BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6432
         (842 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AJ786380_1284250 Cryptosporidium parvum rop-r gene for repeat...    50   5e-05   
pir|S54157|S54157 extensin-like protein - cowpea (fragment)            42   0.011   Vigna unguiculata
gb:AF046998_472865 Borrelia burgdorferi plasmid cp32 2.9-8 loci ...    39   0.094   
gb:BBU45421_747819 Borrelia burgdorferi 2.9-1 locus, ORF 5-8, OR...    37   0.36    
gb:CR382130_1662870 Yarrowia lipolytica chromosome D of strain C...    37   0.61    
gb:BBU45422_747824 Borrelia burgdorferi 2.9-2 locus, ORF-C gene,...    37   0.61    
pir|T18296|T18296 myosin heavy chain - Entamoeba histolytica>gb:...    37   0.61    Entamoeba histolytica
gb:BVU313092_1643196 Beta vulgaris mRNA for salt tolerance prote...    36   1.0     
gb:AY133874_1581694 Arabidopsis thaliana clone U18540 unknown pr...    35   1.4     
gb:AF143476_482868 Borrelia hermsii strain Yor-1 BdrC1 (bdrC1) a...    35   1.4     
gb:AE014186_938101 Plasmodium falciparum 3D7 chromosome 11 compl...    35   1.8     
gb:AE017353_1760135 Cryptococcus neoformans var. neoformans JEC2...    35   2.3     
gb:PF111E_1392008 Plasmodium falciparum 11-1 gene part 5.              35   2.3     
gb:AE017333_448709 Bacillus licheniformis DSM 13, complete genom...    35   2.3     
pir|S00485|S00485 gene 11-1 protein precursor - malaria parasite...    35   2.3     Plasmodium falciparum
gb:AF275345_1782524 Lycopersicon esculentum putative permease ge...    34   3.0     
gb:AC121365_1740192 Oryza sativa (japonica cultivar-group) chrom...    34   3.0     
gb:AC116963_1206870 Dictyostelium discoideum chromosome 2 map 46...    34   3.0     
sp|P42539|YO04_BPL2|YO04_BPL2 Hypothetical 18.2 kDa protein (ORF4).>gb:BL2...    34   3.0     Acholeplasma virus L2
sp|Q8CSA7|SYA_STAEP|SYA_STAEP Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine...    34   3.0     Staphylococcus epidermidis
gb:BC037055_2097960 Mus musculus zinc finger protein 326, mRNA (...    34   4.0     
gb:AB012725_2043723 Mus musculus ZAN75 mRNA for zinc finger prot...    34   4.0     
gb:AK017693_1159276 Mus musculus 8 days embryo whole body cDNA, ...    34   4.0     
gb:AE014185_937950 Plasmodium falciparum 3D7 chromosome 10 compl...    34   4.0     
gb:AP006627_564720 Bacillus clausii KSM-K16 DNA, complete genome.      34   4.0     
pir|T28394|T28394 hypothetical protein MSV234 [imported] - Melan...    34   4.0     Melanoplus sanguinipes entomopoxvirus
pir|H83978|H83978 GTP-binding protein TypA/BipA (tyrosine phosph...    34   4.0     Bacillus halodurans
gb:BBU45424_747834 Borrelia burgdorferi 2.9-4 locus, ORF-C gene,...    33   5.2     
gb:AJ719999_2502186 Gallus gallus mRNA for hypothetical protein,...    33   6.8     
gb:AE017225_409664 Bacillus anthracis str. Sterne, complete genome.    33   6.8     
gb:AE017038_384569 Bacillus anthracis str. Ames section 15 of 18...    33   6.8     
sp|P87293|YDN1_SCHPO|YDN1_SCHPO Hypothetical protein C16A10.01 in chromosom...    33   6.8     Schizosaccharomyces pombe
gb:CP000001_854736 Bacillus cereus ZK, complete genome.                33   8.8     
gb:BA000028_694973 Oceanobacillus iheyensis HTE831 DNA, complete...    33   8.8     
gb:AE017355_465420 Bacillus thuringiensis serovar konkukian str....    33   8.8     
gb:AE017012_379258 Bacillus cereus ATCC 14579 section 15 of 18 o...    33   8.8     


>gb:AJ786380_1284250 Cryptosporidium parvum rop-r gene for repeat
           organellar protein-related, isolate ISSC6.
          Length = 366

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 25/85 (29%), Positives = 50/85 (58%)
 Frame = +2

