BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6398
         (747 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|B84833|B84833 hypothetical protein At2g40730 [imported] - Ar...   333   2e-90   Arabidopsis thaliana [mouse-ear cress]
gb:AP003446_1829535 Oryza sativa (japonica cultivar-group) genom...   317   1e-85   
gb:AP003446_1829534 Oryza sativa (japonica cultivar-group) genom...   317   1e-85   
gb:BC087141_2110030 Rattus norvegicus SCY1-like 1 (S. cerevisiae...   120   2e-26   
gb:BC034519_2097675 Mus musculus SCY1-like 1 (S. cerevisiae), mR...   120   3e-26   
gb:AF276514_2061239 Mus musculus 105-kDa kinase-like protein mRN...   120   3e-26   
gb:AF255613_1893155 Homo sapiens teratoma-associated tyrosine ki...   115   6e-25   
gb:AB051428_1867942 Homo sapiens gklp mRNA for kinase-like prote...   115   6e-25   
gb:AB051427_1867941 Homo sapiens gklp mRNA for kinase-like prote...   115   6e-25   
gb:AB047077_1867506 Homo sapiens gklp mRNA for kinase-like prote...   115   6e-25   
gb:AE014297_1142022 Drosophila melanogaster chromosome 3R, compl...   112   7e-24   
gb:BC074449_2557951 Xenopus laevis hypothetical protein LOC44371...   110   4e-23   
gb:AF297709_1895606 Homo sapiens telomerase regulation-associate...   101   2e-20   
gb:AE017349_1758829 Cryptococcus neoformans var. neoformans JEC2...    75   1e-12   
gb:CR382133_1666863 Debaryomyces hansenii chromosome A of strain...    72   8e-12   
sp|O13733|YDOD_SCHPO|YDOD_SCHPO Hypothetical protein C15A10.13 in chromosom...    70   5e-11   Schizosaccharomyces pombe
pir|T26272|T26272 hypothetical protein W07G4.3 - Caenorhabditis ...    69   9e-11   Caenorhabditis elegans [roundworm]
gb:BX323056_2567324 Zebrafish DNA sequence from clone DKEY-97O5 ...    67   3e-10   
gb:BC044195_2548583 Danio rerio zgc:55575, mRNA (cDNA clone MGC:...    67   3e-10   
gb:BC070637_2555613 Xenopus laevis hypothetical protein MGC81481...    65   1e-09   
gb:NCB11A5_1688960 Neurospora crassa DNA linkage group V BAC clo...    60   6e-08   
gb:BC066800_2105828 Mus musculus RIKEN cDNA 1200016D23 gene, mRN...    59   1e-07   
gb:AK004809_1152611 Mus musculus adult male lung cDNA, RIKEN ful...    59   1e-07   
gb:HS97P20_1999870 Human DNA sequence from clone RP1-97P20 on ch...    58   2e-07   
gb:HS97P20_1999869 Human DNA sequence from clone RP1-97P20 on ch...    58   2e-07   
gb:HS97P20_1999868 Human DNA sequence from clone RP1-97P20 on ch...    58   2e-07   
gb:BC014662_1974764 Homo sapiens ezrin-binding partner PACE-1, t...    58   2e-07   
gb:AY144493_1937071 Homo sapiens ezrin-binding protein PACE-1 mR...    58   2e-07   
gb:AF540957_1906450 Homo sapiens ezrin-binding partner PACE-1 mR...    58   2e-07   
gb:CR382131_1664598 Yarrowia lipolytica chromosome E of strain C...    57   5e-07   
gb:AE014297_1141893 Drosophila melanogaster chromosome 3R, compl...    55   1e-06   
gb:PFA929351_1392938 Plasmodium falciparum strain 3D7, chromosom...    52   9e-06   
gb:BC063798_1986358 Homo sapiens SCY1-like 2 (S. cerevisiae), mR...    52   1e-05   
gb:BX908811_1644643 Neurospora crassa DNA linkage group VI Cosmi...    52   1e-05   
gb:LMFL1508_1387756 Leishmania major Friedlin chromosome 21 cosm...    52   1e-05   
gb:CR860469_1184536 Pongo pygmaeus mRNA; cDNA DKFZp459E161 (from...    52   1e-05   
gb:AE016819_1748616 Ashbya gossypii (= Eremothecium gossypii) AT...    50   6e-05   
gb:BC042443_2098616 Mus musculus SCY1-like 2 (S. cerevisiae), mR...    49   7e-05   
gb:CR382136_1668707 Debaryomyces hansenii chromosome D of strain...    46   6e-04   
gb:CR382131_1663815 Yarrowia lipolytica chromosome E of strain C...    46   6e-04   
sp|P53009|SCY1_YEAST|SCY1_YEAST SCY1 protein.>pir|S64090|S64090 SCY1 protei...    45   0.001   Saccharomyces cerevisiae [brewer's yeast]
pir|S60992|S60992 hypothetical protein YOR112w - yeast (Saccharo...    45   0.002   Saccharomyces cerevisiae [brewer's yeast]
gb:AE014296_1135657 Drosophila melanogaster chromosome 3L, compl...    44   0.003   
gb:BX784401_2567939 Zebrafish DNA sequence from clone CH211-244B...    41   0.026   
pir|T50397|T50397 probable serine/threonine protein kinase [impo...    40   0.035   Schizosaccharomyces pombe
gb:AF003134_1230775 Caenorhabditis elegans cosmid ZC581, complet...    39   0.13    
gb:AB037781_1866572 Homo sapiens mRNA for KIAA1360 protein, part...    38   0.17    
gb:CR380955_1651638 Candida glabrata strain CBS138 chromosome I ...    37   0.29    
gb:CR382125_1658083 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.50    
gb:AC016163_1538125 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    37   0.50    
gb:CAU92261_1645594 Candida albicans CDC2-related protein kinase...    36   0.85    
gb:CNS07EGI_1374405 chromosome IX of strain GB-M1 of Encephalito...    36   0.85    
pir|T29772|T29772 hypothetical protein ZC581.9 - Caenorhabditis ...    36   0.85    Caenorhabditis elegans [roundworm]
gb:AY181250_1587586 Kluyveromyces delphensis SCY1 (SCY1), GUP1 (...    35   1.1     
gb:AE017343_1755802 Cryptococcus neoformans var. neoformans JEC2...    35   1.5     
gb:AP005613_1854941 Oryza sativa (japonica cultivar-group) genom...    34   2.5     
gb:AE014296_1137037 Drosophila melanogaster chromosome 3L, compl...    34   2.5     
pir|A56699|A56699 guanylate cyclase (EC 4.6.1.2), receptor-type ...    34   2.5     Drosophila melanogaster
sp|O32866|MTRB_METKA|MTRB_METKA Tetrahydromethanopterin S-methyltransferase...    34   3.2     Methanopyrus kandleri
gb:AY014441_1287958 Drosophila americana strain G96.36 fused1 pr...    33   4.2     
gb:AY014435_1287952 Drosophila americana strain G96.21 fused1 pr...    33   4.2     
gb:AE014186_938205 Plasmodium falciparum 3D7 chromosome 11 compl...    33   5.5     
gb:AJ720053_2502240 Gallus gallus mRNA for hypothetical protein,...    33   7.2     
gb:AF231723_2218879 Dengue virus type 4 isolate P75-514 envelope...    33   7.2     
gb:AB011967_1511593 Oryza sativa OsPK4 gene, complete cds.>gb:AC...    33   7.2     
gb:AF239866_1253941 Drosophila lummei fused protein (fu) gene, p...    33   7.2     
gb:CP000004_861918 Gluconobacter oxydans 621H plasmid pGOX1, com...    33   7.2     
gb:CR382124_1656964 Kluyveromyces lactis strain NRRL Y-1140 chro...    32   9.4     
pir|T03130|T03130 probable tyrosine kinase - alcelaphine herpesv...    32   9.4     Alcelaphine herpesvirus 1 strain C500


