QTGDSV--RLFLGHT 668

Query: 597  GYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASN 776
              V +    P +   L T S D    +WDI TG R     G  +S     V S+S +   
Sbjct: 669  ASVVSVAVSP-DGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSA----VYSLSFNKEG 723

Query: 777  TNMFVSGSCDTTACLWDTR 833
             N+ VSG  D +  +WD +
Sbjct: 724  -NILVSGGADQSVRVWDLK 741



>pir|AG1837|AG1837 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681239 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 304

 Score =  103 bits (257), Expect = 9e-21
 Identities = 72/228 (31%), Positives = 113/228 (49%), Gaps = 1/228 (0%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            RTL GH   V +  + P +   L + S DKT  +W++     T +  G  +S  +  V+S
Sbjct: 8    RTLKGHSDKVMSVMFSP-DGQRLASGSADKTVRVWNLANE-ETLILKGHGKSSWSGGVNS 65

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
            ++ S  N     S S D T  LWD    +  +  F GHE  V +V F PDG    +GS D
Sbjct: 66   IAFSP-NGKTLASASDDKTIKLWDVNTGAEII-AFTGHEEAVYSVSFSPDGKTLVSGSKD 123

Query: 936  GTCRLFDIRTGHQLQVYS-QPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAK 1112
             + +L+ + TG +L  YS + H D+    V S+AFS  G+++ +G    D  +    LAK
Sbjct: 124  KSVKLWSLATGREL--YSLKGHLDD----VLSVAFSPDGQVVASGGAGNDKTIKIWHLAK 177

Query: 1113 MVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
              +   +  +   G I+ L  S DG+ L +GSWD  +K+W +    ++
Sbjct: 178  QKVQTITGHSEWFGGINSLAFSPDGNILASGSWDKNIKLWQWQNSEEI 225



 Score =  102 bits (254), Expect = 2e-20
 Identities = 87/322 (27%), Positives = 147/322 (45%), Gaps = 8/322 (2%)
 Frame = +3

Query: 288  DLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQ----KTHAIKLPCAW 455
            DL+  R L+GH+ KV S+ ++P+  R+ S S D  + VWN    +    K H        
Sbjct: 3    DLIFVRTLKGHSDKVMSVMFSPDGQRLASGSADKTVRVWNLANEETLILKGHGKSSWSGG 62

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED 635
            V + AFSP G+++A    D    ++++     N G   ++ T  GH+  V +  + P + 
Sbjct: 63   VNSIAFSPNGKTLASASDDKTIKLWDV-----NTGAEIIAFT--GHEEAVYSVSFSP-DG 114

Query: 636  AHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGS-CDTT 812
              L++ S DK+  LW + TG            GH  DV SV+ S     +   G+  D T
Sbjct: 115  KTLVSGSKDKSVKLWSLATGRELYSL-----KGHLDDVLSVAFSPDGQVVASGGAGNDKT 169

Query: 813  ACLWDTRVASRAVRTFHGHE---GDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQV 983
              +W   +A + V+T  GH    G + ++ F PDGN   +GS D   +L+  +   ++  
Sbjct: 170  IKIW--HLAKQKVQTITGHSEWFGGINSLAFSPDGNILASGSWDKNIKLWQWQNSEEICT 227

Query: 984  YSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRIS 1163
             +  HSD+    V  ++FS +G +L +   +    +W      ++    S    H+  + 
Sbjct: 228  LT-GHSDH----VCCVSFSPNGNILASASKDKSIKLWQVDTRSII----SSFIVHEESVY 278

Query: 1164 CLGLSGDGSALCTGSWDTTLKI 1229
             L  S DG  L + S D  ++I
Sbjct: 279  SLAFSPDGQTLASSSGDKIIRI 300



 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 40/136 (29%), Positives = 66/136 (48%)
 Frame = +3

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            VRT  GH   V++V F PDG R  +GS D T R++++     L +     S +    V S
Sbjct: 7    VRTLKGHSDKVMSVMFSPDGQRLASGSADKTVRVWNLANEETLILKGHGKS-SWSGGVNS 65

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            IAFS +G+ L +   +    +WD      ++        H+  +  +  S DG  L +GS
Sbjct: 66   IAFSPNGKTLASASDDKTIKLWDVNTGAEIIAF----TGHEEAVYSVSFSPDGKTLVSGS 121

Query: 1209 WDTTLKIWAFGGYRQV 1256
             D ++K+W+    R++
Sbjct: 122  KDKSVKLWSLATGREL 137



>gb:CZA382_119892 Amycolatopsis orientalis cosmid pCZA382.
          Length = 1241

 Score =  102 bits (255), Expect = 1e-20
 Identities = 85/318 (26%), Positives = 139/318 (43%), Gaps = 1/318 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKT-HAIKLPCAWVMTCAFSPTG 485
            L GHTG V  L ++P+   + +AS D  + +W+    +     +      V + AFS  G
Sbjct: 664  LTGHTGMVNGLAFSPDGTTLATASADRTVRLWDVARHRPIGEPMSGHTNTVTSIAFSSDG 723

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
            + +  G  D     +++         + +   + GHKG ++A    P +     TSS DK
Sbjct: 724  RLLVTGSADGTVRTWDIT------SRTPIGEPMVGHKGPITAVALSP-DGVTAATSSNDK 776

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  LW++ T  R  +  G+  +GHT+  + V+ S     +  S S D T  LW+    + 
Sbjct: 777  TVRLWNVAT--RAPI--GDPLTGHTSVTNGVAFSPDG-QILASTSGDKTVRLWNVATRAP 831

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
                  GH      V F PDG    T S D T R++D  T  + Q  +   S + V    
Sbjct: 832  IGDPLTGHTNVTYGVAFSPDGRTLATSSWDKTVRIWDT-TSRRQQGTALIGSTSSVF--- 887

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            +IAFS  G  L  G ++    VW           G+L  +H   +  + LS +G  L TG
Sbjct: 888  NIAFSPDGSALAGGDSDSSTLVWSLR--------GTLVPAHADAVYAVALSPEGRVLGTG 939

Query: 1206 SWDTTLKIWAFGGYRQVI 1259
            + D  +++W    +R+++
Sbjct: 940  ADDRKVRLWETSTHRELV 957



 Score =  102 bits (254), Expect = 2e-20
 Identities = 81/268 (30%), Positives = 120/268 (44%), Gaps = 2/268 (0%)
 Frame = +3

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED 635
            V   AFSP G+ +A    DS   ++++           +   L+GH G V+   + P + 
Sbjct: 628  VRDVAFSPDGRVLATAAGDSSVRLWDIA------SRQPLGNPLTGHTGMVNGLAFSP-DG 680

Query: 636  AHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTA 815
              L T+S D+T  LWD+          GE  SGHT  V+S++ S S+  + V+GS D T 
Sbjct: 681  TTLATASADRTVRLWDVARHRPI----GEPMSGHTNTVTSIAFS-SDGRLLVTGSADGTV 735

Query: 816  CLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQP 995
              WD    +       GH+G + AV   PDG    T S+D T RL+++ T   +      
Sbjct: 736  RTWDITSRTPIGEPMVGHKGPITAVALSPDGVTAATSSNDKTVRLWNVATRAPIGDPLTG 795

Query: 996  HSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV--WDTLLAKMVLNLGSLQNSHDGRISCL 1169
            H+         +AFS  G++L +  T+GD  V  W+      +   G     H      +
Sbjct: 796  HTS----VTNGVAFSPDGQILAS--TSGDKTVRLWNVATRAPI---GDPLTGHTNVTYGV 846

Query: 1170 GLSGDGSALCTGSWDTTLKIWAFGGYRQ 1253
              S DG  L T SWD T++IW     RQ
Sbjct: 847  AFSPDGRTLATSSWDKTVRIWDTTSRRQ 874



 Score =  100 bits (250), Expect = 6e-20
 Identities = 87/310 (28%), Positives = 134/310 (43%), Gaps = 2/310 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHA-IKLPCAWVMTCAFSPTG 485
            L GHT +V S+ ++P+   + + S DG L +W+A       + +     WV   AFSP G
Sbjct: 960  LTGHTAEVRSMAFSPQGGILATGSWDGTLRLWDAANRAPIGSPLTGHVDWVRGLAFSPDG 1019

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
              VA  G+D    ++N+         +     L+GH   V+   + P +   L T++ DK
Sbjct: 1020 HFVATAGMDMTVRLWNVAT------RAPFGPPLTGHTNSVTGIAFSP-DGRSLATAANDK 1072

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  LWD+ +  R+ +  GE  +GHT+ V  V  S     +  S   D T  LWD  VASR
Sbjct: 1073 TIRLWDVPS--RSPI--GEPLTGHTSVVRDVVFSPDG-KLLASAGDDKTVRLWD--VASR 1125

Query: 846  A-VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
              + T  GH G+V+ +   PDG    + S D T RL+D        V S          +
Sbjct: 1126 TLIATLEGHTGEVLKLAISPDGRELASTSLDKTVRLWDTANRSTTTVLSASTG------L 1179

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
              +A++  G  L  G   G+  +W T + ++            G++     +  GS L  
Sbjct: 1180 AGVAYTPDG--LVTGGVTGNVLLWTTDVTRLA-----------GQV----CAATGSELSD 1222

Query: 1203 GSWDTTLKIW 1232
              W   L  W
Sbjct: 1223 DEWRRYLPTW 1232



 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 83/314 (26%), Positives = 137/314 (43%), Gaps = 2/314 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKT-HAIKLPCAWVMTCAFSPTG 485
            L GHTG+V  + ++P+   + +A+ D  + +W+  + Q   + +      V   AFSP G
Sbjct: 621  LLGHTGEVRDVAFSPDGRVLATAAGDSSVRLWDIASRQPLGNPLTGHTGMVNGLAFSPDG 680

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
             ++A    D    ++      D   +  +   +SGH   V++  +  ++   L+T S D 
Sbjct: 681  TTLATASADRTVRLW------DVARHRPIGEPMSGHTNTVTSIAF-SSDGRLLVTGSADG 733

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T   WDIT+  RT +  GE   GH   +++V++S        S S D T  LW+    + 
Sbjct: 734  TVRTWDITS--RTPI--GEPMVGHKGPITAVALSPDGVTAATS-SNDKTVRLWNVATRAP 788

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
                  GH      V F PDG    + S D T RL+++ T   +      H++     VT
Sbjct: 789  IGDPLTGHTSVTNGVAFSPDGQILASTSGDKTVRLWNVATRAPIGDPLTGHTN-----VT 843

Query: 1026 -SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
              +AFS  GR L     +    +WDT   +     G+        +  +  S DGSAL  
Sbjct: 844  YGVAFSPDGRTLATSSWDKTVRIWDTTSRR---QQGTALIGSTSSVFNIAFSPDGSALAG 900

Query: 1203 GSWDTTLKIWAFGG 1244
            G  D++  +W+  G
Sbjct: 901  GDSDSSTLVWSLRG 914



 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 83/341 (24%), Positives = 138/341 (40%), Gaps = 33/341 (9%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTS-QKTHAIKLPCAWVMTCAFSPTG 485
            L GHT   Y + ++P+   + ++S D  + +W+  +  Q+  A+    + V   AFSP G
Sbjct: 836  LTGHTNVTYGVAFSPDGRTLATSSWDKTVRIWDTTSRRQQGTALIGSTSSVFNIAFSPDG 895

Query: 486  QSVACGGLDSVCSIFNLN---LPPDNDGNSTVSRT------------------------- 581
             ++A G  DS   +++L    +P   D    V+ +                         
Sbjct: 896  SALAGGDSDSSTLVWSLRGTLVPAHADAVYAVALSPEGRVLGTGADDRKVRLWETSTHRE 955

Query: 582  ----LSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV 749
                L+GH   V +  + P +   L T S D T  LWD     R  +  G   +GH   V
Sbjct: 956  LVAPLTGHTAEVRSMAFSP-QGGILATGSWDGTLRLWDAAN--RAPI--GSPLTGHVDWV 1010

Query: 750  SSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS 929
              ++ S     +  +G  D T  LW+    +       GH   V  + F PDG    T +
Sbjct: 1011 RGLAFSPDGHFVATAGM-DMTVRLWNVATRAPFGPPLTGHTNSVTGIAFSPDGRSLATAA 1069

Query: 930  DDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLA 1109
            +D T RL+D+ +   +      H+      V  + FS  G+LL +   +    +WD    
Sbjct: 1070 NDKTIRLWDVPSRSPIGEPLTGHTS----VVRDVVFSPDGKLLASAGDDKTVRLWDVASR 1125

Query: 1110 KMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             ++  L      H G +  L +S DG  L + S D T+++W
Sbjct: 1126 TLIATL----EGHTGEVLKLAISPDGRELASTSLDKTVRLW 1162



 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 84/348 (24%), Positives = 133/348 (38%), Gaps = 42/348 (12%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT--------CA 470
            GH G + ++  +P+     ++S D  + +WN  T       + P    +T         A
Sbjct: 752  GHKGPITAVALSPDGVTAATSSNDKTVRLWNVAT-------RAPIGDPLTGHTSVTNGVA 804

Query: 471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT 650
            FSP GQ +A    D    ++N+         + +   L+GH        + P +   L T
Sbjct: 805  FSPDGQILASTSGDKTVRLWNVAT------RAPIGDPLTGHTNVTYGVAFSP-DGRTLAT 857

Query: 651  SSGDKTCGLWDITT---------GLRTSVF------------GGEYQSG----------- 734
            SS DKT  +WD T+         G  +SVF            GG+  S            
Sbjct: 858  SSWDKTVRIWDTTSRRQQGTALIGSTSSVFNIAFSPDGSALAGGDSDSSTLVWSLRGTLV 917

Query: 735  --HTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDG 908
              H   V +V++S     +  +G+ D    LW+T      V    GH  +V ++ F P G
Sbjct: 918  PAHADAVYAVALSPEG-RVLGTGADDRKVRLWETSTHRELVAPLTGHTAEVRSMAFSPQG 976

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
                TGS DGT RL+D      +      H D     V  +AFS  G  +     +    
Sbjct: 977  GILATGSWDGTLRLWDAANRAPIGSPLTGHVD----WVRGLAFSPDGHFVATAGMDMTVR 1032

Query: 1089 VWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            +W+          G     H   ++ +  S DG +L T + D T+++W
Sbjct: 1033 LWNVATR---APFGPPLTGHTNSVTGIAFSPDGRSLATAANDKTIRLW 1077



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +3

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            V  +AFS  GR+L     +    +WD    +    LG+    H G ++ L  S DG+ L 
Sbjct: 628  VRDVAFSPDGRVLATAAGDSSVRLWDIASRQP---LGNPLTGHTGMVNGLAFSPDGTTLA 684

Query: 1200 TGSWDTTLKIWAFGGYRQV 1256
            T S D T+++W    +R +
Sbjct: 685  TASADRTVRLWDVARHRPI 703



>gb:BC043494_1983422 Homo sapiens WD repeat domain 5B, mRNA (cDNA
            clone MGC:49879 IMAGE:6056052), complete
            cds.>gb:CR457279_1993486 Homo sapiens full open reading
            frame cDNA clone RZPDo834A0813D for gene WDR5B, WD repeat
            domain 5B; complete cds, incl. stopcodon.
          Length = 330

 Score =  101 bits (251), Expect = 4e-20
 Identities = 72/234 (30%), Positives = 121/234 (51%), Gaps = 3/234 (1%)
 Frame = +3

Query: 546  PDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEY 725
            P+N  N  +  TL GH   VS+ ++ PN +  L +SS D+   +W          + G+Y
Sbjct: 26   PENP-NYALKCTLVGHTEAVSSVKFSPNGE-WLASSSADRLIIIW--------GAYDGKY 75

Query: 726  QS---GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKF 896
            +    GH  ++S V+ S S+++  VS S D T  LWD R + + ++T  GH   V    F
Sbjct: 76   EKTLYGHNLEISDVAWS-SDSSRLVSASDDKTLKLWDVR-SGKCLKTLKGHSNYVFCCNF 133

Query: 897  FPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTN 1076
             P  N   +GS D T ++++++TG  L+  S  HSD     V+++ F+ SG L+ +G  +
Sbjct: 134  NPPSNLIISGSFDETVKIWEVKTGKCLKTLSA-HSDP----VSAVHFNCSGSLIVSGSYD 188

Query: 1077 GDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            G C +WD    +    L +L +  +  +S +  S +G  + T + D TLK+W +
Sbjct: 189  GLCRIWDAASGQC---LKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDY 239



 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 68/276 (24%), Positives = 125/276 (45%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  +I+W A   +    +      +   A+S    
Sbjct: 37   LVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSS 96

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    ++++        +    +TL GH  YV  C + P  +  +I+ S D+T
Sbjct: 97   RLVSASDDKTLKLWDVR-------SGKCLKTLKGHSNYVFCCNFNPPSNL-IISGSFDET 148

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +W++ TG  L+T        S H+  VS+V  + S  ++ VSGS D    +WD   + 
Sbjct: 149  VKIWEVKTGKCLKT-------LSAHSDPVSAVHFNCSG-SLIVSGSYDGLCRIWDA-ASG 199

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G    T + D T +L+D   G  L+ Y+     NE + 
Sbjct: 200  QCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYT--GHKNEKYC 257

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 258  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL 293



 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 65/240 (27%), Positives = 107/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L GH  ++  + W+ + +R+VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 77   KTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPP 136

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
               +  G  D    I+ +             +TLS H   VSA  +  N    LI S S 
Sbjct: 137  SNLIISGSFDETVKIWEVK-------TGKCLKTLSAHSDPVSAVHF--NCSGSLIVSGSY 187

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T V            VS V  S  N    ++ + D T  LWD  
Sbjct: 188  DGLCRIWDAASGQCLKTLV------DDDNPPVSFVKFS-PNGKYILTATLDNTLKLWDYS 240

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               R ++T+ GH+ +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 241  -RGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL-QGHTD 298



 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 50/221 (22%), Positives = 90/221 (40%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P  N I+S S D  + +W   T +    +      V    F+
Sbjct: 117 CLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFN 176

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            +G  +  G  D +C I+      D      +   +      VS  ++ PN   +++T++
Sbjct: 177 CSGSLIVSGSYDGLCRIW------DAASGQCLKTLVDDDNPPVSFVKFSPN-GKYILTAT 229

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 230 LDNTLKLWDYSRGRCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 285

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 286 TKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326



>gb:AX878269_1477372 Sequence 13174 from Patent
            EP1074617.>gb:AK002149_1908857 Homo sapiens cDNA FLJ11287
            fis, clone PLACE1009596, weakly similar to VEGETATIBLE
            INCOMPATIBILITY PROTEIN HET-E-1.
          Length = 330

 Score =  101 bits (251), Expect = 4e-20
 Identities = 72/234 (30%), Positives = 121/234 (51%), Gaps = 3/234 (1%)
 Frame = +3

Query: 546  PDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEY 725
            P+N  N  +  TL GH   VS+ ++ PN +  L +SS D+   +W          + G+Y
Sbjct: 26   PENP-NYALKCTLVGHTEAVSSVKFSPNGE-WLASSSADRLIIIW--------GAYDGKY 75

Query: 726  QS---GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKF 896
            +    GH  ++S V+ S S+++  VS S D T  LWD R + + ++T  GH   V    F
Sbjct: 76   EKTLYGHNLEISDVAWS-SDSSRLVSASDDKTLKLWDVR-SGKCLKTLKGHSNYVFCCNF 133

Query: 897  FPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTN 1076
             P  N   +GS D T ++++++TG  L+  S  HSD     V+++ F+ SG L+ +G  +
Sbjct: 134  NPPSNLIISGSFDETVKIWEVKTGKCLKTLSA-HSDP----VSAVHFNCSGSLIVSGSYD 188

Query: 1077 GDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            G C +WD    +    L +L +  +  +S +  S +G  + T + D TLK+W +
Sbjct: 189  GLCRIWDAASGQC---LKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDY 239



 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 68/276 (24%), Positives = 125/276 (45%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  +I+W A   +    +      +   A+S    
Sbjct: 37   LVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSS 96

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    ++++        +    +TL GH  YV  C + P  +  +I+ S D+T
Sbjct: 97   RLVSASDDKTLKLWDVR-------SGKCLKTLKGHSNYVFCCNFNPPSNL-IISGSFDET 148

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +W++ TG  L+T        S H+  VS+V  + S  ++ VSGS D    +WD   + 
Sbjct: 149  VKIWEVKTGKCLKT-------LSAHSDPVSAVHFNCSG-SLIVSGSYDGLCRIWDA-ASG 199

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G    T + D T +L+D   G  L+ Y+     NE + 
Sbjct: 200  QCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYT--GQKNEKYC 257

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 258  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL 293



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 64/240 (26%), Positives = 106/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + L GH  ++  + W+ + +R+VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 77   KTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPP 136

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
               +  G  D    I+ +             +TLS H   VSA  +  N    LI S S 
Sbjct: 137  SNLIISGSFDETVKIWEVK-------TGKCLKTLSAHSDPVSAVHF--NCSGSLIVSGSY 187

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T V            VS V  S  N    ++ + D T  LWD  
Sbjct: 188  DGLCRIWDAASGQCLKTLV------DDDNPPVSFVKFS-PNGKYILTATLDNTLKLWDYS 240

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               R ++T+ G + +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 241  -RGRCLKTYTGQKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL-QGHTD 298



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 50/221 (22%), Positives = 91/221 (41%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P  N I+S S D  + +W   T +    +      V    F+
Sbjct: 117 CLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFN 176

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            +G  +  G  D +C I+      D      +   +      VS  ++ PN   +++T++
Sbjct: 177 CSGSLIVSGSYDGLCRIW------DAASGQCLKTLVDDDNPPVSFVKFSPN-GKYILTAT 229

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G+    +       + S +     VSGS D    +W+ + 
Sbjct: 230 LDNTLKLWDYSRGRCLKTYTGQKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 285

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 286 TKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326



>gb:AC117075_1207781 Dictyostelium discoideum chromosome 2 map
            5201047-5455781 strain AX4, complete sequence.
          Length = 730

 Score =  100 bits (250), Expect = 6e-20
 Identities = 85/326 (26%), Positives = 153/326 (46%), Gaps = 14/326 (4%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C   L G+T +++ L  +   N + S++ DG + +W+   SQ   +I    +   + + S
Sbjct: 409  CINTLTGNTSRIWDLSSSSNGNLLASSAGDGIIKIWD--VSQNKSSISSSSS---SSSSS 463

Query: 477  PTGQSVACG--------GLDSV-CSIFNLNLPPDNDGNSTVSR-----TLSGHKGYVSAC 614
                S+  G        G++++  ++ NLN   +N+  S V       +L  H+G     
Sbjct: 464  SITSSITSGINSISINSGINNINNNLNNLNNNNNNNNKSNVINNNCLLSLKAHEGDAYTV 523

Query: 615  QYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVS 794
            Q+ P ++ H+ T   DK+  L+D+ TG     F     SGHT  +S V I   + N+ +S
Sbjct: 524  QFHPGQN-HIATGGYDKSIHLYDVRTGQLVKSF-----SGHTGSISKV-IFNPHGNLIIS 576

Query: 795  GSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQ 974
            GS D+T   WD  V+   ++T   H G+V ++     G+   + S D + RL+DIR    
Sbjct: 577  GSKDSTIKFWDI-VSGVCIKTLSSHLGEVTSIATNSSGSYLLSASKDNSNRLWDIRNARP 635

Query: 975  LQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDG 1154
            ++ + + H +   + + S +F  +  L+  G  +G  Y+WD     ++  LG+  N+   
Sbjct: 636  IKRF-KGHQNTSKNFIRS-SFGPNESLVVGGSEDGYTYIWDIETCNILQKLGTPSNNMPM 693

Query: 1155 RISCLGLSGDGSALCTGSWDTTLKIW 1232
              S      + S L T S D ++K+W
Sbjct: 694  VYSATWCQ-EQSLLATCSQDCSVKLW 718



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 59/274 (21%), Positives = 115/274 (41%), Gaps = 12/274 (4%)
 Frame = +3

Query: 471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT 650
            F   G ++A G  D+   ++N           T   TL+G+   +       N +  L +
Sbjct: 383  FIGNGLTLASGSSDNTIKLWNTE-------TGTCINTLTGNTSRIWDLSSSSNGNL-LAS 434

Query: 651  SSGDKTCGLWDIT------TGLRTSVFGGEYQSGHTADVSSVSISA------SNTNMFVS 794
            S+GD    +WD++      +   +S       S  T+ ++S+SI++      +N N   +
Sbjct: 435  SAGDGIIKIWDVSQNKSSISSSSSSSSSSSITSSITSGINSISINSGINNINNNLNNLNN 494

Query: 795  GSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQ 974
             + +         + +  + +   HEGD   V+F P  N   TG  D +  L+D+RTG  
Sbjct: 495  NNNNNNK---SNVINNNCLLSLKAHEGDAYTVQFHPGQNHIATGGYDKSIHLYDVRTGQL 551

Query: 975  LQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDG 1154
            ++ +S          ++ + F+  G L+ +G  +     WD +    +  L    +SH G
Sbjct: 552  VKSFS-----GHTGSISKVIFNPHGNLIISGSKDSTIKFWDIVSGVCIKTL----SSHLG 602

Query: 1155 RISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
             ++ +  +  GS L + S D + ++W     R +
Sbjct: 603  EVTSIATNSSGSYLLSASKDNSNRLWDIRNARPI 636



>gb:CR857638_1181860 Pongo pygmaeus mRNA; cDNA DKFZp469A0528 (from
            clone DKFZp469A0528).
          Length = 330

 Score =  100 bits (249), Expect = 7e-20
 Identities = 72/234 (30%), Positives = 121/234 (51%), Gaps = 3/234 (1%)
 Frame = +3

Query: 546  PDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEY 725
            P+N  N  +  TL GH   VS+ ++ PN +  L +SS D+   +W          + G+Y
Sbjct: 26   PENP-NYALKCTLVGHTEAVSSVKFSPNGE-WLASSSADRLIIIW--------GAYDGKY 75

Query: 726  QS---GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKF 896
            +    GH  ++S V+ S S+++  VS S D T  LWD R + + ++T  GH   V    F
Sbjct: 76   ERTLYGHNLEISDVAWS-SDSSRLVSASDDKTLKLWDMR-SGKCLKTLKGHSNYVFCCNF 133

Query: 897  FPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTN 1076
             P  N   +GS D T ++++++TG  L+  S  HSD     V+++ F+ SG L+ +G  +
Sbjct: 134  NPPSNLIISGSFDETVKIWEVKTGKCLKTLSA-HSDP----VSAVHFNCSGSLIVSGSYD 188

Query: 1077 GDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            G C +WD    +    L +L +  +  +S +  S +G  + T + D TLK+W +
Sbjct: 189  GLCRIWDAASGQC---LKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDY 239



 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 68/276 (24%), Positives = 125/276 (45%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  +I+W A   +    +      +   A+S    
Sbjct: 37   LVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYERTLYGHNLEISDVAWSSDSS 96

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    ++++        +    +TL GH  YV  C + P  +  +I+ S D+T
Sbjct: 97   RLVSASDDKTLKLWDMR-------SGKCLKTLKGHSNYVFCCNFNPPSNL-IISGSFDET 148

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +W++ TG  L+T        S H+  VS+V  + S  ++ VSGS D    +WD   + 
Sbjct: 149  VKIWEVKTGKCLKT-------LSAHSDPVSAVHFNCSG-SLIVSGSYDGLCRIWDA-ASG 199

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G    T + D T +L+D   G  L+ Y+     NE + 
Sbjct: 200  QCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYT--GHKNEKYC 257

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 258  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL 293



 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 66/240 (27%), Positives = 107/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L GH  ++  + W+ + +R+VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 77   RTLYGHNLEISDVAWSSDSSRLVSASDDKTLKLWDMRSGKCLKTLKGHSNYVFCCNFNPP 136

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
               +  G  D    I+ +             +TLS H   VSA  +  N    LI S S 
Sbjct: 137  SNLIISGSFDETVKIWEVK-------TGKCLKTLSAHSDPVSAVHF--NCSGSLIVSGSY 187

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T V            VS V  S  N    ++ + D T  LWD  
Sbjct: 188  DGLCRIWDAASGQCLKTLV------DDDNPPVSFVKFS-PNGKYILTATLDNTLKLWDYS 240

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               R ++T+ GH+ +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 241  -RGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL-QGHTD 298



 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 50/221 (22%), Positives = 90/221 (40%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P  N I+S S D  + +W   T +    +      V    F+
Sbjct: 117 CLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFN 176

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            +G  +  G  D +C I+      D      +   +      VS  ++ PN   +++T++
Sbjct: 177 CSGSLIVSGSYDGLCRIW------DAASGQCLKTLVDDDNPPVSFVKFSPN-GKYILTAT 229

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 230 LDNTLKLWDYSRGRCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 285

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 286 TKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326



>pir|AG2375|AG2375 WD-40 repeat-protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_685548 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 786

 Score =  100 bits (248), Expect = 1e-19
 Identities = 81/313 (25%), Positives = 143/313 (45%), Gaps = 3/313 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH+GKV S+  +P+   IVS   D  + +WN  T +    +      V + A SP 
Sbjct: 488  KTITGHSGKVKSVAISPDGEVIVSGCTDQTVNIWNLQTGKLIRTLTGNLGEVSSVAISPD 547

Query: 483  GQSVACG-GLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG 659
            G  +A G G+    ++   +L         +  TL GH+  V+     P+     I +SG
Sbjct: 548  GNFLAVGSGVHPRSNVKVWHLK-----TGKLLHTLLGHQKPVNVVVISPDGQ---ILASG 599

Query: 660  DKTCGLWDIT--TGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
                 +W++    G+  +V        H++ V +++IS  +T +  SGS D    LW+ R
Sbjct: 600  SNKIKIWNLQKGDGVPPTVGDRICTLWHSSAVHAIAISPDST-ILASGSSDNKIRLWNPR 658

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
                 +RT + H+ +V A+    DG    +GS D T +++ + TG  L   +    D   
Sbjct: 659  TGD-PLRTLNSHDNEVKAIAISRDGQFLFSGSADTTIKIWHLITGQILHTLTGHSGD--- 714

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
              + S+  S +G+ LF+G  +    +W     +++  L      H   ++ + +S  G+ 
Sbjct: 715  --IKSLTTSPNGQFLFSGSADTTIKIWRISTGELLHTL----TGHSASVNSVAISPGGNL 768

Query: 1194 LCTGSWDTTLKIW 1232
            L +GS D T+KIW
Sbjct: 769  LASGSADQTIKIW 781



 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 59/231 (25%), Positives = 111/231 (48%), Gaps = 10/231 (4%)
 Frame = +3

Query: 570  VSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTG--LRTSVFGGEYQSGHTA 743
            +++T++GH G V +    P+ +  +++   D+T  +W++ TG  +RT        +G+  
Sbjct: 486  LTKTITGHSGKVKSVAISPDGEV-IVSGCTDQTVNIWNLQTGKLIRTL-------TGNLG 537

Query: 744  DVSSVSISASNTNMFVSGSCD--TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRF 917
            +VSSV+IS     + V       +   +W  +   + + T  GH+  V  V   PDG   
Sbjct: 538  EVSSVAISPDGNFLAVGSGVHPRSNVKVWHLKTG-KLLHTLLGHQKPVNVVVISPDGQIL 596

Query: 918  GTGSDDGTCRLFDIRTGHQL------QVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNG 1079
             +GS+    ++++++ G  +      ++ +  HS      V +IA S    +L +G ++ 
Sbjct: 597  ASGSNK--IKIWNLQKGDGVPPTVGDRICTLWHSS----AVHAIAISPDSTILASGSSDN 650

Query: 1080 DCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
               +W+      +  L    NSHD  +  + +S DG  L +GS DTT+KIW
Sbjct: 651  KIRLWNPRTGDPLRTL----NSHDNEVKAIAISRDGQFLFSGSADTTIKIW 697



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 65/263 (24%), Positives = 106/263 (40%), Gaps = 44/263 (16%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSAS---QDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
            R L G+ G+V S+  +P+ N +   S       + VW+  T +  H +      V     
Sbjct: 530  RTLTGNLGEVSSVAISPDGNFLAVGSGVHPRSNVKVWHLKTGKLLHTLLGHQKPVNVVVI 589

Query: 474  SPTGQSVACGGL------------------DSVCSIFN------LNLPPD---------- 551
            SP GQ +A G                    D +C++++      + + PD          
Sbjct: 590  SPDGQILASGSNKIKIWNLQKGDGVPPTVGDRICTLWHSSAVHAIAISPDSTILASGSSD 649

Query: 552  ------NDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVF 713
                  N       RTL+ H   V A   +  +   L + S D T  +W + TG      
Sbjct: 650  NKIRLWNPRTGDPLRTLNSHDNEVKAIA-ISRDGQFLFSGSADTTIKIWHLITGQILHTL 708

Query: 714  GGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS-RAVRTFHGHEGDVIAV 890
                 +GH+ D+ S++ S +   +F SGS DTT  +W  R+++   + T  GH   V +V
Sbjct: 709  -----TGHSGDIKSLTTSPNGQFLF-SGSADTTIKIW--RISTGELLHTLTGHSASVNSV 760

Query: 891  KFFPDGNRFGTGSDDGTCRLFDI 959
               P GN   +GS D T +++ I
Sbjct: 761  AISPGGNLLASGSADQTIKIWQI 783



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 23/77 (29%), Positives = 36/77 (46%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
           L GH+G + SL  +P    + S S D  + +W   T +  H +    A V + A SP G 
Sbjct: 708 LTGHSGDIKSLTTSPNGQFLFSGSADTTIKIWRISTGELLHTLTGHSASVNSVAISPGGN 767

Query: 489 SVACGGLDSVCSIFNLN 539
            +A G  D    I+ ++
Sbjct: 768 LLASGSADQTIKIWQID 784



>gb:BC081008_2561918 Xenopus laevis WD repeat domain 5, mRNA (cDNA
            clone MGC:81485 IMAGE:6636637), complete
            cds.>gb:BC088786_2565883 Xenopus tropicalis hypothetical
            LOC496891, mRNA (cDNA clone MGC:107779 IMAGE:7017022),
            complete cds.
          Length = 334

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 71/239 (29%), Positives = 120/239 (50%), Gaps = 3/239 (1%)
 Frame = +3

Query: 531  NLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSV 710
            N + P     N T+  TL+GH   VS+ ++ PN +  L +SS DK   +W          
Sbjct: 24   NQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGE-WLASSSADKLIKIW--------GA 74

Query: 711  FGGEYQ---SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDV 881
            + G+++   SGH   +S V+ S S++N+ VS S D T  +WD   + + ++T  GH   V
Sbjct: 75   YDGKFEKTISGHKLGISDVAWS-SDSNLLVSASDDKTLKIWDVS-SGKCLKTLKGHSNYV 132

Query: 882  IAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLF 1061
                F P  N   +GS D + R++D++TG  L+     HSD     V+++ F+  G L+ 
Sbjct: 133  FCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPA-HSDP----VSAVHFNRDGSLIV 187

Query: 1062 AGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            +   +G C +WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 188  SSSYDGLCRIWDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 243



 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 65/276 (23%), Positives = 122/276 (44%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  + +W A   +    I      +   A+S    
Sbjct: 41   LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN 100

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    I++++       +    +TL GH  YV  C + P  +  +++ S D++
Sbjct: 101  LLVSASDDKTLKIWDVS-------SGKCLKTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 152

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 153  VRIWDVKTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 203

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 204  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--CHKNEKYC 261

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 262  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKL 297



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 5/239 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ + N +VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 81   KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ 140

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 141  SNLIVSGSFDESVRIWDVK-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 191

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD-T 830
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD +
Sbjct: 192  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 244

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
            +       T H +E   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 245  KGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKL-QGHTD 302