Query: 557 QKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEAM 736
           +K E++ES +K ++ ++E I   K EK+ES +K +   +E+I   K EK+ES +K +   
Sbjct: 83  EKYEEIESIIKEKDEVIETISKEKEEKIESIIKEKNKEIEIISKEKEEKIESIIKEKNEE 142

Query: 737 VEVIDNLKMEXVERPLKGEEAMVDL 811
           +E+I   +++ + +  K  + +  L
Sbjct: 143 IEIISK-EIDAINKEKKETKVLEQL 166



 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 23/85 (27%), Positives = 50/85 (58%)
 Frame = +2

Query: 557 QKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEAM 736
           ++ E+VE  ++ ++  ++ I   K E++ES +K ++ ++E I   K EK+ES +K +   
Sbjct: 61  ERDEEVEIIIREKDEKIQNILKEKYEEIESIIKEKDEVIETISKEKEEKIESIIKEKNKE 120

Query: 737 VEVIDNLKMEXVERPLKGEEAMVDL 811
           +E+I   K E +E  +K +   +++
Sbjct: 121 IEIISKEKEEKIESIIKEKNEEIEI 145



 Score = 40.8 bits (94), Expect = 0.032
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 4/84 (4%)
 Frame = +2

Query: 536 LLVVIDHQKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEV----IDNLKMEK 703
           ++  I  +K EK+ES +K +   +E+I   K EK+ES +K +   +E+    ID +  EK
Sbjct: 98  VIETISKEKEEKIESIIKEKNKEIEIISKEKEEKIESIIKEKNEEIEIISKEIDAINKEK 157

Query: 704 VESHLKGEEAMVEVIDNLKMEXVE 775
            E+ +  +   ++ I   K E +E
Sbjct: 158 KETKVLEQLEELQKIITEKEETME 181



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 27/88 (30%), Positives = 45/88 (51%)
 Frame = +2

Query: 545 VIDHQKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKG 724
           +I   K E+ E+ +K     +E I   K E++E  LK  +  VE+I   K EK+++ LK 
Sbjct: 24  MIIKDKEEEFETRIKEMMKEIESIQIKKDEEMEYRLKERDEEVEIIIREKDEKIQNILKE 83

Query: 725 EEAMVEVIDNLKMEXVERPLKGEEAMVD 808
           +   +E I   K E +E   K +E  ++
Sbjct: 84  KYEEIESIIKEKDEVIETISKEKEEKIE 111



>pir|S54157|S54157 extensin-like protein - cowpea (fragment)
          Length = 279

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 38/90 (42%), Positives = 46/90 (51%)
 Frame = -2

Query: 826 HGSHP*IHHSLLSFQRSFHXLHLQIVYNLHHSLLSFQMAFHLLHLQIVYNLHHSLLSFQM 647
           H  H  +HH LL F  S H LHL + ++LH  +     + H  HL     LHH LL F  
Sbjct: 14  HHRHHLLHHHLLMFT-SHHLLHL-LPHHLHMCI-----SRHHHHL-----LHHHLLMFT- 60

Query: 646 AFHLLHLRIVYNLHHSLLSFQMAFHLLHLL 557
           + HLLHL     L H L  F  + HLLHLL
Sbjct: 61  SHHLLHL-----LPHHLPMF-TSLHLLHLL 84



>gb:AF046998_472865 Borrelia burgdorferi plasmid cp32 2.9-8 loci
           sequence, BlyA (blyA), BlyB (blyB), bbs27 protein
           (bbs27), RepU (repU), RepL (repL), and Mlp8 (mlp8)
           genes, complete cds; and unknown genes.
          Length = 186

 Score = 39.3 bits (90), Expect = 0.094
 Identities = 30/82 (36%), Positives = 42/82 (51%)
 Frame = -3

Query: 807 STIASSPFKGLSTFSIFRLSITSTIASSPFKWLSTFSIFRLSITSTIASSPFKWLSTFSI 628
           ST++   FK  ST SI    + S +  S  K+ ST SI    + S ++   FK+ ST SI
Sbjct: 52  STLSILAFKFFSTLSI----LVSKLDISFCKFFSTVSI----LVSKLSILAFKFFSTLSI 103