>pir|B84833|B84833 hypothetical protein At2g40730 [imported] -
           Arabidopsis thaliana>gb:AC007660_1536082 Arabidopsis
           thaliana chromosome II section 220 of 255 of the
           complete sequence. Sequence from clones T2P4, T7D17,
           T20B5.
          Length = 604

 Score =  333 bits (854), Expect = 2e-90
 Identities = 160/195 (82%), Positives = 173/195 (88%)
 Frame = +2

Query: 161 MLKFLKXXXXXXXXXXKDLPYNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND 340
           M KFLK          KDLPYNIG+PY SAWGSW H+RGTSKDDG+PVSIFALSG+NA D
Sbjct: 1   MFKFLKGVVAGSGTGLKDLPYNIGDPYPSAWGSWSHFRGTSKDDGSPVSIFALSGNNAQD 60

Query: 341 GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG 520
           GHLAAGRNGVKRLRTVRHPNILSFLHSTEVET DGSTTKVTIYIVTEPVMPL +K+KELG
Sbjct: 61  GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETHDGSTTKVTIYIVTEPVMPLSDKIKELG 120

Query: 521 LVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFD 700
           L  TQRDEY+A GLH+I KAVSFLNNDCKLVHGNVC+ASVVVT TLDWKLHALDVLSEFD
Sbjct: 121 LKATQRDEYFALGLHQIGKAVSFLNNDCKLVHGNVCLASVVVTPTLDWKLHALDVLSEFD 180

Query: 701 GNNETSTGPMLQYEW 745
           G+NE+++GPML YEW
Sbjct: 181 GSNESASGPMLPYEW 195



>gb:AP003446_1829535 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1529_G03.
          Length = 442

 Score =  317 bits (813), Expect = 1e-85
 Identities = 152/195 (77%), Positives = 160/195 (82%)
 Frame = +2

Query: 161 MLKFLKXXXXXXXXXXKDLPYNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND 340
           M KFLK          KD PY IGEPY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct: 1   MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD 60

Query: 341 GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG 520
            HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EKLKEL 
Sbjct: 61  RHLVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAMKHTIYIVTEPVTPLSEKLKELN 120

Query: 521 LVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFD 700
           L GTQRDEY+AWGLH+I+KAVSFLNNDCKLVHGNVCV SVVVTQTLDWKLHA DVLSEFD
Sbjct: 121 LGGTQRDEYFAWGLHQISKAVSFLNNDCKLVHGNVCVTSVVVTQTLDWKLHAFDVLSEFD 180

Query: 701 GNNETSTGPMLQYEW 745
            NNE S  PMLQ+EW
Sbjct: 181 ANNEASNSPMLQFEW 195



>gb:AP003446_1829534 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1529_G03.
          Length = 825

 Score =  317 bits (813), Expect = 1e-85
 Identities = 152/195 (77%), Positives = 160/195 (82%)
 Frame = +2

Query: 161 MLKFLKXXXXXXXXXXKDLPYNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAND 340
           M KFLK          KD PY IGEPY+SAWGSW H+RGTSKDDG+PVSIF+LSGSN  D
Sbjct: 1   MFKFLKEVVAGSGSGLKDFPYTIGEPYASAWGSWTHHRGTSKDDGSPVSIFSLSGSNPQD 60

Query: 341 GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG 520
            HL AGRNGVKRLRTVRHPNILSFLHSTE E  DG   K TIYIVTEPV PL EKLKEL 
Sbjct: 61  RHLVAGRNGVKRLRTVRHPNILSFLHSTEAEVPDGPAMKHTIYIVTEPVTPLSEKLKELN 120

Query: 521 LVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFD 700
           L GTQRDEY+AWGLH+I+KAVSFLNNDCKLVHGNVCV SVVVTQTLDWKLHA DVLSEFD
Sbjct: 121 LGGTQRDEYFAWGLHQISKAVSFLNNDCKLVHGNVCVTSVVVTQTLDWKLHAFDVLSEFD 180

Query: 701 GNNETSTGPMLQYEW 745
            NNE S  PMLQ+EW
Sbjct: 181 ANNEASNSPMLQFEW 195



>gb:BC087141_2110030 Rattus norvegicus SCY1-like 1 (S. cerevisiae)
           (predicted), mRNA (cDNA clone MGC:95113 IMAGE:7127562),
           complete cds.
          Length = 807

 Score =  120 bits (302), Expect = 2e-26
 Identities = 65/168 (38%), Positives = 92/168 (54%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNIGE--PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+ +    P     G WV +RG  K  G+ VSIF        +      +   KRL+
Sbjct: 10  RDFPFELNPEPPEGGPPGPWVLHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  ++IVTE V PL   LK     G  +++  +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +    GN
Sbjct: 122 HQIVKALSFLVNDCNLIHNNVCMAAVFVDKAGEWKLGGLDYMYSAQGN 169



>gb:BC034519_2097675 Mus musculus SCY1-like 1 (S. cerevisiae), mRNA
           (cDNA clone MGC:18927 IMAGE:3672524), complete cds.
          Length = 806

 Score =  120 bits (301), Expect = 3e-26
 Identities = 64/168 (38%), Positives = 92/168 (54%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNIGE--PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+ +    P     G W+ +RG  K  G+ VSIF        +      +   KRL+
Sbjct: 10  RDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  ++IVTE V PL   LK     G  +++  +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +    GN
Sbjct: 122 HQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGN 169



>gb:AF276514_2061239 Mus musculus 105-kDa kinase-like protein mRNA,
           complete cds.
          Length = 806

 Score =  120 bits (301), Expect = 3e-26
 Identities = 64/168 (38%), Positives = 92/168 (54%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNIGE--PYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+ +    P     G W+ +RG  K  G+ VSIF        +      +   KRL+
Sbjct: 10  RDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  ++IVTE V PL   LK     G  +++  +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +    GN
Sbjct: 122 HQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGN 169



>gb:AF255613_1893155 Homo sapiens teratoma-associated tyrosine
           kinase (TAPK) gene, exons 1 through 6 and partial cds.
          Length = 283

 Score =  115 bits (289), Expect = 6e-25
 Identities = 63/168 (37%), Positives = 90/168 (53%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNI--GEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+ +    P     G W  +RG  K  G+PVSIF        +      +   KR +
Sbjct: 10  RDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +    GN
Sbjct: 122 HQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGN 169



>gb:AB051428_1867942 Homo sapiens gklp mRNA for kinase-like protein
           splice variant 1, complete cds.
          Length = 791

 Score =  115 bits (289), Expect = 6e-25
 Identities = 63/168 (37%), Positives = 90/168 (53%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNI--GEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+ +    P     G W  +RG  K  G+PVSIF        +      +   KR +
Sbjct: 10  RDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +    GN
Sbjct: 122 HQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGN 169