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 48/221 (21%), Positives = 88/221 (39%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 121 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 180

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 181 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 233

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     +       +       + S +     VSGS D    +W+ + 
Sbjct: 234 LDNTLKLWDYSKGKCLKTYTCHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 289

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 290 TKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



>gb:BC077844_2560496 Xenopus laevis WD repeat domain 5, mRNA (cDNA
            clone MGC:80538 IMAGE:5161701), complete cds.
          Length = 334

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 71/239 (29%), Positives = 120/239 (50%), Gaps = 3/239 (1%)
 Frame = +3

Query: 531  NLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSV 710
            N + P     N T+  TL+GH   VS+ ++ PN +  L +SS DK   +W          
Sbjct: 24   NQSKPAPVKPNYTLKFTLAGHTKAVSSVKFSPNGE-WLASSSADKLIKIW--------GA 74

Query: 711  FGGEYQ---SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDV 881
            + G+++   SGH   +S V+ S S++N+ VS S D T  +WD   + + ++T  GH   V
Sbjct: 75   YDGKFEKTISGHKLGISDVAWS-SDSNLLVSASDDKTLKIWDIS-SGKCLKTLKGHSNYV 132

Query: 882  IAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLF 1061
                F P  N   +GS D + R++D++TG  L+     HSD     V+++ F+  G L+ 
Sbjct: 133  FCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPA-HSDP----VSAVHFNRDGSLIV 187

Query: 1062 AGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            +   +G C +WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 188  SSSYDGLCRIWDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 243



 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 65/276 (23%), Positives = 122/276 (44%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  + +W A   +    I      +   A+S    
Sbjct: 41   LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN 100

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    I++++       +    +TL GH  YV  C + P  +  +++ S D++
Sbjct: 101  LLVSASDDKTLKIWDIS-------SGKCLKTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 152

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 153  VRIWDVKTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 203

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 204  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--CHKNEKYC 261

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 262  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKL 297



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 5/239 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ + N +VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 81   KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDISSGKCLKTLKGHSNYVFCCNFNPQ 140

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 141  SNLIVSGSFDESVRIWDVK-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 191

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD-T 830
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD +
Sbjct: 192  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 244

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
            +       T H +E   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 245  KGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKL-QGHTD 302



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 48/221 (21%), Positives = 88/221 (39%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 121 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 180

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 181 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 233

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     +       +       + S +     VSGS D    +W+ + 
Sbjct: 234 LDNTLKLWDYSKGKCLKTYTCHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 289

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 290 TKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



>sp|Q9V3J8|WDS_DROME Will die slowly protein.>gb:AE014298_1124067
            Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003424_1209249 Drosophila melanogaster
            chromosome X, section 8 of 74 of the complete
            sequence.>gb:AF233288_1253294 Drosophila melanogaster WDS
            (wds) and egghead (egh) genes, complete
            cds.>gb:AY118386_1300108 Drosophila melanogaster RE31658
            full insert cDNA.>gb:DMBR25B3_1378189 Drosophila
            melanogaster BAC clone BACR25B3.
          Length = 361

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 70/229 (30%), Positives = 117/229 (51%), Gaps = 3/229 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ---S 731
            N T+  TL+GH   VSA ++ PN +  L +SS DK   +W          + G+++   S
Sbjct: 61   NYTLKFTLAGHTKAVSAVKFSPNGE-WLASSSADKLIKIW--------GAYDGKFEKTIS 111

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   +S V+ S S++ + VSGS D T  +W+     ++++T  GH   V    F P  N
Sbjct: 112  GHKLGISDVAWS-SDSRLLVSGSDDKTLKVWELS-TGKSLKTLKGHSNYVFCCNFNPQSN 169

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +GS D + R++D+RTG  L+     HSD     V+++ F+  G L+ +   +G C +
Sbjct: 170  LIVSGSFDESVRIWDVRTGKCLKTL-PAHSD----PVSAVHFNRDGSLIVSSSYDGLCRI 224

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 225  WDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 270



 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 73/313 (23%), Positives = 137/313 (43%), Gaps = 5/313 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V ++ ++P    + S+S D  + +W A   +    I      +   A+S   +
Sbjct: 68   LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSR 127

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +  G  D    ++ L     + G S   +TL GH  YV  C + P  +  +++ S D++
Sbjct: 128  LLVSGSDDKTLKVWEL-----STGKSL--KTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 179

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 180  VRIWDVRTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 230

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 231  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYC 288

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            + +      G+ + +G  +   Y+W+    ++V  L      H   + C       + + 
Sbjct: 289  IFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL----QGHTDTVLCTACHPTENIIA 344

Query: 1200 TGSW--DTTLKIW 1232
            + +   D T+K+W
Sbjct: 345  SAALENDKTIKLW 357



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 61/240 (25%), Positives = 103/240 (42%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ +   +VS S D  L VW   T +    +K    +V  C F+P 
Sbjct: 108  KTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQ 167

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 168  SNLIVSGSFDESVRIWDVR-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 218

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD  
Sbjct: 219  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 271

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               + ++T+ GH+ +   I   F   G ++  +GS+D    ++++++   +Q   Q H+D
Sbjct: 272  -KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL-QGHTD 329



 Score = 37.7 bits (86), Expect = 0.59
 Identities = 28/136 (20%), Positives = 58/136 (42%), Gaps = 6/136 (4%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAI----KLPCAWVMT 464
           C + L  H+  V ++ +  + + IVS+S DG   +W+  + Q    +      P ++V  
Sbjct: 190 CLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV-- 247

Query: 465 CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKG--YVSACQYVPNEDA 638
             FSP G+ +    LD+   +++ +            +T +GHK   Y     +      
Sbjct: 248 -KFSPNGKYILAATLDNTLKLWDYS-------KGKCLKTYTGHKNEKYCIFANFSVTGGK 299

Query: 639 HLITSSGDKTCGLWDI 686
            +++ S D    +W++
Sbjct: 300 WIVSGSEDNMVYIWNL 315



>gb:CR382138_1671323 Debaryomyces hansenii chromosome F of strain
            CBS767 of Debaryomyces hansenii.
          Length = 777

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 78/265 (29%), Positives = 121/265 (45%), Gaps = 7/265 (2%)
 Frame = +3

Query: 459  MTCA-FSPTGQSVACGGLDSVCSIFNLNLPP------DNDGNSTVSRTLSGHKGYVSACQ 617
            MTC  F+     +A G  DS   +++L+  P       +  N+  SR L GH G V    
Sbjct: 444  MTCLDFNDDSNLMAAGFQDSFIKLWSLDGKPLKSVFKKDKYNNDNSRKLIGHSGPVYGVS 503

Query: 618  YVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSG 797
            + P ++ +LI+ S DKT  LW + +      +      GH   +  V  S    + F + 
Sbjct: 504  FSP-DNRYLISGSEDKTVRLWSLDSYSALVSY-----KGHNQPIWDVKFSPFG-HYFATA 556

Query: 798  SCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQL 977
            S D TA LW T      +R F GH  DV  ++F P+ N   TGS D TCR++D++TG+ +
Sbjct: 557  SHDQTARLWATDHIY-PLRIFAGHINDVDCIEFHPNSNYVFTGSSDKTCRMWDVQTGNSV 615

Query: 978  QVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            +++           V  +A S  GR L +   +G   +WD   A     L +++      
Sbjct: 616  RIFM-----GHTGPVNCMAVSSDGRWLASAGEDGVVNIWD---AGSGRRLKTMRGHGRSS 667

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            I  L  S DG  L +   D T+++W
Sbjct: 668  IYSLAFSRDGGVLVSSGADNTVRVW 692



 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 61/226 (26%), Positives = 103/226 (45%), Gaps = 6/226 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW-----NALTSQKTHAIKLPCAWVMTC 467
            R L GH+G VY + ++P+   ++S S+D  + +W     +AL S K H        +   
Sbjct: 490  RKLIGHSGPVYGVSFSPDNRYLISGSEDKTVRLWSLDSYSALVSYKGHNQP-----IWDV 544

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
             FSP G   A    D    ++  +       +    R  +GH   V   ++ PN + ++ 
Sbjct: 545  KFSPFGHYFATASHDQTARLWATD-------HIYPLRIFAGHINDVDCIEFHPNSN-YVF 596

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T S DKTC +WD+ TG    +F      GHT  V+ +++S S+     S   D    +WD
Sbjct: 597  TGSSDKTCRMWDVQTGNSVRIF-----MGHTGPVNCMAVS-SDGRWLASAGEDGVVNIWD 650

Query: 828  TRVASRAVRTFHGH-EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
               + R ++T  GH    + ++ F  DG    +   D T R++D++
Sbjct: 651  AG-SGRRLKTMRGHGRSSIYSLAFSRDGGVLVSSGADNTVRVWDVK 695



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 61/219 (27%), Positives = 98/219 (44%), Gaps = 9/219 (4%)
 Frame = +3

Query: 627  NEDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQS--------GHTADVSSVSISASNT 779
            N+D++L+ +   D    LW +      SVF  +  +        GH+  V  VS S  N 
Sbjct: 450  NDDSNLMAAGFQDSFIKLWSLDGKPLKSVFKKDKYNNDNSRKLIGHSGPVYGVSFSPDNR 509

Query: 780  NMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
             + +SGS D T  LW     S  V ++ GH   +  VKF P G+ F T S D T RL+  
Sbjct: 510  YL-ISGSEDKTVRLWSLDSYSALV-SYKGHNQPIWDVKFSPFGHYFATASHDQTARLWAT 567

Query: 960  RTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ 1139
               + L++++       ++ V  I F  +   +F G ++  C +WD      V     + 
Sbjct: 568  DHIYPLRIFA-----GHINDVDCIEFHPNSNYVFTGSSDKTCRMWDVQTGNSV----RIF 618

Query: 1140 NSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
              H G ++C+ +S DG  L +   D  + IW  G  R++
Sbjct: 619  MGHTGPVNCMAVSSDGRWLASAGEDGVVNIWDAGSGRRL 657



 Score = 36.2 bits (82), Expect = 1.7
 Identities = 30/135 (22%), Positives = 51/135 (37%), Gaps = 8/135 (5%)
 Frame = +3

Query: 855  TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR----- 1019
            TFH    D+  + F  D N    G  D   +L+ +       V+ +   +N+  R     
Sbjct: 436  TFHNANNDMTCLDFNDDSNLMAAGFQDSFIKLWSLDGKPLKSVFKKDKYNNDNSRKLIGH 495

Query: 1020 ---VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V  ++FS   R L +G  +    +W       +++       H+  I  +  S  G 
Sbjct: 496  SGPVYGVSFSPDNRYLISGSEDKTVRLWSLDSYSALVS----YKGHNQPIWDVKFSPFGH 551

Query: 1191 ALCTGSWDTTLKIWA 1235
               T S D T ++WA
Sbjct: 552  YFATASHDQTARLWA 566



>sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5
            (Transcription initiation factor TFIID 72 kDa subunit)
            (TAFII-72).>pir|T41454|T41454 transcription initiation
            factor TFIID chain taf72 - fission yeast
            (Schizosaccharomyces pombe)>gb:AB001372_1508461
            Schizosaccharomyces pombe DNA for TFIID subunit taf72p,
            complete cds.>gb:SPCC5E4_1721457 S.pombe chromosome III
            cosmid c5E4.
          Length = 643

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 77/269 (28%), Positives = 121/269 (44%), Gaps = 11/269 (4%)
 Frame = +3

Query: 459  MTCA-FSPTGQSVACGGLDSVCSIFNL-----NLPP-----DNDGNSTVSRTLSGHKGYV 605
            M CA FSP    +ACG  +S   ++++     +LP      D+DG    S  L  H G V
Sbjct: 327  MNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTSVEDSDG----SVRLLSHSGPV 382

Query: 606  SACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNM 785
                + P ++ +L++ S D +  LW + T      +      GHT  V  V+      + 
Sbjct: 383  YGTTFSP-DNKYLLSCSEDASARLWSVDTKTALVAY-----KGHTGPVWDVAFGPFG-HY 435

Query: 786  FVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT 965
            F + S D TA LW        +R F GH  DV  V F P+     TGS D TCRL+D+  
Sbjct: 436  FATASHDQTAQLWSCDHIY-PLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHR 494

Query: 966  GHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNS 1145
            GH ++V+     +     VT++A +  G  + +  + G  ++WD    + +  +      
Sbjct: 495  GHSVRVF-----NGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIKTM----RG 545

Query: 1146 HDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            H G I  L  S + + L +G  D T++ W
Sbjct: 546  HRGNIYSLSFSRESTVLVSGGSDCTVRAW 574



 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 61/217 (28%), Positives = 97/217 (44%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
           L  H+G VY   ++P+   ++S S+D    +W+  T     A K     V   AF P G 
Sbjct: 375 LLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFGH 434

Query: 489 SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             A    D    +++ +       +    R  +GH   V    + PN  A+++T S DKT
Sbjct: 435 YFATASHDQTAQLWSCD-------HIYPLRVFAGHLSDVDCVTFHPN-SAYVLTGSSDKT 486

Query: 669 CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
           C LWD+  G    VF     +GHT  V++V+I+     M  S   +    LWD     R 
Sbjct: 487 CRLWDVHRGHSVRVF-----NGHTQPVTAVAIAPDGHTM-ASADSEGLIHLWDIG-TGRR 539

Query: 849 VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
           ++T  GH G++ ++ F  +     +G  D T R +D+
Sbjct: 540 IKTMRGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDV 576



 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 46/176 (26%), Positives = 79/176 (44%), Gaps = 2/176 (1%)
 Frame = +3

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDG 908
            H+  V   + S  N  + +S S D +A LW  DT+ A  A   + GH G V  V F P G
Sbjct: 378  HSGPVYGTTFSPDNKYL-LSCSEDASARLWSVDTKTALVA---YKGHTGPVWDVAFGPFG 433

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
            + F T S D T +L+     + L+V++   SD     V  + F  +   +  G ++  C 
Sbjct: 434  HYFATASHDQTAQLWSCDHIYPLRVFAGHLSD-----VDCVTFHPNSAYVLTGSSDKTCR 488

Query: 1089 VWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            +WD      V     + N H   ++ + ++ DG  + +   +  + +W  G  R++
Sbjct: 489  LWDVHRGHSV----RVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRI 540



>gb:AK127882_1916943 Homo sapiens cDNA FLJ45988 fis, clone
            PUAEN2006639, weakly similar to Vegetatible
            incompatibility protein HET-E-1.
          Length = 369

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 74/266 (27%), Positives = 112/266 (42%), Gaps = 11/266 (4%)
 Frame = +3

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            A + +G     G  D  C +++         +     TL GH+  V A  +       + 
Sbjct: 99   ALNKSGSCFITGSYDRTCKLWD-------SASGEELNTLEGHRNVVYAIAFNNPYGDKIA 151

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T S DKTC LW + TG     F      GHTA++  +S +  +T +  +GS DTTA LWD
Sbjct: 152  TGSFDKTCKLWSVETGKCYHTF-----RGHTAEIVCLSFNPQST-LVATGSMDTTAKLWD 205

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
             +     V T  GH  ++I++ F   G+R  TGS D T  ++D  TG ++ +        
Sbjct: 206  IQ-NGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILI-----G 259

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRI--SCLGLSG 1181
                ++S +F+    L+  G  +  C +WD    K V  L      HD  I  SC   +G
Sbjct: 260  HCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATL----TGHDDEILDSCFDYTG 315

Query: 1182 ---------DGSALCTGSWDTTLKIW 1232
                     DG +LC        + W
Sbjct: 316  KLIATASADDGVSLCRPGRSAVARSW 341



 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 60/217 (27%), Positives = 103/217 (47%), Gaps = 4/217 (1%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWT-PEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG 485
           L+GH   VY++ +  P  ++I + S D    +W+  T +  H  +   A ++  +F+P  
Sbjct: 130 LEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQS 189

Query: 486 QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
             VA G +D+   ++++        N     TL GH   + +  +  + D  +IT S D 
Sbjct: 190 TLVATGSMDTTAKLWDIQ-------NGEEVYTLRGHSAEIISLSFNTSGD-RIITGSFDH 241

Query: 666 TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
           T  +WD  TG + ++       GH A++SS S +  + ++ ++GS D T  LWD     +
Sbjct: 242 TVVVWDADTGRKVNIL-----IGHCAEISSASFN-WDCSLILTGSMDKTCKLWDA-TNGK 294

Query: 846 AVRTFHGHEGDVIAVKFFPDGNRFGTGS-DDGT--CR 947
            V T  GH+ +++   F   G    T S DDG   CR
Sbjct: 295 CVATLTGHDDEILDSCFDYTGKLIATASADDGVSLCR 331



 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 36/134 (26%), Positives = 63/134 (47%), Gaps = 1/134 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C    +GHT ++  L + P+   + + S D    +W+    ++ + ++   A +++ +F+
Sbjct: 169 CYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFN 228

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TS 653
            +G  +  G  D    ++      D D    V+  L GH   +S+  +  N D  LI T 
Sbjct: 229 TSGDRIITGSFDHTVVVW------DADTGRKVN-ILIGHCAEISSASF--NWDCSLILTG 279

Query: 654 SGDKTCGLWDITTG 695
           S DKTC LWD T G
Sbjct: 280 SMDKTCKLWDATNG 293



>sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5
            (TBP-associated factor 5) (TBP-associated factor 90 kDa)
            (TAFII-90).>pir|S34023|S34023 TATA box-binding
            protein-associated factor chain TAFII90 - yeast
            (Saccharomyces cerevisiae)>gb:AY692890_1622937
            Saccharomyces cerevisiae clone FLH113143.01X YBR198C
            gene, complete cds.>gb:SCCHRIIFG_1706759 S.cerevisiae
            RIM, MSI1, PGI, and ribosomal protein L21
            genes.>gb:SCYBR198C_1711438 S.cerevisiae chromosome II
            reading frame ORF YBR198c.
          Length = 798

 Score = 98.2 bits (243), Expect = 4e-19
 Identities = 83/269 (30%), Positives = 121/269 (44%), Gaps = 11/269 (4%)
 Frame = +3

Query: 459  MTCA-FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVS----------RTLSGHKGYV 605
            M+C  FS   +  A G  DS   I++L+    N+ N  ++          +TL GH G V
Sbjct: 469  MSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTV 528

Query: 606  SACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNM 785
             +  + P ++ +L++ S DKT  LW + T      +      GH   V  VS S    + 
Sbjct: 529  YSTSFSP-DNKYLLSGSEDKTVRLWSMDTHTALVSY-----KGHNHPVWDVSFSPLG-HY 581

Query: 786  FVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT 965
            F + S D TA LW        +R F GH  DV  V F P+G    TGS D TCR++D+ T
Sbjct: 582  FATASHDQTARLWSCDHIY-PLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 640

Query: 966  GHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNS 1145
            G  ++++           V SIA    GR L  G  +G   VWD    K    L  ++  
Sbjct: 641  GDSVRLFL-----GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGK---RLKQMRGH 692

Query: 1146 HDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                I  L  S +G+ L +G  D T+++W
Sbjct: 693  GKNAIYSLSYSKEGNVLISGGADHTVRVW 721



 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 63/227 (27%), Positives = 107/227 (47%), Gaps = 6/227 (2%)
 Frame = +3

Query: 300  CRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN-----ALTSQKTHAIKLPCAWVMT 464
            C+ L GH+G VYS  ++P+   ++S S+D  + +W+     AL S K H        V  
Sbjct: 518  CKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHP-----VWD 572

Query: 465  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL 644
             +FSP G   A    D    +++ +       +    R  +GH   V    + PN   ++
Sbjct: 573  VSFSPLGHYFATASHDQTARLWSCD-------HIYPLRIFAGHLNDVDCVSFHPN-GCYV 624

Query: 645  ITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW 824
             T S DKTC +WD++TG    +F      GHTA V S+++   +     +GS D    +W
Sbjct: 625  FTGSSDKTCRMWDVSTGDSVRLF-----LGHTAPVISIAV-CPDGRWLSTGSEDGIINVW 678

Query: 825  DTRVASRAVRTFHGH-EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
            D     R ++   GH +  + ++ +  +GN   +G  D T R++D++
Sbjct: 679  DIGTGKR-LKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724



 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 53/171 (30%), Positives = 79/171 (46%), Gaps = 1/171 (0%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH+  V S S S  N  + +SGS D T  LW     +  V ++ GH   V  V F P G+
Sbjct: 523  GHSGTVYSTSFSPDNKYL-LSGSEDKTVRLWSMDTHTALV-SYKGHNHPVWDVSFSPLGH 580

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
             F T S D T RL+     + L++++   +D     V  ++F  +G  +F G ++  C +
Sbjct: 581  YFATASHDQTARLWSCDHIYPLRIFAGHLND-----VDCVSFHPNGCYVFTGSSDKTCRM 635

Query: 1092 WDTLLAKMV-LNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFG 1241
            WD      V L LG     H   +  + +  DG  L TGS D  + +W  G
Sbjct: 636  WDVSTGDSVRLFLG-----HTAPVISIAVCPDGRWLSTGSEDGIINVWDIG 681



>gb:CR382125_1658273 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 826

 Score = 97.8 bits (242), Expect = 5e-19
 Identities = 78/265 (29%), Positives = 121/265 (45%), Gaps = 7/265 (2%)
 Frame = +3

Query: 459  MTCA-FSPTGQSVACGGLDSVCSIFNLN------LPPDNDGNSTVSRTLSGHKGYVSACQ 617
            MTC  FS   +  A G  DS   ++ L+      + P    + + S TL GH G V +  
Sbjct: 501  MTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVA 560

Query: 618  YVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSG 797
            + P ++ +L+++S DKT  LW + T      +      GH   V  V  S    + F++ 
Sbjct: 561  FSP-DNRYLLSASEDKTVRLWSLDTFTCLVCY-----KGHNHPVWYVKFSPLG-HYFITA 613

Query: 798  SCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQL 977
            S D TA LW        +R F GH  DV    F P+G    TGS D TCR++DI+TG  +
Sbjct: 614  SHDQTARLWSCDHIY-PLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSV 672

Query: 978  QVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            +++           VT++  S  GR L  G  +G   VWD    K    +  ++      
Sbjct: 673  RLFL-----GHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGK---RIKQMKGHGKNP 724

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            I  +  + +G+ L TG  D ++++W
Sbjct: 725  IYSITFNKEGNCLVTGGADQSVRVW 749



 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 63/219 (28%), Positives = 102/219 (46%), Gaps = 1/219 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VYS+ ++P+   ++SAS+D  + +W+  T       K     V    FSP G 
Sbjct: 549  LVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGH 608

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                   D    +++ +       +    R  SGH   V    + PN   ++ T S DKT
Sbjct: 609  YFITASHDQTARLWSCD-------HIYPLRIFSGHLNDVDCSTFHPN-GCYVFTGSSDKT 660

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
            C +WDI TG    +F      GHT+ V+++ +S        +GS D T  +WD     R 
Sbjct: 661  CRMWDIQTGDSVRLF-----LGHTSPVTALEVSPDG-RWLTTGSEDGTIIVWDIGTGKR- 713

Query: 849  VRTFHGH-EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
            ++   GH +  + ++ F  +GN   TG  D + R++DI+
Sbjct: 714  IKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752



 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 66/221 (29%), Positives = 101/221 (45%), Gaps = 11/221 (4%)
 Frame = +3

Query: 627  NEDAHLITSSG--DKTCGLWDITTGLRTSVFGGEYQS--------GHTADVSSVSISASN 776
            ++DA L T++G  D T  +W +      S+   + +         GH+  V SV+ S  N
Sbjct: 507  SDDARL-TAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDN 565

Query: 777  TNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
              + +S S D T  LW     +  V  + GH   V  VKF P G+ F T S D T RL+ 
Sbjct: 566  RYL-LSASEDKTVRLWSLDTFTCLV-CYKGHNHPVWYVKFSPLGHYFITASHDQTARLWS 623

Query: 957  IRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMV-LNLGS 1133
                + L+++S   +D     V    F  +G  +F G ++  C +WD      V L LG 
Sbjct: 624  CDHIYPLRIFSGHLND-----VDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLG- 677

Query: 1134 LQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
                H   ++ L +S DG  L TGS D T+ +W  G  +++
Sbjct: 678  ----HTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRI 714



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 49/199 (24%), Positives = 82/199 (41%), Gaps = 5/199 (2%)
 Frame = +3

Query: 252  SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNA-----LT 416
            S+ KT   +      C    +GH   V+ + ++P  +  ++AS D    +W+      L 
Sbjct: 572  SEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLR 631

Query: 417  SQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHK 596
                H   + C+      F P G  V  G  D  C ++++       G+S   R   GH 
Sbjct: 632  IFSGHLNDVDCS-----TFHPNGCYVFTGSSDKTCRMWDI-----QTGDSV--RLFLGHT 679

Query: 597  GYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASN 776
              V+A +  P +   L T S D T  +WDI TG R     G  ++     + S++ +   
Sbjct: 680  SPVTALEVSP-DGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKN----PIYSITFNKEG 734

Query: 777  TNMFVSGSCDTTACLWDTR 833
             N  V+G  D +  +WD +
Sbjct: 735  -NCLVTGGADQSVRVWDIK 752



>gb:BC052124_2550472 Danio rerio zgc:76895, mRNA (cDNA clone MGC:56591
            IMAGE:5915175), complete cds.>gb:BC066729_2554566 Danio
            rerio zgc:76895, mRNA (cDNA clone MGC:76895
            IMAGE:6520391), complete cds.
          Length = 334

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 68/229 (29%), Positives = 117/229 (51%), Gaps = 3/229 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ---S 731
            N T+  TL+GH   VS+ ++ P+ +  L +SS DK   +W          + G+++   S
Sbjct: 34   NYTLKFTLAGHTKAVSSVKFSPSGE-WLASSSADKLIKIW--------GAYDGKFEKTIS 84

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   +S V+ S S++N+ VS S D T  +WD   + + ++T  GH   V    F P  N
Sbjct: 85   GHKLGISDVAWS-SDSNLLVSASDDKTLKIWDVS-SGKCLKTLKGHSNYVFCCNFNPQSN 142

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +GS D + R++D++TG  L+     HSD     V+++ F+  G L+ +   +G C +
Sbjct: 143  LIVSGSFDESVRIWDVKTGKCLKTLPA-HSDP----VSAVHFNRDGSLIVSSSYDGLCRI 197

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 198  WDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 243



 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 65/276 (23%), Positives = 122/276 (44%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  + +W A   +    I      +   A+S    
Sbjct: 41   LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN 100

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    I++++       +    +TL GH  YV  C + P  +  +++ S D++
Sbjct: 101  LLVSASDDKTLKIWDVS-------SGKCLKTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 152

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 153  VRIWDVKTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 203

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 204  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYC 261

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 262  IFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKL 297



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 62/240 (25%), Positives = 106/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ + N +VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 81   KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ 140

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 141  SNLIVSGSFDESVRIWDVK-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 191

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD  
Sbjct: 192  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 244

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               + ++T+ GH+ +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 245  -KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKL-QGHTD 302



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 121 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 180

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 181 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 233

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 234 LDNTLKLWDYSKGKCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNMVYIWNLQ- 289

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 290 TKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



>gb:HSU75309_2025968 Human TBP-associated factor (hTAFII100) mRNA,
            partial cds.
          Length = 801

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 72/219 (32%), Positives = 103/219 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            + L GH G V    + P+ + +L++SS D T  LW + T   T + G     GH   V  
Sbjct: 538  KILYGHSGPVYGASFSPDRN-YLLSSSEDGTVRLWSLQTF--TCLVG---YKGHNYPVWD 591

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
               S      FVSG  D  A LW T    + +R F GH  DV   +F P+ N   TGS D
Sbjct: 592  TQFSPYGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVNCTRFHPNSNYVATGSAD 649

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RL+D+  G+ +++++          + S+ FS +GR L  G T+G   +WD     M
Sbjct: 650  RTVRLWDVLNGNCVRIFT-----GHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLM 704

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            V  L      H   +  L  S DG  L +GS D T+++W
Sbjct: 705  VGEL----KGHTDTVCSLRFSRDGEILASGSMDNTVRLW 739



 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 63/216 (29%), Positives = 100/216 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY   ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 540  LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY 599

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  ++ PN + ++ T S D+T
Sbjct: 600  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVNCTRFHPNSN-YVATGSADRT 651

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     +G+ D    LWD       
Sbjct: 652  VRLWDVLNGNCVRIF-----TGHKGPIHSLTFS-PNGRFLATGATDGRVLLWDIG-HGLM 704

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            V    GH   V +++F  DG    +GS D T RL+D
Sbjct: 705  VGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD 740



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 1/202 (0%)
 Frame = +3

Query: 630  EDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            +D+ LI     D T  +W +T     SV                   AS+ ++    S D
Sbjct: 481  DDSSLIAGGFADSTVRVWSVTPKKLRSVK-----------------QASDLSLIDKESDD 523

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
                + D + AS  ++  +GH G V    F PD N   + S+DGT RL+ ++T   L  Y
Sbjct: 524  VLERIMDEKTASE-LKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGY 582

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                     + V    FS  G    +G  +    +W T   + +     +   H   ++C
Sbjct: 583  K-----GHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPL----RIFAGHLADVNC 633

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 + + + TGS D T+++W
Sbjct: 634  TRFHPNSNYVATGSADRTVRLW 655



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 20/79 (25%), Positives = 40/79 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + + + DGR+++W+         +K     V +  FS
Sbjct: 662 CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS 721

Query: 477 PTGQSVACGGLDSVCSIFN 533
             G+ +A G +D+   +++
Sbjct: 722 RDGEILASGSMDNTVRLWD 740



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + +  FSP 
Sbjct: 622 RIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN 681

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH   V + ++  + D  ++ S S 
Sbjct: 682 GRFLATGATDGRVLLWDI-------GHGLMVGELKGHTDTVCSLRF--SRDGEILASGSM 732

Query: 660 DKTCGLWD 683
           D T  LWD
Sbjct: 733 DNTVRLWD 740



>gb:HSTAFII10_2020620 H.sapiens mRNA for TAFII100 protein.
          Length = 799

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 72/219 (32%), Positives = 103/219 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            + L GH G V    + P+ + +L++SS D T  LW + T   T + G     GH   V  
Sbjct: 537  KILYGHSGPVYGASFSPDRN-YLLSSSEDGTVRLWSLQTF--TCLVG---YKGHNYPVWD 590

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
               S      FVSG  D  A LW T    + +R F GH  DV   +F P+ N   TGS D
Sbjct: 591  TQFSPYGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVNCTRFHPNSNYVATGSAD 648

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RL+D+  G+ +++++          + S+ FS +GR L  G T+G   +WD     M
Sbjct: 649  RTVRLWDVLNGNCVRIFT-----GHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLM 703

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            V  L      H   +  L  S DG  L +GS D T+++W
Sbjct: 704  VGEL----KGHTDTVCSLRFSRDGEILASGSMDNTVRLW 738



 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 63/216 (29%), Positives = 100/216 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY   ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 539  LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY 598

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  ++ PN + ++ T S D+T
Sbjct: 599  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVNCTRFHPNSN-YVATGSADRT 650

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     +G+ D    LWD       
Sbjct: 651  VRLWDVLNGNCVRIF-----TGHKGPIHSLTFS-PNGRFLATGATDGRVLLWDIG-HGLM 703

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            V    GH   V +++F  DG    +GS D T RL+D
Sbjct: 704  VGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD 739



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 1/202 (0%)
 Frame = +3

Query: 630  EDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            +D+ LI     D T  +W +T     SV                   AS+ ++    S D
Sbjct: 480  DDSSLIAGGFADSTVRVWSVTPKKLRSVK-----------------QASDLSLIDKESDD 522

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
                + D + AS  ++  +GH G V    F PD N   + S+DGT RL+ ++T   L  Y
Sbjct: 523  VLERIMDEKTASE-LKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGY 581

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                     + V    FS  G    +G  +    +W T   + +     +   H   ++C
Sbjct: 582  K-----GHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPL----RIFAGHLADVNC 632

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 + + + TGS D T+++W
Sbjct: 633  TRFHPNSNYVATGSADRTVRLW 654



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 20/79 (25%), Positives = 40/79 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + + + DGR+++W+         +K     V +  FS
Sbjct: 661 CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS 720

Query: 477 PTGQSVACGGLDSVCSIFN 533
             G+ +A G +D+   +++
Sbjct: 721 RDGEILASGSMDNTVRLWD 739



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + +  FSP 
Sbjct: 621 RIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN 680

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH   V + ++  + D  ++ S S 
Sbjct: 681 GRFLATGATDGRVLLWDI-------GHGLMVGELKGHTDTVCSLRF--SRDGEILASGSM 731

Query: 660 DKTCGLWD 683
           D T  LWD
Sbjct: 732 DNTVRLWD 739



>gb:HSA011376_2000038 Homo sapiens mRNA for hypothetical protein (WDR5
            gene), partial.
          Length = 362

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 68/229 (29%), Positives = 116/229 (50%), Gaps = 3/229 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ---S 731
            N  +  TL+GH   VS+ ++ PN +  L +SS DK   +W          + G+++   S
Sbjct: 62   NYALKFTLAGHTKAVSSVKFSPNGE-WLASSSADKLIKIW--------GAYDGKFEKTIS 112

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   +S V+ S S++N+ VS S D T  +WD   + + ++T  GH   V    F P  N
Sbjct: 113  GHKLGISDVAWS-SDSNLLVSASDDKTLKIWDVS-SGKCLKTLKGHSNYVFCCNFNPQSN 170

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +GS D + R++D++TG  L+     HSD     V+++ F+  G L+ +   +G C +
Sbjct: 171  LIVSGSFDESVRIWDVKTGKCLKTLPA-HSDP----VSAVHFNRDGSLIVSSSYDGLCRI 225

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 226  WDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 271



 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 89/338 (26%), Positives = 153/338 (45%), Gaps = 11/338 (3%)
 Frame = +3

Query: 252  SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKT- 428
            S  + P+S GP+ LV C         V ++  T EK     A++       +A  S+ T 
Sbjct: 6    SLNRLPLSPGPSTLVSC------AASVRAMA-TEEKKPETEAARAQPTPSSSATQSKPTP 58

Query: 429  ----HAIKLPCAW----VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL 584
                +A+K   A     V +  FSP G+ +A    D +  I+        DG     +T+
Sbjct: 59   VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGA-----YDGK--FEKTI 111

Query: 585  SGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSV 758
            SGHK  +S   +  + +  L+++S DKT  +WD+++G  L+T         GH+  V   
Sbjct: 112  SGHKLGISDVAWSSDSNL-LVSASDDKTLKIWDVSSGKCLKT-------LKGHSNYVFCC 163

Query: 759  SISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDG 938
            + +   +N+ VSGS D +  +WD +   + ++T   H   V AV F  DG+   + S DG
Sbjct: 164  NFN-PQSNLIVSGSFDESVRIWDVK-TGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDG 221

Query: 939  TCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMV 1118
             CR++D  +G  L+       D++   V+ + FS +G+ + A   +    +WD    K +
Sbjct: 222  LCRIWDTASGQCLKTL----IDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCL 277

Query: 1119 LNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                  +N      +   ++G G  + +GS D  + IW
Sbjct: 278  KTYTGHKNEKYCIFANFSVTG-GKWIVSGSEDNLVYIW 314



 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 65/276 (23%), Positives = 122/276 (44%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  + +W A   +    I      +   A+S    
Sbjct: 69   LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN 128

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    I++++       +    +TL GH  YV  C + P  +  +++ S D++
Sbjct: 129  LLVSASDDKTLKIWDVS-------SGKCLKTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 180

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 181  VRIWDVKTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 231

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 232  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYC 289

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 290  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL 325



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 62/240 (25%), Positives = 106/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ + N +VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 109  KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ 168

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 169  SNLIVSGSFDESVRIWDVK-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 219

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD  
Sbjct: 220  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 272