Query: 627 FGLSITSTIASSPFKWLSTFSI 562
                 ST++   FK+ ST SI
Sbjct: 104 LAFKFFSTLSIFKFKFFSTVSI 125



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 7/76 (9%)
 Frame = -3

Query: 765 SIFRLSITSTIASSPFKWLSTFSIFRLSITSTIASSPFKWLST-------FSIFGLSITS 607
           SIF+    ST++   FK+ ST SI    + S +  S  K+ ST        SI      S
Sbjct: 44  SIFKFKFFSTLSILAFKFFSTLSI----LVSKLDISFCKFFSTVSILVSKLSILAFKFFS 99

Query: 606 TIASSPFKWLSTFSIF 559
           T++   FK+ ST SIF
Sbjct: 100 TLSILAFKFFSTLSIF 115



>gb:BBU45421_747819 Borrelia burgdorferi 2.9-1 locus, ORF 5-8,
           ORF-A-D, REP+, REP-, and lipoprotein (LP) genes,
           complete cds.
          Length = 143

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 7/67 (10%)
 Frame = -3

Query: 741 STIASSPFKWLSTFSIFRLSITSTIASSPFKWLSTFSIFGLSIT-------STIASSPFK 583
           ST++   FK+ ST SI  LS   T++   FK+ ST SI    +        ST++   FK
Sbjct: 34  STLSILAFKFFSTLSILALSSLLTLSILAFKFFSTVSILASKLDISFCKFFSTLSILAFK 93

Query: 582 WLSTFSI 562
           + ST SI
Sbjct: 94  FFSTVSI 100



>gb:CR382130_1662870 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 382

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 14/96 (14%)
 Frame = -3

Query: 840 TTAIATEAT-----PRSTIASSPFKGLSTFSIFRLSITSTIASSPFKWLSTFSIFRLSIT 676
           +T   TE T     P +T   + FKG +TF+ F  + T T+   P    +T + F+ + T
Sbjct: 153 STTTVTEITKIHVDPSTTATVTAFKGTTTFTAFEGTTTHTVEGKPVTTTATVTAFKGTTT 212

Query: 675 ---------STIASSPFKWLSTFSIFGLSITSTIAS 595
                    ST   + FK  +T + F  + T+T  S
Sbjct: 213 VTKDKDVSPSTTTVTAFKGTTTVTAFKGTTTTTFTS 248



>gb:BBU45422_747824 Borrelia burgdorferi 2.9-2 locus, ORF-C gene,
           partial cds, ORF-D, REP+, REP-, and lipoprotein (LP)
           genes, complete cds.
          Length = 174

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 27/73 (36%), Positives = 39/73 (53%)
 Frame = -3

Query: 777 LSTFSIFRLSITSTIASSPFKWLSTFSIFRLSITSTIASSPFKWLSTFSIFGLSITSTIA 598
           +S  SIF+    ST++   FK+ ST SI    + S +  S  K+ ST SI    + S ++
Sbjct: 39  ISNPSIFKFKFFSTLSILAFKFFSTLSI----LVSKLDISFCKFFSTVSI----LVSKLS 90

Query: 597 SSPFKWLSTFSIF 559
              FK+ ST SIF
Sbjct: 91  ILAFKFFSTLSIF 103



 Score = 33.5 bits (75), Expect = 5.2
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 21/103 (20%)
 Frame = -3

Query: 807 STIASSPFKGLSTFSIF--RLSIT------------STIASSPFKWLSTFSIFRLSITST 670
           ST++   FK  ST SI   +L I+            S ++   FK+ ST SIF+    ST
Sbjct: 51  STLSILAFKFFSTLSILVSKLDISFCKFFSTVSILVSKLSILAFKFFSTLSIFKFKFFST 110

Query: 669 I-------ASSPFKWLSTFSIFGLSITSTIASSPFKWLSTFSI 562
           +       +   FK+ ST SI    +TS +  S  K+ ST SI
Sbjct: 111 VSILVSKLSILAFKFFSTVSI----LTSKLDISFCKFFSTLSI 149



>pir|T18296|T18296 myosin heavy chain - Entamoeba
            histolytica>gb:ENHMHCAX_1384762 Entamoeba histolytica
            myosin heavy chain (mhcA) gene, complete cds.
          Length = 2139

 Score = 36.6 bits (83), Expect = 0.61
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 3/67 (4%)
 Frame = +2

Query: 560  KMEKVESHLKGEEAMVEVIDNPKME---KVESHLKGEEAMVEVIDNLKMEKVESHLKGEE 730
            K++ +E  +   E+ +   +  K E   K+E+  + +E + E IDNLK +  +S LKGE+
Sbjct: 904  KIQDLEDKISELESKLSAAELDKQELNLKIENLEEDKEELKETIDNLKGDLKDSKLKGED 963