>gb:AB051427_1867941 Homo sapiens gklp mRNA for kinase-like protein,
           complete cds.>gb:BC069233_1987878 Homo sapiens SCY1-like
           1 (S. cerevisiae), mRNA (cDNA clone MGC:78454
           IMAGE:6581110), complete cds.
          Length = 808

 Score =  115 bits (289), Expect = 6e-25
 Identities = 63/168 (37%), Positives = 90/168 (53%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNI--GEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+ +    P     G W  +RG  K  G+PVSIF        +      +   KR +
Sbjct: 10  RDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +    GN
Sbjct: 122 HQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGN 169



>gb:AB047077_1867506 Homo sapiens gklp mRNA for kinase-like protein
           splice variant 2, complete cds.
          Length = 707

 Score =  115 bits (289), Expect = 6e-25
 Identities = 63/168 (37%), Positives = 90/168 (53%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNI--GEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+ +    P     G W  +RG  K  G+PVSIF        +      +   KR +
Sbjct: 10  RDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +    GN
Sbjct: 122 HQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGN 169



>gb:AE014297_1142022 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003771_1224015 Drosophila melanogaster
           chromosome 3R, section 109 of 118 of the complete
           sequence.
          Length = 873

 Score =  112 bits (280), Expect = 7e-24
 Identities = 63/168 (37%), Positives = 91/168 (54%), Gaps = 2/168 (1%)
 Frame = +2

Query: 209 KDLPYNIGEPYSS--AWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           KD PY+IGEP      +  W  ++   K     VS+F     + +D      +  +KRL+
Sbjct: 11  KDFPYDIGEPVGGFDQYSIWTLHKAKRKTTLEEVSVFVYDIRSGSDTKCELAKAALKRLK 70

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHP+IL +L S E + +        +Y+ TE V PL     +LG    Q+  Y AWG+
Sbjct: 71  TLRHPSILQYLDSLETDKM--------LYVATEAVDPLGTYFSKLGSDNVQKGLYLAWGI 122

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
            +IT+A+SFLNND  L H NV   SV V  + +WKL +L+ +S  DGN
Sbjct: 123 FQITRALSFLNNDGNLRHNNVSAWSVFVNASGEWKLGSLEYVSAADGN 170



>gb:BC074449_2557951 Xenopus laevis hypothetical protein LOC443710,
           mRNA (cDNA clone IMAGE:6948530), partial cds.
          Length = 823

 Score =  110 bits (274), Expect = 4e-23
 Identities = 61/160 (38%), Positives = 86/160 (53%)
 Frame = +2

Query: 209 KDLPYNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTV 388
           +D PY++        G W   +G  K  G PVS+F        +    A +   KR++T+
Sbjct: 6   RDFPYDVTGEREELPGGWGIQKGKKKTGGDPVSVFTYEIRPGAEEQTQAAKTASKRIKTL 65

Query: 389 RHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHR 568
           +HPNILS+        VDG  T   +YIVTEPV PL   +K     G   +   +WGLH+
Sbjct: 66  KHPNILSY--------VDGLETDKCLYIVTEPVTPLETYVKLRTDSGGVSELEISWGLHQ 117

Query: 569 ITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVL 688
           I KA+SFL ND  L+H NVC+++V V +  +WKL  LD +
Sbjct: 118 IVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYM 157



>gb:AF297709_1895606 Homo sapiens telomerase regulation-associated
           protein mRNA, complete cds.
          Length = 786

 Score =  101 bits (251), Expect = 2e-20
 Identities = 60/162 (37%), Positives = 87/162 (53%), Gaps = 2/162 (1%)
 Frame = +2

Query: 209 KDLPYN-IGEPYSSAW-GSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLR 382
           +D P+  I EP  +A  G         +  G+PVSIF        +      +   KR +
Sbjct: 10  RDFPFELIPEPPEAACPGPGPCTAAARRATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFK 69

Query: 383 TVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGL 562
           T+RHPNIL++        +DG  T+  +++VTE V PL   LK     G  ++   +WGL
Sbjct: 70  TLRHPNILAY--------IDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGL 121

Query: 563 HRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVL 688
           H+I KA+SFL NDC L+H NVC+A+V V +  +WKL  LD +
Sbjct: 122 HQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYM 163



>gb:AE017349_1758829 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 931

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 51/182 (28%), Positives = 85/182 (46%), Gaps = 21/182 (11%)
 Frame = +2

Query: 218 PYNIGEPY---SSAWGSWVHYRGTSKDDGAPVSIFALS--------GSNANDGHLAAGRN 364
           P+++GE      S    W    G  +DDG P+++F           GS          +N
Sbjct: 20  PFSVGERIPGLDSHSSIWEIREGVKRDDGTPLTLFIYDSTLPLFQPGSKDRKVLFQLAKN 79

Query: 365 GVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGT---- 532
            +K+LRT+RHP+I+ ++ S E ET         IYI TE V PL   L++    G     
Sbjct: 80  ALKKLRTIRHPDIIKYIDSVETET--------HIYIATERVRPLEGVLRDWETGGALASG 131

Query: 533 -----QRDEYYAWGLHRITKAVSFLNN-DCKLVHGNVCVASVVVTQTLDWKLHALDVLSE 694
                 ++ +  WG+  ++ A++FLN+      H  +   S+ VT +L+W+L   ++L+ 
Sbjct: 132 SGRAKGKENWIGWGVRSLSSALAFLNSPPLSQHHSYLLPTSIFVTPSLEWRLAGFELLTG 191

Query: 695 FD 700
            D
Sbjct: 192 KD 193



>gb:CR382133_1666863 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 760

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 49/155 (31%), Positives = 83/155 (53%), Gaps = 6/155 (3%)
 Frame = +2

Query: 260 WVHYRGTS-KDDGAPVSIFALSGS---NANDGHLAAGRNGVKRLRTVRHPNILSFLHSTE 427
           W  Y G + K+D APV+IF  +     N  + ++A  RN  K+++ ++HP I+S +   E
Sbjct: 38  WTIYDGLNPKNDNAPVTIFEFNLKDPVNIQNDYIALARNCFKKVKLIKHPGIISVIDFIE 97

Query: 428 VETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ-RDEYYAWGLHRITKAVSFLNNDC 604
            +          +YIVTE V+PL      LG   TQ  ++   +G++ I +++ F+N  C
Sbjct: 98  NDNF--------LYIVTEQVVPL---KSYLGNNKTQISEDAKLFGIYSIGQSLLFINMKC 146

Query: 605 KLVHGNVCV-ASVVVTQTLDWKLHALDVLSEFDGN 706
             +HGN+ V  S+ VT   DWKL   ++L+  + +
Sbjct: 147 HCLHGNIDVNNSIFVTSAGDWKLFGFELLTNLNSD 181



>sp|O13733|YDOD_SCHPO Hypothetical protein C15A10.13 in chromosome
           I.>pir|T37713|T37713 hypothetical protein SPAC15A10.13 -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC15A10_1716569 S.pombe chromosome I cosmid
           c15A10.
          Length = 637

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 48/168 (28%), Positives = 81/168 (48%), Gaps = 1/168 (0%)
 Frame = +2

Query: 164 LKFLKXXXXXXXXXXKDLPYNIGEPYSSAWGS-WVHYRGTSKDDGAPVSIFALSGSNAND 340
           + F+K             PY++ E    +  S W    G+ ++   P S+F++S S   +
Sbjct: 1   MDFIKSAASFIAKAGSQFPYDLNEKIPLSSNSVWTLQTGSIRESAQPCSVFSISLSTHPE 60