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               + ++T+ GH+ +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 273  -KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL-QGHTD 330



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 149 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 208

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 209 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 261

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 262 LDNTLKLWDYSKGKCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 317

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 318 TKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 358



>gb:BC052268_1984779 Homo sapiens TAF5 RNA polymerase II, TATA box
            binding protein (TBP)-associated factor, 100kDa, mRNA
            (cDNA clone IMAGE:6575596), partial cds.
          Length = 805

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 72/219 (32%), Positives = 103/219 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            + L GH G V    + P+ + +L++SS D T  LW + T   T + G     GH   V  
Sbjct: 542  KILYGHSGPVYGASFSPDRN-YLLSSSEDGTVRLWSLQTF--TCLVG---YKGHNYPVWD 595

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
               S      FVSG  D  A LW T    + +R F GH  DV   +F P+ N   TGS D
Sbjct: 596  TQFSPYGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVNCTRFHPNSNYVATGSAD 653

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RL+D+  G+ +++++          + S+ FS +GR L  G T+G   +WD     M
Sbjct: 654  RTVRLWDVLNGNCVRIFT-----GHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLM 708

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            V  L      H   +  L  S DG  L +GS D T+++W
Sbjct: 709  VGEL----KGHTDTVCSLRFSRDGEILASGSMDNTVRLW 743



 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 63/216 (29%), Positives = 100/216 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY   ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 544  LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY 603

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  ++ PN + ++ T S D+T
Sbjct: 604  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVNCTRFHPNSN-YVATGSADRT 655

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     +G+ D    LWD       
Sbjct: 656  VRLWDVLNGNCVRIF-----TGHKGPIHSLTFS-PNGRFLATGATDGRVLLWDIG-HGLM 708

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            V    GH   V +++F  DG    +GS D T RL+D
Sbjct: 709  VGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD 744



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 1/202 (0%)
 Frame = +3

Query: 630  EDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            +D+ LI     D T  +W +T     SV                   AS+ ++    S D
Sbjct: 485  DDSSLIAGGFADSTVRVWSVTPKKLRSVK-----------------QASDLSLIDKESDD 527

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
                + D + AS  ++  +GH G V    F PD N   + S+DGT RL+ ++T   L  Y
Sbjct: 528  VLERIMDEKTASE-LKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGY 586

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                     + V    FS  G    +G  +    +W T   + +     +   H   ++C
Sbjct: 587  K-----GHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPL----RIFAGHLADVNC 637

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 + + + TGS D T+++W
Sbjct: 638  TRFHPNSNYVATGSADRTVRLW 659



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 20/79 (25%), Positives = 40/79 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + + + DGR+++W+         +K     V +  FS
Sbjct: 666 CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS 725

Query: 477 PTGQSVACGGLDSVCSIFN 533
             G+ +A G +D+   +++
Sbjct: 726 RDGEILASGSMDNTVRLWD 744



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + +  FSP 
Sbjct: 626 RIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN 685

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH   V + ++  + D  ++ S S 
Sbjct: 686 GRFLATGATDGRVLLWDI-------GHGLMVGELKGHTDTVCSLRF--SRDGEILASGSM 736

Query: 660 DKTCGLWD 683
           D T  LWD
Sbjct: 737 DNTVRLWD 744



>gb:AL591408_1930058 Human DNA sequence from clone RP11-792D24 on
            chromosome 10 Contains the INA gene for internexin
            neuronal intermediate filament protein alpha, the RNF134
            gene for ring finger protein 134, the TAF5D gene for 100
            kD TAF5 RNA polymerase II TATA box binding protein
            (TBP)-associated factor, a novel gene, the 5' end of the
            PDCD11 gene for programmed cell death 11 and four CpG
            islands, complete sequence.
          Length = 800

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 72/219 (32%), Positives = 103/219 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            + L GH G V    + P+ + +L++SS D T  LW + T   T + G     GH   V  
Sbjct: 537  KILYGHSGPVYGASFSPDRN-YLLSSSEDGTVRLWSLQTF--TCLVG---YKGHNYPVWD 590

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
               S      FVSG  D  A LW T    + +R F GH  DV   +F P+ N   TGS D
Sbjct: 591  TQFSPYGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVNCTRFHPNSNYVATGSAD 648

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RL+D+  G+ +++++          + S+ FS +GR L  G T+G   +WD     M
Sbjct: 649  RTVRLWDVLNGNCVRIFT-----GHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLM 703

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            V  L      H   +  L  S DG  L +GS D T+++W
Sbjct: 704  VGEL----KGHTDTVCSLRFSRDGEILASGSMDNTVRLW 738



 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 63/216 (29%), Positives = 100/216 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY   ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 539  LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY 598

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  ++ PN + ++ T S D+T
Sbjct: 599  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVNCTRFHPNSN-YVATGSADRT 650

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     +G+ D    LWD       
Sbjct: 651  VRLWDVLNGNCVRIF-----TGHKGPIHSLTFS-PNGRFLATGATDGRVLLWDIG-HGLM 703

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            V    GH   V +++F  DG    +GS D T RL+D
Sbjct: 704  VGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD 739



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 1/202 (0%)
 Frame = +3

Query: 630  EDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            +D+ LI     D T  +W +T     SV                   AS+ ++    S D
Sbjct: 480  DDSSLIAGGFADSTVRVWSVTPKKLRSVK-----------------QASDLSLIDKESDD 522

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
                + D + AS  ++  +GH G V    F PD N   + S+DGT RL+ ++T   L  Y
Sbjct: 523  VLERIMDEKTASE-LKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGY 581

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                     + V    FS  G    +G  +    +W T   + +     +   H   ++C
Sbjct: 582  K-----GHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPL----RIFAGHLADVNC 632

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 + + + TGS D T+++W
Sbjct: 633  TRFHPNSNYVATGSADRTVRLW 654



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 20/79 (25%), Positives = 40/79 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + + + DGR+++W+         +K     V +  FS
Sbjct: 661 CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS 720

Query: 477 PTGQSVACGGLDSVCSIFN 533
             G+ +A G +D+   +++
Sbjct: 721 RDGEILASGSMDNTVRLWD 739



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + +  FSP 
Sbjct: 621 RIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN 680

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH   V + ++  + D  ++ S S 
Sbjct: 681 GRFLATGATDGRVLLWDI-------GHGLMVGELKGHTDTVCSLRF--SRDGEILASGSM 731

Query: 660 DKTCGLWD 683
           D T  LWD
Sbjct: 732 DNTVRLWD 739



>gb:AF391288_1267431 Branchiostoma floridae cosmid MPMGc117G0971,
            partial sequence.
          Length = 353

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 68/229 (29%), Positives = 117/229 (51%), Gaps = 3/229 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ---S 731
            N T+  TL+GH   VS+ ++ PN +  L +SS DK   +W          + G+++   S
Sbjct: 53   NYTLKFTLAGHTKAVSSVKFSPNGE-WLASSSADKLIKIW--------GAYDGKFEKTIS 103

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   +S V+ S S++++ VS S D T  +WD   + + ++T  GH   V    F P  N
Sbjct: 104  GHKLGISDVAWS-SDSHLLVSASDDKTLKIWDLN-SGKCLKTLKGHSNYVFCCNFNPQSN 161

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +GS D + R++D++TG  L+     HSD     V+++ F+  G L+ +   +G C +
Sbjct: 162  LIVSGSFDESVRIWDVKTGKCLKTLPA-HSDP----VSAVHFNRDGSLIVSSSYDGLCRI 216

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 217  WDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 262



 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 72/313 (23%), Positives = 135/313 (43%), Gaps = 5/313 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  + +W A   +    I      +   A+S    
Sbjct: 60   LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSH 119

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    I++LN       +    +TL GH  YV  C + P  +  +++ S D++
Sbjct: 120  LLVSASDDKTLKIWDLN-------SGKCLKTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 171

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 172  VRIWDVKTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 222

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 223  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYC 280

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            + +      G+ + +G  +   ++W+    ++V  L      H   + C       + + 
Sbjct: 281  IFANFSVTGGKWIVSGSEDNMVFIWNLQTKEVVQKL----QGHTDVVLCTACHPTENIIA 336

Query: 1200 TGSW--DTTLKIW 1232
            + +   D T+K+W
Sbjct: 337  SAALENDKTIKLW 349



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 61/240 (25%), Positives = 106/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ + + +VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 100  KTISGHKLGISDVAWSSDSHLLVSASDDKTLKIWDLNSGKCLKTLKGHSNYVFCCNFNPQ 159

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 160  SNLIVSGSFDESVRIWDVK-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 210

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD  
Sbjct: 211  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 263

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               + ++T+ GH+ +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 264  -KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVFIWNLQTKEVVQKL-QGHTD 321



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/221 (21%), Positives = 88/221 (39%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 140 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 199

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 200 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 252

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 253 LDNTLKLWDYSKGKCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNMVFIWNLQ- 308

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   V+     P  N   + +  +D T +L+
Sbjct: 309 TKEVVQKLQGHTDVVLCTACHPTENIIASAALENDKTIKLW 349



>gb:AK088953_1175721 Mus musculus 2 days neonate thymus thymic cells
            cDNA, RIKEN full-length enriched library,
            clone:E430033I22 product:TRANSCRIPTION INITIATION FACTOR
            TFIID 100 KDA SUBUNIT (TAFII-100) (TAFII100) homolog
            [Homo sapiens], full insert sequence.
          Length = 801

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 72/219 (32%), Positives = 103/219 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            + L GH G V    + P+ + +L++SS D T  LW + T   T + G     GH   V  
Sbjct: 538  KILYGHSGPVYGASFSPDRN-YLLSSSEDGTVRLWSLQTF--TCLVG---YKGHNYPVWD 591

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
               S      FVSG  D  A LW T    + +R F GH  DV   +F P+ N   TGS D
Sbjct: 592  TQFSPYGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVNCTRFHPNSNYVATGSAD 649

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RL+D+  G+ +++++          + S+ FS +GR L  G T+G   +WD     M
Sbjct: 650  RTVRLWDVLNGNCVRIFT-----GHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLM 704

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            V  L      H   +  L  S DG  L +GS D T+++W
Sbjct: 705  VGEL----KGHTDTVCSLRFSRDGEILASGSMDNTVRLW 739



 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 63/216 (29%), Positives = 100/216 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY   ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 540  LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY 599

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  ++ PN + ++ T S D+T
Sbjct: 600  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVNCTRFHPNSN-YVATGSADRT 651

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     +G+ D    LWD       
Sbjct: 652  VRLWDVLNGNCVRIF-----TGHKGPIHSLTFS-PNGRFLATGATDGRVLLWDIG-HGLM 704

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            V    GH   V +++F  DG    +GS D T RL+D
Sbjct: 705  VGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD 740



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 1/202 (0%)
 Frame = +3

Query: 630  EDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            +D+ LI     D T  +W +T     SV                   AS+ ++    S D
Sbjct: 481  DDSSLIAGGFADSTVRVWSVTPKKLRSVK-----------------QASDLSLIDKESDD 523

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
                + D + AS  ++  +GH G V    F PD N   + S+DGT RL+ ++T   L  Y
Sbjct: 524  VLERIMDEKTASE-LKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGY 582

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                     + V    FS  G    +G  +    +W T   + +     +   H   ++C
Sbjct: 583  K-----GHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPL----RIFAGHLADVNC 633

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 + + + TGS D T+++W
Sbjct: 634  TRFHPNSNYVATGSADRTVRLW 655



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 20/79 (25%), Positives = 40/79 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + + + DGR+++W+         +K     V +  FS
Sbjct: 662 CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS 721

Query: 477 PTGQSVACGGLDSVCSIFN 533
             G+ +A G +D+   +++
Sbjct: 722 RDGEILASGSMDNTVRLWD 740



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + +  FSP 
Sbjct: 622 RIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN 681

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH   V + ++  + D  ++ S S 
Sbjct: 682 GRFLATGATDGRVLLWDI-------GHGLMVGELKGHTDTVCSLRF--SRDGEILASGSM 732

Query: 660 DKTCGLWD 683
           D T  LWD
Sbjct: 733 DNTVRLWD 740



>sp|P61964|WDR5_HUMAN WD-repeat protein 5.>sp|P61965|WDR5_MOUSE
            WD-repeat protein 5 (WD-repeat protein
            BIG-3).>gb:AK075937_1171116 Mus musculus ES cells cDNA,
            RIKEN full-length enriched library, clone:2410008O07
            product:WD repeat protein BIG-3 mRNA, full insert
            sequence.>gb:AX405754_1467682 Sequence 169 from Patent
            WO0222660.>gb:AK000552_1907995 Homo sapiens cDNA FLJ20545
            fis, clone KAT11476.>gb:BC001635_1967731 Homo sapiens WD
            repeat domain 5, transcript variant 1, mRNA (cDNA clone
            MGC:1025 IMAGE:3538255), complete
            cds.>gb:BX649632_1991884 Human DNA sequence from clone
            LL09NC01-251B2 on chromosome 9, complete
            sequence.>gb:AF416510_2065338 Mus musculus WD repeat
            protein BIG-3 mRNA, complete cds.>gb:BC016103_2092180 Mus
            musculus WD repeat domain 5, mRNA (cDNA clone MGC:27687
            IMAGE:4919781), complete cds.>gb:BC025801_2095138 Mus
            musculus WD repeat domain 5, mRNA (cDNA clone MGC:36316
            IMAGE:5132525), complete cds.
          Length = 334

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 68/229 (29%), Positives = 116/229 (50%), Gaps = 3/229 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ---S 731
            N  +  TL+GH   VS+ ++ PN +  L +SS DK   +W          + G+++   S
Sbjct: 34   NYALKFTLAGHTKAVSSVKFSPNGE-WLASSSADKLIKIW--------GAYDGKFEKTIS 84

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   +S V+ S S++N+ VS S D T  +WD   + + ++T  GH   V    F P  N
Sbjct: 85   GHKLGISDVAWS-SDSNLLVSASDDKTLKIWDVS-SGKCLKTLKGHSNYVFCCNFNPQSN 142

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +GS D + R++D++TG  L+     HSD     V+++ F+  G L+ +   +G C +
Sbjct: 143  LIVSGSFDESVRIWDVKTGKCLKTLPA-HSDP----VSAVHFNRDGSLIVSSSYDGLCRI 197

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 198  WDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 243



 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 65/276 (23%), Positives = 122/276 (44%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  + +W A   +    I      +   A+S    
Sbjct: 41   LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN 100

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    I++++       +    +TL GH  YV  C + P  +  +++ S D++
Sbjct: 101  LLVSASDDKTLKIWDVS-------SGKCLKTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 152

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 153  VRIWDVKTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 203

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 204  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYC 261

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 262  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL 297



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 62/240 (25%), Positives = 106/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ + N +VSAS D  L +W+  + +    +K    +V  C F+P 
Sbjct: 81   KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ 140

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 141  SNLIVSGSFDESVRIWDVK-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 191

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD  
Sbjct: 192  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 244

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               + ++T+ GH+ +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 245  -KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL-QGHTD 302



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 121 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 180

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 181 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 233

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 234 LDNTLKLWDYSKGKCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 289

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 290 TKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



>sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5
            (Transcription initiation factor TFIID 100 kDa subunit)
            (TAF(II)100) (TAFII-100) (TAFII100).>gb:HSU80191_2026400
            Human TFIID subunit TAFII100 mRNA, complete cds.
          Length = 800

 Score = 97.1 bits (240), Expect = 8e-19
 Identities = 72/219 (32%), Positives = 103/219 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            + L GH G V    + P+ + +L++SS D T  LW + T   T + G     GH   V  
Sbjct: 537  KILYGHSGPVYGASFSPDRN-YLLSSSEDGTVRLWSLQTF--TCLVG---YKGHNYPVWD 590

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
               S      FVSG  D  A LW T    + +R F GH  DV   +F P+ N   TGS D
Sbjct: 591  TQFSPYGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVNCTRFHPNSNYVATGSAD 648

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RL+D+  G+ +++++          + S+ FS +GR L  G T+G   +WD     M
Sbjct: 649  RTVRLWDVLNGNCVRIFT-----GHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLM 703

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            V  L      H   +  L  S DG  L +GS D T+++W
Sbjct: 704  VGEL----KGHTDTVCSLRFSRDGEILASGSMDNTVRLW 738



 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 63/216 (29%), Positives = 100/216 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY   ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 539  LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY 598

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  ++ PN + ++ T S D+T
Sbjct: 599  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVNCTRFHPNSN-YVATGSADRT 650

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     +G+ D    LWD       
Sbjct: 651  VRLWDVLNGNCVRIF-----TGHKGPIHSLTFS-PNGRFLATGATDGRVLLWDIG-HGLM 703

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            V    GH   V +++F  DG    +GS D T RL+D
Sbjct: 704  VGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD 739



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 1/202 (0%)
 Frame = +3

Query: 630  EDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            +D+ LI     D T  +W +T     SV                   AS+ ++    S D
Sbjct: 480  DDSSLIAGGFADSTVRVWSVTPKKLRSVK-----------------QASDLSLIDKESDD 522

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
                + D + AS  ++  +GH G V    F PD N   + S+DGT RL+ ++T   L  Y
Sbjct: 523  VLERIMDEKTASE-LKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGY 581

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                     + V    FS  G    +G  +    +W T   + +     +   H   ++C
Sbjct: 582  K-----GHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPL----RIFAGHLADVNC 632

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 + + + TGS D T+++W
Sbjct: 633  TRFHPNSNYVATGSADRTVRLW 654



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 20/79 (25%), Positives = 40/79 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + + + DGR+++W+         +K     V +  FS
Sbjct: 661 CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS 720

Query: 477 PTGQSVACGGLDSVCSIFN 533
             G+ +A G +D+   +++
Sbjct: 721 RDGEILASGSMDNTVRLWD 739



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + +  FSP 
Sbjct: 621 RIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN 680

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH   V + ++  + D  ++ S S 
Sbjct: 681 GRFLATGATDGRVLLWDI-------GHGLMVGELKGHTDTVCSLRF--SRDGEILASGSM 731

Query: 660 DKTCGLWD 683
           D T  LWD
Sbjct: 732 DNTVRLWD 739



>gb:AE012949_287446 Chlorobium tepidum TLS section 170 of 194 of the
            complete genome.>gb:AE006470_934614 Chlorobium tepidum
            TLS complete genome.
          Length = 329

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 72/317 (22%), Positives = 126/317 (39%), Gaps = 2/317 (0%)
 Frame = +3

Query: 288  DLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC 467
            D    + L GH  +V  + ++P+  ++VS S D ++ +W+  T    H +     WV   
Sbjct: 36   DAALIKTLVGHEDRVLGVRFSPDGKKLVSGSFDEKVKLWDVETGNAIHTMSGHTTWVKCV 95

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
             +SP G  VA G +DS   I+++                 GH   V    + P +   + 
Sbjct: 96   DYSPKGDKVASGSIDSTVRIWDV-------ATGQCLHVCKGHDTEVRMIAFSP-DGKTVA 147

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            + S D T   WD  TG            GH + +  ++ SA    +   G  +    +WD
Sbjct: 148  SCSRDTTIKFWDTETGNEVKTL-----FGHKSYIECIAFSADGKKLVSCGE-EPVVKIWD 201

Query: 828  TRVASRAVRTFHGHEGDVIA--VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
                       +   GD ++  V F PDG++      D   ++ D  TG  L+V  + H 
Sbjct: 202  LETGKNIA---NYPTGDTLSHFVSFSPDGSQIALCGRDAKVKVLDAATGQMLKVL-EGHE 257

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSG 1181
            D     V ++ ++ +G L+ +   +    +WD     +V         H   +  +  S 
Sbjct: 258  DG----VRALCYNPAGTLIASAANDESVRLWDVAKGALV----HTYRGHTHEVQSVAFSP 309

Query: 1182 DGSALCTGSWDTTLKIW 1232
            DG  + +GS D  +K+W
Sbjct: 310  DGKVIASGSDDFKIKLW 326



 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 64/255 (25%), Positives = 107/255 (41%), Gaps = 38/255 (14%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
           + GHT  V  +D++P+ +++ S S D  + +W+  T Q  H  K     V   AFSP G+
Sbjct: 85  MSGHTTWVKCVDYSPKGDKVASGSIDSTVRIWDVATGQCLHVCKGHDTEVRMIAFSPDGK 144

Query: 489 SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK- 665
           +VA    D+    ++        GN    +TL GHK Y+    +  + D   + S G++ 
Sbjct: 145 TVASCSRDTTIKFWDTET-----GNEV--KTLFGHKSYIECIAF--SADGKKLVSCGEEP 195

Query: 666 TCGLWDITTGLRTSVFG-GEYQS------------------------------------G 734
              +WD+ TG   + +  G+  S                                    G
Sbjct: 196 VVKIWDLETGKNIANYPTGDTLSHFVSFSPDGSQIALCGRDAKVKVLDAATGQMLKVLEG 255

Query: 735 HTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNR 914
           H   V ++  + + T +  S + D +  LWD    +  V T+ GH  +V +V F PDG  
Sbjct: 256 HEDGVRALCYNPAGT-LIASAANDESVRLWDVAKGA-LVHTYRGHTHEVQSVAFSPDGKV 313

Query: 915 FGTGSDDGTCRLFDI 959
             +GSDD   +L+ +
Sbjct: 314 IASGSDDFKIKLWGV 328



>gb:AJ720488_2502675 Gallus gallus mRNA for hypothetical protein,
            clone 18o16.
          Length = 334

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 69/239 (28%), Positives = 118/239 (49%), Gaps = 3/239 (1%)
 Frame = +3

Query: 531  NLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSV 710
            N + P     N  +  TL+GH   VS+ ++ PN +  L +SS DK   +W          
Sbjct: 24   NQSKPAPVKPNYALKFTLAGHTKAVSSVKFSPNGE-WLASSSADKLIKIW--------GA 74

Query: 711  FGGEYQ---SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDV 881
            + G+++   SGH   +S V+ S S++N+ VS S D T  +WD   + + ++   GH   V
Sbjct: 75   YDGKFEKTISGHKLGISDVAWS-SDSNLLVSASDDKTLKIWDVS-SGKCLKALKGHSNYV 132

Query: 882  IAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLF 1061
                F P  N   +GS D + R++D++TG  L+     HSD     V+++ F+  G L+ 
Sbjct: 133  FCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPA-HSDP----VSAVHFNRDGSLIV 187

Query: 1062 AGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            +   +G C +WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 188  SSSYDGLCRIWDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 243



 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 64/276 (23%), Positives = 121/276 (43%), Gaps = 3/276 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V S+ ++P    + S+S D  + +W A   +    I      +   A+S    
Sbjct: 41   LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN 100

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    I++++       +    + L GH  YV  C + P  +  +++ S D++
Sbjct: 101  LLVSASDDKTLKIWDVS-------SGKCLKALKGHSNYVFCCNFNPQSNL-IVSGSFDES 152

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +WD+ TG  L+T          H+  VS+V  +    ++ VS S D    +WDT  + 
Sbjct: 153  VRIWDVKTGKCLKT-------LPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASG 203

Query: 843  RAVRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
            + ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + 
Sbjct: 204  QCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYC 261

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
            + +      G+ + +G  +   Y+W+    ++V  L
Sbjct: 262  IFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL 297



 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 63/240 (26%), Positives = 107/240 (44%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ + N +VSAS D  L +W+  + +   A+K    +V  C F+P 
Sbjct: 81   KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKALKGHSNYVFCCNFNPQ 140

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             +TL  H   VSA  +  N D  LI SS  
Sbjct: 141  SNLIVSGSFDESVRIWDVK-------TGKCLKTLPAHSDPVSAVHF--NRDGSLIVSSSY 191

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD  
Sbjct: 192  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 244

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               + ++T+ GH+ +   I   F   G ++  +GS+D    +++++T   +Q   Q H+D
Sbjct: 245  -KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKL-QGHTD 302



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 121 CLKALKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 180

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 181 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 233

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 234 LDNTLKLWDYSKGKCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 289

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
               V+   GH   VI+    P  N   + +  +D T +L+
Sbjct: 290 TKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



>sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5
            (Transcription initiation factor TFIID 100 kDa subunit)
            (TAF(II)100) (TAFII-100) (TAFII100).>gb:AK031985_1162681
            Mus musculus adult male medulla oblongata cDNA, RIKEN
            full-length enriched library, clone:6330528C20
            product:TRANSCRIPTION INITIATION FACTOR TFIID 100 KDA
            SUBUNIT (TAFII-100) (TAFII100) homolog [Homo sapiens],
            full insert sequence.
          Length = 801

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 71/219 (32%), Positives = 103/219 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            + L GH G V    + P+ + +L++SS D T  LW + T   T + G     GH   V  
Sbjct: 538  KILYGHSGPVYGASFSPDRN-YLLSSSEDGTVRLWSLQTF--TCLVG---YKGHNYPVWD 591

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
               S      FVSG  D  A LW T    + +R F GH  DV   ++ P+ N   TGS D
Sbjct: 592  TQFSPYGY-YFVSGGHDRVARLWATD-HYQPLRIFAGHLADVNCTRYHPNSNYVATGSAD 649

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T RL+D+  G+ +++++          + S+ FS +GR L  G T+G   +WD     M
Sbjct: 650  RTVRLWDVLNGNCVRIFT-----GHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLM 704

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            V  L      H   +  L  S DG  L +GS D T+++W
Sbjct: 705  VGEL----KGHTDTVCSLRFSRDGEILASGSMDNTVRLW 739



 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 64/216 (29%), Positives = 100/216 (46%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+G VY   ++P++N ++S+S+DG + +W+  T       K     V    FSP G 
Sbjct: 540  LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY 599

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                GG D V  ++  +       +    R  +GH   V+  +Y PN + ++ T S D+T
Sbjct: 600  YFVSGGHDRVARLWATD-------HYQPLRIFAGHLADVNCTRYHPNSN-YVATGSADRT 651

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+  G    +F     +GH   + S++ S  N     +G+ D    LWD       
Sbjct: 652  VRLWDVLNGNCVRIF-----TGHKGPIHSLTFS-PNGRFLATGATDGRVLLWDIG-HGLM 704

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
            V    GH   V +++F  DG    +GS D T RL+D
Sbjct: 705  VGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD 740



 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 48/202 (23%), Positives = 80/202 (39%), Gaps = 1/202 (0%)
 Frame = +3

Query: 630  EDAHLITSS-GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            +D+ LI     D T  +W +T     SV                   AS+ ++    S D
Sbjct: 481  DDSSLIAGGFADSTVRVWSVTPKKLRSVK-----------------QASDLSLIDKESDD 523

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
                + D + AS  ++  +GH G V    F PD N   + S+DGT RL+ ++T   L  Y
Sbjct: 524  VLERIMDEKTASE-LKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGY 582

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                     + V    FS  G    +G  +    +W T   + +     +   H   ++C
Sbjct: 583  K-----GHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPL----RIFAGHLADVNC 633

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
                 + + + TGS D T+++W
Sbjct: 634  TRYHPNSNYVATGSADRTVRLW 655



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 20/79 (25%), Positives = 40/79 (50%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH G ++SL ++P    + + + DGR+++W+         +K     V +  FS
Sbjct: 662 CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS 721

Query: 477 PTGQSVACGGLDSVCSIFN 533
             G+ +A G +D+   +++
Sbjct: 722 RDGEILASGSMDNTVRLWD 740



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 30/128 (23%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R   GH   V    + P  N + + S D  + +W+ L              + +  FSP 
Sbjct: 622 RIFAGHLADVNCTRYHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN 681

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SG 659
           G+ +A G  D    ++++       G+  +   L GH   V + ++  + D  ++ S S 
Sbjct: 682 GRFLATGATDGRVLLWDI-------GHGLMVGELKGHTDTVCSLRF--SRDGEILASGSM 732

Query: 660 DKTCGLWD 683
           D T  LWD
Sbjct: 733 DNTVRLWD 740



>gb:BA000012_667578 Mesorhizobium loti MAFF303099 DNA, complete
            genome.
          Length = 586

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 79/288 (27%), Positives = 125/288 (43%), Gaps = 36/288 (12%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH   V  L   P+   I+SAS D  + +W+    Q    + +      T  + P G S 
Sbjct: 289  GHRDAVVWLAVAPDGRSIMSASTDRVIKLWDIGGKQLIRNLGVHKDMARTALYMPDGVSA 348

Query: 495  ACGGLD-----------SVCSIFN---------LNLPPDNDG----------------NS 566
              GG D           +V  +F          L + PD                   N+
Sbjct: 349  LTGGDDGEIVLRKLADGAVLHVFQAGQNGGVNKLAISPDGKRAVSGHDTGNVIVWDLVNN 408

Query: 567  TVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTAD 746
            +V   L+GH   +SA    P +    ++ S D T  LWDI +G +   + G  Q  + A 
Sbjct: 409  SVLHVLTGHDWSISAVAVSP-DGKQALSGSIDGTLKLWDIESGKQLRSWHGHEQGTYGA- 466

Query: 747  VSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTG 926
                 +  ++ +  ++GS D T  +WD   + R V+ F GHEG V A+    DG R  +G
Sbjct: 467  -----VFTADAHRLITGSGDLTIKVWDLD-SGREVKRFEGHEGTVYALALSADGKRLLSG 520

Query: 927  SDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGY 1070
            S DGT RL+D+ TG+Q+ ++     D++   + ++AF+  G +L  GY
Sbjct: 521  SLDGTARLWDMETGNQIALF-----DSQTGPIYAVAFAPDGTVLTGGY 563



 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 71/259 (27%), Positives = 108/259 (41%)
 Frame = +3

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED 635
            V+  A +P G+S+     D V  ++++       G   + R L  HK       Y+P + 
Sbjct: 294  VVWLAVAPDGRSIMSASTDRVIKLWDI-------GGKQLIRNLGVHKDMARTALYMP-DG 345

Query: 636  AHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTA 815
               +T   D    L  +  G    VF    Q+G    V+ ++IS       VSG      
Sbjct: 346  VSALTGGDDGEIVLRKLADGAVLHVF----QAGQNGGVNKLAISPDGKRA-VSGHDTGNV 400

Query: 816  CLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQP 995
             +WD  V +  +    GH+  + AV   PDG +  +GS DGT +L+DI +G QL+ +   
Sbjct: 401  IVWDL-VNNSVLHVLTGHDWSISAVAVSPDGKQALSGSIDGTLKLWDIESGKQLRSW-HG 458

Query: 996  HSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGL 1175
            H       V    F+     L  G  +    VWD    + V         H+G +  L L
Sbjct: 459  HEQGTYGAV----FTADAHRLITGSGDLTIKVWDLDSGREVKRF----EGHEGTVYALAL 510

Query: 1176 SGDGSALCTGSWDTTLKIW 1232
            S DG  L +GS D T ++W
Sbjct: 511  SADGKRLLSGSLDGTARLW 529



 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 50/175 (28%), Positives = 78/175 (44%)
 Frame = +3

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   V  ++++    ++ +S S D    LWD     + +R    H+       + PDG 
Sbjct: 289  GHRDAVVWLAVAPDGRSI-MSASTDRVIKLWDIG-GKQLIRNLGVHKDMARTALYMPDGV 346

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               TG DDG   L  +  G  L V+    +      V  +A S  G+   +G+  G+  V
Sbjct: 347  SALTGGDDGEIVLRKLADGAVLHVFQAGQNGG----VNKLAISPDGKRAVSGHDTGNVIV 402

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            WD L+   VL++      HD  IS + +S DG    +GS D TLK+W     +Q+
Sbjct: 403  WD-LVNNSVLHV---LTGHDWSISAVAVSPDGKQALSGSIDGTLKLWDIESGKQL 453



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 55/225 (24%), Positives = 89/225 (39%), Gaps = 2/225 (0%)
 Frame = +3

Query: 588  GHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSIS 767
            GH+  V      P +   ++++S D+   LWDI         G       TA      +S
Sbjct: 289  GHRDAVVWLAVAP-DGRSIMSASTDRVIKLWDIGGKQLIRNLGVHKDMARTALYMPDGVS 347

Query: 768  ASNTNMFVSGSCDTTACLWDTRVASRAV-RTFH-GHEGDVIAVKFFPDGNRFGTGSDDGT 941
            A      ++G  D    L   ++A  AV   F  G  G V  +   PDG R  +G D G 
Sbjct: 348  A------LTGGDDGEIVL--RKLADGAVLHVFQAGQNGGVNKLAISPDGKRAVSGHDTGN 399

Query: 942  CRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVL 1121
              ++D+     L V +          ++++A S  G+   +G  +G   +WD    K + 
Sbjct: 400  VIVWDLVNNSVLHVLT-----GHDWSISAVAVSPDGKQALSGSIDGTLKLWDIESGKQLR 454

Query: 1122 NLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            +    +    G +     + D   L TGS D T+K+W     R+V
Sbjct: 455  SWHGHEQGTYGAV----FTADAHRLITGSGDLTIKVWDLDSGREV 495



>gb:AB007645_1510148 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K8K14.>gb:AY057698_1564110 Arabidopsis thaliana
            AT5g67320/K8K14_4 mRNA, complete cds.>gb:AY143932_1583389
            Arabidopsis thaliana At5g67320/K8K14_4 mRNA, complete
            cds.
          Length = 613

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 89/345 (25%), Positives = 153/345 (44%), Gaps = 34/345 (9%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN--------ALTSQKTHAIKLPCAW- 455
            R L+GHT +V +  W+P  + + S S D    +W+          T +  +A+ L  A  
Sbjct: 259  RILEGHTSEVCACAWSPSASLLASGSGDATARIWSIPEGSFKAVHTGRNINALILKHAKG 318

Query: 456  --------VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA 611
                    V T  ++  G  +A G  D    I+ LN          +  TLS HKG + +
Sbjct: 319  KSNEKSKDVTTLDWNGEGTLLATGSCDGQARIWTLN--------GELISTLSKHKGPIFS 370

Query: 612  CQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADV---SSVSISASNTN 782
             ++    D +L+T S D+T  +WD+        F  E+ SG T DV   ++VS + S+T+
Sbjct: 371  LKWNKKGD-YLLTGSVDRTAVVWDVKAEEWKQQF--EFHSGPTLDVDWRNNVSFATSSTD 427

Query: 783  MFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
              +         + +TR A    +TF GH+G+V  VK+ P G+   + SDD T ++++I+
Sbjct: 428  SMIY-----LCKIGETRPA----KTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKIWNIK 478

Query: 963  TG--------HQLQVY------SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDT 1100
                      H  ++Y      + P ++N   ++T  + S    +           +WD 
Sbjct: 479  QSTFVHDLREHTKEIYTIRWSPTGPGTNNPNKQLTLASASFDSTV----------KLWDA 528

Query: 1101 LLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
             L KM+ +     N H   +  L  S +G  + +GS D ++ IW+
Sbjct: 529  ELGKMLCSF----NGHREPVYSLAFSPNGEYIASGSLDKSIHIWS 569



 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 54/235 (22%), Positives = 106/235 (45%), Gaps = 8/235 (3%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L  H G ++SL W  + + +++ S D   +VW+    +     +      +   +     
Sbjct: 361  LSKHKGPIFSLKWNKKGDYLLTGSVDRTAVVWDVKAEEWKQQFEFHSGPTLDVDWR-NNV 419

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            S A    DS+  +  +       G +  ++T +GH+G V+  ++ P     L + S D T
Sbjct: 420  SFATSSTDSMIYLCKI-------GETRPAKTFTGHQGEVNCVKWDPTGSL-LASCSDDST 471

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSIS-----ASNTNM---FVSGSCDTTACLW 824
              +W+I    + S F  + +  HT ++ ++  S      +N N      S S D+T  LW
Sbjct: 472  AKIWNI----KQSTFVHDLRE-HTKEIYTIRWSPTGPGTNNPNKQLTLASASFDSTVKLW 526