Query: 731  AMVEVID 751
              VE+ +
Sbjct: 964  LEVEITE 970



 Score = 36.2 bits (82), Expect = 0.80
 Identities = 24/72 (33%), Positives = 44/72 (61%)
 Frame = +2

Query: 596  EAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEAMVEVIDNLKMEXVE 775
            EA ++ +++ K+ ++ES L   E   + + NLK+E +E   + +E + E IDNLK +  +
Sbjct: 902  EAKIQDLED-KISELESKLSAAELDKQEL-NLKIENLE---EDKEELKETIDNLKGDLKD 956

Query: 776  RPLKGEEAMVDL 811
              LKGE+  V++
Sbjct: 957  SKLKGEDLEVEI 968



>gb:BVU313092_1643196 Beta vulgaris mRNA for salt tolerance protein
           1 (sato1 gene).
          Length = 356

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 14/17 (82%), Positives = 16/17 (94%)
 Frame = +1

Query: 199 MATMNPFDLLGDDDNED 249
           M TMNPFDLLGD+DN+D
Sbjct: 1   MTTMNPFDLLGDNDNDD 17



>gb:AY133874_1581694 Arabidopsis thaliana clone U18540 unknown
           protein (At2g45005) mRNA, complete cds.
          Length = 739

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 14/113 (12%)
 Frame = -3

Query: 828 ATEATPRSTIASSPFKGLSTFSIFRLSITSTIASSPFKWLSTFSIFRLSITSTI------ 667
           A+ ++  +T + SPF G+STF+    S TS  ++SPF   + FS  + + +ST       
Sbjct: 294 ASSSSGATTSSPSPF-GVSTFNSSSTSNTSNASASPFSASTGFSFLKSTASSTTSSTTPS 352

Query: 666 -------ASSPFKW-LSTFSIFGLSITSTIASSPFKWLSTFSIF*WSITTSKT 532
                  +SS F +  S  S F LS  S+ A +     + FSI   + T+S T
Sbjct: 353 APPQTASSSSSFSFGTSANSGFNLSTGSSAAPASSTSGAVFSIATTTTTSSST 405



>gb:AF143476_482868 Borrelia hermsii strain Yor-1 BdrC1 (bdrC1) and
           BdrC1- (bdrC1-) genes, complete cds.
          Length = 148

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 32/97 (32%), Positives = 42/97 (43%), Gaps = 21/97 (21%)
 Frame = -3

Query: 792 SPFKGLSTFSIFRLSITSTIA-------SSPFKWLSTFSIFRLSITSTIA-------SSP 655
           S F    T SIF L + ST++        S F    T SIF L + ST++        S 
Sbjct: 38  SDFNSFLTLSIFMLRLFSTVSILLSRSLMSDFNSFLTLSIFMLRLFSTVSILLSRSLMSD 97

Query: 654 FKWLSTFSIFGLSITSTIA-------SSPFKWLSTFS 565
           F    T SIF L + ST++        S F+   TFS
Sbjct: 98  FNSFLTLSIFMLRLFSTVSILLSMSLMSDFRLAPTFS 134



>gb:AE014186_938101 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014837_1228835 Plasmodium falciparum 3D7
            chromosome 11 section 2 of 8 of the complete sequence.
          Length = 5922

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 19/60 (31%), Positives = 36/60 (60%)
 Frame = +2

Query: 560  KMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEAMV 739
            +M+ +E    G+E ++EV  N K + +E    G+E ++EV ++ K + +E   +GEE M+
Sbjct: 4794 EMKILEDSANGKEKILEVRQNGKEKILEDSANGKEKILEVREDGKEKILEGGTEGEENML 4853



 Score = 34.3 bits (77), Expect = 3.0
 Identities = 19/60 (31%), Positives = 36/60 (60%)
 Frame = +2

Query: 626  KMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEAMVEVIDNLKMEXVERPLKGEEAMV 805
            +M+ +E    G+E ++EV  N K + +E    G+E ++EV ++ K + +E   +GEE M+
Sbjct: 4794 EMKILEDSANGKEKILEVRQNGKEKILEDSANGKEKILEVREDGKEKILEGGTEGEENML 4853



>gb:AE017353_1760135 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 499

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 32/92 (34%), Positives = 46/92 (50%)
 Frame = -3