Query: 341 GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELG 520
               A R   + ++T+RHP I+ +L + +  T         +YI TE V P+  +L EL 
Sbjct: 61  WAELADR-ACETMKTLRHPCIIKYLSTYKSST--------HLYIATETVRPVTTELNELS 111

Query: 521 LVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDW 664
                  E   +GL R++ A+SFLN D  +VHGN+ ++SV +    +W
Sbjct: 112 A------EIKTYGLWRVSAALSFLN-DKNIVHGNLQMSSVYLNSADEW 152



>pir|T26272|T26272 hypothetical protein W07G4.3 - Caenorhabditis
           elegans>gb:CEW07G4_1369030 Caenorhabditis elegans cosmid
           W07G4, complete sequence.
          Length = 820

 Score = 68.9 bits (167), Expect = 9e-11
 Identities = 41/120 (34%), Positives = 68/120 (56%)
 Frame = +2

Query: 338 DGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKEL 517
           D   +  +   ++L+T+RHPNI+++L S E+E         T Y+VTE   PL   LKE 
Sbjct: 52  DNRSSTLKQQAQKLKTMRHPNIITYLDSIELEG--------TFYLVTEKCKPLELYLKEA 103

Query: 518 GLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEF 697
           GL  +Q++   +WG+ ++  A+ F+ ++ KL H N+    V VT   DWK+  L +++ F
Sbjct: 104 GLTESQKEFVVSWGMFQLLNALKFM-HEAKLSHENL-RKGVFVTAGGDWKIGGLHLVTGF 161



>gb:BX323056_2567324 Zebrafish DNA sequence from clone DKEY-97O5 in
           linkage group 20 Contains the 3' end of a novel gene, a
           novel gene (zgc:55575), the gene for a novel protein
           similar to vertebrate PRG4, the gene for a novel protein
           similar to translocated promoter region (to activated
           MET oncogene) (TPR), the gene for a novel protein
           similar to vertebrate phosducin (PDC), the gene for a
           novel protein similar to prostaglandin-endoperoxide
           synthase 2 (ptgs2), the 5' end of the gene for a novel
           protein similar to cytosolic phospholipase a2 (cpla2)
           and two CpG islands, complete sequence.
          Length = 768

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 49/136 (36%), Positives = 71/136 (52%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG P S+F     N +  + AA     K L+T+RHP +L FL S  V+  DG      I+
Sbjct: 33  DGKPASVFVHKQDNEDKVNKAA-----KHLKTLRHPCLLRFL-SCSVQ--DGG-----IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTEPV PL   L  L        E    GL+ + +A+ FL++  K  H NVC++SV V 
Sbjct: 80  LVTEPVQPLKRLLDNLSA------EEICAGLYDLLQALVFLHDRGKSSHNNVCISSVFVG 133

Query: 650 QTLDWKLHALDVLSEF 697
           +   WKL  ++ + +F
Sbjct: 134 EDGHWKLGGMETVCKF 149



>gb:BC044195_2548583 Danio rerio zgc:55575, mRNA (cDNA clone
           MGC:55575 IMAGE:2643253), complete cds.
          Length = 768

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 49/136 (36%), Positives = 71/136 (52%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG P S+F     N +  + AA     K L+T+RHP +L FL S  V+  DG      I+
Sbjct: 33  DGKPASVFVHKQDNEDKVNKAA-----KHLKTLRHPCLLRFL-SCSVQ--DGG-----IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTEPV PL   L  L        E    GL+ + +A+ FL++  K  H NVC++SV V 
Sbjct: 80  LVTEPVQPLKRLLDNLSA------EEICAGLYDLLQALVFLHDRGKSSHNNVCISSVFVG 133

Query: 650 QTLDWKLHALDVLSEF 697
           +   WKL  ++ + +F
Sbjct: 134 EDGHWKLGGMETVCKF 149



>gb:BC070637_2555613 Xenopus laevis hypothetical protein MGC81481,
           mRNA (cDNA clone MGC:81481 IMAGE:6636554), complete cds.
          Length = 705

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 47/133 (35%), Positives = 73/133 (54%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           +G P S+F     N +    AA     K L+T+RHP +L FL  T  +  DG      IY
Sbjct: 33  EGRPASVFVYQPENQDKVDKAA-----KHLKTLRHPCLLRFLSCTVEQ--DG------IY 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL   L++L       DE  A G++ + +A+ FL++  K+ H NVC++SV V+
Sbjct: 80  LVTERVQPLEMLLEKLST-----DEICA-GIYDVLQALVFLHDRGKVSHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVL 688
           +   WKL  ++++
Sbjct: 134 EDGHWKLGGMEMV 146



>gb:NCB11A5_1688960 Neurospora crassa DNA linkage group V BAC clone
           B11A5.
          Length = 776

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 46/178 (25%), Positives = 66/178 (37%), Gaps = 2/178 (1%)
 Frame = +2

Query: 164 LKFLKXXXXXXXXXXKDLPYNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDG 343
           + FLK             PYN G+        W  Y GT                     
Sbjct: 1   MDFLKSAVASAIAKGPPFPYNFGDKVDFDPSIWTLYNGT--------------------- 39

Query: 344 HLAAGRNGVKRLRTVRHPNILSFLHSTE--VETVDGSTTKVTIYIVTEPVMPLCEKLKEL 517
                R GV             F H T   ++      T   IYI TE ++PL   +K  
Sbjct: 40  -----RRGV-------------FAHGTSWSLKLSLAQKTDSYIYIATERLVPLSWHVKRK 81

Query: 518 GLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLS 691
            L      E   WGL+ + K + F+N D   +HGN+ VAS+  +++ +WK+   +VLS
Sbjct: 82  SL----SPETAKWGLYSVAKTLKFINGDASSIHGNLKVASIYTSESGEWKIGGFEVLS 135



>gb:BC066800_2105828 Mus musculus RIKEN cDNA 1200016D23 gene, mRNA
           (cDNA clone MGC:76473 IMAGE:30435732), complete cds.
          Length = 612

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 48/135 (35%), Positives = 70/135 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKCASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSPAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVLSE 694
           +   WKL  ++ + +
Sbjct: 134 EDGHWKLGGMETVCQ 148



>gb:AK004809_1152611 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200016D23
           product:hypothetical ARM repeat structure containing
           protein, full insert sequence.>gb:BC043085_2098818 Mus
           musculus RIKEN cDNA 1200016D23 gene, mRNA (cDNA clone
           MGC:57999 IMAGE:6417440), complete cds.
          Length = 735

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 48/135 (35%), Positives = 70/135 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKCASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSPAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVLSE 694
           +   WKL  ++ + +
Sbjct: 134 EDGHWKLGGMETVCQ 148



>gb:HS97P20_1999870 Human DNA sequence from clone RP1-97P20 on
           chromosome 1q23.2-24.3 Contains the 3' end of a novel
           gene (FLJ45155 FLJ10706 FLJ39174) and the gene for
           ezrin-binding partner PACE-1 (PACE-1), complete
           sequence.
          Length = 588

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 48/133 (36%), Positives = 69/133 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKFASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSSAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVL 688
           +   WKL  ++ +
Sbjct: 134 EDGHWKLGGMETV 146