Query: 825  DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS 989
            D  +  + + +F+GH   V ++ F P+G    +GS D +  ++ I+ G  ++ Y+
Sbjct: 527  DAELG-KMLCSFNGHREPVYSLAFSPNGEYIASGSLDKSIHIWSIKEGKIVKTYT 580



 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 52/220 (23%), Positives = 82/220 (37%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +   GH G+V  + W P  + + S S D    +WN   S   H ++     + T  +SPT
Sbjct: 442 KTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKIWNIKQSTFVHDLREHTKEIYTIRWSPT 501

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN+   L ++S D
Sbjct: 502 G-------------------PGTNN----------------------PNKQLTLASASFD 520

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD   G     F     +GH   V S++ S  N     SGS D +  +W  +   
Sbjct: 521 STVKLWDAELGKMLCSF-----NGHREPVYSLAFS-PNGEYIASGSLDKSIHIWSIK-EG 573

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
           + V+T+ G+ G +  V +  +GN+      D +  + D R
Sbjct: 574 KIVKTYTGN-GGIFEVCWNKEGNKIAACFADNSVCVLDFR 612



>sp|P74442|Y143_SYNY3 Hypothetical WD-repeat protein
            slr0143.>pir|S76414|S76414 beta transducin-like protein,
            132K - Synechocystis sp.  (strain PCC
            6803)>gb:BA000022_689324 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 1191

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 86/311 (27%), Positives = 134/311 (43%), Gaps = 3/311 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH   V S+  +  KN I SAS+DG + +W     +           +    FSP G+
Sbjct: 556  LTGHRDGVTSVAISSHKNLIASASRDGTVHLWTP-QGEFLREFTGHTGSIYRVDFSPNGK 614

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
              A  G D    I++L      DGN  + +TL GH+  V +  + P+ +  L ++S D+T
Sbjct: 615  IFATAGQDQTVKIWDL------DGN--LLQTLKGHQDSVYSVSFSPDGEI-LASTSRDRT 665

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW   +G   +V G     GHT  V     S     + VS   D    LWD  +    
Sbjct: 666  VRLWHWRSGKTLAVLG-----GHTKSVDDAQFSPDGQTL-VSVCRDGQIRLWD--LDGNL 717

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            +R F   E     V + P+GN     +DDGT RL+  +   +++     H +     VT 
Sbjct: 718  IRQFGLPEVAFFGVNWHPNGNLLAVAADDGTVRLWTPQ--GEIKATLSGHDE----FVTR 771

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDG---RISCLGLSGDGSALC 1199
            + F+  G+ LF+  +NG    W T         G +   + G    I  L L+ +G+ L 
Sbjct: 772  VVFTPDGKQLFSSSSNGSVIHWST--------SGKMLKKYQGYPEAIFGLALASNGALLA 823

Query: 1200 TGSWDTTLKIW 1232
             G+ +  +K+W
Sbjct: 824  IGAENNLVKVW 834



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 70/280 (25%), Positives = 113/280 (40%), Gaps = 5/280 (1%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW----NALTSQKTHAIKLPCAWVMTCA 470
            R   GHTG +Y +D++P      +A QD  + +W    N L + K H        V + +
Sbjct: 595  REFTGHTGSIYRVDFSPNGKIFATAGQDQTVKIWDLDGNLLQTLKGHQDS-----VYSVS 649

Query: 471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT 650
            FSP G+ +A    D    +++         +      L GH   V   Q+ P+    L++
Sbjct: 650  FSPDGEILASTSRDRTVRLWHWR-------SGKTLAVLGGHTKSVDDAQFSPDGQT-LVS 701

Query: 651  SSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSIS-ASNTNMFVSGSCDTTACLWD 827
               D    LWD+   L    FG         +V+   ++   N N+    + D T  LW 
Sbjct: 702  VCRDGQIRLWDLDGNL-IRQFG-------LPEVAFFGVNWHPNGNLLAVAADDGTVRLWT 753

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
             +   +A  T  GH+  V  V F PDG +  + S +G+  +    +G  L+ Y       
Sbjct: 754  PQGEIKA--TLSGHDEFVTRVVFTPDGKQLFSSSSNGSV-IHWSTSGKMLKKY-----QG 805

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL 1127
                +  +A + +G LL  G  N    VWD      ++NL
Sbjct: 806  YPEAIFGLALASNGALLAIGAENNLVKVWDMSPKSDLVNL 845



>gb:CR380959_1653880 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 806

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 68/229 (29%), Positives = 104/229 (45%), Gaps = 6/229 (2%)
 Frame = +3

Query: 300  CRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN-----ALTSQKTHAIKLPCAWVMT 464
            C  L GH+G VYS  ++P+   +VS S+D  + +W+     AL + K H        V  
Sbjct: 526  CSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHP-----VWD 580

Query: 465  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL 644
              FSP G   A    D    ++  +       +    R  +GH   V    + PN   ++
Sbjct: 581  VKFSPLGHYFASASHDQTARLWACD-------HIYPLRIFAGHTNDVDTVSFHPN-GCYV 632

Query: 645  ITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW 824
             T S DKTC +WD++TG    +F      GHTA V S  +S        +GS D   CLW
Sbjct: 633  FTGSSDKTCRMWDVSTGDSVRLF-----LGHTAPVLSTQVSPDG-RWLATGSEDGVICLW 686

Query: 825  DTRVASRAVRTFHGH-EGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG 968
            D     R ++   GH +  V ++ F  +GN   +G  D + R++D++ G
Sbjct: 687  DIGTGKR-IKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHG 734



 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 76/265 (28%), Positives = 115/265 (43%), Gaps = 11/265 (4%)
 Frame = +3

Query: 471  FSPTGQSVACGGLDSVCSIFNLN----LPP-------DNDGNSTVSRTLSGHKGYVSACQ 617
            FS   +  A G  DS   I++L+    + P       D         TL GH G V +  
Sbjct: 481  FSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTS 540

Query: 618  YVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSG 797
            + P ++ +L++ S DKT  LW + T   T++       GH   V  V  S    + F S 
Sbjct: 541  FSP-DNMYLVSGSEDKTVKLWSMDT--HTALVN---YKGHNHPVWDVKFSPLG-HYFASA 593

Query: 798  SCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQL 977
            S D TA LW        +R F GH  DV  V F P+G    TGS D TCR++D+ TG  +
Sbjct: 594  SHDQTARLWACDHIY-PLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSV 652

Query: 978  QVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            +++           V S   S  GR L  G  +G   +WD    K    +  ++      
Sbjct: 653  RLFL-----GHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGK---RIKQMRGHGKNA 704

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            +  L  + +G+ L +G  D ++++W
Sbjct: 705  VHSLSFNKEGNVLISGGADHSVRVW 729



>gb:BA000045_742319 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1721

 Score = 93.6 bits (231), Expect = 9e-18
 Identities = 100/380 (26%), Positives = 149/380 (39%), Gaps = 68/380 (17%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL-TSQKTHAIKLPCAWVMTCAFSPTG 485
            L GH   + S+  +P+   I SAS D  + +WN+  TS KT  +    + V   ++SP G
Sbjct: 1097 LVGHKSWISSIAHSPDGKAIASASADKTVKIWNSNGTSFKT--LFTDTSDVRAVSYSPDG 1154

Query: 486  QSVACGGLDS------------------VCSIFNLNLPPDN--------DG-------NS 566
            + +A G L+                   V  I  L+  PD         DG       N 
Sbjct: 1155 RLIATGNLNGGLNLWLAEGKWLRFIPAHVQRITGLSFSPDGQKIVTSSYDGTIKVWRING 1214

Query: 567  TVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTAD 746
             + +TL+GH   V    + P +   + ++S DKT  +W      R      +   GHT  
Sbjct: 1215 KLIKTLTGHNDKVIDVAFSP-DGKWIASASADKTVKVW------RDDGILSKTLKGHTEQ 1267

Query: 747  VSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTG 926
            + SV+ S  N+ M  + S D T  LW  ++    +RT  GH   V  V F  DG  F TG
Sbjct: 1268 IESVTFSP-NSQMIATASVDKTVKLW--QLNGVLIRTVRGHTDGVYDVVFSQDGQTFATG 1324

Query: 927  SDDGTCRLFD-----IRT--GHQLQVYSQPHSDNEVHRVT-------------------- 1025
            S D T  L+      IRT  GH   V S     ++   VT                    
Sbjct: 1325 SSDRTIMLWHVDGTLIRTLRGHSASVNSLSFGRSDRTLVTGGDDSNLRIWKLSNFNTSFQ 1384

Query: 1026 -------SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGD 1184
                   SIA     + L AG ++G   +W     ++    G ++  HD     + +S D
Sbjct: 1385 AFENPVRSIALGPQEQFLIAGGSDGTIKIWGNNGRQISTLRGHIRTVHD-----ISISPD 1439

Query: 1185 GSALCTGSWDTTLKIWAFGG 1244
               + +  WD T+K+W   G
Sbjct: 1440 KKMIASAGWDKTIKLWHTSG 1459



 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 73/322 (22%), Positives = 131/322 (40%)
 Frame = +3

Query: 288  DLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTC 467
            D +  + L+GHT ++ S+ ++P    I +AS D  + +W  L       ++     V   
Sbjct: 1254 DGILSKTLKGHTEQIESVTFSPNSQMIATASVDKTVKLWQ-LNGVLIRTVRGHTDGVYDV 1312

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
             FS  GQ+ A G  D    ++++        + T+ RTL GH   V++  +    D  L+
Sbjct: 1313 VFSQDGQTFATGSSDRTIMLWHV--------DGTLIRTLRGHSASVNSLSF-GRSDRTLV 1363

Query: 648  TSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
            T   D    +W      + S F   +Q+     V S+++        ++G  D T  +W 
Sbjct: 1364 TGGDDSNLRIW------KLSNFNTSFQAFEN-PVRSIALGPQE-QFLIAGGSDGTIKIWG 1415

Query: 828  TRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDN 1007
                 R + T  GH   V  +   PD     +   D T +L+   T  +L    + HS  
Sbjct: 1416 NN--GRQISTLRGHIRTVHDISISPDKKMIASAGWDKTIKLW--HTSGELIQTLREHS-- 1469

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                V S+A S +G+ L +   + +  VW     K+ +  G     H   ++ +  +  G
Sbjct: 1470 --RPVFSVAISPNGQYLVSAGADKNIIVWKADGTKLRVLKG-----HSSEVNRVFFTASG 1522

Query: 1188 SALCTGSWDTTLKIWAFGGYRQ 1253
              + +G  D  L +W   G ++
Sbjct: 1523 QEIISGGADGKLILWNIDGSKK 1544



 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 86/343 (25%), Positives = 132/343 (38%), Gaps = 5/343 (1%)
 Frame = +3

Query: 231  DVATYARSQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNA 410
            D  T+A       I     D    R L+GH+  V SL +      +V+   D  L +W  
Sbjct: 1317 DGQTFATGSSDRTIMLWHVDGTLIRTLRGHSASVNSLSFGRSDRTLVTGGDDSNLRIWKL 1376

Query: 411  LT-SQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLS 587
               +    A + P   V + A  P  Q +  GG D    I+          N     TL 
Sbjct: 1377 SNFNTSFQAFENP---VRSIALGPQEQFLIAGGSDGTIKIWG--------NNGRQISTLR 1425

Query: 588  GHKGYVSACQYVPNEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSI 764
            GH   V      P  D  +I S+G DKT  LW  +  L  ++        H+  V SV+I
Sbjct: 1426 GHIRTVHDISISP--DKKMIASAGWDKTIKLWHTSGELIQTL------REHSRPVFSVAI 1477

Query: 765  SASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTC 944
            S  N    VS   D    +W  +     +R   GH  +V  V F   G    +G  DG  
Sbjct: 1478 S-PNGQYLVSAGADKNIIVW--KADGTKLRVLKGHSSEVNRVFFTASGQEIISGGADGKL 1534

Query: 945  RLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVW---DTLLAKM 1115
             L++I    +  +  + +S      + S++ S  GR++  G  +G   +W     LL + 
Sbjct: 1535 ILWNIDGSKKRTIEDRGNS------LRSLSISPDGRIIAVGSVDGHFKLWHKDGRLLWQT 1588

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
            V        +H+  I  +  S DG+ + T +    +K+W   G
Sbjct: 1589 V--------AHETEIRSIAYSPDGALIATAA-GNDIKLWKPNG 1622



>gb:CNS07EGR_2569984 BAC A of library A from Tetraodon nigroviridis,
            T-cell receptor alpha delta locus (germline).
          Length = 1076

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 88/325 (27%), Positives = 137/325 (42%), Gaps = 8/325 (2%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGKV----YSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            P + V  + ++  T KV    + + WTPE  R+V+ +  G   +WN LT      ++   
Sbjct: 102  PMNAVTTKFVRTSTNKVKCPVFVIRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHD 161

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
            + V    +S     +           +  N+      N+   +    HK  +    + P 
Sbjct: 162  SPVRAMTWSHNDMWMLTADHGGYVKYWQSNM------NNV--KMFQAHKEAIREASFSPT 213

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             D    T S D T  +WD        +       GH ADV  V    +   + VSGS D+
Sbjct: 214  -DNKFATCSDDGTVRIWDFLRCHEERIL-----RGHGADVKCVDWHPTK-GLVVSGSKDS 266

Query: 810  TACL--WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-GHQLQ 980
               +  WD +   +++ T H H+  V+ VK+  +GN   T S D  C+LFDIR    +LQ
Sbjct: 267  QQPIKFWDPKTG-QSLATLHAHKNTVMEVKWNLNGNWLLTASRDHLCKLFDIRNLKEELQ 325

Query: 981  VYSQPHSDNEVHRVTSIAFSISGRLLFA-GYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            V+            T++A+      LFA G ++G    W T + K V   G ++ +H+G 
Sbjct: 326  VFR-----GHKKEATAVAWHPVHEGLFASGGSDGSLLFWHTGVEKEV---GGMEMAHEGM 377

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            I  L     G  LC+GS D T K W
Sbjct: 378  IWSLAWHPLGHILCSGSNDHTSKFW 402



>gb:AE014297_1141988 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003770_1223981 Drosophila melanogaster
            chromosome 3R, section 108 of 118 of the complete
            sequence.
          Length = 436

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 80/295 (27%), Positives = 133/295 (45%), Gaps = 4/295 (1%)
 Frame = +3

Query: 360  NRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT-GQSVACGGLDSVCSIFNL 536
            ++IV+ S DG   VW+A + Q         A ++   F P  G+S+A   LD    I+++
Sbjct: 164  DKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDV 223

Query: 537  NLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAH-LITSSGDKTCGLWDITTGLRTSVF 713
                     S   + L+ H   V A ++  N D   L+T S D +  +WD+    R+   
Sbjct: 224  E-------TSHELQQLTHHGAEVIAARF--NRDGQMLLTGSFDHSAAIWDV----RSKSL 270

Query: 714  GGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVK 893
            G + + GH+A++S+   + S + +  +GS D TA +WDTR   + +     H  +V+ V 
Sbjct: 271  GHQLR-GHSAELSNCVWNFSGS-LIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVS 328

Query: 894  FFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS--QPHSDNEVHRVTSIAFSISGRLLFAG 1067
            F   G    T S D T R++ +    +L++ S    HSD     V+ + FS SG +L   
Sbjct: 329  FDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDE----VSKVCFSPSGCMLLTA 384

Query: 1068 YTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              +    +W T   +    L      H+G +     S  G A+ T S D + + W
Sbjct: 385  SADNTARLWLTESGQCSQVLAG----HEGEVFSCAYSYAGDAILTASKDNSCRFW 435



 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 57/214 (26%), Positives = 98/214 (45%), Gaps = 18/214 (8%)
 Frame = +3

Query: 645  ITSSGDKTCGLWDITTGLRTSVFGGE-----------------YQSGHTADVSSVSISAS 773
            +T S D+TC + +  T     +  G                   QSG + + +  + S  
Sbjct: 103  LTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGGSGN-NLTTFSII 161

Query: 774  NTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFP-DGNRFGTGSDDGTCRL 950
             ++  V+GS D TA +W    + +++ TF+GH  +++A +F P DG    T S DG+ R+
Sbjct: 162  FSDKIVTGSFDGTAKVWSA-TSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARI 220

Query: 951  FDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLG 1130
            +D+ T H+LQ  +   ++     V +  F+  G++L  G  +    +WD        +LG
Sbjct: 221  YDVETSHELQQLTHHGAE-----VIAARFNRDGQMLLTGSFDHSAAIWDV----RSKSLG 271

Query: 1131 SLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                 H   +S    +  GS + TGS D T +IW
Sbjct: 272  HQLRGHSAELSNCVWNFSGSLIATGSLDNTARIW 305



 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 69/264 (26%), Positives = 114/264 (43%), Gaps = 4/264 (1%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNR-IVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
            GHT ++ + ++ P   + I +AS DG   +++  TS +   +    A V+   F+  GQ 
Sbjct: 191  GHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQM 250

Query: 492  VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TSSGDKT 668
            +  G  D   +I+++        + ++   L GH   +S C +  N    LI T S D T
Sbjct: 251  LLTGSFDHSAAIWDVR-------SKSLGHQLRGHSAELSNCVW--NFSGSLIATGSLDNT 301

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              +WD T  L   ++     + H+ +V  VS  A+   +  + S D TA +W    +S  
Sbjct: 302  ARIWD-TRKLDQELY---LAARHSDEVLDVSFDAAG-QLLATCSSDCTARVWRLEGSSEL 356

Query: 849  --VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
              +    GH  +V  V F P G    T S D T RL+   +G   QV +    +     V
Sbjct: 357  EMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGE-----V 411

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVW 1094
             S A+S +G  +     +  C  W
Sbjct: 412  FSCAYSYAGDAILTASKDNSCRFW 435



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 38/173 (21%), Positives = 72/173 (41%), Gaps = 1/173 (0%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNA-LTSQKTHAIKLPCAWVMTCAFSPTG 485
           L+GH+ ++ +  W    + I + S D    +W+     Q+ +        V+  +F   G
Sbjct: 274 LRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAG 333

Query: 486 QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
           Q +A    D    ++ L    +      +   ++GH   VS   + P+    L+T+S D 
Sbjct: 334 QLLATCSSDCTARVWRL----EGSSELEMLSLMAGHSDEVSKVCFSPS-GCMLLTASADN 388

Query: 666 TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW 824
           T  LW   +G  + V      +GH  +V S + S +  +  ++ S D +   W
Sbjct: 389 TARLWLTESGQCSQVL-----AGHEGEVFSCAYSYAG-DAILTASKDNSCRFW 435



>gb:AE014297_1138047 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1138048 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE003602_1217435
            Drosophila melanogaster chromosome 3R, section 6 of 118
            of the complete sequence.>gb:AE003602_1217436 Drosophila
            melanogaster chromosome 3R, section 6 of 118 of the
            complete sequence.>gb:AY051695_1290289 Drosophila
            melanogaster LD24014 full length cDNA.
          Length = 807

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 85/325 (26%), Positives = 138/325 (42%), Gaps = 8/325 (2%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGK----VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            P++ V  R ++  T K    +++L WTPE  R+V+ +  G   +WN LT      ++   
Sbjct: 129  PSNAVTTRFVKTATNKMRCPIFTLAWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHD 188

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
              V T  +S     +  G        +  N+      N+   +    HK  +    + P 
Sbjct: 189  ISVRTMVWSHNDSWMVTGDHGGYVKYWQSNM------NNV--KMYQAHKEAIRGISFSPT 240

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             D+  ++ S D T  +WD        V       GH ADV  V        M VSGS D 
Sbjct: 241  -DSKFVSGSDDGTLRIWDFMRCQEERVL-----RGHGADVKCVHWHPQK-GMIVSGSKDN 293

Query: 810  --TACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-GHQLQ 980
                 +WD + +  A+ T H H+  V+ +K+  +GN   T S D   +LFDIR    ++Q
Sbjct: 294  QQPIKIWDPK-SGIALATLHAHKSTVMDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQ 352

Query: 981  VYSQPHSDNEVHRVTSIAF-SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            V+            +S+++  I   L  +G ++G    W+    K    +G ++ +HD  
Sbjct: 353  VFR-----GHKKEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDK---EIGCVETAHDSI 404

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            +  L     G  LC+GS D T+K W
Sbjct: 405  VWTLAWHPLGHILCSGSNDHTIKFW 429



>gb:BC056820_2552003 Danio rerio TAF5-like RNA polymerase II,
            p300/CBP-associated factor (PCAF)-associated factor, mRNA
            (cDNA clone MGC:63765 IMAGE:2641473), complete cds.
          Length = 601

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 68/230 (29%), Positives = 106/230 (46%), Gaps = 2/230 (0%)
 Frame = +3

Query: 549  DNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ 728
            D D + +  +TL GH G V    ++ +    L++ S D T   WD+ +   T ++ G   
Sbjct: 339  DEDASGSEIKTLRGHSGPVYRTAFLTDASG-LLSCSEDSTVRYWDLKSFTNTVLYRGHAY 397

Query: 729  SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDG 908
                 DVS  S+       F + S D TA LW     +  +R + GH  DV  VKF P+ 
Sbjct: 398  PVWDVDVSPCSL------YFSTASHDRTARLWSF-ARTYPLRLYAGHLSDVDCVKFHPNS 450

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR--VTSIAFSISGRLLFAGYTNGD 1082
            N   TGS D T RL+  R G  +++++        HR  V ++AFS +G+ L +   +  
Sbjct: 451  NYIATGSTDKTVRLWSTRQGASVRLFTG-------HRGPVLTLAFSPNGKYLASAGEDQR 503

Query: 1083 CYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              +WD     +  +L      H   IS L  S D S + + S D T+++W
Sbjct: 504  LKLWDLASGGLFKDL----RGHTDTISSLSFSQDSSLVASASMDNTVRVW 549



 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 51/223 (22%), Positives = 92/223 (41%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           + L+GH+G VY   +  + + ++S S+D  +  W+  +   T   +     V     SP 
Sbjct: 348 KTLRGHSGPVYRTAFLTDASGLLSCSEDSTVRYWDLKSFTNTVLYRGHAYPVWDVDVSPC 407

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
               +    D    +++          +   R  +GH   V   ++ PN + ++ T S D
Sbjct: 408 SLYFSTASHDRTARLWSF-------ARTYPLRLYAGHLSDVDCVKFHPNSN-YIATGSTD 459

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
           KT  LW    G    +F     +GH   V +++ S +   +  +G  D    LWD   + 
Sbjct: 460 KTVRLWSTRQGASVRLF-----TGHRGPVLTLAFSPNGKYLASAGE-DQRLKLWDL-ASG 512

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGH 971
              +   GH   + ++ F  D +   + S D T R++DIR  H
Sbjct: 513 GLFKDLRGHTDTISSLSFSQDSSLVASASMDNTVRVWDIRNAH 555



>gb:AY463620_1607709 Arabidopsis thaliana TAF5 (At5g25150) mRNA,
            complete cds.
          Length = 669

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 68/217 (31%), Positives = 101/217 (46%)
 Frame = +3

Query: 582  LSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVS 761
            L GH G V +  + P  D  +++SS D T  LW          +      GH   V    
Sbjct: 414  LLGHSGPVYSATFSPPGD-FVLSSSADTTIRLWSTKLNANLVCY-----KGHNYPVWDAQ 467

Query: 762  ISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGT 941
             S    + F S S D TA +W      + +R   GH  DV  V++ P+ N   TGS D T
Sbjct: 468  FSPFG-HYFASCSHDRTARIWSMD-RIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKT 525

Query: 942  CRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVL 1121
             RL+D++TG  ++++    S      V S+A S  GR + +G  +G   +WD   A+ + 
Sbjct: 526  VRLWDVQTGECVRIFIGHRS-----MVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCIT 580

Query: 1122 NLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             L      H+  +  L  SG+GS L +GS D T+K+W
Sbjct: 581  PL----MGHNSCVWSLSYSGEGSLLASGSADCTVKLW 613



 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 67/235 (28%), Positives = 107/235 (45%)
 Frame = +3

Query: 273  SFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCA 452
            S GP        L GH+G VYS  ++P  + ++S+S D  + +W+   +      K    
Sbjct: 402  SIGPNGRRSYTLLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNY 461

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
             V    FSP G   A    D    I++++            R ++GH   V   Q+ PN 
Sbjct: 462  PVWDAQFSPFGHYFASCSHDRTARIWSMD-------RIQPLRIMAGHLSDVDCVQWHPNC 514

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTT 812
            + ++ T S DKT  LWD+ TG    +F      GH + V S+++S     M  SG  D T
Sbjct: 515  N-YIATGSSDKTVRLWDVQTGECVRIF-----IGHRSMVLSLAMSPDGRYM-ASGDEDGT 567

Query: 813  ACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQL 977
              +WD   A R +    GH   V ++ +  +G+   +GS D T +L+D+ +  +L
Sbjct: 568  IMMWDLSTA-RCITPLMGHNSCVWSLSYSGEGSLLASGSADCTVKLWDVTSSTKL 621



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 6/102 (5%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C R   GH   V SL  +P+   + S  +DG +++W+  T++    +    + V + ++S
Sbjct: 536 CVRIFIGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLSYS 595

Query: 477 PTGQSVACGGLD------SVCSIFNLNLPPDNDGNSTVSRTL 584
             G  +A G  D       V S   L    + +GNS   R+L
Sbjct: 596 GEGSLLASGSADCTVKLWDVTSSTKLTKAEEKNGNSNRLRSL 637



>gb:AK009247_1155025 Mus musculus adult male tongue cDNA, RIKEN
            full-length enriched library, clone:2310009C03
            product:hypothetical Trp-Asp repeat (WD-repeat) structure
            containing protein, full insert
            sequence.>gb:BC064045_2105298 Mus musculus WD repeat
            domain 5B, mRNA (cDNA clone MGC:73550 IMAGE:1245342),
            complete cds.
          Length = 328

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 63/227 (27%), Positives = 119/227 (52%), Gaps = 1/227 (0%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTG-LRTSVFGGEYQSGH 737
            N  +  TL+GH   +S+ ++ PN +  L +S+ D    +W    G  + +++G      H
Sbjct: 28   NYALRLTLAGHSAAISSVKFSPNGE-WLASSAADALIIIWGAYDGNCKKTLYG------H 80

Query: 738  TADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRF 917
            + ++S V+ S S+++  VS S D T  +WD R + + ++T  GH   V    F P  N  
Sbjct: 81   SLEISDVAWS-SDSSRLVSASDDKTLKVWDMR-SGKCLKTLKGHSDFVFCCDFNPPSNLI 138

Query: 918  GTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWD 1097
             +GS D + ++++++TG  L+  S  HSD     ++++ F+ +G L+ +G  +G C +WD
Sbjct: 139  VSGSFDESVKIWEVKTGKCLKTLSA-HSDP----ISAVNFNCNGSLIVSGSYDGLCRIWD 193

Query: 1098 TLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
                +    L +L +  +  +S +  S +G  + T + D TLK+W +
Sbjct: 194  AASGQC---LRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDY 237



 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 73/316 (23%), Positives = 144/316 (45%), Gaps = 7/316 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+  + S+ ++P    + S++ D  +I+W A        +      +   A+S    
Sbjct: 35   LAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSS 94

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    ++++        +    +TL GH  +V  C + P  +  +++ S D++
Sbjct: 95   RLVSASDDKTLKVWDMR-------SGKCLKTLKGHSDFVFCCDFNPPSNL-IVSGSFDES 146

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +W++ TG  L+T        S H+  +S+V+ +  N ++ VSGS D    +WD   + 
Sbjct: 147  VKIWEVKTGKCLKT-------LSAHSDPISAVNFNC-NGSLIVSGSYDGLCRIWDA-ASG 197

Query: 843  RAVRTFHGHEGD--VIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
            + +RT    EG+  V  VKF P+G    T + D T +L+D   G  L+ Y+     NE +
Sbjct: 198  QCLRTL-ADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYT--GHKNEKY 254

Query: 1017 RVTSIAFSISGR-LLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
             + + +FS++GR  + +G  +   Y+W+    ++V  L      H   +         + 
Sbjct: 255  CLFA-SFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRL----QGHTDVVISAACHPTKNI 309

Query: 1194 LCTGSW--DTTLKIWA 1235
            + + +   D T+K+W+
Sbjct: 310  IASAALENDKTIKVWS 325



 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 66/250 (26%), Positives = 114/250 (45%), Gaps = 5/250 (2%)
 Frame = +3

Query: 270  ISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            I +G  D  C + L GH+ ++  + W+ + +R+VSAS D  L VW+  + +    +K   
Sbjct: 64   IIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHS 123

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
             +V  C F+P    +  G  D    I+ +             +TLS H   +SA  +  N
Sbjct: 124  DFVFCCDFNPPSNLIVSGSFDESVKIWEVK-------TGKCLKTLSAHSDPISAVNFNCN 176

Query: 630  EDAHLITSSGDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
              + +++ S D  C +WD  +G  LRT    G         VS V  S  N    ++ + 
Sbjct: 177  -GSLIVSGSYDGLCRIWDAASGQCLRTLADEG------NPPVSFVKFS-PNGKYILTATL 228

Query: 804  DTTACLWDTRVASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQ 974
            D T  LWD     R ++T+ GH+ +   +   F   G ++  +GS+D    +++++T   
Sbjct: 229  DNTLKLWDYS-RGRCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQTKEI 287

Query: 975  LQVYSQPHSD 1004
            +Q   Q H+D
Sbjct: 288  VQ-RLQGHTD 296



>gb:BA000045_740800 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1671

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 87/321 (27%), Positives = 138/321 (42%), Gaps = 7/321 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW----NALTSQKTHAIKLPCAWVMTCA 470
            R L GH  +V S+D++P+   + SAS DG + +W    N ++  K H        + + A
Sbjct: 1178 RTLMGHQDEVMSVDFSPDGQTLASASWDGTVRMWGIQGNLISILKEHK-----DGIWSVA 1232

Query: 471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT 650
            FSP GQ +A  G D    ++N+        +  +  TLS +     + ++ P + + L +
Sbjct: 1233 FSPDGQRLASAGQDKTLRLWNV--------HGQLLHTLSDNTTPFLSVRFSP-DGSILAS 1283

Query: 651  SSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDT 830
             S DKT  LW     L +S+       GHT  V+S+  SA    +  S S D T  LW  
Sbjct: 1284 GSVDKTVRLWSREGVLLSSL------HGHTGRVNSLDFSADG-RILASASDDKTLLLW-- 1334

Query: 831  RVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            R+    +  F GH   V  V F PD   F T   DGT  L+D R G        P +   
Sbjct: 1335 RLYGPPLTAFRGHGQWVSCVGFSPDSQAFATAGGDGTLDLWD-RQGRLENRVIPPAT--- 1390

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHD---GRISCLGLSG 1181
               + ++A+S  G ++ +G  +    +W           GS  +  D     ++ L  S 
Sbjct: 1391 ---IFALAYSPDGTIIASGGNDRAVRLW--------TRHGSYLSQFDKQGAAVTSLSFSP 1439

Query: 1182 DGSALCTGSWDTTLKIWAFGG 1244
            +G+ +  G  D  + +W   G
Sbjct: 1440 NGNLIAAGGPDGLVWLWGHKG 1460



 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 82/308 (26%), Positives = 133/308 (43%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH   + S+ ++P+   + SA   G + +W +    +T  I+   A + +  FSP  +
Sbjct: 1098 LKGHANNITSICFSPDGEFMASADDRGSIYLWTSKGELRT-VIRGHNATIWSLRFSPDSK 1156

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A    D    ++N         N  + RTL GH+  V +  + P+    L ++S D T
Sbjct: 1157 LLASASQDKTVRLWN--------RNGKILRTLMGHQDEVMSVDFSPDGQT-LASASWDGT 1207

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              +W I   L + +        H   + SV+ S     +  +G  D T  LW+  V  + 
Sbjct: 1208 VRMWGIQGNLISIL------KEHKDGIWSVAFSPDGQRLASAGQ-DKTLRLWN--VHGQL 1258

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   +    ++V+F PDG+   +GS D T RL+  R G  L   S  H      RV S
Sbjct: 1259 LHTLSDNTTPFLSVRFSPDGSILASGSVDKTVRLWS-REGVLL---SSLH--GHTGRVNS 1312

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            + FS  GR+L +   +    +W      +    G     H   +SC+G S D  A  T  
Sbjct: 1313 LDFSADGRILASASDDKTLLLWRLYGPPLTAFRG-----HGQWVSCVGFSPDSQAFATAG 1367

Query: 1209 WDTTLKIW 1232
             D TL +W
Sbjct: 1368 GDGTLDLW 1375



 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 92/350 (26%), Positives = 142/350 (40%), Gaps = 37/350 (10%)
 Frame = +3

Query: 294  VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN----ALTSQKTHAIKLPCAWVM 461
            V   +L GHTG+V SLD++ +   + SAS D  L++W      LT+ + H       WV 
Sbjct: 1298 VLLSSLHGHTGRVNSLDFSADGRILASASDDKTLLLWRLYGPPLTAFRGHG-----QWVS 1352

Query: 462  TCAFSPTGQSVACGGLDSV-----------------CSIFNLNLPPD-----NDGNSTVS 575
               FSP  Q+ A  G D                    +IF L   PD     + GN    
Sbjct: 1353 CVGFSPDSQAFATAGGDGTLDLWDRQGRLENRVIPPATIFALAYSPDGTIIASGGNDRAV 1412

Query: 576  RTLSGHKGY----------VSACQYVPNEDAHLITSSG-DKTCGLWDITTGLRTSVFGGE 722
            R  + H  Y          V++  + PN   +LI + G D    LW    G +  +F  +
Sbjct: 1413 RLWTRHGSYLSQFDKQGAAVTSLSFSPN--GNLIAAGGPDGLVWLW----GHKGKLF-KK 1465

Query: 723  YQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFP 902
              +GH A+++ V        +  +G  D T  +W        +RT  GH   +  + F P
Sbjct: 1466 ISTGH-AELAVVRFGPRGLFLATAGGVDRTIRIWSQ--TGTLLRTLRGHPDLITDLTFSP 1522

Query: 903  DGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGD 1082
            D     + S DGT R + I    QL      HS    +RVTSI FS  G+ + +   +G 
Sbjct: 1523 DNQVLVSASRDGTLRYWTI--AGQLLKTINAHS----NRVTSIDFSADGKTVASAGADGT 1576

Query: 1083 CYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
              +W  +   + +  G     H   +  +  S D   L +G+ D ++ +W
Sbjct: 1577 VRLWGPVGESVAVLYG-----HKDSVGAVRFSPDSKILLSGAADGSVFLW 1621



 Score = 83.6 bits (205), Expect = 9e-15
 Identities = 84/321 (26%), Positives = 136/321 (42%), Gaps = 9/321 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN----ALTSQKTHAIKLPCAWVMTCAFS 476
            ++GH   ++SL ++P+   + SASQD  + +WN     L +   H  +     VM+  FS
Sbjct: 1139 IRGHNATIWSLRFSPDSKLLASASQDKTVRLWNRNGKILRTLMGHQDE-----VMSVDFS 1193

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P GQ++A    D    ++ +       GN  +   L  HK  + +  + P  D   + S+
Sbjct: 1194 PDGQTLASASWDGTVRMWGI------QGN--LISILKEHKDGIWSVAFSP--DGQRLASA 1243

Query: 657  G-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            G DKT  LW++   L  ++      S +T    SV  S    ++  SGS D T  LW   
Sbjct: 1244 GQDKTLRLWNVHGQLLHTL------SDNTTPFLSVRFSPDG-SILASGSVDKTVRLWSRE 1296

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
                 + + HGH G V ++ F  DG    + SDD T  L+        ++Y  P +    
Sbjct: 1297 --GVLLSSLHGHTGRVNSLDFSADGRILASASDDKTLLLW--------RLYGPPLTAFRG 1346