Query: 840 TTAIATEATPRSTIASSPFKGLSTFSIFRLSITSTIASSPFKWLSTFSIFRLSITSTIAS 661
           TTA++ E TP S++ SS     +T S    +I ST+ SS     S+ S    S  + ++S
Sbjct: 272 TTALSAEVTPMSSVRSS---SRATSSSTSTAIHSTVHSSTVSSTSSHS----STATLVSS 324

Query: 660 SPFKWLSTFSIFGLSITSTIASSPFKWLSTFS 565
           S F    T +    + TST  +  F  LSTFS
Sbjct: 325 SSF----TRATASSTSTSTSFTPTFTSLSTFS 352



>gb:PF111E_1392008 Plasmodium falciparum 11-1 gene part 5.
          Length = 219

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +2

Query: 545 VIDHQKMEKVESHLKGEEAMVE-VIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLK 721
           V+  + +E+VE  ++ EE + E +I+    E+V   +  EE + EVI    +E+V   L 
Sbjct: 106 VVPEEVVEEVEEEVEIEEILPEELIEELVTEEVIEEVIPEEVIEEVIPEELVEEVIPELL 165

Query: 722 GEEAMVEVIDNLKMEXVE 775
            EE + EV++ ++   VE
Sbjct: 166 VEEVVPEVVEEVQEPLVE 183



>gb:AE017333_448709 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858509 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 138

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 17/49 (34%), Positives = 32/49 (65%)
 Frame = +2

Query: 584 LKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEE 730
           L+G  + VEV++N +  K E  +K  +A+ EV+D+  +E + S+ +GE+
Sbjct: 83  LEGPISPVEVLENEEPAKRELWIKIRDAVKEVLDSTTLEDLASYTEGEQ 131



>pir|S00485|S00485 gene 11-1 protein precursor - malaria parasite
            (Plasmodium falciparum) (fragments)
          Length = 1948

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = +2

Query: 545  VIDHQKMEKVESHLKGEEAMVE-VIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLK 721
            V+  + +E+VE  ++ EE + E +I+    E+V   +  EE + EVI    +E+V   L 
Sbjct: 1835 VVPEEVVEEVEEEVEIEEILPEELIEELVTEEVIEEVIPEEVIEEVIPEELVEEVIPELL 1894

Query: 722  GEEAMVEVIDNLKMEXVE 775
             EE + EV++ ++   VE
Sbjct: 1895 VEEVVPEVVEEVQEPLVE 1912



>gb:AF275345_1782524 Lycopersicon esculentum putative permease gene,
           partial cds; suppressor-like protein, putative
           centromere protein, putative auxin growth promotor
           protein, and putative protein phosphatase genes,
           complete cds; LTR-A long terminal repeat, complete
           sequence; putative copia-like polyprotein gene, complete
           cds; LTR-B long terminal repeat, complete sequence;
           MADS-box transcription factor JOINTLESS gene, complete
           cds; TH65-like protein gene, partial cds; and unknown
           genes.
          Length = 1310

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 27/86 (31%), Positives = 43/86 (50%)
 Frame = +2

Query: 548 IDHQKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGE 727
           +D  K+E +E      ++  E+ +N K    E   K +EA      NLK+EK+   L G+
Sbjct: 21  LDEAKLE-IEKLRANYQSKAELCENLKRVNNELLTKNQEA------NLKVEKLTHELSGK 73

Query: 728 EAMVEVIDNLKMEXVERPLKGEEAMV 805
           E  + V + L  E +E  LK +E+ V
Sbjct: 74  EDELAVTEQLH-EAIESKLKEKESAV 98



>gb:AC121365_1740192 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0053E05, complete sequence.
          Length = 390

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +1

Query: 199 MATMNPFDLLGDDDNED 249
           MAT NPFDLLG DDN+D
Sbjct: 1   MATANPFDLLGGDDNDD 17



>gb:AC116963_1206870 Dictyostelium discoideum chromosome 2 map
            4657875-4914984 strain AX4, complete sequence.
          Length = 995

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 32/91 (35%), Positives = 42/91 (46%)
 Frame = -3

Query: 840  TTAIATEATPRSTIASSPFKGLSTFSIFRLSITSTIASSPFKWLSTFSIFRLSITSTIAS 661
            TT      +P +   SSP    +T S+F  +  +   SSP    +T S+F  S T+   S
Sbjct: 804  TTTSMFGRSPTTLYGSSP---TTTTSMFGSNSNTLYGSSP---TTTTSMFGRSPTTLYGS 857