>gb:HS97P20_1999869 Human DNA sequence from clone RP1-97P20 on
           chromosome 1q23.2-24.3 Contains the 3' end of a novel
           gene (FLJ45155 FLJ10706 FLJ39174) and the gene for
           ezrin-binding partner PACE-1 (PACE-1), complete
           sequence.>gb:HS97P201_1999872 Novel human gene mapping
           to chomosome 1.
          Length = 688

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 48/133 (36%), Positives = 69/133 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKFASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSSAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVL 688
           +   WKL  ++ +
Sbjct: 134 EDGHWKLGGMETV 146



>gb:HS97P20_1999868 Human DNA sequence from clone RP1-97P20 on
           chromosome 1q23.2-24.3 Contains the 3' end of a novel
           gene (FLJ45155 FLJ10706 FLJ39174) and the gene for
           ezrin-binding partner PACE-1 (PACE-1), complete
           sequence.
          Length = 742

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 48/133 (36%), Positives = 69/133 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKFASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSSAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVL 688
           +   WKL  ++ +
Sbjct: 134 EDGHWKLGGMETV 146



>gb:BC014662_1974764 Homo sapiens ezrin-binding partner PACE-1,
           transcript variant 1, mRNA (cDNA clone MGC:23025
           IMAGE:4852719), complete cds.
          Length = 688

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 48/133 (36%), Positives = 69/133 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKFASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSSAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVL 688
           +   WKL  ++ +
Sbjct: 134 EDGHWKLGGMETV 146



>gb:AY144493_1937071 Homo sapiens ezrin-binding protein PACE-1 mRNA,
           complete cds; alternatively spliced.
          Length = 742

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 48/133 (36%), Positives = 69/133 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKFASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSSAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVL 688
           +   WKL  ++ +
Sbjct: 134 EDGHWKLGGMETV 146



>gb:AF540957_1906450 Homo sapiens ezrin-binding partner PACE-1 mRNA,
           complete cds.
          Length = 688

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 48/133 (36%), Positives = 69/133 (51%)
 Frame = +2

Query: 290 DGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIY 469
           DG   S+F     N +  + AA     K L+T+RHP +L FL  T VE  DG      I+
Sbjct: 33  DGKFASVFVYKRENEDKVNKAA-----KHLKTLRHPCLLRFLSCT-VEA-DG------IH 79

Query: 470 IVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT 649
           +VTE V PL     E+ L      E  A G++ I  A+ FL++   L H NVC++SV V+
Sbjct: 80  LVTERVQPL-----EVALETLSSAEVCA-GIYDILLALIFLHDRGHLTHNNVCLSSVFVS 133

Query: 650 QTLDWKLHALDVL 688
           +   WKL  ++ +
Sbjct: 134 EDGHWKLGGMETV 146



>gb:CR382131_1664598 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 749

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 44/200 (22%), Positives = 88/200 (44%), Gaps = 10/200 (5%)
 Frame = +2

Query: 164 LKFLKXXXXXXXXXXKDLPYNIGEPYSSAWGS---WVHYRGTSKDDGAPVSIFALSGSNA 334
           + FL             LP+ +G+    A      W  Y  T K + +  ++F       
Sbjct: 1   MDFLTKAIGTVSSYGSKLPFVLGDATQKASEGRSLWTVYDATLKSNSSDCTVFEFVADQT 60

Query: 335 ND-GHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLK 511
                +   ++  + L+T R P IL    + E +T        ++++VTE    L + ++
Sbjct: 61  YPRDRIVVVKHFARSLKTYRFPGILKVHDTVETDT--------SVHVVTERCRSLAQVIR 112

Query: 512 ELGLVGTQRDEYYA----WGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHAL 679
           +       +DE  A    WGL+ +T+ +  +N +    HGN+ + S+ +T + +WK+  L
Sbjct: 113 D------SKDELSADRILWGLYFVTETLKQINAEGASTHGNISLDSIFITASGEWKVGGL 166

Query: 680 DVL-SEFDGNNE-TSTGPML 733
           +++ ++ D  +   S GP+L
Sbjct: 167 ELITAQKDAQSALASFGPLL 186



>gb:AE014297_1141893 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003767_1223886 Drosophila melanogaster
           chromosome 3R, section 105 of 118 of the complete
           sequence.>gb:AY069624_1294354 Drosophila melanogaster
           LD39455 full length cDNA.
          Length = 835

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 37/150 (24%), Positives = 64/150 (42%), Gaps = 9/150 (6%)
 Frame = +2

Query: 260 WVHYRGTSKDDGAPVSIFALS-------GSNANDGHLAAGRNGVKRLRTVRHPNILSFLH 418
           W  Y G  K     VS+F            +  +  L   R GV++L  +RHP++L+  H
Sbjct: 46  WKVYNGHKKSTKQEVSVFVFEKKSLERWSKDDRETMLETLRRGVQQLTKIRHPHVLTVQH 105

Query: 419 STEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQR--DEYYAWGLHRITKAVSFL 592
             E        ++ ++   TEPV      +    +   ++  D     GL ++   + FL
Sbjct: 106 PLE-------ESRDSLAFATEPVFASLANVVGDNVRSEKKLYDVEIRHGLLQLFDGLQFL 158

Query: 593 NNDCKLVHGNVCVASVVVTQTLDWKLHALD 682
           + D K+VH N+   ++V+ +   WKL   D
Sbjct: 159 HQDAKIVHRNISAETIVINKNRSWKLFGFD 188



>gb:PFA929351_1392938 Plasmodium falciparum strain 3D7, chromosome
           5, segment 1/4.
          Length = 850

 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 43/144 (29%), Positives = 64/144 (44%), Gaps = 2/144 (1%)
 Frame = +2

Query: 269 YRGTSKDDGAPVSIFALSGSNANDGHLAAG-RNGVKRLRTVRHPNILSFLHSTEVETVDG 445
           Y G  K+ G  V +F    +N     +    +N +   + + HPNIL  L + E E    
Sbjct: 37  YEGHDKN-GEEVCVFIYEKNNKETSFVKRYIKNHLSYSKKLIHPNILKVLDTYENEK--- 92

Query: 446 STTKVTIYIVTEPVMPLC-EKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGN 622
                 IYIVTE  +PL  EK+K   +          WGL+ I + + F+N+ C  +HG 
Sbjct: 93  -----RIYIVTEKCVPLIYEKIKSDPI----------WGLYEIMRCIHFINS-CNYIHGL 136

Query: 623 VCVASVVVTQTLDWKLHALDVLSE 694
           +   S+ V     WKL   D + E
Sbjct: 137 INPLSIFVNSKGRWKLSNFDCIHE 160



>gb:BC063798_1986358 Homo sapiens SCY1-like 2 (S. cerevisiae), mRNA
           (cDNA clone MGC:70725 IMAGE:6473586), complete cds.
          Length = 929

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 36/164 (21%), Positives = 73/164 (44%), Gaps = 22/164 (13%)
 Frame = +2

Query: 257 SWVHYRGTSKDDGAPVSIFALSGSNAN-------DGHLAAGRNGVKRLRTVRHPNILSFL 415
           +W  + GT K     V++F       +       D  + + + GV++L  +RHP +L+  
Sbjct: 46  AWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQ 105

Query: 416 HSTEVETVDGSTTKVTIYIVTEPVM---------------PLCEKLKELGLVGTQRDEYY 550
           H  E        ++  +   TEPV                P+   +K+  L   +     
Sbjct: 106 HPLE-------ESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETK--- 155