Query: 1014 HR--VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNS--HDGRISCLGLSG 1181
            H   V+ + FS   +       +G   +WD          G L+N       I  L  S 
Sbjct: 1347 HGQWVSCVGFSPDSQAFATAGGDGTLDLWD--------RQGRLENRVIPPATIFALAYSP 1398

Query: 1182 DGSALCTGSWDTTLKIWAFGG 1244
            DG+ + +G  D  +++W   G
Sbjct: 1399 DGTIIASGGNDRAVRLWTRHG 1419



 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 79/312 (25%), Positives = 133/312 (42%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH+  +  + ++  +  + SAS D  + +W  L       +K     + +  FSP G+
Sbjct: 1057 LEGHSDFISQVSFSSSRKLMASASWDRTIRLWQ-LDGMPIKILKGHANNITSICFSPDGE 1115

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +A    D   SI+             +   + GH   + + ++ P+    L ++S DKT
Sbjct: 1116 FMA--SADDRGSIYLWT------SKGELRTVIRGHNATIWSLRFSPDSKL-LASASQDKT 1166

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LW+    +  ++       GH  +V SV  S     +  S S D T  +W   +    
Sbjct: 1167 VRLWNRNGKILRTLM------GHQDEVMSVDFSPDGQTL-ASASWDGTVRMWG--IQGNL 1217

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            +     H+  + +V F PDG R  +   D T RL+++  G  L       SDN      S
Sbjct: 1218 ISILKEHKDGIWSVAFSPDGQRLASAGQDKTLRLWNVH-GQLLHTL----SDNTT-PFLS 1271

Query: 1029 IAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGS 1208
            + FS  G +L +G  +    +W    ++  + L SL + H GR++ L  S DG  L + S
Sbjct: 1272 VRFSPDGSILASGSVDKTVRLW----SREGVLLSSL-HGHTGRVNSLDFSADGRILASAS 1326

Query: 1209 WDTTLKIWAFGG 1244
             D TL +W   G
Sbjct: 1327 DDKTLLLWRLYG 1338



>gb:CR382135_1668291 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 417

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 65/239 (27%), Positives = 107/239 (44%), Gaps = 6/239 (2%)
 Frame = +3

Query: 546  PDNDGNSTVSRTLSG-HKGYVSACQYVPNEDAHLITSSGDKTCGLWDITT-GLRTSVFGG 719
            PD+D    + R ++G H+G+V +C   P  +   +T S D T  +WD+ +  L+ ++   
Sbjct: 104  PDSDSRWKLLRVMAGAHQGWVRSCTVDPVTNKWFVTGSSDSTIKIWDLASLNLKATI--- 160

Query: 720  EYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA----VRTFHGHEGDVIA 887
               +GH   V S+++S+    +F SGS D T   WD    +      +R +HGH G + A
Sbjct: 161  ---TGHIMGVRSLAVSSRYPYLF-SGSEDKTVKCWDLERTNSLLGCQIRNYHGHVGGIYA 216

Query: 888  VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAG 1067
            +   P+ +   TG  D   R++D+R+  ++ V S   SD     +TSIA  I    +   
Sbjct: 217  MALHPELDLLFTGGRDSVIRVWDLRSRTEIMVLSGHRSD-----ITSIASQIGDPQIITS 271

Query: 1068 YTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
              +    +WD   A   L L      H   I  + +      +C+G     LK W   G
Sbjct: 272  SMDATIRLWDIRKATTQLAL----THHSKSIRLMAMHPQEMTMCSGDTSGNLKEWLLPG 326



 Score = 41.6 bits (96), Expect = 0.041
 Identities = 48/229 (20%), Positives = 76/229 (33%), Gaps = 3/229 (1%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           RN  GH G +Y++   PE + + +  +D  + VW+                         
Sbjct: 205 RNYHGHVGGIYAMALHPELDLLFTGGRDSVIRVWDL------------------------ 240

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
                                     + T    LSGH+  +++       D  +ITSS D
Sbjct: 241 -------------------------RSRTEIMVLSGHRSDITSIASQIG-DPQIITSSMD 274

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWDI             Q   T    S+ + A +       S DT+  L +  +  
Sbjct: 275 ATIRLWDIRKATT--------QLALTHHSKSIRLMAMHPQEMTMCSGDTSGNLKEWLLPG 326

Query: 843 RAVRTFHGHEGD---VIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQ 980
             +    GH G+   +  +   P  N   +G DDG    +D  +G  LQ
Sbjct: 327 GELLNEFGHSGENKIINTLSINPSNNTLFSGYDDGRMEFYDYVSGDLLQ 375



>gb:AY524043_625304 Micromonospora echinospora ATCC 15835 gentamicin
            biosynthesis gene cluster, complete sequence.
          Length = 311

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 75/260 (28%), Positives = 110/260 (42%), Gaps = 1/260 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKT-HAIKLPCAWVMTCAFSP 479
            R L GHT  V+ + + PE   + SAS+D    +W+  T ++    +    A V   AF P
Sbjct: 56   RTLTGHTDTVWLVVFDPEGRLLASASEDRTARIWDVSTGEQVGEPLTGHTAGVYGVAFHP 115

Query: 480  TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG 659
             G  +A G  D    ++ +       G   V   L+     +    + P  D HL+ S+G
Sbjct: 116  DGGLLATGSADHTVRLWKV------PGGEPVGEPLTESTDEIDGVAFHP--DGHLVASTG 167

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D    L+D  TG       G    GHT    SV+ S     +  SGS D T  +WD    
Sbjct: 168  DAV-RLYDTATGRPV----GTPLVGHTKGAVSVAFSPDG-RLLASGSDDLTVRIWDHAAG 221

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
              AV    GH   V  V F P+G    + ++D T R++D+ TG Q+      H+      
Sbjct: 222  GAAVEPLVGHTDAVDGVVFHPNGRLLVSAAEDCTVRVWDVATGRQVGEVETGHT----AP 277

Query: 1020 VTSIAFSISGRLLFAGYTNG 1079
            V +IAF  SG  +     +G
Sbjct: 278  VWNIAFDRSGERIVTASQDG 297



 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 78/316 (24%), Positives = 126/316 (39%), Gaps = 3/316 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQ---KTHAIKLPCAWVMTCAFSP 479
            L GH   V    + P+ + + ++ +DG + +W+A T +   +T        W++   F P
Sbjct: 15   LTGHQEGVIGAVFHPDDHLVATSGEDGTVRLWDATTGEQVGRTLTGHTDTVWLV--VFDP 72

Query: 480  TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG 659
             G+ +A    D    I++++          V   L+GH   V    + P +   L T S 
Sbjct: 73   EGRLLASASEDRTARIWDVST------GEQVGEPLTGHTAGVYGVAFHP-DGGLLATGSA 125

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D T  LW +  G       GE  +  T ++  V   A + +  +  S      L+DT   
Sbjct: 126  DHTVRLWKVPGGEPV----GEPLTESTDEIDGV---AFHPDGHLVASTGDAVRLYDTATG 178

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
                    GH    ++V F PDG    +GSDD T R++D   G         H+D     
Sbjct: 179  RPVGTPLVGHTKGAVSVAFSPDGRLLASGSDDLTVRIWDHAAGGAAVEPLVGHTD----A 234

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            V  + F  +GRLL +   +    VWD    + V   G ++  H   +  +     G  + 
Sbjct: 235  VDGVVFHPNGRLLVSAAEDCTVRVWDVATGRQV---GEVETGHTAPVWNIAFDRSGERIV 291

Query: 1200 TGSWDTTLKIWAFGGY 1247
            T S D T +I  F  Y
Sbjct: 292  TASQDGTARILPFPAY 307



>gb:MPU575934_149470 Micromonospora purpurea DOS biosynthetic gene
            cluster.
          Length = 298

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 75/260 (28%), Positives = 110/260 (42%), Gaps = 1/260 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKT-HAIKLPCAWVMTCAFSP 479
            R L GHT  V+ + + PE   + SAS+D    +W+  T ++    +    A V   AF P
Sbjct: 43   RTLTGHTDTVWLVVFDPEGRLLASASEDRTARIWDVSTGEQVGEPLTGHTAGVYGVAFHP 102

Query: 480  TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG 659
             G  +A G  D    ++ +       G   V   L+     +    + P  D HL+ S+G
Sbjct: 103  DGGLLATGSADHTVRLWKV------PGGEPVGEPLTESTDEIDGVAFHP--DGHLVASTG 154

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D    L+D  TG       G    GHT    SV+ S     +  SGS D T  +WD    
Sbjct: 155  DAV-RLYDTATGRPV----GTPLVGHTKGAVSVAFSPDG-RLLASGSDDLTVRIWDHAAG 208

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
              AV    GH   V  V F P+G    + ++D T R++D+ TG Q+      H+      
Sbjct: 209  GAAVEPLVGHTDAVDGVVFHPNGRLLVSAAEDCTVRVWDVATGRQVGEVETGHT----AP 264

Query: 1020 VTSIAFSISGRLLFAGYTNG 1079
            V +IAF  SG  +     +G
Sbjct: 265  VWNIAFDRSGERIVTASQDG 284



 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 78/316 (24%), Positives = 126/316 (39%), Gaps = 3/316 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQ---KTHAIKLPCAWVMTCAFSP 479
            L GH   V    + P+ + + ++ +DG + +W+A T +   +T        W++   F P
Sbjct: 2    LTGHQEGVIGAVFHPDDHLVATSGEDGTVRLWDATTGEQVGRTLTGHTDTVWLV--VFDP 59

Query: 480  TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG 659
             G+ +A    D    I++++          V   L+GH   V    + P +   L T S 
Sbjct: 60   EGRLLASASEDRTARIWDVST------GEQVGEPLTGHTAGVYGVAFHP-DGGLLATGSA 112

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D T  LW +  G       GE  +  T ++  V   A + +  +  S      L+DT   
Sbjct: 113  DHTVRLWKVPGGEPV----GEPLTESTDEIDGV---AFHPDGHLVASTGDAVRLYDTATG 165

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
                    GH    ++V F PDG    +GSDD T R++D   G         H+D     
Sbjct: 166  RPVGTPLVGHTKGAVSVAFSPDGRLLASGSDDLTVRIWDHAAGGAAVEPLVGHTD----A 221

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            V  + F  +GRLL +   +    VWD    + V   G ++  H   +  +     G  + 
Sbjct: 222  VDGVVFHPNGRLLVSAAEDCTVRVWDVATGRQV---GEVETGHTAPVWNIAFDRSGERIV 278

Query: 1200 TGSWDTTLKIWAFGGY 1247
            T S D T +I  F  Y
Sbjct: 279  TASQDGTARILPFPAY 294



>gb:BC051783_2550450 Danio rerio zgc:56312, mRNA (cDNA clone MGC:56312
            IMAGE:5603337), complete cds.
          Length = 347

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 65/231 (28%), Positives = 107/231 (46%), Gaps = 1/231 (0%)
 Frame = +3

Query: 543  PPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGE 722
            PP +         LSGH+G V  C++ PN  A L +S  D+   +W++            
Sbjct: 39   PPRSSSLQAPIMLLSGHEGEVYCCKFHPN-GATLASSGYDRLILMWNVYGDCENYAT--- 94

Query: 723  YQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFP 902
               GH+  V  +  +   + +F S S D T C+WD+    R V+   GH   V +     
Sbjct: 95   -LKGHSGAVMELHYNTDGSLLF-SASTDKTVCVWDSETGER-VKRLKGHTSFVNSCFPAR 151

Query: 903  DGNRFG-TGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNG 1079
             G +   TGSDDGT +L+DIR    +      H+    ++V S+ F+ +   + +G  + 
Sbjct: 152  RGPQLACTGSDDGTVKLWDIRKKASV------HTFQNTYQVLSVTFNDTSDQIISGGIDN 205

Query: 1080 DCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            D  VWD    K++ ++      H   ++ L LS DGS L + S D ++++W
Sbjct: 206  DIKVWDLRQNKLIYSM----QGHGDSVTGLSLSADGSYLLSNSMDNSVRVW 252



 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 75/311 (24%), Positives = 127/311 (40%), Gaps = 4/311 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHA-IKLPCAWVMTCAFSPTG 485
            L GH G+VY   + P    + S+  D  +++WN     + +A +K     VM   ++  G
Sbjct: 52   LSGHEGEVYCCKFHPNGATLASSGYDRLILMWNVYGDCENYATLKGHSGAVMELHYNTDG 111

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
              +     D    ++      D++    V R L GH  +V++C           T S D 
Sbjct: 112  SLLFSASTDKTVCVW------DSETGERVKR-LKGHTSFVNSCFPARRGPQLACTGSDDG 164

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  LWDI        F   YQ      V SV+ +   ++  +SG  D    +WD R  ++
Sbjct: 165  TVKLWDIRKKASVHTFQNTYQ------VLSVTFN-DTSDQIISGGIDNDIKVWDLR-QNK 216

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR---TGHQLQVYSQPHSDNEVH 1016
             + +  GH   V  +    DG+   + S D + R++DIR      +     Q +  N   
Sbjct: 217  LIYSMQGHGDSVTGLSLSADGSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEK 276

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
             +   ++S  G  + AG  +   Y+WDT   ++V  L      H G ++ +    +   +
Sbjct: 277  NLLRCSWSADGSKIAAGSADRFVYIWDTTTRRIVYKL----PGHAGSVNEVAFHPEEPIV 332

Query: 1197 CTGSWDTTLKI 1229
             +GS D  L I
Sbjct: 333  LSGSSDKRLYI 343



 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 83/305 (27%), Positives = 135/305 (44%), Gaps = 13/305 (4%)
 Frame = +3

Query: 357  KNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW-------VMTCAFSPTGQSVACGGLDS 515
            +  +V+A+Q  +L   +A+   ++ +++ P          V  C F P G ++A  G D 
Sbjct: 22   RTELVAAAQSQQL---SAMGPPRSSSLQAPIMLLSGHEGEVYCCKFHPNGATLASSGYDR 78

Query: 516  VCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SGDKTCGLWDITT 692
            +  ++N+       G+     TL GH G V    Y  N D  L+ S S DKT  +WD  T
Sbjct: 79   LILMWNVY------GDCENYATLKGHSGAVMELHY--NTDGSLLFSASTDKTVCVWDSET 130

Query: 693  GLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHE 872
            G R          GHT+ V+S   +     +  +GS D T  LWD R  + +V TF  + 
Sbjct: 131  GERVKRL-----KGHTSFVNSCFPARRGPQLACTGSDDGTVKLWDIRKKA-SVHTFQ-NT 183

Query: 873  GDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGR 1052
              V++V F    ++  +G  D   +++D+R  ++L    Q H D+    VT ++ S  G 
Sbjct: 184  YQVLSVTFNDTSDQIISGGIDNDIKVWDLRQ-NKLIYSMQGHGDS----VTGLSLSADGS 238

Query: 1053 LLFAGYTNGDCYVWDTLLAK-----MVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDT 1217
             L +   +    VWD          + +  G++ N     + C   S DGS +  GS D 
Sbjct: 239  YLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRC-SWSADGSKIAAGSADR 297

Query: 1218 TLKIW 1232
             + IW
Sbjct: 298  FVYIW 302



 Score = 35.0 bits (79), Expect = 3.8
 Identities = 31/135 (22%), Positives = 58/135 (42%), Gaps = 8/135 (5%)
 Frame = +3

Query: 306 NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALT-SQKTHAIKLPCAWV-------M 461
           ++QGH   V  L  + + + ++S S D  + VW+    + K   +K+    V       +
Sbjct: 220 SMQGHGDSVTGLSLSADGSYLLSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLL 279

Query: 462 TCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAH 641
            C++S  G  +A G  D    I++            +   L GH G V+   + P E+  
Sbjct: 280 RCSWSADGSKIAAGSADRFVYIWDTT-------TRRIVYKLPGHAGSVNEVAFHP-EEPI 331

Query: 642 LITSSGDKTCGLWDI 686
           +++ S DK   + +I
Sbjct: 332 VLSGSSDKRLYIGEI 346



>pir|AG2400|AG2400 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120)>gb:BA000019_685748 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 589

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 75/310 (24%), Positives = 133/310 (42%), Gaps = 2/310 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V+S+  T +   +VSAS+D  + VWN  T++ T  ++     V   A +P  Q
Sbjct: 299  LFGHTDSVWSVALTKDGQTLVSASEDQTIKVWNLETAKVTTTLQGHTDTVRAIALTPDDQ 358

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
            ++  G  D    I+NL           + RTLS H G + +   + ++   L+T+  + +
Sbjct: 359  TLISGSADKTIKIWNLQ-------RLRIKRTLSSHAGGIWSLA-ISSDGQTLVTAHENGS 410

Query: 669  CGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              +W+  TG  LRT         GH   + SV++S      F +G  D    +W+     
Sbjct: 411  IQIWNFPTGQLLRTI-------KGHQGRIFSVAMSPDG-ETFATGGIDKKIKIWNL-YTG 461

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
              + T   H+  V A+ F  DG    + S D + +++ + TG  L             RV
Sbjct: 462  ECLHTITEHQDTVRALVFSRDGKMLASSSWDKSIKIWQMPTGKLLHTLL-----GHTSRV 516

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
             ++   I  + L +G  +    +WD    K++  +    + H   I  +  +     L +
Sbjct: 517  VTLNLGIDEQTLVSGSLDNKLKIWDMQTGKLLDTI----SGHTDWILAIAANPAKQILVS 572

Query: 1203 GSWDTTLKIW 1232
             + D T+++W
Sbjct: 573  SAKDKTIRVW 582



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 59/219 (26%), Positives = 102/219 (46%), Gaps = 2/219 (0%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R L  H G ++SL  + +   +V+A ++G + +WN  T Q    IK     + + A SP 
Sbjct: 381 RTLSSHAGGIWSLAISSDGQTLVTAHENGSIQIWNFPTGQLLRTIKGHQGRIFSVAMSPD 440

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G++ A GG+D    I+NL              T++ H+  V A  +   +   L +SS D
Sbjct: 441 GETFATGGIDKKIKIWNLY-------TGECLHTITEHQDTVRALVF-SRDGKMLASSSWD 492

Query: 663 KTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
           K+  +W + TG  L T +       GHT+ V ++++      + VSGS D    +WD + 
Sbjct: 493 KSIKIWQMPTGKLLHTLL-------GHTSRVVTLNLGIDEQTL-VSGSLDNKLKIWDMQ- 543

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
             + + T  GH   ++A+   P      + + D T R++
Sbjct: 544 TGKLLDTISGHTDWILAIAANPAKQILVSSAKDKTIRVW 582



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 34/128 (26%), Positives = 60/128 (46%)
 Frame = +3

Query: 855  TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIA 1034
            T  GH   V +V    DG    + S+D T +++++ T  ++    Q H+D     V +IA
Sbjct: 298  TLFGHTDSVWSVALTKDGQTLVSASEDQTIKVWNLETA-KVTTTLQGHTDT----VRAIA 352

Query: 1035 FSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWD 1214
             +   + L +G  +    +W+    ++   L    +SH G I  L +S DG  L T   +
Sbjct: 353  LTPDDQTLISGSADKTIKIWNLQRLRIKRTL----SSHAGGIWSLAISSDGQTLVTAHEN 408

Query: 1215 TTLKIWAF 1238
             +++IW F
Sbjct: 409  GSIQIWNF 416



>sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein beta
            subunit-like protein.>pir|S11904|S11904 GTP-binding
            regulatory protein beta chain homolog - Chlamydomonas
            reinhardtii>gb:CRGPLP_1673408 C. reinhardtii Cblp gene
            for a G protein beta subunit-like polypeptide.
          Length = 318

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 92/325 (28%), Positives = 138/325 (42%), Gaps = 14/325 (4%)
 Frame = +3

Query: 309  LQGHTGKVYSL--DWTPEKNRIVSASQDGRLIVWNALTSQKTH-----AIKLPCAWVMTC 467
            L+GHT  V ++     P  N ++SAS+D  ++VW    S+  +     A++    +V   
Sbjct: 11   LKGHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKALRGHSHFVQDV 70

Query: 468  AFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGH-KGYVSACQYVPNEDAHL 644
              S  GQ    G  D    +++LN         T +R   GH K  +S    V N    +
Sbjct: 71   VISSDGQFCLTGSWDGTLRLWDLN-------TGTTTRRFVGHTKDVLSVAFSVDNRQ--I 121

Query: 645  ITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN-MFVSGSCDTTACL 821
            ++ S DKT  LW+     + ++  GE + GHT  VS V  S   TN + VSG  D    +
Sbjct: 122  VSGSRDKTIKLWNTLGECKYTI--GEPE-GHTEWVSCVRFSPMTTNPIIVSGGWDKMVKV 178

Query: 822  WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHS 1001
            W+     +      GH G V  V   PDG+   +G  DG   L+D+  G +L  YS    
Sbjct: 179  WNL-TNCKLKNNLVGHHGYVNTVTVSPDGSLCASGGKDGIAMLWDLAEGKRL--YSLDAG 235

Query: 1002 DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRIS---CLG 1172
            D     +  + FS   R      T     +WD     +V +L    N    +     C+ 
Sbjct: 236  D----VIHCLCFS-PNRYWLCAATQSSIKIWDLESKSIVDDLRPEFNITSKKAQVPYCVS 290

Query: 1173 L--SGDGSALCTGSWDTTLKIWAFG 1241
            L  S DGS L +G  D  +++WA G
Sbjct: 291  LAWSADGSTLYSGYTDGQIRVWAVG 315



 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 63/241 (26%), Positives = 98/241 (40%), Gaps = 16/241 (6%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLP---CAWVMTCAF 473
           R   GHT  V S+ ++ +  +IVS S+D  + +WN L   K + I  P     WV    F
Sbjct: 100 RRFVGHTKDVLSVAFSVDNRQIVSGSRDKTIKLWNTLGECK-YTIGEPEGHTEWVSCVRF 158

Query: 474 SP--TGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
           SP  T   +  GG D +  ++NL        N  +   L GH GYV+     P  D  L 
Sbjct: 159 SPMTTNPIIVSGGWDKMVKVWNLT-------NCKLKNNLVGHHGYVNTVTVSP--DGSLC 209

Query: 648 TSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSV--SISASNTNMFVSGSCDTTAC 818
            S G D    LWD+  G R           ++ D   V   +  S    ++  +  ++  
Sbjct: 210 ASGGKDGIAMLWDLAEGKRL----------YSLDAGDVIHCLCFSPNRYWLCAATQSSIK 259

Query: 819 LWDTRVAS-----RAVRTFHGHEGDV---IAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQ 974
           +WD    S     R        +  V   +++ +  DG+   +G  DG  R++ +  GH 
Sbjct: 260 IWDLESKSIVDDLRPEFNITSKKAQVPYCVSLAWSADGSTLYSGYTDGQIRVWAV--GHS 317

Query: 975 L 977
           L
Sbjct: 318 L 318



>gb:AF268195_2060958 Mus musculus strain BALB/c IRA1 mRNA, complete
            cds.
          Length = 514

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 87/336 (25%), Positives = 142/336 (42%), Gaps = 28/336 (8%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + +VS S D    +WN     TS  T  +   C          
Sbjct: 165  LRGHESEVFICAWNPVSDLLVSGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPS 224

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 225  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 274

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 275  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 325

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---H 971
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++     H
Sbjct: 326  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVH 385

Query: 972  QLQVYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLN 1124
             LQ +++         + +I +S +G          +L +   +    +WD      +  
Sbjct: 386  DLQAHNK--------EIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHT 437

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            L      H   +  +  S DG  L +GS+D  + IW
Sbjct: 438  L----TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 469



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 265  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 324

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 325  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLKI 375

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 376  WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 434

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 435  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 488

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 489  VCWNAAGDKVGASASDGSVCVLD 511



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 52/220 (23%), Positives = 85/220 (38%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 343 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPT 402

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 403 G-------------------PGTNN----------------------PNANLMLASASFD 421

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S        SGS D    +W+T+  +
Sbjct: 422 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDG-RYLASGSFDKCVHIWNTQTGA 475

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 476 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 513



 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 67/272 (24%), Positives = 110/272 (40%), Gaps = 21/272 (7%)
 Frame = +3

Query: 483  GQSVACGGLDSVCSIFN-----LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            G++ A G  +   +I N     + +  D +  S  +  L GH+  V  C + P  D  L+
Sbjct: 127  GENTANGEENGAHTIANNHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDL-LV 185

Query: 648  TSSGDKTCGLWDI----TTG-----LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGS 800
            + SGD T  +W++    T+G     LR  +  G        DV+S+  ++  T +  +GS
Sbjct: 186  SGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGT-LLATGS 244

Query: 801  CDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQ 974
             D  A +W  D  +AS    T   H+G + A+K+   GN   +   D T  ++D  TG  
Sbjct: 245  YDGFARIWTKDGNLAS----TLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEA 300

Query: 975  LQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ----- 1139
             Q +         H   ++         FA  +   C          V  LG  +     
Sbjct: 301  KQQFP-------FHSAPALDVDWQSNNTFASCSTDMCI--------HVCKLGQDRPIKTF 345

Query: 1140 NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
              H   ++ +     G+ L + S D TLKIW+
Sbjct: 346  QGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 377



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTP---------EKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W+       H +    
Sbjct: 383 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQ 442

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFN 533
             V + AFSP G+ +A G  D    I+N
Sbjct: 443 EPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 433 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 491

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 492 NAAGDKVGASASDGSVC 508



>gb:AC087851_1734183 Oryza sativa chromosome 3 BAC OSJNBb0072E24
            genomic sequence, complete sequence.
          Length = 361

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 82/309 (26%), Positives = 137/309 (44%), Gaps = 1/309 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT  V ++ ++ + N + S S DGR+ VWN  T      ++   +      + P G 
Sbjct: 70   LAGHTDTVCTVAFSSDGNLLASGSFDGRINVWNTATRTLQGTLEGSGSGFEWLKWHPRGH 129

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI-TSSGDK 665
             +  G  D        NL   N  ++ +  T +GH   V+   + P  D  LI T S D 
Sbjct: 130  LIIAGSED-------CNLWMWNADHNAILNTFAGHSSTVTCGDFTP--DGKLICTGSDDA 180

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            +  +WD  T     V  G     HT  ++ +S++ S++   VSGS D + C+ +   + +
Sbjct: 181  SLRIWDPRTAQSRHVVRG--HGYHTDGLTCLSVT-SDSQTIVSGSKDNSVCVVNIN-SGQ 236

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
             V +  GH G +  V   P  N   TGS D    ++D+  G Q    +  H +     VT
Sbjct: 237  VVGSLDGHTGSIECVGISPSYNWVATGSMDQKLIIWDL--GRQSIRCTCNHDEG----VT 290

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            S+A+    R + +G  +G   +WD+L  + V         H   +  L +S DG+++ + 
Sbjct: 291  SLAWLGPSRFVASGCIDGMVRIWDSLSGECVRAFA----GHGDVVQSLAVSADGNSIVSV 346

Query: 1206 SWDTTLKIW 1232
            S D +  I+
Sbjct: 347  STDGSALIF 355



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 74/271 (27%), Positives = 115/271 (42%), Gaps = 9/271 (3%)
 Frame = +3

Query: 456  VMTCAFSPTGQS-VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            +   A SPT  S VA GG D    ++ +       G++     L+GH   V  C    + 
Sbjct: 34   IFAVACSPTDASLVASGGKDDRGFLWKI-------GSAEDVLELAGHTDTV--CTVAFSS 84

Query: 633  DAHLITS-SGDKTCGLWDITTG-----LRTSVFGGEYQSGHTADVSSVSISASNTNMFVS 794
            D +L+ S S D    +W+  T      L  S  G E+   H              ++ ++
Sbjct: 85   DGNLLASGSFDGRINVWNTATRTLQGTLEGSGSGFEWLKWHPRG-----------HLIIA 133

Query: 795  GSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQ 974
            GS D    +W+    +  + TF GH   V    F PDG    TGSDD + R++D RT   
Sbjct: 134  GSEDCNLWMWNAD-HNAILNTFAGHSSTVTCGDFTPDGKLICTGSDDASLRIWDPRTAQS 192

Query: 975  LQVYSQP--HSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSH 1148
              V      H+D     +T ++ +   + + +G  +    V +    ++V   GSL + H
Sbjct: 193  RHVVRGHGYHTDG----LTCLSVTSDSQTIVSGSKDNSVCVVNINSGQVV---GSL-DGH 244

Query: 1149 DGRISCLGLSGDGSALCTGSWDTTLKIWAFG 1241
             G I C+G+S   + + TGS D  L IW  G
Sbjct: 245  TGSIECVGISPSYNWVATGSMDQKLIIWDLG 275



 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 57/218 (26%), Positives = 97/218 (44%), Gaps = 3/218 (1%)
 Frame = +3

Query: 315 GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWV--MTC-AFSPTG 485
           GH+  V   D+TP+   I + S D  L +W+  T+Q  H ++        +TC + +   
Sbjct: 156 GHSSTVTCGDFTPDGKLICTGSDDASLRIWDPRTAQSRHVVRGHGYHTDGLTCLSVTSDS 215

Query: 486 QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
           Q++  G  D+   + N+N       +  V  +L GH G +      P+ +  + T S D+
Sbjct: 216 QTIVSGSKDNSVCVVNIN-------SGQVVGSLDGHTGSIECVGISPSYN-WVATGSMDQ 267

Query: 666 TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
              +WD+    R S+        H   V+S++     +    SG  D    +WD+ ++  
Sbjct: 268 KLIIWDLG---RQSI---RCTCNHDEGVTSLA-WLGPSRFVASGCIDGMVRIWDS-LSGE 319

Query: 846 AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
            VR F GH   V ++    DGN   + S DG+  +FDI
Sbjct: 320 CVRAFAGHGDVVQSLAVSADGNSIVSVSTDGSALIFDI 357



 Score = 35.8 bits (81), Expect = 2.2
 Identities = 39/155 (25%), Positives = 66/155 (42%), Gaps = 9/155 (5%)
 Frame = +3

Query: 252 SQGKTPISFGPTDLVCCRN---------LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVW 404
           S  +T +S    + VC  N         L GHTG +  +  +P  N + + S D +LI+W
Sbjct: 213 SDSQTIVSGSKDNSVCVVNINSGQVVGSLDGHTGSIECVGISPSYNWVATGSMDQKLIIW 272

Query: 405 NALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL 584
           + L  Q           V + A+    + VA G +D +  I+      D+     V R  
Sbjct: 273 D-LGRQSIRCTCNHDEGVTSLAWLGPSRFVASGCIDGMVRIW------DSLSGECV-RAF 324

Query: 585 SGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDIT 689
           +GH G V     V  +   +++ S D +  ++DI+
Sbjct: 325 AGH-GDVVQSLAVSADGNSIVSVSTDGSALIFDIS 358



>gb:CR382134_1667630 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 504

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 77/317 (24%), Positives = 125/317 (39%), Gaps = 15/317 (4%)
 Frame = +3

Query: 330  VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGL 509
            + ++ WTPE  R++ AS  G   VWN +T      ++     +++  +S   + +  G  
Sbjct: 125  INTVKWTPEGRRLLVASHSGEFTVWNGMTFNFETIMQAHDLAILSLKYSHNDEWLLSGDQ 184

Query: 510  DSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDIT 689
              V   +  N    N         ++GH   +    + PN D+  +T S D T  +W+  
Sbjct: 185  SGVIKYWQTNFNNVN--------IINGHSDGIRDIAFSPN-DSKFLTCSDDSTMKIWNFN 235

Query: 690  TGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGH 869
             G       G +    +AD         N  + VSGS D    LWD R AS  V T HG 
Sbjct: 236  NGQEERSLVGHHWDVKSADWH------PNLGLIVSGSKDNLIKLWDPR-ASSCVSTLHGF 288

Query: 870  EGDVIAVKFFPDGNR--FGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSI 1043
            +  +   KF P G +    + S D +CR+FD+RT   + V     +D        +  S+
Sbjct: 289  KHTITKTKFQPTGTKRLLASVSRDKSCRIFDLRTMKDILVIRDHETDLSCVEWHPVHPSM 348

Query: 1044 SGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNS-------------HDGRISCLGLSGD 1184
                 + G  N   Y+ D+ ++   +   S  NS             H+  I  L     
Sbjct: 349  ITTAAYDGSMNH--YIMDSYISDNNIKNDSNNNSTSPIEASHKIPYAHEKAIHALEYHPL 406

Query: 1185 GSALCTGSWDTTLKIWA 1235
            G  LC+   D + + W+
Sbjct: 407  GHLLCSAGADRSARFWS 423



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 36/167 (21%), Positives = 73/167 (43%), Gaps = 1/167 (0%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
           + GH+  +  + ++P  ++ ++ S D  + +WN    Q+  ++      V +  + P   
Sbjct: 201 INGHSDGIRDIAFSPNDSKFLTCSDDSTMKIWNFNNGQEERSLVGHHWDVKSADWHPNLG 260

Query: 489 SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS-SGDK 665
            +  G  D++  ++      D   +S VS TL G K  ++  ++ P     L+ S S DK
Sbjct: 261 LIVSGSKDNLIKLW------DPRASSCVS-TLHGFKHTITKTKFQPTGTKRLLASVSRDK 313

Query: 666 TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
           +C ++D+ T     V        H  D+S V     + +M  + + D
Sbjct: 314 SCRIFDLRTMKDILVI-----RDHETDLSCVEWHPVHPSMITTAAYD 355



 Score = 40.4 bits (93), Expect = 0.091
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 2/85 (2%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           R+L GH   V S DW P    IVS S+D  + +W+   S     +      +    F PT
Sbjct: 241 RSLVGHHWDVKSADWHPNLGLIVSGSKDNLIKLWDPRASSCVSTLHGFKHTITKTKFQPT 300

Query: 483 G--QSVACGGLDSVCSIFNLNLPPD 551
           G  + +A    D  C IF+L    D
Sbjct: 301 GTKRLLASVSRDKSCRIFDLRTMKD 325



 Score = 36.2 bits (82), Expect = 1.7
 Identities = 31/117 (26%), Positives = 49/117 (41%)
 Frame = +3

Query: 888  VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAG 1067
            VK+ P+G R    S  G   +++  T    +   Q H       + S+ +S +   L +G
Sbjct: 128  VKWTPEGRRLLVASHSGEFTVWNGMT-FNFETIMQAHD----LAILSLKYSHNDEWLLSG 182

Query: 1068 YTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
              +G    W T       N  ++ N H   I  +  S + S   T S D+T+KIW F
Sbjct: 183  DQSGVIKYWQTNF-----NNVNIINGHSDGIRDIAFSPNDSKFLTCSDDSTMKIWNF 234



>gb:CR382127_1660168 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 532

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 82/329 (24%), Positives = 134/329 (40%), Gaps = 27/329 (8%)
 Frame = +3

Query: 330  VYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGL 509
            VYS  WTP+  R+++ S  G   +WN +T      ++   + V +  +S +G+ +  G  
Sbjct: 148  VYSATWTPDGRRLLTGSMSGEFTLWNGMTFNFESIMQAHESGVRSLKYSHSGEWLLSGDH 207

Query: 510  DSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDIT 689
            +     +  +L       + V+     H+  +    + P+ D   +T S D    +WD  
Sbjct: 208  EGNVKFWQPSL-------NCVNVIDKAHRESIRELAFAPS-DHKFVTGSDDGLLKIWDF- 258

Query: 690  TGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGH 869
                 S        GH  DV SV    S   + VSGS D    LWD R A   V TFHG 
Sbjct: 259  ---HESSNAESVLKGHGWDVKSVDWH-SELGLIVSGSKDNLIKLWDPRSAKN-VNTFHGF 313

Query: 870  EGDVIAVKFFPDGNR--FGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV---------- 1013
            +  V+   F P G +     G  D TCR+ D+R  +     + P +  ++          
Sbjct: 314  KNTVMKTTFQPTGTKRLLAAGCRDRTCRILDLRMLNSGSSEAGPTAGTDMPTRGDRSMAV 373