Query: 660  SPFKWLSTFSIFGLSITSTIASSPFKWLSTF 568
            SP     T SIFG S T+   SSP    S F
Sbjct: 858  SP---TPTTSIFGSSSTTLYGSSPTTTTSIF 885



>sp|P42539|YO04_BPL2 Hypothetical 18.2 kDa protein
           (ORF4).>gb:BL2CG_1504319 Bacteriophage L2 (from
           Mycoplasma), complete genome.
          Length = 161

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 1/111 (0%)
 Frame = +2

Query: 500 LTMRIIMATTMVLLVVIDHQKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEV 679
           L+  I + + M+L  V ++ K +  E  LKGEE  + V      +K+      EEA V+ 
Sbjct: 20  LSWFIAVGSIMILWPVWEYLKKKAHEQKLKGEE--IIVAQAMTEQKLTIDFLREEAAVKE 77

Query: 680 IDNLKMEKVESHLKGEEAM-VEVIDNLKMEXVERPLKGEEAMVDLGVASVA 829
           ++ LK E +E  +K   A+ ++ ID   +  +E   K +E    LG+  ++
Sbjct: 78  LERLKAESLE--IKERNAVEIDGIDYQGLTTIELKAKAKE----LGITGIS 122



>sp|Q8CSA7|SYA_STAEP Alanyl-tRNA synthetase (EC 6.1.1.7)
           (Alanine--tRNA ligase) (AlaRS).>gb:CP000029_81786
           Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016748_322951 Staphylococcus epidermidis
           ATCC 12228, section 5 of 9 of the complete
           genome.>gb:AE015929_1147620 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 876

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 20/75 (26%), Positives = 39/75 (52%)
 Frame = +2

Query: 536 LLVVIDHQKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESH 715
           L V  D+Q +EKV+   + E+ +++ ++    E     +   E  VE+I+NLK+   E  
Sbjct: 722 LKVKSDNQVVEKVKQLQEEEKGLLKQLEQRNKEITSLKMGNIEEQVELINNLKVLATEVE 781

Query: 716 LKGEEAMVEVIDNLK 760
           +   +A+   +D+ K
Sbjct: 782 IPNPKAIRSTMDDFK 796



>gb:BC037055_2097960 Mus musculus zinc finger protein 326, mRNA
           (cDNA clone MGC:46856 IMAGE:4948371), complete cds.
          Length = 374

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +2

Query: 569 KVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEA-MVEV 745
           + E  +KGE    E+ D+P+ +++E   + EE + E I+  + E+ E   +GEEA  VE 
Sbjct: 255 RYERFVKGENPF-EIQDHPQDQQIEGDEEDEEKIDEPIEEEEEEEEEEEEEGEEAGSVE- 312

Query: 746 IDNLKMEXVERPLKGEEAMVDLGVASVAIAV 838
                    E  ++GEE   +   A  A AV
Sbjct: 313 --------EEGDVEGEEGTAEAAAAGEADAV 335



>gb:AB012725_2043723 Mus musculus ZAN75 mRNA for zinc finger
           protein, complete cds.
          Length = 580

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +2

Query: 569 KVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEA-MVEV 745
           + E  +KGE    E+ D+P+ +++E   + EE + E I+  + E+ E   +GEEA  VE 
Sbjct: 461 RYERFVKGENPF-EIQDHPQDQQIEGDEEDEEKIDEPIEEEEEEEEEEEEEGEEAGSVE- 518

Query: 746 IDNLKMEXVERPLKGEEAMVDLGVASVAIAV 838
                    E  ++GEE   +   A  A AV
Sbjct: 519 --------EEGDVEGEEGTAEAAAAGEADAV 541



>gb:AK017693_1159276 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730470H14
           product:zinc finger protein 326, full insert
           sequence.>gb:AX961836_1484412 Sequence 47 from Patent
           WO03104277.
          Length = 580

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 1/91 (1%)
 Frame = +2

Query: 569 KVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEA-MVEV 745
           + E  +KGE    E+ D+P+ +++E   + EE + E I+  + E+ E   +GEEA  VE 
Sbjct: 461 RYERFVKGENPF-EIQDHPQDQQIEGDEEDEEKIGEPIEEEEEEEEEEEEEGEEAGSVE- 518

Query: 746 IDNLKMEXVERPLKGEEAMVDLGVASVAIAV 838
                    E  ++GEE   +   A  A AV
Sbjct: 519 --------EEGDVEGEEGTAEAAAAGEADAV 541