Query: 551 AWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALD 682
            +GL ++++ +SFL++  K+VHGN+   ++++ ++  WK+   D
Sbjct: 156 -YGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFD 198



>gb:BX908811_1644643 Neurospora crassa DNA linkage group VI Cosmid
           contig H4H7.
          Length = 1015

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 57/211 (27%), Positives = 84/211 (39%), Gaps = 41/211 (19%)
 Frame = +2

Query: 221 YNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFA------------LSGSNANDGHLAAGRN 364
           Y+I    ++  G W  Y    K  G   S+F             LS S+A  G       
Sbjct: 19  YSISSTLTTTAGPWKIYPAKKKSTGKEYSVFVFDRKILDAHSKDLSRSSAA-GFKKVVEE 77

Query: 365 GVKRLRT-------VRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKL-KELG 520
            V+RL+        +RHP IL  +   E ET  G    VT  + T     L EK  +E  
Sbjct: 78  VVERLKKEASSLARLRHPAILELVEPVE-ETRGGGLQFVTEPVTTSLAAVLQEKDDQERN 136

Query: 521 LVGTQRDEY--------------------YAWGLHRITKAVSFLNNDCKLVHGNVCVASV 640
            VG +   Y                    Y  GL +++KA+ FL+ +  LVHGN+   ++
Sbjct: 137 GVGGRSSRYVREEPDGTRRRREVEIDELEYQKGLLQVSKALEFLHENAGLVHGNLTPDAI 196

Query: 641 VVTQTLDWKLHALDVLS-EFDGNNETSTGPM 730
           ++    DWK+  L   S + D +  TS  P+
Sbjct: 197 LINAKSDWKVSGLAFCSPQQDSDKPTSIQPI 227



>gb:LMFL1508_1387756 Leishmania major Friedlin chromosome 21 cosmid
           L1508, PREFINAL.
          Length = 233

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 49/163 (30%), Positives = 72/163 (44%), Gaps = 9/163 (5%)
 Frame = +2

Query: 239 YSSAWGSWVHYRGTSKDDGAP-VSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFL 415
           Y+S    W    GT  DD    VSIF  S S A     +  R  +K+L         S +
Sbjct: 31  YTSPRMCWTLRPGTQSDDAQTRVSIFTCSVSAAATAGSSGDRELIKQLARNTMRRAKSLM 90

Query: 416 HSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGL----VGTQRDEY---YAWGLHRIT 574
               ++         TIYI TEP + L + L+ L L     G   +EY    A+GL  + 
Sbjct: 91  IPGFLKCHGAVEHSDTIYIATEPCVALKDVLESLELRRHYCGEMEEEYAASVAYGLDTVG 150

Query: 575 KAVSFLNNDCKLVHGNVCVASVVVTQTLD-WKLHALDVLSEFD 700
            A+  L ++ +LVHGNV   S+ ++     W+L  L+ +S  D
Sbjct: 151 GALGALQSN-RLVHGNVHCGSIFISAASGFWRLFGLEFISAVD 192



>gb:CR860469_1184536 Pongo pygmaeus mRNA; cDNA DKFZp459E161 (from
           clone DKFZp459E161).
          Length = 335

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 36/164 (21%), Positives = 73/164 (44%), Gaps = 22/164 (13%)
 Frame = +2

Query: 257 SWVHYRGTSKDDGAPVSIFALSGSNAN-------DGHLAAGRNGVKRLRTVRHPNILSFL 415
           +W  + GT K     V++F       +       D  + + + GV++L  +RHP +L+  
Sbjct: 46  AWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQ 105

Query: 416 HSTEVETVDGSTTKVTIYIVTEPVM---------------PLCEKLKELGLVGTQRDEYY 550
           H  E        ++  +   TEPV                P+   +K+  L   +     
Sbjct: 106 HPLE-------ESRDCLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETK--- 155

Query: 551 AWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALD 682
            +GL ++++ +SFL++  K+VHGN+   ++++ ++  WK+   D
Sbjct: 156 -YGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFD 198



>gb:AE016819_1748616 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 732

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 43/146 (29%), Positives = 69/146 (47%), Gaps = 2/146 (1%)
 Frame = +2

Query: 260 WVHYRGTSKDDGAPVSIFALSGSN--ANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVE 433
           W  Y+GT K D   V++F  S     ++ G     RN V++ +T++ P ++  L     E
Sbjct: 35  WDVYQGTRKADSQAVTLFVHSRQKKASDAGIEQLVRNAVRKAKTLKLPGLVRVL-----E 89

Query: 434 TVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLV 613
            +D  T    +YIVTE V PL  +L   G VG   +     GL ++  A+  L  +  + 
Sbjct: 90  VLD--TDPNVVYIVTERVQPLFPEL--AGAVG---ELSLGLGLSQVFGALRILEENAHVT 142

Query: 614 HGNVCVASVVVTQTLDWKLHALDVLS 691
            G +   SV V +  +W L  L++ S
Sbjct: 143 LGTLSRGSVYVNERGEWCLFGLELCS 168



>gb:BC042443_2098616 Mus musculus SCY1-like 2 (S. cerevisiae), mRNA
           (cDNA clone MGC:30478 IMAGE:4037878), complete cds.
          Length = 930

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 22/164 (13%)
 Frame = +2

Query: 257 SWVHYRGTSKDDGAPVSIFALSGSNAN-------DGHLAAGRNGVKRLRTVRHPNILSFL 415
           +W  + GT K     V++F       +       D  + + + GV++L  +RHP +L+  
Sbjct: 46  AWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQ 105

Query: 416 HSTEVETVDGSTTKVTIYIVTEPVMP---------------LCEKLKELGLVGTQRDEYY 550
           H  E        ++  +   TEPV                 +   +K+  L   +     
Sbjct: 106 HPLE-------ESRDCLAFCTEPVFASLANVLGNWENLPSSISPDIKDYKLYDVETK--- 155

Query: 551 AWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALD 682
            +GL ++++ +SFL++  K+VHGNV   +V++ ++  WK+   D
Sbjct: 156 -YGLLQVSEGLSFLHSSVKMVHGNVTPENVILNKSGAWKIMGFD 198



>gb:CR382136_1668707 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 844

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 44/183 (24%), Positives = 71/183 (38%), Gaps = 23/183 (12%)
 Frame = +2

Query: 221 YNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSN--ANDGHLAAGRNGVK------- 373
           YN+ E  S     W  Y    K  G  VS+F    S   A    + A  +  K       
Sbjct: 14  YNVLENPSFVSEPWYIYPAKHKSSGQAVSVFIFDKSKFEAQVNRICASSSNTKNPKVIIN 73

Query: 374 -----------RLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPV---MPLCEKLK 511
                      +L  ++HP IL+     E        TK+ +  V+E V   +      K
Sbjct: 74  ECYELLKFEISQLAKLKHPQILTIFEVLE-------ETKLKLLFVSELVTDNLLTVNVSK 126

Query: 512 ELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLS 691
           +L  +  Q+      GL ++ K + FL+N C+++H N+  +S+ +    DWKL     L 
Sbjct: 127 DLDELSIQK------GLLQMAKGLQFLHNYCQIIHLNLQPSSIFINSQGDWKLSGFRFLQ 180