Query: 1014 -HRVTSIAFSIS-----GRLLFAGYTNGDCYVW--DTLLA-------KMVLNLGSLQNSH 1148
                 S  FS++       ++ +G   G  Y +  DT  A         +L + ++ ++H
Sbjct: 374  LRGHDSDVFSLTWHPTHANVVTSGTKTGSIYTFNVDTTPAGGAYGPDSGILPVNTIPSAH 433

Query: 1149 DGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
            D  +S L    +G  LC+G  D   + WA
Sbjct: 434  DYCVSTLDYHPEGHVLCSGGLDRMTRFWA 462



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 46/156 (29%), Positives = 70/156 (44%), Gaps = 17/156 (10%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTG- 485
           L+GH   V S+DW  E   IVS S+D  + +W+  +++  +        VM   F PTG 
Sbjct: 268 LKGHGWDVKSVDWHSELGLIVSGSKDNLIKLWDPRSAKNVNTFHGFKNTVMKTTFQPTGT 327

Query: 486 -QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRT---------------LSGHKGYVSACQ 617
            + +A G  D  C I +L +   N G+S    T               L GH   V +  
Sbjct: 328 KRLLAAGCRDRTCRILDLRML--NSGSSEAGPTAGTDMPTRGDRSMAVLRGHDSDVFSLT 385

Query: 618 YVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEY 725
           + P   A+++T SG KT  ++  T  + T+  GG Y
Sbjct: 386 WHPTH-ANVVT-SGTKTGSIY--TFNVDTTPAGGAY 417



 Score = 39.3 bits (90), Expect = 0.20
 Identities = 35/120 (29%), Positives = 49/120 (40%)
 Frame = +3

Query: 879  VIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLL 1058
            V +  + PDG R  TGS  G   L++  T    +   Q H       V S+ +S SG  L
Sbjct: 148  VYSATWTPDGRRLLTGSMSGEFTLWNGMT-FNFESIMQAHESG----VRSLKYSHSGEWL 202

Query: 1059 FAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
             +G   G+   W   L  + +    +  +H   I  L  +       TGS D  LKIW F
Sbjct: 203  LSGDHEGNVKFWQPSLNCVNV----IDKAHRESIRELAFAPSDHKFVTGSDDGLLKIWDF 258



>pir|T46032|T46032 WD-40 repeat regulatory protein tup1 homolog -
            Arabidopsis thaliana>gb:ATT16K5_1554579 Arabidopsis
            thaliana DNA chromosome 3, BAC clone T16K5.
          Length = 317

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 73/262 (27%), Positives = 120/262 (45%), Gaps = 3/262 (1%)
 Frame = +3

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNED 635
            V +  FS  G+ +A    D     + +N    ND  +   +  +GH+  +S   +  + D
Sbjct: 27   VSSVKFSSDGRLLASASADKTIRTYTINTI--NDPIAEPVQEFTGHENGISDVAF--SSD 82

Query: 636  AHLITS-SGDKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
            A  I S S DKT  LWD+ TG  ++T +       GHT     V+ +  + NM VSGS D
Sbjct: 83   ARFIVSASDDKTLKLWDVETGSLIKTLI-------GHTNYAFCVNFNPQS-NMIVSGSFD 134

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
             T  +WD     + ++    H   V AV F  DG+   + S DG CR++D  TGH ++  
Sbjct: 135  ETVRIWDV-TTGKCLKVLPAHSDPVTAVDFNRDGSLIVSSSYDGLCRIWDSGTGHCVKTL 193

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                 D+E   V+ + FS +G+ +  G  +    +W+   AK +       N+     S 
Sbjct: 194  ----IDDENPPVSFVRFSPNGKFILVGTLDNTLRLWNISSAKFLKTYTGHVNAQYCISSA 249

Query: 1167 LGLSGDGSALCTGSWDTTLKIW 1232
              ++ +G  + +GS D  + +W
Sbjct: 250  FSVT-NGKRIVSGSEDNCVHMW 270



 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/217 (23%), Positives = 91/217 (41%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           + L GHT   + +++ P+ N IVS S D  + +W+  T +    +      V    F+  
Sbjct: 107 KTLIGHTNYAFCVNFNPQSNMIVSGSFDETVRIWDVTTGKCLKVLPAHSDPVTAVDFNRD 166

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G  +     D +C I+      D+     V   +      VS  ++ PN    ++  + D
Sbjct: 167 GSLIVSSSYDGLCRIW------DSGTGHCVKTLIDDENPPVSFVRFSPN-GKFILVGTLD 219

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LW+I++      + G   + +     S + S +N    VSGS D    +W+   + 
Sbjct: 220 NTLRLWNISSAKFLKTYTGHVNAQYCI---SSAFSVTNGKRIVSGSEDNCVHMWELN-SK 275

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
           + ++   GH   V+ V   P  N   +GS D T R++
Sbjct: 276 KLLQKLEGHTETVMNVACHPTENLIASGSLDKTVRIW 312



 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 58/266 (21%), Positives = 105/266 (39%), Gaps = 6/266 (2%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH   +  + ++ +   IVSAS D  L +W+  T      +     +     F+P    +
Sbjct: 69   GHENGISDVAFSSDARFIVSASDDKTLKLWDVETGSLIKTLIGHTNYAFCVNFNPQSNMI 128

Query: 495  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG-DKTC 671
              G  D    I+++             + L  H   V+A  +  N D  LI SS  D  C
Sbjct: 129  VSGSFDETVRIWDVT-------TGKCLKVLPAHSDPVTAVDF--NRDGSLIVSSSYDGLC 179

Query: 672  GLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
             +WD  TG  ++T +            VS V  S  N    + G+ D T  LW+   +++
Sbjct: 180  RIWDSGTGHCVKTLI------DDENPPVSFVRFS-PNGKFILVGTLDNTLRLWNIS-SAK 231

Query: 846  AVRTFHGHEGDVIAVK---FFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVH 1016
             ++T+ GH      +       +G R  +GS+D    ++++ +   LQ       +    
Sbjct: 232  FLKTYTGHVNAQYCISSAFSVTNGKRIVSGSEDNCVHMWELNSKKLLQ-----KLEGHTE 286

Query: 1017 RVTSIAFSISGRLLFAGYTNGDCYVW 1094
             V ++A   +  L+ +G  +    +W
Sbjct: 287  TVMNVACHPTENLIASGSLDKTVRIW 312



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 44/185 (23%), Positives = 84/185 (45%), Gaps = 9/185 (4%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKL-------PCAW 455
           C + L  H+  V ++D+  + + IVS+S DG   +W++ T    H +K        P ++
Sbjct: 147 CLKVLPAHSDPVTAVDFNRDGSLIVSSSYDGLCRIWDSGTG---HCVKTLIDDENPPVSF 203

Query: 456 VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKG--YVSACQYVPN 629
           V    FSP G+ +  G LD+   ++N++       ++   +T +GH    Y  +  +   
Sbjct: 204 V---RFSPNGKFILVGTLDNTLRLWNIS-------SAKFLKTYTGHVNAQYCISSAFSVT 253

Query: 630 EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
               +++ S D    +W++ +         +   GHT  V +V+   +  N+  SGS D 
Sbjct: 254 NGKRIVSGSEDNCVHMWELNSKKLL-----QKLEGHTETVMNVACHPTE-NLIASGSLDK 307

Query: 810 TACLW 824
           T  +W
Sbjct: 308 TVRIW 312



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 42/175 (24%), Positives = 73/175 (41%), Gaps = 4/175 (2%)
 Frame = +3

Query: 729  SGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS----RAVRTFHGHEGDVIAVKF 896
            + H   VSSV  S S+  +  S S D T   +     +      V+ F GHE  +  V F
Sbjct: 21   TSHNRAVSSVKFS-SDGRLLASASADKTIRTYTINTINDPIAEPVQEFTGHENGISDVAF 79

Query: 897  FPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTN 1076
              D     + SDD T +L+D+ TG  ++           +    + F+    ++ +G  +
Sbjct: 80   SSDARFIVSASDDKTLKLWDVETGSLIKTLI-----GHTNYAFCVNFNPQSNMIVSGSFD 134

Query: 1077 GDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFG 1241
                +WD    K +  L +    H   ++ +  + DGS + + S+D   +IW  G
Sbjct: 135  ETVRIWDVTTGKCLKVLPA----HSDPVTAVDFNRDGSLIVSSSYDGLCRIWDSG 185



 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 29/127 (22%), Positives = 52/127 (40%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            +T   H   V +VKF  DG    + S D T R + I T +              + ++ +
Sbjct: 18   QTLTSHNRAVSSVKFSSDGRLLASASADKTIRTYTINTINDPIAEPVQEFTGHENGISDV 77

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            AFS   R + +   +    +WD     ++  L      H     C+  +   + + +GS+
Sbjct: 78   AFSSDARFIVSASDDKTLKLWDVETGSLIKTL----IGHTNYAFCVNFNPQSNMIVSGSF 133

Query: 1212 DTTLKIW 1232
            D T++IW
Sbjct: 134  DETVRIW 140



>gb:BC045888_2549405 Danio rerio zgc:56055, mRNA (cDNA clone MGC:56055
            IMAGE:3820440), complete cds.
          Length = 416

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 82/311 (26%), Positives = 128/311 (41%), Gaps = 1/311 (0%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            RN +GH   + SLD++P   +I S S D  ++VWN     + +        V    FSP+
Sbjct: 12   RNFKGHRDAITSLDFSPSGKQIASGSVDASVMVWNMKPQSRAYRFTGHKDAVTCVQFSPS 71

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYV-SACQYVPNEDAHLITSSG 659
               +A    D    ++     P   G S + R    H G V S C     +   L+T+S 
Sbjct: 72   AHLLASSSRDKTVRLW----VPSVKGESVLFR---AHTGSVRSVCFSADGQS--LLTASD 122

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D++  LW +    R  +     +  +    +  S    +  + VS S D T  LWD   +
Sbjct: 123  DQSIKLWSVH---RQKIICTLREHNNWVRCARFS---PDGQLMVSVSDDRTVKLWDAS-S 175

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + + TF    G    V F P      T S D T R++DIRT H L  + Q HS      
Sbjct: 176  RQLIHTFCEPGGYSSYVDFHPSSTCIATASSDNTVRVWDIRT-HTLLQHYQVHS----AA 230

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALC 1199
            V +++F  SG  L    ++    + D L  +++  L    + H G  SC+  S  G    
Sbjct: 231  VNALSFHPSGNHLLTASSDSTLKILDLLEGRLLYTL----HGHQGSASCVSFSRSGDQFA 286

Query: 1200 TGSWDTTLKIW 1232
            +   D  + +W
Sbjct: 287  SAGSDQQVMVW 297



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 33/128 (25%), Positives = 59/128 (46%)
 Frame = +3

Query: 852  RTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
            R F GH   + ++ F P G +  +GS D +  +++++   +   ++  H D     VT +
Sbjct: 12   RNFKGHRDAITSLDFSPSGKQIASGSVDASVMVWNMKPQSRAYRFTG-HKD----AVTCV 66

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
             FS S  LL +   +    +W       V     L  +H G +  +  S DG +L T S 
Sbjct: 67   QFSPSAHLLASSSRDKTVRLW----VPSVKGESVLFRAHTGSVRSVCFSADGQSLLTASD 122

Query: 1212 DTTLKIWA 1235
            D ++K+W+
Sbjct: 123  DQSIKLWS 130



>gb:AB086191_2047797 Mus musculus mRNA for putative WDC146, complete
            cds.
          Length = 1330

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 87/325 (26%), Positives = 135/325 (41%), Gaps = 8/325 (2%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGKV----YSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            P + V  + ++  T KV    + + WTPE  R+V+ +  G   +WN LT      ++   
Sbjct: 102  PMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHD 161

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
            + V    +S     +           +  N+      N+   +    HK  +    + P 
Sbjct: 162  SPVRAMTWSHNDMWMLTADHGGYVKYWQSNM------NNV--KMFQAHKEAIREASFSPT 213

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             D    T S D T  +WD        +       GH ADV  V    +   + VSGS D+
Sbjct: 214  -DNKFATCSDDGTVRIWDFLRCHEERIL-----RGHGADVKCVDWHPTK-GLVVSGSKDS 266

Query: 810  TACL--WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-GHQLQ 980
               +  WD +   +++ T H H+  V+ VK   +GN   T S D  C+LFDIR    +LQ
Sbjct: 267  QQPIKFWDPKTG-QSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRNLKEELQ 325

Query: 981  VYSQPHSDNEVHRVTSIAFSISGRLLFA-GYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            V+            T++A+      LFA G ++G    W   + K V   G ++ +H+G 
Sbjct: 326  VFR-----GHKKEATAVAWHPVHEGLFASGGSDGSLLFWHVGVEKEV---GGMEMAHEGM 377

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            I  L     G  LC+GS D T K W
Sbjct: 378  IWSLAWHPLGHILCSGSNDHTSKFW 402



>gb:BT012225_1641431 Arabidopsis thaliana At5g13480 gene, complete
            cds.
          Length = 647

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 79/297 (26%), Positives = 125/297 (42%), Gaps = 1/297 (0%)
 Frame = +3

Query: 345  WTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCS 524
            WTP   R+++ SQ G   +WN  +      ++     + +  +S     +  G       
Sbjct: 131  WTPSGRRLITGSQSGEFTLWNGQSFNFEMILQAHDQPIRSMVWSHNENYMVSGDDGGTLK 190

Query: 525  IFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRT 704
             +  N+       + V    + HK  +    +    D    + S D T  +WD T  +  
Sbjct: 191  YWQNNM-------NNVKANKTAHKESIRDLSFCKT-DLKFCSCSDDTTVKVWDFTKCVDE 242

Query: 705  SVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVI 884
            S       +GH  DV SV    + + + VSG  D    LWDTR + R + + HGH+  V+
Sbjct: 243  SSL-----TGHGWDVKSVDWHPTKS-LLVSGGKDQLVKLWDTR-SGRELCSLHGHKNIVL 295

Query: 885  AVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLF- 1061
            +VK+  +GN   T S D   +L+DIRT  +LQ +     D     VTS+A+       F 
Sbjct: 296  SVKWNQNGNWLLTASKDQIIKLYDIRTMKELQSFRGHTKD-----VTSLAWHPCHEEYFV 350

Query: 1062 AGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            +G ++G    W        +    + N+HD  +  L     G  LC+GS D T K W
Sbjct: 351  SGSSDGSICHWIVGHENPQI---EIPNAHDNSVWDLAWHPIGYLLCSGSNDHTTKFW 404



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 55/217 (25%), Positives = 91/217 (41%), Gaps = 1/217 (0%)
 Frame = +3

Query: 306 NLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW-VMTCAFSPT 482
           N   H   +  L +     +  S S D  + VW+  T     +      W V +  + PT
Sbjct: 202 NKTAHKESIRDLSFCKTDLKFCSCSDDTTVKVWD-FTKCVDESSLTGHGWDVKSVDWHPT 260

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
              +  GG D +  +++        G    S  L GHK  V + ++  N +  L+T+S D
Sbjct: 261 KSLLVSGGKDQLVKLWDTR-----SGRELCS--LHGHKNIVLSVKWNQNGN-WLLTASKD 312

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
           +   L+DI T      F      GHT DV+S++    +   FVSGS D + C W     +
Sbjct: 313 QIIKLYDIRTMKELQSF-----RGHTKDVTSLAWHPCHEEYFVSGSSDGSICHWIVGHEN 367

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF 953
             +   + H+  V  + + P G    +GS+D T + +
Sbjct: 368 PQIEIPNAHDNSVWDLAWHPIGYLLCSGSNDHTTKFW 404



 Score = 38.1 bits (87), Expect = 0.45
 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 4/88 (4%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTP-EKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAW---VMTCA 470
           ++ +GHT  V SL W P  +   VS S DG +  W  +   +   I++P A    V   A
Sbjct: 327 QSFRGHTKDVTSLAWHPCHEEYFVSGSSDGSICHW--IVGHENPQIEIPNAHDNSVWDLA 384

Query: 471 FSPTGQSVACGGLDSVCSIFNLNLPPDN 554
           + P G  +  G  D     +  N P DN
Sbjct: 385 WHPIGYLLCSGSNDHTTKFWCRNRPADN 412



 Score = 35.0 bits (79), Expect = 3.8
 Identities = 30/120 (25%), Positives = 50/120 (41%), Gaps = 3/120 (2%)
 Frame = +3

Query: 888  VKFFPDGNRFGTGSDDGTCRLFDIRTGHQ---LQVYSQPHSDNEVHRVTSIAFSISGRLL 1058
            V + P G R  TGS  G   L++ ++ +    LQ + QP        + S+ +S +   +
Sbjct: 129  VLWTPSGRRLITGSQSGEFTLWNGQSFNFEMILQAHDQP--------IRSMVWSHNENYM 180

Query: 1059 FAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
             +G   G    W   +  +  N    + +H   I  L         C+ S DTT+K+W F
Sbjct: 181  VSGDDGGTLKYWQNNMNNVKAN----KTAHKESIRDLSFCKTDLKFCSCSDDTTVKVWDF 236



>gb:AK050653_1169412 Mus musculus 2 days neonate thymus thymic cells
            cDNA, RIKEN full-length enriched library,
            clone:C920029N20 product:WDC146 homolog [Homo sapiens],
            full insert sequence.
          Length = 530

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 87/325 (26%), Positives = 135/325 (41%), Gaps = 8/325 (2%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGKV----YSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            P + V  + ++  T KV    + + WTPE  R+V+ +  G   +WN LT      ++   
Sbjct: 102  PMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHD 161

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
            + V    +S     +           +  N+      N+   +    HK  +    + P 
Sbjct: 162  SPVRAMTWSHNDMWMLTADHGGYVKYWQSNM------NNV--KMFQAHKEAIREASFSPT 213

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             D    T S D T  +WD        +       GH ADV  V    +   + VSGS D+
Sbjct: 214  -DNKFATCSDDGTVRIWDFLRCHEERIL-----RGHGADVKCVDWHPTK-GLVVSGSKDS 266

Query: 810  TACL--WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-GHQLQ 980
               +  WD +   +++ T H H+  V+ VK   +GN   T S D  C+LFDIR    +LQ
Sbjct: 267  QQPIKFWDPKTG-QSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRNLKEELQ 325

Query: 981  VYSQPHSDNEVHRVTSIAFSISGRLLFA-GYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            V+            T++A+      LFA G ++G    W   + K V   G ++ +H+G 
Sbjct: 326  VFR-----GHKKEATAVAWHPVHEGLFASGGSDGSLLFWHVGVEKEV---GGMEMAHEGM 377

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            I  L     G  LC+GS D T K W
Sbjct: 378  IWSLAWHPLGHILCSGSNDHTSKFW 402



>gb:AK036064_1164339 Mus musculus 16 days neonate cerebellum cDNA,
            RIKEN full-length enriched library, clone:9630032A08
            product:IRA1 protein, full insert sequence.
          Length = 514

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 87/336 (25%), Positives = 141/336 (41%), Gaps = 28/336 (8%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 165  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPS 224

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 225  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 274

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 275  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 325

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---H 971
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T R++ ++     H
Sbjct: 326  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLRIWSMKQDNCVH 385

Query: 972  QLQVYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLN 1124
             LQ +++         + +I +S +G          +L +   +    +WD      +  
Sbjct: 386  DLQAHNK--------EIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHT 437

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            L      H   +  +  S DG  L +GS+D  + IW
Sbjct: 438  L----TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 469



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 265  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 324

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 325  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLRI 375

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 376  WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 434

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 435  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 488

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 489  VCWNAAGDKVGASASDGSVCVLD 511



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 52/220 (23%), Positives = 85/220 (38%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 343 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLRIWSMKQDNCVHDLQAHNKEIYTIKWSPT 402

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 403 G-------------------PGTNN----------------------PNANLMLASASFD 421

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S        SGS D    +W+T+  +
Sbjct: 422 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDG-RYLASGSFDKCVHIWNTQTGA 475

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 476 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 513



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTP---------EKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W+       H +    
Sbjct: 383 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQ 442

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFN 533
             V + AFSP G+ +A G  D    I+N
Sbjct: 443 EPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 433 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 491

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 492 NAAGDKVGASASDGSVC 508



>pir|AI2099|AI2099 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_683341 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 357

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 84/324 (25%), Positives = 142/324 (43%), Gaps = 6/324 (1%)
 Frame = +3

Query: 279  GPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVS--ASQDGRLIVWNALTSQKTHAI-KLPC 449
            G T+     +L  H+G+V SL ++P+   IVS  A  DG + +WN+ T ++   I K   
Sbjct: 54   GFTNPSLLHSLNAHSGRVKSLTFSPDSRTIVSGGAYNDGIIRLWNSTTGKRVGTINKAQK 113

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
              V +   SP GQ++A  G D++ +++NL        N+  +R+  GH    S      +
Sbjct: 114  NAVESLVISPDGQTLASSGSDNIINLWNLK-------NNQFTRSFVGHTA--SVMSLAVS 164

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             D  ++ S       +WD+   L+        +  +  D  ++S   S+     SG    
Sbjct: 165  SDGKVLVSGALDGIRVWDL---LQQRPLSTLVRFDNRIDTLAMS---SDGQTLASGDTKG 218

Query: 810  TACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS 989
               LW+     + +R F  H G V  + F PDG    + S D T +++ I    +L    
Sbjct: 219  VIKLWNLSTG-KLIREFTAHSGTVTDITFTPDGQNLISCSSDRTIKVWHI-PSEKLSRTL 276

Query: 990  QPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNS---HDGRI 1160
              H+    + V +IA +  G+ L +   +G   +WD       L+ G L N+   H   +
Sbjct: 277  TGHN----NWVNAIAINRDGKTLASAGRDG-IKLWD-------LSTGELLNTLIGHSDWV 324

Query: 1161 SCLGLSGDGSALCTGSWDTTLKIW 1232
            S +  S DG  L +G +D  + IW
Sbjct: 325  SAIAFSPDGKTLASGGFDGRISIW 348



>sp|Q9C0J8|W146_HUMAN WD-repeat protein WDC146.>gb:AB044749_1867154
            Homo sapiens mRNA for WDC146, complete cds.
          Length = 1336

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 87/325 (26%), Positives = 135/325 (41%), Gaps = 8/325 (2%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGKV----YSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            P + V  + ++  T KV    + + WTPE  R+V+ +  G   +WN LT      ++   
Sbjct: 102  PMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHD 161

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
            + V    +S     +           +  N+      N+   +    HK  +    + P 
Sbjct: 162  SPVRAMTWSHNDMWMLTADHGGYVKYWQSNM------NNV--KMFQAHKEAIREASFSPT 213

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             D    T S D T  +WD        +       GH ADV  V    +   + VSGS D+
Sbjct: 214  -DNKFATCSDDGTVRIWDFLRCHEERIL-----RGHGADVKCVDWHPTK-GLVVSGSKDS 266

Query: 810  TACL--WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-GHQLQ 980
               +  WD +   +++ T H H+  V+ VK   +GN   T S D  C+LFDIR    +LQ
Sbjct: 267  QQPIKFWDPKTG-QSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRNLKEELQ 325

Query: 981  VYSQPHSDNEVHRVTSIAFSISGRLLFA-GYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            V+            T++A+      LFA G ++G    W   + K V   G ++ +H+G 
Sbjct: 326  VFR-----GHKKEATAVAWHPVHEGLFASGGSDGSLLFWHVGVEKEV---GGMEMAHEGM 377

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            I  L     G  LC+GS D T K W
Sbjct: 378  IWSLAWHPLGHILCSGSNDHTSKFW 402



>sp|O15736|TIPD_DICDI Protein tipD.>pir|T08602|T08602 protein TipD -
            slime mold (Dictyostelium discoideum)>gb:AF019236_1233292
            Dictyostelium discoideum TipD (tipD) gene, complete cds.
          Length = 612

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 74/307 (24%), Positives = 134/307 (43%), Gaps = 1/307 (0%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH  ++Y + +    N + +   D  + VW+ ++ Q+   +      +++ +FSP  +S+
Sbjct: 322  GHNSEIYCMAFNSIGNLLATGGGDKCVKVWDVISGQQKSTLLGASQSIVSVSFSPNDESI 381

Query: 495  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG 674
                 D+   ++N  L     G S    TL+GH G V   +++ +    ++T S D+T  
Sbjct: 382  LGTSNDNSARLWNTEL-----GRS--RHTLTGHIGKVYTGKFINSN--RVVTGSHDRTIK 432

Query: 675  LWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVR 854
            LWD+  G  T      +      D+  V +  S T++  SG  D +   WD+        
Sbjct: 433  LWDLQKGYCTRTI---FCFSSCNDL--VILGGSGTHL-ASGHVDHSVRFWDSNAGEPTQV 486

Query: 855  TFHGHEGDVIAVKFFP-DGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSI 1031
                HEG + ++   P + N+  T S D T ++ DIRT   ++ +  P   N ++  T  
Sbjct: 487  LSSIHEGQITSITNSPTNTNQILTNSRDHTLKIIDIRTFDTIRTFKDPEYRNGLN-WTKA 545

Query: 1032 AFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            ++S  GR + +G  +G   +WD    K V  L  + N             +GS++C  SW
Sbjct: 546  SWSPDGRYIASGSIDGSICIWDATNGKTVKVLTKVHN-------------NGSSVCCCSW 592

Query: 1212 DTTLKIW 1232
                 I+
Sbjct: 593  SPLANIF 599



>gb:BC073215_2557068 Xenopus laevis cDNA clone MGC:80502
            IMAGE:5156883, complete cds.
          Length = 522

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 86/333 (25%), Positives = 141/333 (42%), Gaps = 25/333 (7%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 173  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPS 232

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 233  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 282

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 283  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 333

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQ 980
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++  H   
Sbjct: 334  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMK--HDTC 391

Query: 981  VYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLNLGS 1133
            V+     + E++   +I +S +G          +L +   +    +WD      +  L  
Sbjct: 392  VHDLQAHNKEIY---TIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTL-- 446

Query: 1134 LQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                H   +  +  S DG  L +GS+D  + IW
Sbjct: 447  --TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 477



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 273  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 332

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 333  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLKI 383

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 384  WSMKHDTCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 442

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 443  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 496

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 497  VCWNAAGDKVGASASDGSVCVLD 519



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 52/220 (23%), Positives = 86/220 (39%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 351 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKHDTCVHDLQAHNKEIYTIKWSPT 410

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 411 G-------------------PGTNN----------------------PNANLMLASASFD 429

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S     +  SGS D    +W+T+  +
Sbjct: 430 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDGRYL-ASGSFDKCVHIWNTQTGA 483

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 484 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 521



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 60/234 (25%), Positives = 94/234 (40%), Gaps = 16/234 (6%)
 Frame = +3

Query: 582  LSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI----TTG-----LRTSVFGGEYQSG 734
            L GH+  V  C + P  D  L + SGD T  +W++    T+G     LR  +  G     
Sbjct: 173  LRGHESEVFICAWNPVSDL-LASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVP 231

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDG 908
               DV+S+  ++  T +  +GS D  A +W  D  +AS    T   H+G + A+K+   G
Sbjct: 232  SNKDVTSLDWNSEGT-LLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWNKKG 286

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
            N   +   D T  ++D  TG   Q +         H   ++         FA  +   C 
Sbjct: 287  NFILSAGVDKTTIIWDAHTGEAKQQFP-------FHSAPALDVDWQSNNTFASCSTDMCI 339

Query: 1089 VWDTLLAKMVLNLGSLQ-----NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
                     V  LG  +       H   ++ +     G+ L + S D TLKIW+
Sbjct: 340  --------HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 385



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTP---------EKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W+       H +    
Sbjct: 391 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQ 450

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFN 533
             V + AFSP G+ +A G  D    I+N
Sbjct: 451 EPVYSVAFSPDGRYLASGSFDKCVHIWN 478



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 441 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 499

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 500 NAAGDKVGASASDGSVC 516



>gb:AY648770_2541598 Danio rerio FLJ11294-like mRNA, partial cds.
          Length = 557

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 86/325 (26%), Positives = 136/325 (41%), Gaps = 8/325 (2%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGKV----YSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
            P + V  + ++  T KV    + + WTPE  R+V+ +  G   +WN LT      ++   
Sbjct: 102  PMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHD 161

Query: 450  AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPN 629
            + V    +S     +           +  N+      N+   +    HK  +    + P 
Sbjct: 162  SLVRAMTWSHNYMWMLTADHGGYVKYWQSNM------NNV--KMFQAHKEAIREASFSPT 213

Query: 630  EDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDT 809
             D    T S D T  +WD        +       GH ADV  V    +   + VSGS D+
Sbjct: 214  -DNKFATCSDDGTVRIWDFLRCHEERIL-----RGHGADVKCVDWHPTK-GLVVSGSKDS 266

Query: 810  TACL--WDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRT-GHQLQ 980
               +  WD +   +++ T H H+  V+ VK+  +GN   T S D  C+LFDIR    +LQ
Sbjct: 267  QQPIKFWDPKTG-QSLATLHAHKNTVMEVKWNLNGNWLLTASRDHLCKLFDIRNLKEELQ 325

Query: 981  VYSQPHSDNEVHRVTSIAFSISGRLLFA-GYTNGDCYVWDTLLAKMVLNLGSLQNSHDGR 1157
            V+            T++A+      +FA G ++G    W   + K V   G ++ +H+G 
Sbjct: 326  VFR-----GHKKEATAVAWHPVHEGMFASGGSDGSLLFWHVGVEKEV---GGMEMAHEGM 377

Query: 1158 ISCLGLSGDGSALCTGSWDTTLKIW 1232
            I  L     G  LC+GS D T K W
Sbjct: 378  IWSLAWHPLGHILCSGSNDHTSKFW 402



>gb:AY225088_2520401 Xenopus laevis nuclear receptor co-repressor
            complex subunit TBLR1 mRNA, complete cds.
          Length = 519

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 86/333 (25%), Positives = 141/333 (42%), Gaps = 25/333 (7%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 170  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPS 229

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 230  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 279

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 280  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 330

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQ 980
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++  H   
Sbjct: 331  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMK--HDTC 388

Query: 981  VYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLNLGS 1133
            V+     + E++   +I +S +G          +L +   +    +WD      +  L  
Sbjct: 389  VHDLQAHNKEIY---TIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTL-- 443

Query: 1134 LQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                H   +  +  S DG  L +GS+D  + IW
Sbjct: 444  --TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 474



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 270  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 329

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 330  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLKI 380

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 381  WSMKHDTCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 439

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 440  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 493

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 494  VCWNAAGDKVGASASDGSVCVLD 516



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 52/220 (23%), Positives = 86/220 (39%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 348 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKHDTCVHDLQAHNKEIYTIKWSPT 407

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 408 G-------------------PGTNN----------------------PNANLMLASASFD 426

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S     +  SGS D    +W+T+  +
Sbjct: 427 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDGRYL-ASGSFDKCVHIWNTQTGA 480

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 481 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 518



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 61/240 (25%), Positives = 97/240 (40%), Gaps = 16/240 (6%)
 Frame = +3

Query: 564  STVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI----TTG-----LRTSVFG 716
            S+ +  L GH+  V  C + P  D  L + SGD T  +W++    T+G     LR  +  
Sbjct: 164  SSKAVVLRGHESEVFICAWNPVSDL-LASGSGDSTARIWNLSENSTSGSTQLVLRHCIRE 222

Query: 717  GEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW--DTRVASRAVRTFHGHEGDVIAV 890
            G        DV+S+  ++  T +  +GS D  A +W  D  +AS    T   H+G + A+
Sbjct: 223  GGQDVPSNKDVTSLDWNSEGT-LLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFAL 277

Query: 891  KFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGY 1070
            K+   GN   +   D T  ++D  TG   Q +         H   ++         FA  
Sbjct: 278  KWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFP-------FHSAPALDVDWQSNNTFASC 330

Query: 1071 TNGDCYVWDTLLAKMVLNLGSLQ-----NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
            +   C          V  LG  +       H   ++ +     G+ L + S D TLKIW+
Sbjct: 331  STDMCI--------HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 382



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTP---------EKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W+       H +    
Sbjct: 388 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQ 447

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFN 533
             V + AFSP G+ +A G  D    I+N
Sbjct: 448 EPVYSVAFSPDGRYLASGSFDKCVHIWN 475



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 438 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 496

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 497 NAAGDKVGASASDGSVC 513



>pir|T19776|T19776 hypothetical protein C36B1.5 - Caenorhabditis
            elegans>gb:CEC36B1_1361039 Caenorhabditis elegans cosmid
            C36B1, complete sequence.
          Length = 496

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 81/318 (25%), Positives = 140/318 (44%), Gaps = 9/318 (2%)
 Frame = +3

Query: 321  TGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKT-----HAIKLPCAWVMTCAFSPTG 485
            T  V   +++ +   IV+A   G + VW      +      H+ +  CA     AF+   
Sbjct: 204  TRPVAFCEFSADSEHIVTAGWSGSVAVWKREQCAQEIKFIGHSSQAGCARFHPGAFTQND 263

Query: 486  QS----VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITS 653
             S    V+C   D    +++L+         +    L  H   VS   + PN   HL T+
Sbjct: 264  YSSLNVVSCS-YDGTVLLWSLS-------QESPIGELEQHPQRVSKVAFHPNGH-HLATA 314

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
              D T  ++D+TT          YQ GH+  V+ V+     + + ++G  D    +WD R
Sbjct: 315  CFDSTWRMYDLTTKKELL-----YQEGHSKSVADVAFHPDGS-VALTGGHDCYGRVWDMR 368

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               R +    GH  ++ +V++ P+G    TGS D + +++D+R   +   Y+ P   + V
Sbjct: 369  TG-RCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRM--RRNTYTMPAHTSVV 425

Query: 1014 HRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSA 1193
             RV + A   +G+ L +   +    +W T   + +  L      HD RI C+ +S DG  
Sbjct: 426  TRVRADA---AGQYLVSASFDCTLKMWSTTGWQPLRQL----QGHDTRILCVDISPDGQW 478

Query: 1194 LCTGSWDTTLKIWAFGGY 1247
            +C+ ++D T K+WA   Y
Sbjct: 479  MCSSAFDRTFKLWAQSDY 496



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 59/268 (22%), Positives = 107/268 (39%), Gaps = 3/268 (1%)
 Frame = +3

Query: 456  VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDND---GNSTVSRTLSGHKGYVSACQYVP 626
            V  C FS   + +   G     +++            G+S+ +     H G  +   Y  
Sbjct: 207  VAFCEFSADSEHIVTAGWSGSVAVWKREQCAQEIKFIGHSSQAGCARFHPGAFTQNDY-- 264

Query: 627  NEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCD 806
                ++++ S D T  LW ++   + S  G   Q  H   VS V+    N +   +   D
Sbjct: 265  -SSLNVVSCSYDGTVLLWSLS---QESPIGELEQ--HPQRVSKVAFHP-NGHHLATACFD 317

Query: 807  TTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVY 986
            +T  ++D       +    GH   V  V F PDG+   TG  D   R++D+RTG  +   
Sbjct: 318  STWRMYDLTTKKELLYQ-EGHSKSVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFL 376

Query: 987  SQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISC 1166
                 D     + S+ +  +G  +  G ++    VWD  + +    + +    H   ++ 
Sbjct: 377  -----DGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMPA----HTSVVTR 427

Query: 1167 LGLSGDGSALCTGSWDTTLKIWAFGGYR 1250
            +     G  L + S+D TLK+W+  G++
Sbjct: 428  VRADAAGQYLVSASFDCTLKMWSTTGWQ 455



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 27/128 (21%), Positives = 52/128 (40%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C   L GHT +++S++W P    +++ S D  + VW+    + T+ +    + V      
Sbjct: 372 CIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMPAHTSVVTRVRAD 431

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             GQ +     D    +++              R L GH   +  C  +  +   + +S+
Sbjct: 432 AAGQYLVSASFDCTLKMWSTT-------GWQPLRQLQGHDTRI-LCVDISPDGQWMCSSA 483

Query: 657 GDKTCGLW 680
            D+T  LW
Sbjct: 484 FDRTFKLW 491



>sp|Q55563|Y163_SYNY3 Hypothetical WD-repeat protein
            sll0163.>pir|S76086|S76086 beta transducin-like protein,
            190K - Synechocystis sp.  (strain PCC
            6803)>gb:BA000022_689453 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 1693

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 75/277 (27%), Positives = 124/277 (44%), Gaps = 3/277 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH   V ++ ++P+   IV+AS+DG   VWN  T ++   ++     +    FS  GQ
Sbjct: 1420 LRGHQDAVLNVRFSPDSQYIVTASKDGTARVWNN-TGRELAVLRHYEKNIFAAEFSADGQ 1478

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLS---GHKGYVSACQYVPNEDAHLITSSG 659
             +     D+   I+ +           V R +    GH+G V   Q+   +  +++T+S 
Sbjct: 1479 FIVTASDDNTAGIWEI-----------VGREVGICRGHEGPVYFAQFSA-DSRYILTASV 1526

Query: 660  DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVA 839
            D T  +WD       ++      +GH + V     S    N+  + S D TA LWD   +
Sbjct: 1527 DNTARIWDFLGRPLLTL------AGHQSIVYQARFSPEG-NLIATVSADHTARLWDR--S 1577

Query: 840  SRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHR 1019
             + V   +GH+G V  V + PDG    T S+DGT RL+D+ +G +L        +   + 
Sbjct: 1578 GKTVAVLYGHQGLVGTVDWSPDGQMLVTASNDGTARLWDL-SGRELLTL-----EGHGNW 1631

Query: 1020 VTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLG 1130
            V S  FS  GR +     +G   +W       +L+ G
Sbjct: 1632 VRSAEFSPDGRWVLTSSADGTAKLWPVKTLPQLLSQG 1668



 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 84/316 (26%), Positives = 133/316 (42%)
 Frame = +3

Query: 285  TDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMT 464
            T+  C   L  H G V    ++P+   IV+ S D    +WN L  +K   ++     V+ 
Sbjct: 1371 TEGECVAVLADHQGWVREGQFSPDGQWIVTGSADKTAQLWNVL-GKKLTVLRGHQDAVLN 1429

Query: 465  CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHL 644
              FSP  Q +     D    ++N      N G       L  ++  + A ++   +   +
Sbjct: 1430 VRFSPDSQYIVTASKDGTARVWN------NTGRELA--VLRHYEKNIFAAEF-SADGQFI 1480

Query: 645  ITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW 824
            +T+S D T G+W+I  G    +       GH   V     SA ++   ++ S D TA +W
Sbjct: 1481 VTASDDNTAGIWEI-VGREVGIC-----RGHEGPVYFAQFSA-DSRYILTASVDNTARIW 1533

Query: 825  DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
            D     R + T  GH+  V   +F P+GN   T S D T RL+D R+G  + V       
Sbjct: 1534 D--FLGRPLLTLAGHQSIVYQARFSPEGNLIATVSADHTARLWD-RSGKTVAVLY----- 1585

Query: 1005 NEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGD 1184
                 V ++ +S  G++L     +G   +WD L  + +L L      H   +     S D
Sbjct: 1586 GHQGLVGTVDWSPDGQMLVTASNDGTARLWD-LSGRELLTL----EGHGNWVRSAEFSPD 1640

Query: 1185 GSALCTGSWDTTLKIW 1232
            G  + T S D T K+W
Sbjct: 1641 GRWVLTSSADGTAKLW 1656



 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 89/353 (25%), Positives = 139/353 (39%), Gaps = 37/353 (10%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWN----ALTSQKTHAIKLPCAWVMT 464
            C   L+GH   V +  W+P+   I+++S DG   VW+     L + + H   +  A    
Sbjct: 1211 CFAVLKGHQNWVNNALWSPDGQHIITSSSDGTARVWSRHGKCLGTLRGHDHNIHGA---- 1266

Query: 465  CAFSPTGQSVACGGLDSVC------------------SIFNLNLPPDNDGNSTVSR---- 578
              FS  GQ +     D+                     +++ +   D     TVS     
Sbjct: 1267 -RFSLDGQKIVTYSTDNTARLWTKEGTLLTILRGHQKEVYDADFSADGRFVFTVSADQTA 1325

Query: 579  -----------TLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEY 725
                       TL+GH  +V    + P  D  L+T S DKT  LW  T G   +V     
Sbjct: 1326 RQWDISQKDTITLTGHSHWVRNAHFNPKGD-RLLTVSRDKTARLWT-TEGECVAVL---- 1379

Query: 726  QSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPD 905
             + H   V     S       V+GS D TA LW+  V  + +    GH+  V+ V+F PD
Sbjct: 1380 -ADHQGWVREGQFSPDG-QWIVTGSADKTAQLWN--VLGKKLTVLRGHQDAVLNVRFSPD 1435

Query: 906  GNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDC 1085
                 T S DGT R+++  TG +L V      +     + +  FS  G+ +     +   
Sbjct: 1436 SQYIVTASKDGTARVWN-NTGRELAVLRHYEKN-----IFAAEFSADGQFIVTASDDNTA 1489

Query: 1086 YVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
             +W+ +  ++ +  G     H+G +     S D   + T S D T +IW F G
Sbjct: 1490 GIWEIVGREVGICRG-----HEGPVYFAQFSADSRYILTASVDNTARIWDFLG 1537



 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 79/319 (24%), Positives = 127/319 (39%), Gaps = 7/319 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GH+  V +  + P+ +R+++ S+D    +W     +    +     WV    FSP GQ
Sbjct: 1338 LTGHSHWVRNAHFNPKGDRLLTVSRDKTARLWTT-EGECVAVLADHQGWVREGQFSPDGQ 1396

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +  G  D    ++N+               L GH+  V   ++ P+   +++T+S D T
Sbjct: 1397 WIVTGSADKTAQLWNVL--------GKKLTVLRGHQDAVLNVRFSPDSQ-YIVTASKDGT 1447

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              +W+  TG   +V     ++   A+ S+      +    V+ S D TA +W+  +  R 
Sbjct: 1448 ARVWN-NTGRELAVLRHYEKNIFAAEFSA------DGQFIVTASDDNTAGIWE--IVGRE 1498

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR-------TGHQLQVYSQPHSDN 1007
            V    GHEG V   +F  D     T S D T R++D          GHQ  VY       
Sbjct: 1499 VGICRGHEGPVYFAQFSADSRYILTASVDNTARIWDFLGRPLLTLAGHQSIVYQA----- 1553

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                     FS  G L+     +    +WD     + +  G     H G +  +  S DG
Sbjct: 1554 --------RFSPEGNLIATVSADHTARLWDRSGKTVAVLYG-----HQGLVGTVDWSPDG 1600

Query: 1188 SALCTGSWDTTLKIWAFGG 1244
              L T S D T ++W   G
Sbjct: 1601 QMLVTASNDGTARLWDLSG 1619



 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 81/319 (25%), Positives = 126/319 (39%), Gaps = 7/319 (2%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH   V S+ ++P    +V++ QD    +WN    Q T   +    WV    F+  GQ
Sbjct: 1092 LRGHEDWVRSVHFSPHHQFLVTSGQDNTARIWNFAGEQLT-LCQGHADWVRNAEFNCHGQ 1150

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    +++L      +G         GH  +V   Q+ P +   ++T S D T
Sbjct: 1151 ILLTASRDGTARLWDL------EGREI--GLCQGHTSWVRNAQFSP-DGQWIVTCSADGT 1201

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              LWD+++     +       GH   V++   S    ++  S S D TA +W      + 
Sbjct: 1202 ARLWDLSSQCFAVL------KGHQNWVNNALWSPDGQHIITSSS-DGTARVWSRH--GKC 1252

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLF-------DIRTGHQLQVYSQPHSDN 1007
            + T  GH+ ++   +F  DG +  T S D T RL+        I  GHQ +VY       
Sbjct: 1253 LGTLRGHDHNIHGARFSLDGQKIVTYSTDNTARLWTKEGTLLTILRGHQKEVYDAD---- 1308

Query: 1008 EVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDG 1187
                     FS  GR +F    +     WD      +   G   +SH  R +     GD 
Sbjct: 1309 ---------FSADGRFVFTVSADQTARQWDISQKDTITLTG---HSHWVRNAHFNPKGD- 1355

Query: 1188 SALCTGSWDTTLKIWAFGG 1244
              L T S D T ++W   G
Sbjct: 1356 -RLLTVSRDKTARLWTTEG 1373



 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 81/312 (25%), Positives = 127/312 (40%), Gaps = 4/312 (1%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L+GH   + +LDW+ +     +AS D  + +W     ++   ++    WV +  FSP  Q
Sbjct: 1051 LRGHQEAITALDWSADGQYFATASADHTVKLWQR-HGEEVATLRGHEDWVRSVHFSPHHQ 1109

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTL-SGHKGYVSACQYVPNEDAHLITSSGDK 665
             +   G D+   I+N          +    TL  GH  +V   ++  +    L+T+S D 
Sbjct: 1110 FLVTSGQDNTARIWNF---------AGEQLTLCQGHADWVRNAEFNCHGQI-LLTASRDG 1159

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASR 845
            T  LWD+  G    +       GHT+ V +   S       V+ S D TA LWD  ++S+
Sbjct: 1160 TARLWDL-EGREIGLC-----QGHTSWVRNAQFSPDG-QWIVTCSADGTARLWD--LSSQ 1210

Query: 846  AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
                  GH+  V    + PDG    T S DGT R++  R G  L            H + 
Sbjct: 1211 CFAVLKGHQNWVNNALWSPDGQHIITSSSDGTARVWS-RHGKCLGTLR-----GHDHNIH 1264

Query: 1026 SIAFSISGRLLFAGYTNGDCYVW---DTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSAL 1196
               FS+ G+ +    T+    +W    TLL        ++   H   +     S DG  +
Sbjct: 1265 GARFSLDGQKIVTYSTDNTARLWTKEGTLL--------TILRGHQKEVYDADFSADGRFV 1316

Query: 1197 CTGSWDTTLKIW 1232
             T S D T + W
Sbjct: 1317 FTVSADQTARQW 1328



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 65/232 (28%), Positives = 99/232 (42%), Gaps = 10/232 (4%)
 Frame = +3

Query: 579  TLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQS---GHTADV 749
            TL GH+ +V +  + P+    L+TS  D T  +W+         F GE  +   GH   V
Sbjct: 1091 TLRGHEDWVRSVHFSPHHQ-FLVTSGQDNTARIWN---------FAGEQLTLCQGHADWV 1140

Query: 750  SSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS 929
             +   +     + ++ S D TA LWD  +  R +    GH   V   +F PDG    T S
Sbjct: 1141 RNAEFNCHG-QILLTASRDGTARLWD--LEGREIGLCQGHTSWVRNAQFSPDGQWIVTCS 1197

Query: 930  DDGTCRLFDIRT-------GHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
             DGT RL+D+ +       GHQ             + V +  +S  G+ +    ++G   
Sbjct: 1198 ADGTARLWDLSSQCFAVLKGHQ-------------NWVNNALWSPDGQHIITSSSDGTAR 1244

Query: 1089 VWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
            VW    ++    LG+L+  HD  I     S DG  + T S D T ++W   G
Sbjct: 1245 VW----SRHGKCLGTLR-GHDHNIHGARFSLDGQKIVTYSTDNTARLWTKEG 1291



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 42/152 (27%), Positives = 70/152 (46%), Gaps = 1/152 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVM-TCAFSPTG 485
            L GH   VY   ++PE N I + S D    +W+   S KT A+      ++ T  +SP G
Sbjct: 1543 LAGHQSIVYQARFSPEGNLIATVSADHTARLWDR--SGKTVAVLYGHQGLVGTVDWSPDG 1600

Query: 486  QSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDK 665
            Q +     D    +++L+      G   +  TL GH  +V + ++ P +   ++TSS D 
Sbjct: 1601 QMLVTASNDGTARLWDLS------GRELL--TLEGHGNWVRSAEFSP-DGRWVLTSSADG 1651

Query: 666  TCGLWDITTGLRTSVFGGEYQSGHTADVSSVS 761
            T  LW + T  +    GG++   +    + VS
Sbjct: 1652 TAKLWPVKTLPQLLSQGGQWLKNYLTHNALVS 1683



 Score = 42.7 bits (99), Expect = 0.018
 Identities = 41/173 (23%), Positives = 69/173 (39%), Gaps = 3/173 (1%)
 Frame = +3

Query: 735  HTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPD 905
            H   V+ + IS S  N   + ++ + +  A LW        +    GH+  + A+ +  D
Sbjct: 1009 HEGPVTVLRISPSMENTPPLVLTATTNGIAYLWSFH--GELINVLRGHQEAITALDWSAD 1066

Query: 906  GNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDC 1085
            G  F T S D T +L+  R G ++    + H D     V S+ FS   + L     +   
Sbjct: 1067 GQYFATASADHTVKLWQ-RHGEEVATL-RGHED----WVRSVHFSPHHQFLVTSGQDNTA 1120

Query: 1086 YVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGG 1244
             +W+    ++ L  G      +   +C      G  L T S D T ++W   G
Sbjct: 1121 RIWNFAGEQLTLCQGHADWVRNAEFNC-----HGQILLTASRDGTARLWDLEG 1168



>gb:AX882446_1478938 Sequence 17351 from Patent
            EP1074617.>gb:AK022956_1909398 Homo sapiens cDNA FLJ12894
            fis, clone NT2RP2004170, moderately similar to Homo
            sapiens mRNA for transducin (beta) like 1 protein.
          Length = 514

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 86/336 (25%), Positives = 141/336 (41%), Gaps = 28/336 (8%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 165  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPS 224

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 225  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 274

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 275  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 325

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---H 971
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++     H
Sbjct: 326  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVH 385

Query: 972  QLQVYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLN 1124
             LQ +++         + +I +S +G          +L +   +    +WD      +  
Sbjct: 386  DLQAHNK--------EIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHT 437

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            L      H   +  +  S DG  L +GS+D  + IW
Sbjct: 438  L----TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 469



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 265  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 324

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 325  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLKI 375

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 376  WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 434

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 435  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 488

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 489  VCWNAAGDKVGASASDGSVCVLD 511



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 52/220 (23%), Positives = 85/220 (38%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 343 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPT 402

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 403 G-------------------PGTNN----------------------PNANLMLASASFD 421

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S        SGS D    +W+T+  +
Sbjct: 422 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDG-RYLASGSFDKCVHIWNTQTGA 475

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 476 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 513



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 60/234 (25%), Positives = 94/234 (40%), Gaps = 16/234 (6%)
 Frame = +3

Query: 582  LSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI----TTG-----LRTSVFGGEYQSG 734
            L GH+  V  C + P  D  L + SGD T  +W++    T+G     LR  +  G     
Sbjct: 165  LRGHESEVFICAWNPVSDL-LASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVP 223

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDG 908
               DV+S+  ++  T +  +GS D  A +W  D  +AS    T   H+G + A+K+   G
Sbjct: 224  SNKDVTSLDWNSEGT-LLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWNKKG 278

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
            N   +   D T  ++D  TG   Q +         H   ++         FA  +   C 
Sbjct: 279  NFILSAGVDKTTIIWDAHTGEAKQQFP-------FHSAPALDVDWQSNNTFASCSTDMCI 331

Query: 1089 VWDTLLAKMVLNLGSLQ-----NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
                     V  LG  +       H   ++ +     G+ L + S D TLKIW+
Sbjct: 332  --------HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 377



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTP---------EKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W+       H +    
Sbjct: 383 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQ 442

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFN 533
             V + AFSP G+ +A G  D    I+N
Sbjct: 443 EPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 433 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 491

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 492 NAAGDKVGASASDGSVC 508



>gb:CQ783423_1452458 Sequence 3563 from Patent
            EP1396543.>gb:AK075289_1913011 Homo sapiens cDNA FLJ90808
            fis, clone Y79AA1000777, weakly similar to VEGETATIBLE
            INCOMPATIBILITY PROTEIN HET-E-1.
          Length = 407

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 81/310 (26%), Positives = 128/310 (41%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R+ +GH   V  +D++    ++ S S D  L+VW+     + +        V    FSP+
Sbjct: 13   RHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFSPS 72

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G  +A G  D    I+     P+  G STV R  +     V  C    ++    +T+S D
Sbjct: 73   GHLLASGSRDKTVRIW----VPNVKGESTVFRAHTATVRSVHFC----SDGQSFVTASDD 124

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            KT  +W   T  +  +F     S H   V     S     + VS S D T  LWD + + 
Sbjct: 125  KTVKVW--ATHRQKFLFS---LSQHINWVRCAKFSPDG-RLIVSASDDKTVKLWD-KSSR 177

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRV 1022
              V ++  H G V  V F P G        D T +++D+RT   LQ Y Q HS      V
Sbjct: 178  ECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTYRLLQHY-QLHS----AAV 232

Query: 1023 TSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCT 1202
              ++F  SG  L    ++    + D +  +++  L    + H G  + +  S  G    +
Sbjct: 233  NGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTL----HGHQGPATTVAFSRTGEYFAS 288

Query: 1203 GSWDTTLKIW 1232
            G  D  + +W
Sbjct: 289  GGSDEQVMVW 298



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 58/228 (25%), Positives = 92/228 (40%)
 Frame = +3

Query: 567  TVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTAD 746
            ++ R   GH+  V+   +  N    L + S D    +W +    R   F     +GH   
Sbjct: 10   SLERHFKGHRDAVTCVDFSINTK-QLASGSMDSCLMVWHMKPQSRAYRF-----TGHKDA 63

Query: 747  VSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTG 926
            V+ V+ S S  ++  SGS D T  +W   V   +   F  H   V +V F  DG  F T 
Sbjct: 64   VTCVNFSPSG-HLLASGSRDKTVRIWVPNVKGEST-VFRAHTATVRSVHFCSDGQSFVTA 121

Query: 927  SDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLL 1106
            SDD T +++       L   SQ      ++ V    FS  GRL+ +   +    +WD   
Sbjct: 122  SDDKTVKVWATHRQKFLFSLSQ-----HINWVRCAKFSPDGRLIVSASDDKTVKLWDKSS 176

Query: 1107 AKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYR 1250
             + V +       H G ++ +     G+ +     D T+K+W    YR
Sbjct: 177  RECVHSYCE----HGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTYR 220



 Score = 37.7 bits (86), Expect = 0.59
 Identities = 30/116 (25%), Positives = 46/116 (39%)
 Frame = +3

Query: 252 SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTH 431
           S  KT   +  +   C  +   H G V  +D+ P    I +A  D  + VW+  T +   
Sbjct: 164 SDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVRTYRLLQ 223

Query: 432 AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKG 599
             +L  A V   +F P+G  +     DS   I +L           +  TL GH+G
Sbjct: 224 HYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLM-------EGRLLYTLHGHQG 272



 Score = 37.0 bits (84), Expect = 1.0
 Identities = 23/89 (25%), Positives = 40/89 (44%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           ++ Q H+  V  L + P  N +++AS D  L + + +  +  + +        T AFS T
Sbjct: 223 QHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRT 282

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNST 569
           G+  A GG D    ++  N    + G  T
Sbjct: 283 GEYFASGGSDEQVMVWKSNFDIVDHGEVT 311



>gb:AE014296_1135687 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003549_1215020 Drosophila melanogaster
            chromosome 3L, section 36 of 83 of the complete
            sequence.>gb:AF346730_1264337 Drosophila melanogaster
            cannonball mRNA, complete cds.
          Length = 942

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 70/221 (31%), Positives = 106/221 (47%)
 Frame = +3

Query: 576  RTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSS 755
            RTL GH+G V  C + P ED  LIT S D +  LW + +     +F     SGH A V  
Sbjct: 620  RTLYGHQGPVYGCSFNP-EDRFLITCSEDFSVRLWCLLSWSCVVIF-----SGHLAPVCF 673

Query: 756  VSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDD 935
            V + A     F + S D TA +W  +  ++  R   GH  ++    F P+ +   TGS D
Sbjct: 674  V-VFAPRGYYFATASDDCTARVW-MQDNTKPARILQGHLAELGVCLFHPNRHYMATGSAD 731

Query: 936  GTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKM 1115
             T R++DI    Q++++    S     R+T++ +SI GR L +G  +    +WDT  A  
Sbjct: 732  CTVRIWDIVKAVQVRIFRGHKS-----RITALIYSICGRYLVSGGDDNLIMIWDT--ANE 784

Query: 1116 VLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            +L      + H   I+ + +S D + L  G  D  L +W F
Sbjct: 785  ILM--QFFDHHKASINTMEISLDNNILVVGGQDCQLTLWDF 823



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 56/218 (25%), Positives = 89/218 (40%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            R L GH G VY   + PE   +++ S+D  + +W  L+           A V    F+P 
Sbjct: 620  RTLYGHQGPVYGCSFNPEDRFLITCSEDFSVRLWCLLSWSCVVIFSGHLAPVCFVVFAPR 679

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
            G   A    D    ++          N+  +R L GH   +  C + PN   ++ T S D
Sbjct: 680  GYYFATASDDCTARVW-------MQDNTKPARILQGHLAELGVCLFHPNRH-YMATGSAD 731

Query: 663  KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
             T  +WDI   ++  +F G ++S  TA + S+          VSG  D    +WDT    
Sbjct: 732  CTVRIWDIVKAVQVRIFRG-HKSRITALIYSIC-----GRYLVSGGDDNLIMIWDT-ANE 784

Query: 843  RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
              ++ F  H+  +  ++   D N    G  D    L+D
Sbjct: 785  ILMQFFDHHKASINTMEISLDNNILVVGGQDCQLTLWD 822



 Score = 47.0 bits (110), Expect = 0.001
 Identities = 41/177 (23%), Positives = 66/177 (37%)
 Frame = +3

Query: 297  CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
            C     GH   V  + + P      +AS D    VW    ++    ++   A +  C F 
Sbjct: 660  CVVIFSGHLAPVCFVVFAPRGYYFATASDDCTARVWMQDNTKPARILQGHLAELGVCLFH 719

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
            P    +A G  D    I+++         +   R   GHK  ++A  Y      +L++  
Sbjct: 720  PNRHYMATGSADCTVRIWDI-------VKAVQVRIFRGHKSRITALIY-SICGRYLVSGG 771

Query: 657  GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD 827
             D    +WD    +    F       H A ++++ IS  N N+ V G  D    LWD
Sbjct: 772  DDNLIMIWDTANEILMQFF-----DHHKASINTMEISLDN-NILVVGGQDCQLTLWD 822



>sp|Q9BZK7|TBLR_HUMAN F-box-like/WD-repeat protein TBLR1 (Nuclear
            receptor corepressor/HDAC3 complex subunit TBLR1)
            (TBL1-related protein 1).>gb:AF314544_1896406 Homo
            sapiens nuclear receptor co-repressor/HDAC3 complex
            subunit TBLR1 (TBLR1) mRNA, complete cds.
          Length = 514

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 86/336 (25%), Positives = 141/336 (41%), Gaps = 28/336 (8%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 165  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPS 224

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 225  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 274

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 275  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 325

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---H 971
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++     H
Sbjct: 326  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVH 385

Query: 972  QLQVYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLN 1124
             LQ +++         + +I +S +G          +L +   +    +WD      +  
Sbjct: 386  DLQAHNK--------EIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHT 437

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            L      H   +  +  S DG  L +GS+D  + IW
Sbjct: 438  L----TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 469



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 265  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 324

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 325  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLKI 375

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 376  WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 434

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 435  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 488

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 489  VCWNAAGDKVGASASDGSVCVLD 511



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 52/220 (23%), Positives = 85/220 (38%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 343 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPT 402

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 403 G-------------------PGTNN----------------------PNANLMLASASFD 421

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S        SGS D    +W+T+  +
Sbjct: 422 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDG-RYLASGSFDKCVHIWNTQTGA 475

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 476 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 513



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 60/234 (25%), Positives = 94/234 (40%), Gaps = 16/234 (6%)
 Frame = +3

Query: 582  LSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI----TTG-----LRTSVFGGEYQSG 734
            L GH+  V  C + P  D  L + SGD T  +W++    T+G     LR  +  G     
Sbjct: 165  LRGHESEVFICAWNPVSDL-LASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVP 223

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDG 908
               DV+S+  ++  T +  +GS D  A +W  D  +AS    T   H+G + A+K+   G
Sbjct: 224  SNKDVTSLDWNSEGT-LLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWNKKG 278

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
            N   +   D T  ++D  TG   Q +         H   ++         FA  +   C 
Sbjct: 279  NFILSAGVDKTTIIWDAHTGEAKQQFP-------FHSAPALDVDWQSNNTFASCSTDMCI 331

Query: 1089 VWDTLLAKMVLNLGSLQ-----NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
                     V  LG  +       H   ++ +     G+ L + S D TLKIW+
Sbjct: 332  --------HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 377



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTP---------EKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W+       H +    
Sbjct: 383 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQ 442

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFN 533
             V + AFSP G+ +A G  D    I+N
Sbjct: 443 EPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 433 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 491

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 492 NAAGDKVGASASDGSVC 508



>sp|O22212|PRP4_ARATH Hypothetical Trp-Asp repeats containing protein
            At2g41500.>pir|T00806|T02445 probable U4/U6 small nuclear
            ribonucleoprotein [imported] - Arabidopsis
            thaliana>gb:AC002510_1530774 Arabidopsis thaliana
            chromosome 2 clone T32G6 map CIC11C08, complete
            sequence.>gb:AC004625_1531915 Arabidopsis thaliana
            chromosome 2 clone T26J13 map CIC11C08, complete
            sequence.>gb:BT020589_1642983 Arabidopsis thaliana
            At2g41500 gene, complete cds.
          Length = 554

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 72/260 (27%), Positives = 114/260 (43%), Gaps = 2/260 (0%)
 Frame = +3

Query: 471  FSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLIT 650
            FSP    +A    D    ++        DG  T+ +T  GH   ++   + P+   +L T
Sbjct: 306  FSPVDDCLATASADRTAKLWK------TDG--TLLQTFEGHLDRLARVAFHPS-GKYLGT 356

Query: 651  SSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC--DTTACLW 824
            +S DKT  LWDI TG    +     Q GH+  V  ++         ++ SC  D+ A +W
Sbjct: 357  TSYDKTWRLWDINTGAELLL-----QEGHSRSVYGIAFQQDGA---LAASCGLDSLARVW 408

Query: 825  DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
            D R   R++  F GH   V +V F P+G    +G +D  CR++D+R    L  Y  P   
Sbjct: 409  DLRTG-RSILVFQGHIKPVFSVNFSPNGYHLASGGEDNQCRIWDLRMRKSL--YIIPAHA 465

Query: 1005 NEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGD 1184
            N V +V        G  L     +    +W      +V +L      H+ +++ L ++ D
Sbjct: 466  NLVSQVK--YEPQEGYFLATASYDMKVNIWSGRDFSLVKSLA----GHESKVASLDITAD 519

Query: 1185 GSALCTGSWDTTLKIWAFGG 1244
             S + T S D T+K+W   G
Sbjct: 520  SSCIATVSHDRTIKLWTSSG 539



 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 45/171 (26%), Positives = 75/171 (43%)
 Frame = +3

Query: 312 QGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQS 491
           +GH+  VY + +  +     S   D    VW+  T +     +     V +  FSP G  
Sbjct: 378 EGHSRSVYGIAFQQDGALAASCGLDSLARVWDLRTGRSILVFQGHIKPVFSVNFSPNGYH 437

Query: 492 VACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
           +A GG D+ C I++L +             +  H   VS  +Y P E   L T+S D   
Sbjct: 438 LASGGEDNQCRIWDLRMRKS-------LYIIPAHANLVSQVKYEPQEGYFLATASYDMKV 490

Query: 672 GLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLW 824
            +W   +G   S+   +  +GH + V+S+ I+A +++   + S D T  LW
Sbjct: 491 NIW---SGRDFSLV--KSLAGHESKVASLDITA-DSSCIATVSHDRTIKLW 535



 Score = 37.4 bits (85), Expect = 0.77
 Identities = 31/147 (21%), Positives = 56/147 (38%)
 Frame = +3

Query: 819  LWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPH 998
            LW+    +  +     H+     V F P  +   T S D T +L+    G  LQ +    
Sbjct: 281  LWEMPQVTNTIAVLKDHKERATDVVFSPVDDCLATASADRTAKLWKT-DGTLLQTF---- 335

Query: 999  SDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLS 1178
             +  + R+  +AF  SG+ L     +    +WD      +L    LQ  H   +  +   
Sbjct: 336  -EGHLDRLARVAFHPSGKYLGTTSYDKTWRLWDINTGAELL----LQEGHSRSVYGIAFQ 390

Query: 1179 GDGSALCTGSWDTTLKIWAFGGYRQVI 1259
             DG+   +   D+  ++W     R ++
Sbjct: 391  QDGALAASCGLDSLARVWDLRTGRSIL 417



>sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein beta
            subunit-like protein (Receptor of activated protein
            kinase C).>pir|T43299|T43299 probable GTP-binding
            regulatory protein beta chain - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC6B12_1718243 S.pombe
            chromosome I cosmid c6B12.
          Length = 314

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 88/330 (26%), Positives = 136/330 (41%), Gaps = 13/330 (3%)
 Frame = +3

Query: 282  PTDLVCCRNLQGHTGKVYSLDWTPEK-NRIVSASQDGRLIVWNALTSQKTHAIKL----- 443
            P  LV    L+GH+G V SL   PE  + ++S S+D  +I+WN +     + +       
Sbjct: 2    PEQLVLRATLEGHSGWVTSLSTAPENPDILLSGSRDKSIILWNLVRDDVNYGVAQRRLTG 61

Query: 444  PCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYV 623
               +V  CA S           D    +++L            +    GH   V +    
Sbjct: 62   HSHFVSDCALSFDSHYALSASWDKTIRLWDLE-------KGECTHQFVGHTSDVLSVSIS 114

Query: 624  PNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNM-FVSGS 800
            P ++  +++ S DKT  +W+I    + ++  G    GH+  VS V  S +  N+ FVS  
Sbjct: 115  P-DNRQVVSGSRDKTIKIWNIIGNCKYTITDG----GHSDWVSCVRFSPNPDNLTFVSAG 169

Query: 801  CDTTACLWDTRVASRAVRTFH-GHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQL 977
             D    +WD    S  +RT H GH G V AV   PDG+   +G  DGT  L+D+     L
Sbjct: 170  WDKAVKVWDLETFS--LRTSHYGHTGYVSAVTISPDGSLCASGGRDGTLMLWDLNESTHL 227

Query: 978  QVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNL-----GSLQN 1142
              YS     N    + ++ FS   R      T     ++D    + V  L     G  + 
Sbjct: 228  --YSLEAKAN----INALVFS-PNRYWLCAATGSSIRIFDLETQEKVDELTVDFVGVGKK 280

Query: 1143 SHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            S +     L  S DG  L +G  D  +++W
Sbjct: 281  SSEPECISLTWSPDGQTLFSGWTDNLIRVW 310



>gb:BC075548_2558648 Xenopus tropicalis MGC89488 protein, mRNA (cDNA
            clone MGC:89488 IMAGE:6992155), complete cds.
          Length = 379

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 84/314 (26%), Positives = 140/314 (44%), Gaps = 4/314 (1%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLP-CAWVMTCA-FS 476
            R+ +GH   V  +D++P+  ++ S+S D  +++WN     ++ A K P     +TC  FS
Sbjct: 12   RHFKGHKDAVTYVDFSPDGKQLASSSADACVMIWN--FKPQSRAYKYPGHKEAVTCVQFS 69

Query: 477  PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAH-LITS 653
            P+G  VA    D    ++     P+  G S+V   L  H   V    +  + D H  IT+
Sbjct: 70   PSGHLVASSSKDRTVRLW----APNIKGESSV---LKAHTAVVRCVNF--SSDGHTFITA 120

Query: 654  SGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            S DK+   W++    +  ++     + HT  V     S     +  S S D T  +WD  
Sbjct: 121  SDDKSIKAWNLHR--QRFLYS---LTEHTNWVRCARFSPDG-RLIASCSDDKTVRIWD-- 172

Query: 834  VASR-AVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE 1010
            + +R  + TF  ++G    V F P G    +   D T +++DIRT   LQ Y Q H+   
Sbjct: 173  ITNRLCINTFVDYKGHSNYVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQHY-QVHNAG- 230

Query: 1011 VHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGS 1190
               V S++F  SG  L     +G   + D L  +++  L    + H G +  +  S  G 
Sbjct: 231  ---VNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTL----HGHQGPVLSVAFSKSGD 283

Query: 1191 ALCTGSWDTTLKIW 1232
               +G+ D  + +W
Sbjct: 284  QFASGATDAQVLVW 297



 Score = 37.4 bits (85), Expect = 0.77
 Identities = 22/84 (26%), Positives = 40/84 (47%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           ++ Q H   V SL + P  N +++AS DG + + + L  +  + +      V++ AFS +
Sbjct: 222 QHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKS 281

Query: 483 GQSVACGGLDSVCSIFNLNLPPDN 554
           G   A G  D+   ++  N    N
Sbjct: 282 GDQFASGATDAQVLVWKTNFDKYN 305



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 29/128 (22%), Positives = 52/128 (40%)
 Frame = +3

Query: 252 SQGKTPISFGPTDLVCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTH 431
           S  KT   +  T+ +C      + G    +D+ P    + SA  D  + VW+  T++   
Sbjct: 163 SDDKTVRIWDITNRLCINTFVDYKGHSNYVDFNPMGTCVASAGVDSTVKVWDIRTNKLLQ 222

Query: 432 AIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSA 611
             ++  A V + +F P+G  +     D    I +L           +  TL GH+G V +
Sbjct: 223 HYQVHNAGVNSLSFHPSGNYLLTASNDGTVKILDLL-------EGRLIYTLHGHQGPVLS 275

Query: 612 CQYVPNED 635
             +  + D
Sbjct: 276 VAFSKSGD 283



>gb:AJ719937_2502124 Gallus gallus mRNA for hypothetical protein,
            clone 8j10.
          Length = 473

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 87/338 (25%), Positives = 138/338 (40%), Gaps = 30/338 (8%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 164  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPS 223

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 224  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 273

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 274  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 324

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---H 971
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++     H
Sbjct: 325  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDSCVH 384

Query: 972  QLQVYSQ-----------PHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMV 1118
             LQ +++           P ++N    +   + S    +   G   G C    TL     
Sbjct: 385  DLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWGVDRGICI--HTL----- 437

Query: 1119 LNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
                     H   +  +  S DG  L +GS+D  + IW
Sbjct: 438  -------TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 468



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 60/234 (25%), Positives = 94/234 (40%), Gaps = 16/234 (6%)
 Frame = +3

Query: 582  LSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI----TTG-----LRTSVFGGEYQSG 734
            L GH+  V  C + P  D  L + SGD T  +W++    T+G     LR  +  G     
Sbjct: 164  LRGHESEVFICAWNPVSDL-LASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVP 222

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDG 908
               DV+S+  ++  T +  +GS D  A +W  D  +AS    T   H+G + A+K+   G
Sbjct: 223  SNKDVTSLDWNSEGT-LLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWNKKG 277

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
            N   +   D T  ++D  TG   Q +         H   ++         FA  +   C 
Sbjct: 278  NFILSAGVDKTTIIWDAHTGEAKQQFP-------FHSAPALDVDWQSNNTFASCSTDMCI 330

Query: 1089 VWDTLLAKMVLNLGSLQ-----NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
                     V  LG  +       H   ++ +     G+ L + S D TLKIW+
Sbjct: 331  --------HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 376