>gb:AE014185_937950 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014835_1228684 Plasmodium falciparum 3D7
            chromosome 10 section 7 of 7 of the complete sequence.
          Length = 10589

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 29/78 (37%), Positives = 41/78 (52%)
 Frame = +2

Query: 560  KMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEAMV 739
            K E VE  +K EE + EVI    +E+V      EE + EVI  + +E+V   L  EE + 
Sbjct: 3697 KEELVEEVVK-EELVEEVIPEVLVEEVVP----EELLEEVIPKVLVEEVIPELLVEEVVP 3751

Query: 740  EVIDNLKMEXVERPLKGE 793
            EVI+ +  E VE  +  E
Sbjct: 3752 EVIEEVVPEVVEEVVPEE 3769



>gb:AP006627_564720 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 612

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 5/75 (6%)
 Frame = +2

Query: 569 KVESHLKGE-----EAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGEEA 733
           K+E  LK E        VE  D+P M  V    +GE  +  +I+N++ E  E  +   E 
Sbjct: 332 KLEERLKAELETDVSLRVENTDSPDMWVVSG--RGELHLSILIENMRREGYELQVSKPEV 389

Query: 734 MVEVIDNLKMEXVER 778
           ++  +D ++ E VER
Sbjct: 390 IIREVDGIRCEPVER 404



>pir|T28394|T28394 hypothetical protein MSV234 [imported] -
           Melanoplus sanguinipes
           entomopoxvirus>gb:AF063866_2188055 Melanoplus
           sanguinipes entomopoxvirus, complete genome.
          Length = 117

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 21/92 (22%), Positives = 33/92 (35%), Gaps = 1/92 (1%)
 Frame = -2

Query: 838 HGDRHGSHP*IHHSLLSFQRSFHXLHLQIVYNLHHSLLSFQMAFHLLHLQIVYNLHHSLL 659
           H D    H   H  L S+    H  H+   ++ HH    +    H  H  + ++LH    
Sbjct: 10  HFDVFSFHFYFHFHLHSYFHFHHHFHVYFHFHHHHHFHVYFHLHHHHHFHVYFHLHSYFH 69

Query: 658 SFQMAFHL-LHLRIVYNLHHSLLSFQMAFHLL 566
                FH+  H    ++ HH         +LL
Sbjct: 70  FHHHHFHVYFHFHSYFHFHHHHFHVYFDLYLL 101



>pir|H83978|H83978 GTP-binding protein TypA/BipA (tyrosine
           phosphorylated protein A) BH2632 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_656578 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 614

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 5/80 (6%)
 Frame = +2

Query: 554 HQKMEKVESHLKGE-----EAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHL 718
           H    K+E  L+ E        VE  D+P M  V    +GE  +  +I+N++ E  E  +
Sbjct: 327 HVTSRKLEERLRAELETDVSLRVENTDSPDMWVVSG--RGELHLSILIENMRREGYELQV 384

Query: 719 KGEEAMVEVIDNLKMEXVER 778
              E ++  ID ++ E VER
Sbjct: 385 SKPEVIIREIDGVQCEPVER 404



>gb:BBU45424_747834 Borrelia burgdorferi 2.9-4 locus, ORF-C gene,
           partial cds, ORF-D, REP+, REP-, and lipoprotein (LP)
           genes, complete cds.
          Length = 161

 Score = 33.5 bits (75), Expect = 5.2
 Identities = 28/81 (34%), Positives = 39/81 (48%)
 Frame = -3

Query: 804 TIASSPFKGLSTFSIFRLSITSTIASSPFKWLSTFSIFRLSITSTIASSPFKWLSTFSIF 625
           +I+    K  ST SI      ST++   FK+ ST SI    + S +  S  K+ ST SI 
Sbjct: 24  SISERDIKFFSTLSILAFKFFSTVSILAFKFFSTLSI----LVSKLDISFCKFFSTLSI- 78

Query: 624 GLSITSTIASSPFKWLSTFSI 562
              + S +  S  K+ ST SI
Sbjct: 79  ---LVSKLDISFCKFFSTLSI 96



>gb:AJ719999_2502186 Gallus gallus mRNA for hypothetical protein,
           clone 9d22.
          Length = 916

 Score = 33.1 bits (74), Expect = 6.8
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -3

Query: 180 TEICITARSFTGDSRESRKG*LQESMGNKNEKWQRGTLETLAKAAETG 37
           TEIC+  + F+GD+  S    L+E   +KN+ +Q G+L  L +  + G
Sbjct: 399 TEICLNHQIFSGDTVHSC---LEEKEASKNDAFQEGSLRLLCEEEQKG 443