Query: 692 EFD 700
             +
Sbjct: 181 NLN 183



>gb:CR382131_1663815 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 874

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 45/187 (24%), Positives = 69/187 (36%), Gaps = 25/187 (13%)
 Frame = +2

Query: 221 YNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFA--------------LSGSNANDGHLAAG 358
           YNI    +   G+W  +  T +    PVS+F               L  S  +D   +  
Sbjct: 27  YNISSEPAFHAGAWAVHNATRRTTNDPVSVFTFDKKKFESFCSKNGLKNSKGSDEIYSRL 86

Query: 359 RNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQR 538
           RN    L  +RHPN L  +        +G   K ++  VTE V        E       R
Sbjct: 87  RNEATNLARLRHPNFLRIVEPL----YEG---KSSLSFVTERVETCIRAKVEADASRDSR 139

Query: 539 DE-----------YYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDV 685
                            GL ++++ + F++ D K+VH N+ + +V V    DWKL     
Sbjct: 140 STRDHIPPELSPLVIQKGLLQVSEGLKFMHEDAKMVHMNLNLNTVFVDSLGDWKLGGCGY 199

Query: 686 LSEFDGN 706
             E  G+
Sbjct: 200 ACEVAGS 206



>sp|P53009|SCY1_YEAST SCY1 protein.>pir|S64090|S64090 SCY1 protein -
           yeast (Saccharomyces cerevisiae)>gb:SCSCY1GEN_1709457
           S.cerevisiae SCY1 gene.>gb:SCYGL083W_1712004
           S.cerevisiae chromosome VII reading frame ORF YGL083w.
          Length = 804

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 1/129 (0%)
 Frame = +2

Query: 359 RNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQR 538
           RN    L  ++HPNIL+ +   E  + +       +    E V    +  ++  L G  +
Sbjct: 85  RNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSSLETVFRETDDEEQNFLQGHVK 144

Query: 539 DEYYAW-GLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGNNET 715
           D      G+ ++  A+ F++N    VH N+   ++ + +  DWK+  L  L +      T
Sbjct: 145 DNIVVQRGILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKIPPGTNT 204

Query: 716 STGPMLQYE 742
           S   + QY+
Sbjct: 205 SEYFLPQYD 213



>pir|S60992|S60992 hypothetical protein YOR112w - yeast
           (Saccharomyces cerevisiae)>gb:SC130KBXV_1705013
           S.cerevisiae 130kb DNA fragment from chromosome
           XV.>gb:SCXVORFS_1711045 S.cerevisiae DNA of 51 Kb from
           chromosome XV right arm.>gb:SCYOR112W_1714339
           S.cerevisiae chromosome XV reading frame ORF YOR112w.
          Length = 761

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 43/162 (26%), Positives = 70/162 (43%)
 Frame = +2

Query: 218 PYNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHP 397
           PY I E   +    W  + GT K D  PV++F    S  N+  +    N V + + ++ P
Sbjct: 16  PYTIEETAITETALWQCFDGTRKADSLPVTVFKAKRSPENESLIL---NAVHKSKILKIP 72

Query: 398 NILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITK 577
            +      T +ET D      + +IVTE V+P       LG + +Q       G+ ++  
Sbjct: 73  GL-----CTVLETFDSDPQ--STFIVTERVVPF--PWDNLGSL-SQNKFGVELGISQLLA 122

Query: 578 AVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDG 703
            + FL N    V G +   SV +    +W L  L++ S  +G
Sbjct: 123 TLGFLKN---FVLGTLSKDSVFINIKGEWVLFGLELCSSKEG 161



>gb:AE014296_1135657 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003550_1215070 Drosophila melanogaster
           chromosome 3L, section 35 of 83 of the complete
           sequence.
          Length = 621

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 45/215 (20%), Positives = 80/215 (37%), Gaps = 46/215 (21%)
 Frame = +2

Query: 221 YNIGEPYSSAWGS--WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGR--------NGV 370
           + IG+P + A     W  +    K D    S+F      A   H    +        + V
Sbjct: 302 FEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPRRKETITELLKSSV 361

Query: 371 KRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKEL----------- 517
           K L   RHP IL   H+ E E+ D      T+   +EP+      +              
Sbjct: 362 KTLERFRHPRILQIYHTVE-ESAD------TLAFASEPIFASLSNVLAFHESKTYEATNV 414

Query: 518 -----GLVGTQR--------------------DEYYAWGLHRITKAVSFLNNDCKLVHGN 622
                G   +Q                     D    +G  ++T+A+++L+    ++H N
Sbjct: 415 APAAGGAAASQAQAAANTLPQRPAHAKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRN 474

Query: 623 VCVASVVVTQTLDWKLHALDVLSEFDGNNETSTGP 727
           VC +S+++T+   WKL  ++ +   + N+  S+ P
Sbjct: 475 VCPSSILITKRGIWKLAGMEYVERMNENDLNSSIP 509



>gb:BX784401_2567939 Zebrafish DNA sequence from clone CH211-244B2
           in linkage group 4 Contains four novel genes, complete
           sequence.
          Length = 816

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 14/43 (32%), Positives = 31/43 (72%)
 Frame = +2

Query: 554 WGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALD 682
           +GL ++++ +SFL++  K+VHGN+C  ++++ ++  WK+   D
Sbjct: 44  YGLLQVSEGLSFLHSGVKMVHGNLCSENIILNKSGAWKIMGFD 86



>pir|T50397|T50397 probable serine/threonine protein kinase
           [imported] - fission yeast (Schizosaccharomyces
           pombe)>gb:SPBP23A10_1720600 S.pombe chromosome II p1
           p23A10.
          Length = 749

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 41/179 (22%), Positives = 66/179 (36%), Gaps = 29/179 (16%)
 Frame = +2

Query: 221 YNIGEPYSSAWGSWVHYRGTSKDDGAPVSIFALSGSNAN--------DGHLAAG------ 358
           Y+I +  S   G W  Y  + K     VS+F     N +        D +L         
Sbjct: 19  YDIQKENSVQVGPWTVYSASKKGTNEEVSVFTFDKKNLSTLLKRGSIDSNLKTNYVLELL 78

Query: 359 RNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQR 538
           R  V  L  +RHP++L  +   E        +K ++  VT  +  + +   +    G   
Sbjct: 79  RKDVSSLSRLRHPSLLQVVEPLE-------ESKSSMSFVTRRIQSMLQDFIKSSNGGFSN 131

Query: 539 ---------------DEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKL 670
                          +     GL +I   + FL+   K++H N+  +SVVV    DWKL
Sbjct: 132 YGSSANGKSSGNALEEVEIQKGLLQIIDGLVFLHGSAKVIHYNIRPSSVVVDAKGDWKL 190



>gb:AF003134_1230775 Caenorhabditis elegans cosmid ZC581, complete
           sequence.
          Length = 827

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 1/101 (0%)
 Frame = +2

Query: 371 KRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEY- 547
           ++L  + HP IL   HS E        TK  I   TE +    E +    +     D   
Sbjct: 126 QQLMGLIHPRILHMEHSLE-------ETKDYISFATEQIFGNLENV----VTDESLDRLE 174

Query: 548 YAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKL 670
              G+ +I   +S+L+N  K++HGN+   ++ VT T  WK+
Sbjct: 175 IKLGVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKI 215



>gb:AB037781_1866572 Homo sapiens mRNA for KIAA1360 protein, partial
           cds.
          Length = 796

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 13/43 (30%), Positives = 30/43 (69%)
 Frame = +2