 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 42/178 (23%), Positives = 64/178 (35%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 342 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDSCVHDLQAHNKEIYTIKWSPT 401

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 402 G-------------------PGTNN----------------------PNANLMLASASFD 420

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            T  LW +  G+          + H   V SV+ S        SGS D    +W+T+V
Sbjct: 421 STVRLWGVDRGICIHTL-----TKHQEPVYSVAFSPDG-RYLASGSFDKCVHIWNTQV 472



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 9/92 (9%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPE---------KNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W        H +    
Sbjct: 382 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWGVDRGICIHTLTKHQ 441

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFNLNLP 545
             V + AFSP G+ +A G  D    I+N  +P
Sbjct: 442 EPVYSVAFSPDGRYLASGSFDKCVHIWNTQVP 473



>gb:AY461709_1329432 Bombyx mori will die slowly mRNA, complete cds.
          Length = 346

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 65/229 (28%), Positives = 114/229 (49%), Gaps = 3/229 (1%)
 Frame = +3

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQ---S 731
            N T+  TL+GH    ++ ++ P+    L +SS DK   +W          + G+++   S
Sbjct: 46   NYTLKFTLAGHTKAATSVKFSPS-GKWLASSSADKLIKIW--------GAYDGKFEKTIS 96

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GH   +S V+ S S++ + VS S D T  +W+   + + ++T  GH   V    F P  N
Sbjct: 97   GHKMGISDVAWS-SDSRLIVSASDDKTLKVWELS-SGKCLKTLKGHSNYVFCCNFNPQSN 154

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV 1091
               +GS D + R++D+RTG  L+     HSD     V+++ F+  G L+ +   +G C +
Sbjct: 155  LIVSGSFDESVRIWDVRTGKCLKPLPA-HSDP----VSAVHFNRDGSLIVSSSYDGLCRI 209

Query: 1092 WDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAF 1238
            WDT   +    L +L +  +  +S +  S +G  +   + D TLK+W +
Sbjct: 210  WDTASGQC---LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 255



 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 68/311 (21%), Positives = 132/311 (42%), Gaps = 3/311 (0%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
            L GHT    S+ ++P    + S+S D  + +W A   +    I      +   A+S   +
Sbjct: 53   LAGHTKAATSVKFSPSGKWLASSSADKLIKIWGAYDGKFEKTISGHKMGISDVAWSSDSR 112

Query: 489  SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
             +     D    ++ L+       +    +TL GH  YV  C + P  +  +++ S D++
Sbjct: 113  LIVSASDDKTLKVWELS-------SGKCLKTLKGHSNYVFCCNFNPQSNL-IVSGSFDES 164

Query: 669  CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRA 848
              +WD+ TG             H+  VS+V  +    ++ VS S D    +WDT  + + 
Sbjct: 165  VRIWDVRTGKCLKPL-----PAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT-ASGQC 217

Query: 849  VRTFHGHEGDVIA-VKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVT 1025
            ++T    +   ++ VKF P+G      + D T +L+D   G  L+ Y+     NE + + 
Sbjct: 218  LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSRGKCLKTYT--GHKNEKYCIF 275

Query: 1026 SIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTG 1205
            +      G+ + +G  +   Y+W+    ++V  L    + H   + C       + + + 
Sbjct: 276  ANFSVTGGKWIVSGSEDNLVYIWNLQSKEIVQRL----SGHTDTVLCTACHPTENIIASA 331

Query: 1206 SW--DTTLKIW 1232
            +   D T+K+W
Sbjct: 332  ALENDKTIKLW 342



 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 61/240 (25%), Positives = 103/240 (42%), Gaps = 6/240 (2%)
 Frame = +3

Query: 303  RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
            + + GH   +  + W+ +   IVSAS D  L VW   + +    +K    +V  C F+P 
Sbjct: 93   KTISGHKMGISDVAWSSDSRLIVSASDDKTLKVWELSSGKCLKTLKGHSNYVFCCNFNPQ 152

Query: 483  GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG- 659
               +  G  D    I+++             + L  H   VSA  +  N D  LI SS  
Sbjct: 153  SNLIVSGSFDESVRIWDVR-------TGKCLKPLPAHSDPVSAVHF--NRDGSLIVSSSY 203

Query: 660  DKTCGLWDITTG--LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            D  C +WD  +G  L+T +            VS V  S  N    ++ + D T  LWD  
Sbjct: 204  DGLCRIWDTASGQCLKTLI------DDDNPPVSFVKFS-PNGKYILAATLDNTLKLWDYS 256

Query: 834  VASRAVRTFHGHEGD--VIAVKFFPDGNRF-GTGSDDGTCRLFDIRTGHQLQVYSQPHSD 1004
               + ++T+ GH+ +   I   F   G ++  +GS+D    ++++++   +Q  S  H+D
Sbjct: 257  -RGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQSKEIVQRLS-GHTD 314



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/221 (21%), Positives = 89/221 (40%), Gaps = 2/221 (0%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFS 476
           C + L+GH+  V+  ++ P+ N IVS S D  + +W+  T +    +      V    F+
Sbjct: 133 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKPLPAHSDPVSAVHFN 192

Query: 477 PTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSS 656
             G  +     D +C I+      D      +   +      VS  ++ PN   +++ ++
Sbjct: 193 RDGSLIVSSSYDGLCRIW------DTASGQCLKTLIDDDNPPVSFVKFSPN-GKYILAAT 245

Query: 657 GDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRV 836
            D T  LWD + G     + G     +       + S +     VSGS D    +W+ + 
Sbjct: 246 LDNTLKLWDYSRGKCLKTYTGHKNEKYCI---FANFSVTGGKWIVSGSEDNLVYIWNLQ- 301

Query: 837 ASRAVRTFHGHEGDVIAVKFFPDGNRFGTGS--DDGTCRLF 953
           +   V+   GH   V+     P  N   + +  +D T +L+
Sbjct: 302 SKEIVQRLSGHTDTVLCTACHPTENIIASAALENDKTIKLW 342



>gb:AE010953_267897 Methanosarcina acetivorans str. C2A, section 298
            of 534 of the complete genome.>gb:AE010299_908456
            Methanosarcina acetivorans str. C2A, complete genome.
          Length = 1051

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 74/305 (24%), Positives = 130/305 (42%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H   V +++++P+   + +ASQD    VW+A T ++   +K   A +    F+  G+ VA
Sbjct: 688  HKDSVLNVEFSPDGVYVATASQDNTARVWDAYTGEEISVLKHD-AGINKAVFNRDGKYVA 746

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
                D+   ++N          ST       H G V    + P +  ++ T+S D T  +
Sbjct: 747  TASQDNTARVWN---------TSTGKDITLKHGGGVLDVAFSP-DGKYVATASQDNTARV 796

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            W+          G      H   V+ +  S     +  + S D TA +W      +    
Sbjct: 797  WNWNAPT-----GENITLKHEGWVNKIVFSPDGKYV-ATASADNTARIWSASTGKQI--D 848

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAF 1037
               H+G V  V+F  DG    T SDD T ++++  T  +  + +  H+ N  ++V  +AF
Sbjct: 849  VISHDGSVQDVEFSSDGKYVATASDDNTAKVWNWNTSTRKNI-TLKHTLNHSNKVHDVAF 907

Query: 1038 SISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDT 1217
            S  G+ +     + +  +W+  ++    NL     SHD  +S +  S DG  + T S+  
Sbjct: 908  SPDGKKVATASWDKNARIWNLSISNDFTNL-----SHDDYVSRVEFSSDGKFIATTSYGE 962

Query: 1218 TLKIW 1232
            T  IW
Sbjct: 963  TAFIW 967



 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 87/342 (25%), Positives = 137/342 (40%), Gaps = 37/342 (10%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H   +  + ++P+  ++ +AS D    +W+A T ++  AI      V+  AFSP G+ VA
Sbjct: 608  HDYSIKKVFFSPDGKKVATASADETARLWDAYTGKEI-AIMNHGKDVVDIAFSPDGKKVA 666

Query: 498  CGGLDSVCSIFNL--NLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTC 671
                D+   I+++   +P  N            HK  V   ++ P +  ++ T+S D T 
Sbjct: 667  TASADNTSCIWDVYTEIPVLN------------HKDSVLNVEFSP-DGVYVATASQDNTA 713

Query: 672  GLWDITTGLRTSVF-------------GGEY----QSGHTADVSSVSISASNT------- 779
             +WD  TG   SV               G+Y       +TA V + S     T       
Sbjct: 714  RVWDAYTGEEISVLKHDAGINKAVFNRDGKYVATASQDNTARVWNTSTGKDITLKHGGGV 773

Query: 780  ---------NMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSD 932
                         + S D TA +W+    +    T   HEG V  + F PDG    T S 
Sbjct: 774  LDVAFSPDGKYVATASQDNTARVWNWNAPTGENITLK-HEGWVNKIVFSPDGKYVATASA 832

Query: 933  DGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYV--WDTLL 1106
            D T R++   TG Q+ V S   S      V  + FS  G+ +     +    V  W+T  
Sbjct: 833  DNTARIWSASTGKQIDVISHDGS------VQDVEFSSDGKYVATASDDNTAKVWNWNTST 886

Query: 1107 AKMVLNLGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
             K +    +L  +H  ++  +  S DG  + T SWD   +IW
Sbjct: 887  RKNITLKHTL--NHSNKVHDVAFSPDGKKVATASWDKNARIW 926



 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 81/388 (20%), Positives = 140/388 (36%), Gaps = 75/388 (19%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIK------------------- 440
            H G V  + ++P+  ++ +ASQD    +W+  T ++   +                    
Sbjct: 486  HNGSVLDVTFSPDGEKVATASQDKTACIWDVSTGKQITVLNHSNSVSKIIFSSDGKKVAM 545

Query: 441  -----LPCAWVMT---------------CAFSPTGQSVACGGLDSVCSIFNLNLPPDNDG 560
                 + C W  T                AFSP G+ VA    D    ++N++   +   
Sbjct: 546  MISGNIACLWNSTGKQIDVMNHTDVMRDVAFSPDGEKVATASADRTSRLWNVSTGKEI-- 603

Query: 561  NSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHT 740
             + +    S  K + S       +   + T+S D+T  LWD  TG   ++        H 
Sbjct: 604  -AVLKHDYSIKKVFFSP------DGKKVATASADETARLWDAYTGKEIAIMN------HG 650

Query: 741  ADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFG 920
             DV  ++ S     +  + S D T+C+WD       +     H+  V+ V+F PDG    
Sbjct: 651  KDVVDIAFSPDGKKV-ATASADNTSCIWDVYTEIPVLN----HKDSVLNVEFSPDGVYVA 705

Query: 921  TGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDT 1100
            T S D T R++D  TG ++ V       N+        F+  G+ +     +    VW+T
Sbjct: 706  TASQDNTARVWDAYTGEEISVLKHDAGINKA------VFNRDGKYVATASQDNTARVWNT 759

Query: 1101 LLAKMVL-------------------------NLGSLQN-----------SHDGRISCLG 1172
               K +                          N   + N            H+G ++ + 
Sbjct: 760  STGKDITLKHGGGVLDVAFSPDGKYVATASQDNTARVWNWNAPTGENITLKHEGWVNKIV 819

Query: 1173 LSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
             S DG  + T S D T +IW+    +Q+
Sbjct: 820  FSPDGKYVATASADNTARIWSASTGKQI 847



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 72/307 (23%), Positives = 131/307 (42%), Gaps = 2/307 (0%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H   V    ++P+   + + S + +  +W+ L++++T  +      V    FSP G+ VA
Sbjct: 320  HDDWVNKTIFSPDGKYVATVSNE-KAQIWD-LSTEETIDVISHNGSVRDVNFSPDGKYVA 377

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
                D    I+N++   +          +  H   ++   + PN   ++ T S   T  +
Sbjct: 378  TASRDKTSHIWNISTHKEI--------AVLNHNDELAKVFFSPN-GKYIATMSYGSTAYV 428

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWD-TRVASRAVR 854
            W+ +T  + +V        H   V  V +S        + S D T+ LWD T   +  ++
Sbjct: 429  WNASTYEQIAVLK------HADKVCDVELSPDG-KYIATASQDNTSRLWDVTEAENITLK 481

Query: 855  TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIA 1034
                H G V+ V F PDG +  T S D T  ++D+ TG Q+ V +  +S      V+ I 
Sbjct: 482  HTLKHNGSVLDVTFSPDGEKVATASQDKTACIWDVSTGKQITVLNHSNS------VSKII 535

Query: 1035 FSISGRLLFAGYTNGDCYVWDTLLAKM-VLNLGSLQNSHDGRISCLGLSGDGSALCTGSW 1211
            FS  G+ +    +     +W++   ++ V+N       H   +  +  S DG  + T S 
Sbjct: 536  FSSDGKKVAMMISGNIACLWNSTGKQIDVMN-------HTDVMRDVAFSPDGEKVATASA 588

Query: 1212 DTTLKIW 1232
            D T ++W
Sbjct: 589  DRTSRLW 595



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 55/232 (23%), Positives = 97/232 (41%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G V  + ++P+   + +ASQD    VWN       +       WV    FSP G+ VA
Sbjct: 769  HGGGVLDVAFSPDGKYVATASQDNTARVWNWNAPTGENITLKHEGWVNKIVFSPDGKYVA 828

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
                D+   I++ +     D        +  H G V   ++  ++  ++ T+S D T  +
Sbjct: 829  TASADNTARIWSASTGKQID--------VISHDGSVQDVEF-SSDGKYVATASDDNTAKV 879

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            W+  T  R ++   ++   H+  V  V+ S     +  + S D  A +W+  +++     
Sbjct: 880  WNWNTSTRKNITL-KHTLNHSNKVHDVAFSPDGKKV-ATASWDKNARIWNLSISNDFTNL 937

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEV 1013
               H+  V  V+F  DG    T S   T  ++D  TG ++   S     N+V
Sbjct: 938  --SHDDYVSRVEFSSDGKFIATTSYGETAFIWDASTGDKIAAISHDGVVNDV 987



 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 56/211 (26%), Positives = 89/211 (42%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G V  + ++P+   + +AS D    +W+A T ++   I    + V    FS  G+ VA
Sbjct: 811  HEGWVNKIVFSPDGKYVATASADNTARIWSASTGKQIDVISHDGS-VQDVEFSSDGKYVA 869

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
                D+   ++N N       N T+  TL+ H   V    + P +   + T+S DK   +
Sbjct: 870  TASDDNTAKVWNWNTSTRK--NITLKHTLN-HSNKVHDVAFSP-DGKKVATASWDKNARI 925

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRT 857
            W++      S+        H   VS V  S S+     + S   TA +WD     +    
Sbjct: 926  WNL------SISNDFTNLSHDDYVSRVEFS-SDGKFIATTSYGETAFIWDASTGDKIAAI 978

Query: 858  FHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
               H+G V  V F P+G    T SDD T ++
Sbjct: 979  --SHDGVVNDVVFSPNGKYIATASDDNTAKV 1007



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 48/222 (21%), Positives = 91/222 (40%)
 Frame = +3

Query: 591  HKGYVSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISA 770
            H  +V+   + P  D   + +  ++   +WD++T     V        H   V  V+ S 
Sbjct: 320  HDDWVNKTIFSP--DGKYVATVSNEKAQIWDLSTEETIDVIS------HNGSVRDVNFSP 371

Query: 771  SNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRL 950
                +  + S D T+ +W+  +++        H  ++  V F P+G    T S   T  +
Sbjct: 372  DGKYV-ATASRDKTSHIWN--ISTHKEIAVLNHNDELAKVFFSPNGKYIATMSYGSTAYV 428

Query: 951  FDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLG 1130
            ++  T  Q+ V    H+D    +V  +  S  G+ +     +    +WD   A+ +    
Sbjct: 429  WNASTYEQIAVLK--HAD----KVCDVELSPDGKYIATASQDNTSRLWDVTEAENITLKH 482

Query: 1131 SLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
            +L+  H+G +  +  S DG  + T S D T  IW     +Q+
Sbjct: 483  TLK--HNGSVLDVTFSPDGEKVATASQDKTACIWDVSTGKQI 522



>sp|Q09715|TU11_SCHPO Transcriptional repressor
            tup11.>pir|S58306|S58306 WD-40 repeat regulatory protein
            tup1 homolog - fission yeast (Schizosaccharomyces
            pombe)>gb:SPAC18B11_1716842 S.pombe chromosome I cosmid
            c18B11.
          Length = 614

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 68/222 (30%), Positives = 109/222 (49%), Gaps = 7/222 (3%)
 Frame = +3

Query: 315  GHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSV 494
            GH   +YSLD++     IVS S D    +W+  T Q    +++    V   A SP  Q +
Sbjct: 400  GHEQDIYSLDFSHNGRFIVSGSGDRTARLWDVETGQCILKLEIENG-VTAIAISPNDQFI 458

Query: 495  ACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCG 674
            A G LD +  +++++         T+   L GHK  V +  + P+    L++ S DKT  
Sbjct: 459  AVGSLDQIIRVWSVS--------GTLVERLEGHKESVYSIAFSPDSSI-LLSGSLDKTIK 509

Query: 675  LWDI--TTGLRTSVFGGE-----YQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTR 833
            +W++  T  +  S    E       +GHT  V SV++S  ++   +SGS D +   WD +
Sbjct: 510  VWELQATRSVGLSAIKPEGICKATYTGHTDFVLSVAVSP-DSRWGLSGSKDRSMQFWDLQ 568

Query: 834  VASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDI 959
               ++  T  GH+  VI+V F PDG +F +GS D   R++ I
Sbjct: 569  TG-QSYLTCQGHKNSVISVCFSPDGRQFASGSGDLRARIWSI 609



 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 66/269 (24%), Positives = 115/269 (42%), Gaps = 8/269 (2%)
 Frame = +3

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            +V T AFSP G+ +  G  D    +++L+          V    SGH+  + +  +  N 
Sbjct: 362  YVRTIAFSPDGKYLVTGTEDRQIKLWDLS-------TQKVRYVFSGHEQDIYSLDFSHN- 413

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVS-GSCDT 809
               +++ SGD+T  LWD+ TG    +   E ++G TA      I+ S  + F++ GS D 
Sbjct: 414  GRFIVSGSGDRTARLWDVETG--QCILKLEIENGVTA------IAISPNDQFIAVGSLDQ 465

Query: 810  TACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS 989
               +W   V+   V    GH+  V ++ F PD +   +GS D T ++++++    + + +
Sbjct: 466  IIRVWS--VSGTLVERLEGHKESVYSIAFSPDSSILLSGSLDKTIKVWELQATRSVGLSA 523

Query: 990  -QPHS------DNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQNSH 1148
             +P              V S+A S   R   +G  +     WD    +  L        H
Sbjct: 524  IKPEGICKATYTGHTDFVLSVAVSPDSRWGLSGSKDRSMQFWDLQTGQSYLTC----QGH 579

Query: 1149 DGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
               +  +  S DG    +GS D   +IW+
Sbjct: 580  KNSVISVCFSPDGRQFASGSGDLRARIWS 608



 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 61/223 (27%), Positives = 101/223 (45%), Gaps = 5/223 (2%)
 Frame = +3

Query: 603  VSACQYVPNEDAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN 782
            V  C    N   +L T   ++   ++D+ TG +      E     + D+   +I+ S   
Sbjct: 315  VVCCVKFSNNGKYLATGC-NQAANVFDVQTGKKLFTLHEE-SPDPSRDLYVRTIAFSPDG 372

Query: 783  MF-VSGSCDTTACLWDTRVASRAVR-TFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFD 956
             + V+G+ D    LWD  ++++ VR  F GHE D+ ++ F  +G    +GS D T RL+D
Sbjct: 373  KYLVTGTEDRQIKLWD--LSTQKVRYVFSGHEQDIYSLDFSHNGRFIVSGSGDRTARLWD 430

Query: 957  IRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWD---TLLAKMVLNL 1127
            + TG   Q   +   +N V   T+IA S + + +  G  +    VW    TL+ ++    
Sbjct: 431  VETG---QCILKLEIENGV---TAIAISPNDQFIAVGSLDQIIRVWSVSGTLVERL---- 480

Query: 1128 GSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIWAFGGYRQV 1256
                  H   +  +  S D S L +GS D T+K+W     R V
Sbjct: 481  ----EGHKESVYSIAFSPDSSILLSGSLDKTIKVWELQATRSV 519



 Score = 42.7 bits (99), Expect = 0.018
 Identities = 46/178 (25%), Positives = 67/178 (37%)
 Frame = +3

Query: 309 LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQ 488
           L+GH   VYS+ ++P+ + ++S S D  + VW     Q T ++ L        A  P G 
Sbjct: 480 LEGHKESVYSIAFSPDSSILLSGSLDKTIKVWEL---QATRSVGL-------SAIKPEG- 528

Query: 489 SVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKT 668
                    +C                   T +GH  +V +    P+    L + S D++
Sbjct: 529 ---------IC-----------------KATYTGHTDFVLSVAVSPDSRWGL-SGSKDRS 561

Query: 669 CGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
              WD+ TG            GH   V SV  S      F SGS D  A +W    AS
Sbjct: 562 MQFWDLQTGQSYLTC-----QGHKNSVISVCFSPDG-RQFASGSGDLRARIWSIDPAS 613



>sp|Q8BHJ5|TBLR_MOUSE F-box-like/WD-repeat protein TBLR1 (Nuclear
            receptor corepressor/HDAC3 complex subunit TBLR1)
            (TBL1-related protein 1).>gb:AK029595_1161569 Mus
            musculus adult male testis cDNA, RIKEN full-length
            enriched library, clone:4930407K10 product:IRA1 protein,
            full insert sequence.>gb:AK033347_1163286 Mus musculus 15
            days embryo male testis cDNA, RIKEN full-length enriched
            library, clone:8030499H02 product:IRA1 protein, full
            insert sequence.>gb:BC087181_2565038 Xenopus laevis
            hypothetical LOC495857, mRNA (cDNA clone MGC:97978
            IMAGE:7198109), complete cds.
          Length = 514

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 86/336 (25%), Positives = 141/336 (41%), Gaps = 28/336 (8%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 165  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPS 224

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 225  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 274

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 275  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 325

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---H 971
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++     H
Sbjct: 326  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVH 385

Query: 972  QLQVYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLN 1124
             LQ +++         + +I +S +G          +L +   +    +WD      +  
Sbjct: 386  DLQAHNK--------EIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHT 437

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            L      H   +  +  S DG  L +GS+D  + IW
Sbjct: 438  L----TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 469



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 265  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 324

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 325  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLKI 375

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 376  WSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 434

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 435  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 488

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 489  VCWNAAGDKVGASASDGSVCVLD 511



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 52/220 (23%), Positives = 85/220 (38%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 343 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPT 402

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 403 G-------------------PGTNN----------------------PNANLMLASASFD 421

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S        SGS D    +W+T+  +
Sbjct: 422 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDG-RYLASGSFDKCVHIWNTQTGA 475

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 476 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 513



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 67/272 (24%), Positives = 109/272 (40%), Gaps = 21/272 (7%)
 Frame = +3

Query: 483  GQSVACGGLDSVCSIFN-----LNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLI 647
            G++ A G  +   +I N     + +  D +  S  +  L GH+  V  C + P  D  L 
Sbjct: 127  GENTANGEENGAHTIANNHTDMMEVDGDVEIPSNKAVVLRGHESEVFICAWNPVSDL-LA 185

Query: 648  TSSGDKTCGLWDI----TTG-----LRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGS 800
            + SGD T  +W++    T+G     LR  +  G        DV+S+  ++  T +  +GS
Sbjct: 186  SGSGDSTARIWNLSENSTSGPTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGT-LLATGS 244

Query: 801  CDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQ 974
             D  A +W  D  +AS    T   H+G + A+K+   GN   +   D T  ++D  TG  
Sbjct: 245  YDGFARIWTKDGNLAS----TLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEA 300

Query: 975  LQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLGSLQ----- 1139
             Q +         H   ++         FA  +   C          V  LG  +     
Sbjct: 301  KQQFP-------FHSAPALDVDWQSNNTFASCSTDMCI--------HVCKLGQDRPIKTF 345

Query: 1140 NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
              H   ++ +     G+ L + S D TLKIW+
Sbjct: 346  QGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 377



 Score = 41.2 bits (95), Expect = 0.053
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 9/88 (10%)
 Frame = +3

Query: 297 CCRNLQGHTGKVYSLDWTP---------EKNRIVSASQDGRLIVWNALTSQKTHAIKLPC 449
           C  +LQ H  ++Y++ W+P             + SAS D  + +W+       H +    
Sbjct: 383 CVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHTLTKHQ 442

Query: 450 AWVMTCAFSPTGQSVACGGLDSVCSIFN 533
             V + AFSP G+ +A G  D    I+N
Sbjct: 443 EPVYSVAFSPDGRYLASGSFDKCVHIWN 470



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 433 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 491

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 492 NAAGDKVGASASDGSVC 508



>sp|Q94775|GBLP_TRYBB Guanine nucleotide-binding protein beta
            subunit-like protein (Activated protein kinase C receptor
            homolog) (Track).>gb:AF049902_1236612 Trypanosoma brucei
            rhodesiense activated protein kinase C receptor homolog
            TRACK mRNA, complete cds.>gb:TBU72205_1399480 Trypanosoma
            brucei activated protein kinase C receptor homolog mRNA,
            complete cds.
          Length = 318

 Score = 89.4 bits (220), Expect = 2e-16
 Identities = 84/303 (27%), Positives = 133/303 (43%), Gaps = 13/303 (4%)
 Frame = +3

Query: 225  DTDVATYARSQGKTPISFGPT----DLVCC-----RNLQGHTGKVYSLDWTPEKNRIVSA 377
            +T     + S+ KT +S+GP        C      R L+GH+  V  +  +   N  VSA
Sbjct: 26   ETATKVVSTSRDKTLLSWGPNPDRHSSECSYGLPDRRLEGHSAFVSDVALSNNGNFAVSA 85

Query: 378  SQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDND 557
            S D  L +WN    Q  +        V++ AFSP  + +  GG D+   ++N+      +
Sbjct: 86   SWDHSLRLWNLQNGQCQYKFLGHTKDVLSVAFSPDNRQIVSGGRDNALRVWNVK----GE 141

Query: 558  GNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSG-DKTCGLWDITTG-LRTSVFGGEYQS 731
               T+SR    H  +VS  ++ P+ DA +I S G D    +WD+ TG L T +       
Sbjct: 142  CMHTLSR--GAHTDWVSCVRFSPSLDAPVIVSGGWDNLVKVWDLATGRLVTDL------K 193

Query: 732  GHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGN 911
            GHT  V+SV++S    ++  S   D  A LWD            G    +  + F P+  
Sbjct: 194  GHTNYVTSVTVSPDG-SLCASSDKDGVARLWDLTKGEALSEMAAG--APINQICFSPNRY 250

Query: 912  RFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNE--VHRVTSIAFSISGRLLFAGYTNGDC 1085
                 ++ G  R+FD+     +   +  H  ++  V    SIA+S  G  L++GYT+   
Sbjct: 251  WMCAATEKG-IRIFDLENKDIIVELAPEHQGSKKIVPECVSIAWSADGSTLYSGYTDNVI 309

Query: 1086 YVW 1094
             VW
Sbjct: 310  RVW 312



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 82/324 (25%), Positives = 124/324 (38%), Gaps = 16/324 (4%)
 Frame = +3

Query: 309  LQGHTGKVYSL--DWTPEK-NRIVSASQDGRLIVWNALTSQKTHAIK--LP-------CA 452
            L GH G V SL    TPE   ++VS S+D  L+ W     + +      LP        A
Sbjct: 9    LTGHRGWVTSLACPQTPETATKVVSTSRDKTLLSWGPNPDRHSSECSYGLPDRRLEGHSA 68

Query: 453  WVMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNE 632
            +V   A S  G        D    ++NL        N        GH   V +  + P +
Sbjct: 69   FVSDVALSNNGNFAVSASWDHSLRLWNLQ-------NGQCQYKFLGHTKDVLSVAFSP-D 120

Query: 633  DAHLITSSGDKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISAS-NTNMFVSGSCDT 809
            +  +++   D    +W++      ++  G     HT  VS V  S S +  + VSG  D 
Sbjct: 121  NRQIVSGGRDNALRVWNVKGECMHTLSRG----AHTDWVSCVRFSPSLDAPVIVSGGWDN 176

Query: 810  TACLWDTRVASRAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYS 989
               +WD     R V    GH   V +V   PDG+   +   DG  RL+D+  G  L   +
Sbjct: 177  LVKVWDL-ATGRLVTDLKGHTNYVTSVTVSPDGSLCASSDKDGVARLWDLTKGEALSEMA 235

Query: 990  QPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCYVWDTLLAKMVLNLG-SLQNSHDGRISC 1166
                 N+      I FS   R      T     ++D     +++ L    Q S      C
Sbjct: 236  AGAPINQ------ICFS-PNRYWMCAATEKGIRIFDLENKDIIVELAPEHQGSKKIVPEC 288

Query: 1167 LGL--SGDGSALCTGSWDTTLKIW 1232
            + +  S DGS L +G  D  +++W
Sbjct: 289  VSIAWSADGSTLYSGYTDNVIRVW 312



>gb:AF268193_1893996 Homo sapiens IRA1 mRNA, complete cds,
            alternatively spliced.
          Length = 514

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 86/336 (25%), Positives = 141/336 (41%), Gaps = 28/336 (8%)
 Frame = +3

Query: 309  LQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNAL---TSQKTHAIKLPCAW-------- 455
            L+GH  +V+   W P  + + S S D    +WN     TS  T  +   C          
Sbjct: 165  LRGHESEVFICAWNPVSDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPS 224

Query: 456  ---VMTCAFSPTGQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVP 626
               V +  ++  G  +A G  D    I+        DGN  ++ TL  HKG + A ++  
Sbjct: 225  NKDVTSLDWNSEGTLLATGSYDGFARIWT------KDGN--LASTLGQHKGPIFALKW-- 274

Query: 627  NEDAHLITSSG-DKTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSC 803
            N+  + I S+G DKT  +WD  TG     F       H+A    V   ++NT      SC
Sbjct: 275  NKKGNFILSAGVDKTTIIWDAHTGEAKQQF-----PFHSAPALDVDWQSNNT----FASC 325

Query: 804  DTTACLWDTRVAS-RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTG---H 971
             T  C+   ++   R ++TF GH  +V A+K+ P GN   + SDD T +++ ++     H
Sbjct: 326  STDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVH 385

Query: 972  QLQVYSQPHSDNEVHRVTSIAFSISG---------RLLFAGYTNGDCYVWDTLLAKMVLN 1124
             LQ +++         + +I +S +G          +L +   +    +WD      +  
Sbjct: 386  DLQQHNK--------EIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVDRGICIHT 437

Query: 1125 LGSLQNSHDGRISCLGLSGDGSALCTGSWDTTLKIW 1232
            L      H   +  +  S DG  L +GS+D  + IW
Sbjct: 438  L----TKHQEPVYSVAFSPDGRYLASGSFDKCVHIW 469



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 61/263 (23%), Positives = 102/263 (38%), Gaps = 3/263 (1%)
 Frame = +3

Query: 318  HTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPTGQSVA 497
            H G +++L W  + N I+SA  D   I+W+A T +         A  +   +       +
Sbjct: 265  HKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQSNNTFAS 324

Query: 498  CGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGDKTCGL 677
            C   D    +  L       G     +T  GH   V+A ++ P  +  L + S D T  +
Sbjct: 325  CS-TDMCIHVCKL-------GQDRPIKTFQGHTNEVNAIKWDPTGNL-LASCSDDMTLKI 375

Query: 678  WDITTGLRTSVFGGEYQSGHTADVSSVSISASNTN---MFVSGSCDTTACLWDTRVASRA 848
            W +             +  +T   S      +N N   M  S S D+T  LWD       
Sbjct: 376  WSMKQDNCVHDLQQHNKEIYTIKWSPTGPGTNNPNANLMLASASFDSTVRLWDVD-RGIC 434

Query: 849  VRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTS 1028
            + T   H+  V +V F PDG    +GS D    +++ +TG      +  HS      +  
Sbjct: 435  IHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTG------ALVHSYRGTGGIFE 488

Query: 1029 IAFSISGRLLFAGYTNGDCYVWD 1097
            + ++ +G  + A  ++G   V D
Sbjct: 489  VCWNAAGDKVGASASDGSVCVLD 511



 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 52/220 (23%), Positives = 85/220 (38%)
 Frame = +3

Query: 303 RNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPT 482
           +  QGHT +V ++ W P  N + S S D  L +W+       H ++     + T  +SPT
Sbjct: 343 KTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSMKQDNCVHDLQQHNKEIYTIKWSPT 402

Query: 483 GQSVACGGLDSVCSIFNLNLPPDNDGNSTVSRTLSGHKGYVSACQYVPNEDAHLITSSGD 662
           G                   P  N+                      PN +  L ++S D
Sbjct: 403 G-------------------PGTNN----------------------PNANLMLASASFD 421

Query: 663 KTCGLWDITTGLRTSVFGGEYQSGHTADVSSVSISASNTNMFVSGSCDTTACLWDTRVAS 842
            T  LWD+  G+          + H   V SV+ S        SGS D    +W+T+  +
Sbjct: 422 STVRLWDVDRGICIHTL-----TKHQEPVYSVAFSPDG-RYLASGSFDKCVHIWNTQTGA 475

Query: 843 RAVRTFHGHEGDVIAVKFFPDGNRFGTGSDDGTCRLFDIR 962
             V ++ G  G +  V +   G++ G  + DG+  + D+R
Sbjct: 476 -LVHSYRG-TGGIFEVCWNAAGDKVGASASDGSVCVLDLR 513



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 60/234 (25%), Positives = 94/234 (40%), Gaps = 16/234 (6%)
 Frame = +3

Query: 582  LSGHKGYVSACQYVPNEDAHLITSSGDKTCGLWDI----TTG-----LRTSVFGGEYQSG 734
            L GH+  V  C + P  D  L + SGD T  +W++    T+G     LR  +  G     
Sbjct: 165  LRGHESEVFICAWNPVSDL-LASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVP 223

Query: 735  HTADVSSVSISASNTNMFVSGSCDTTACLW--DTRVASRAVRTFHGHEGDVIAVKFFPDG 908
               DV+S+  ++  T +  +GS D  A +W  D  +AS    T   H+G + A+K+   G
Sbjct: 224  SNKDVTSLDWNSEGT-LLATGSYDGFARIWTKDGNLAS----TLGQHKGPIFALKWNKKG 278

Query: 909  NRFGTGSDDGTCRLFDIRTGHQLQVYSQPHSDNEVHRVTSIAFSISGRLLFAGYTNGDCY 1088
            N   +   D T  ++D  TG   Q +         H   ++         FA  +   C 
Sbjct: 279  NFILSAGVDKTTIIWDAHTGEAKQQFP-------FHSAPALDVDWQSNNTFASCSTDMCI 331

Query: 1089 VWDTLLAKMVLNLGSLQ-----NSHDGRISCLGLSGDGSALCTGSWDTTLKIWA 1235
                     V  LG  +       H   ++ +     G+ L + S D TLKIW+
Sbjct: 332  --------HVCKLGQDRPIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWS 377



 Score = 34.3 bits (77), Expect = 6.5
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%)
 Frame = +3

Query: 294 VCCRNLQGHTGKVYSLDWTPEKNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAF 473
           +C   L  H   VYS+ ++P+   + S S D  + +WN  T    H+ +     +    +
Sbjct: 433 ICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSYR-GTGGIFEVCW 491

Query: 474 SPTGQSVACGGLD-SVC 521
           +  G  V     D SVC
Sbjct: 492 NAAGDKVGASASDGSVC 508


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,539,039,956
Number of Sequences: 1806583
Number of extensions: 33911936
Number of successful extensions: 107425
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 76827
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 93929
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 121333671446
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)