>gb:AE017225_409664 Bacillus anthracis str. Sterne, complete genome.
          Length = 778

 Score = 33.1 bits (74), Expect = 6.8
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = +2

Query: 548 IDHQKMEKVESHLKGEEAMVEVIDNPK-MEKVESHLKGEEAMVEVIDNLKMEKVESHLKG 724
           I  +  EK+ +HL GE A+ +++D+P+ +  V +  K +E    ++++  +EKV S L G
Sbjct: 111 IGKRTAEKIVAHL-GEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNG 169



>gb:AE017038_384569 Bacillus anthracis str. Ames section 15 of 18 of
           the complete genome.>gb:AE017334_454416 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE016879_1014274 Bacillus anthracis str. Ames
           complete genome.
          Length = 770

 Score = 33.1 bits (74), Expect = 6.8
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = +2

Query: 548 IDHQKMEKVESHLKGEEAMVEVIDNPK-MEKVESHLKGEEAMVEVIDNLKMEKVESHLKG 724
           I  +  EK+ +HL GE A+ +++D+P+ +  V +  K +E    ++++  +EKV S L G
Sbjct: 103 IGKRTAEKIVAHL-GEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNG 161



>sp|P87293|YDN1_SCHPO Hypothetical protein C16A10.01 in chromosome
           I.>pir|T37766|T37766 probable integral membrane protein
           - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC16A10_1716629 S.pombe chromosome I cosmid
           c16A10.
          Length = 830

 Score = 33.1 bits (74), Expect = 6.8
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = -3

Query: 768 FSIFRLSITSTIASSPFKWLSTFSIFRLSITSTIASSPFKWLSTFSIFGLSITSTIASSP 589
           FS+F LS   TI S+ + W+   +    +  S IA SP+ ++    IF LS+     S P
Sbjct: 628 FSLF-LSFGITIGSALYGWMDKDATDADTCMSIIAVSPYWYILLIPIFTLSLLIVTQSHP 686

Query: 588 FKW 580
            +W
Sbjct: 687 RQW 689



>gb:CP000001_854736 Bacillus cereus ZK, complete genome.
          Length = 778

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +2

Query: 548 IDHQKMEKVESHLKGEEAMVEVIDNPK-MEKVESHLKGEEAMVEVIDNLKMEKVESHLKG 724
           I  +  EK+  HL GE A+ +++D+P+ +  V +  K +E    ++++  +EKV S L G
Sbjct: 111 IGKRTAEKIVDHL-GEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNG 169



>gb:BA000028_694973 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 607

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 22/77 (28%), Positives = 41/77 (53%)
 Frame = +2

Query: 548 IDHQKMEKVESHLKGEEAMVEVIDNPKMEKVESHLKGEEAMVEVIDNLKMEKVESHLKGE 727
           I+ + M+++E+ +      V+  D+P +  V    +GE  +  +I+N++ E  E  L   
Sbjct: 333 IEERLMKQLETDVS---LRVDPTDSPDVWTVSG--RGELHLSILIENMRREGYELQLSKP 387

Query: 728 EAMVEVIDNLKMEXVER 778
           E ++  ID +K E VER
Sbjct: 388 EVIIREIDGVKCEPVER 404



>gb:AE017355_465420 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 778

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +2

Query: 548 IDHQKMEKVESHLKGEEAMVEVIDNPK-MEKVESHLKGEEAMVEVIDNLKMEKVESHLKG 724
           I  +  EK+  HL GE A+ +++D+P+ +  V +  K +E    ++++  +EKV S L G
Sbjct: 111 IGKRTAEKIVDHL-GEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNG 169



>gb:AE017012_379258 Bacillus cereus ATCC 14579 section 15 of 18 of
           the complete genome.>gb:AE016877_1019508 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 778

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = +2

Query: 548 IDHQKMEKVESHLKGEEAMVEVIDNPK-MEKVESHLKGEEAMVEVIDNLKMEKVESHLKG 724
           I  +  EK+  HL GE A+ +++D+P+ +  V +  K +E    ++++  +EKV S L G
Sbjct: 111 IGKRTAEKIVDHL-GEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNG 169


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 597,825,571
Number of Sequences: 1806583
Number of extensions: 10553025
Number of successful extensions: 38797
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 31484
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37936
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 56474197762
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)