Query: 554 WGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALD 682
           +GL ++++ +SFL++  K+VHGN+   ++++ ++  WK+   D
Sbjct: 19  YGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFD 61



>gb:CR380955_1651638 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 676

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 1/100 (1%)
 Frame = +2

Query: 260 WVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETV 439
           W  Y GT K D  PV++F  +   A+   L A  N + + + ++ P + S L   E+   
Sbjct: 31  WQVYNGTRKSDSLPVTLFK-AQRRADTEQLIA--NALHKAKILKIPGLCSVL---EISDS 84

Query: 440 DGSTTKVTIYIVTEPVMPL-CEKLKELGLVGTQRDEYYAW 556
           D  +T    +I+TE V P   +KLK+     + +D  Y W
Sbjct: 85  DPQST----FIITERVTPFNWDKLKD---YSSNKDSVYLW 117



>gb:CR382125_1658083 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 767

 Score = 36.6 bits (83), Expect = 0.50
 Identities = 34/137 (24%), Positives = 52/137 (37%), Gaps = 9/137 (6%)
 Frame = +2

Query: 359 RNGVKRLRTVRHPNILSFLHSTE---------VETVDGSTTKVTIYIVTEPVMPLCEKLK 511
           RN V  L   +HPNIL  +   E          E V GS       +  E         +
Sbjct: 88  RNQVNNLAKFKHPNILQLIEPLEEHSKNFLFVTEYVSGSLFN----LFQEQDSVTSTFGE 143

Query: 512 ELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHALDVLS 691
           EL       +     G+ ++ +A+ F++N    VH ++   SV V +  DWKL  L  L 
Sbjct: 144 ELLQSNDTNNLTIQRGILQVCQALDFIHNKTSSVHLDIQPRSVFVNENADWKLSGLGHLI 203

Query: 692 EFDGNNETSTGPMLQYE 742
           +           + QY+
Sbjct: 204 KLPEGTNVGDFTIPQYD 220



>gb:AC016163_1538125 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.
          Length = 909

 Score = 36.6 bits (83), Expect = 0.50
 Identities = 29/123 (23%), Positives = 55/123 (44%), Gaps = 10/123 (8%)
 Frame = +2

Query: 332 ANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMP-LCEKL 508
           A D  L   R    +L  +RHP ++  + + +         K  + +VTEP+   +   L
Sbjct: 96  AEDAFLDLIRADAGKLVRLRHPGVVHVVQALD-------ENKNAMALVTEPLFASVANAL 148

Query: 509 KELGLVGTQRDEYYAW---------GLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLD 661
             +  VG    +  +          GL +I++ ++FL+N+  L+H  +   +V++T    
Sbjct: 149 GNVENVGNVPKDLKSMEMSLLEVKHGLLQISETLNFLHNNANLIHRAISPENVLITSAGS 208

Query: 662 WKL 670
           WKL
Sbjct: 209 WKL 211



>gb:CAU92261_1645594 Candida albicans CDC2-related protein kinase
           CRK1 gene, complete cds.
          Length = 746

 Score = 35.8 bits (81), Expect = 0.85
 Identities = 36/158 (22%), Positives = 72/158 (45%), Gaps = 13/158 (8%)
 Frame = +2

Query: 272 RGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILS----------FLHS 421
           +  SK DG+ V+I  L   +A +G        +  L+ + H NIL+            + 
Sbjct: 60  KAKSKKDGSLVAIKQLINHSAKEGFPITAMREITILKQLNHKNILTIQDMIFEEPKMSNR 119

Query: 422 TEVETVDGSTTKVTIYIVTEPVMPLCEKLK---ELGLVGTQRDEYYAWGLHRITKAVSFL 592
           T++ T+ GS   VT Y+ ++ ++ L E  K   ELG +           + ++ K + ++
Sbjct: 120 TDIITMRGSFYTVTPYMSSD-LVGLLENPKIKLELGQIKCI--------MQQLLKGIQYV 170

Query: 593 NNDCKLVHGNVCVASVVVTQTLDWKLHALDVLSEFDGN 706
           +N  K +H ++  A++++ Q    K+    +   + GN
Sbjct: 171 HNQ-KFLHRDIKAANILIGQDGVLKIADFGLARIYHGN 207



>gb:CNS07EGI_1374405 chromosome IX of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 489

 Score = 35.8 bits (81), Expect = 0.85
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +2

Query: 377 LRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAW 556
           L+ ++H  I+S L+   VE           Y++T  ++P C   K       +  E+  +
Sbjct: 50  LKKIKHDTIIS-LYRLNVEKG---------YLITRRLLPFCSVFKR------ETKEFNKY 93

Query: 557 GLHRITKAVSFLNNDCKLVHGNV 625
              +I +A+ FL++ C +VHGN+
Sbjct: 94  IAFKIAQALVFLHDKCGVVHGNI 116



>pir|T29772|T29772 hypothetical protein ZC581.9 - Caenorhabditis
           elegans
          Length = 689

 Score = 35.8 bits (81), Expect = 0.85
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +2

Query: 557 GLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKL 670
           G+ +I   +S+L+N  K++HGN+   ++ VT T  WK+
Sbjct: 40  GVLQIIDGMSYLHNSAKMLHGNLTPDAIYVTATKTWKI 77



>gb:AY181250_1587586 Kluyveromyces delphensis SCY1 (SCY1), GUP1
           (GUP1), YGL085w (YGL085w), MAD1 (MAD1), MMS2 (MMS2), and
           mating pheromone alpha2 (MFalpha2) genes, complete cds.
          Length = 799

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 32/133 (24%), Positives = 52/133 (39%), Gaps = 17/133 (12%)
 Frame = +2

Query: 359 RNGVKRLRTVRHPNILSFLHSTEVETVDGSTTKVTIYIVTEPVMPLCEKL---------- 508
           RN V  L  +RHPNIL+ +   E  + +          VTE V    E L          
Sbjct: 83  RNQVNNLAKLRHPNILTMIEPLEEHSKN-------FLFVTEYVTDCIESLYRGDNRSGYT 135

Query: 509 KELGLVGTQRDE-------YYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWK 667
               ++G   D+           GL +   A+ F++     VH ++   S+ + +  DWK
Sbjct: 136 HTSDILGNSNDDSGLVSDILTQRGLLQTVNALEFIHTRAGSVHLDIQPRSIFMNENSDWK 195

Query: 668 LHALDVLSEFDGN 706
           +  L  L + + N
Sbjct: 196 VSGLGHLFKLNDN 208



>gb:AE017343_1755802 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 994

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +2

Query: 557 GLHRITKAVSFLNNDCKLVHGNVCVASVVVTQTLDWKLHAL 679
           G  ++ + + FL+N  K+VH N+ + +VV+    DWKL  L
Sbjct: 189 GTLQLARGLGFLHNQAKMVHLNLGLEAVVINSKGDWKLTGL 229



>gb:AP005613_1854941 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0082C09.
          Length = 667

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 314 ALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFL 415
           A++G   +DG +AA   G++ L  +RHPNIL  L
Sbjct: 397 AVAGVGGDDGDVAAAAAGLRELARLRHPNILPLL 430



>gb:AE014296_1137037 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1137038 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE014296_1137039
           Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003516_1213706 Drosophila melanogaster
           chromosome 3L, section 69 of 83 of the complete
           sequence.>gb:AE003516_1213707 Drosophila melanogaster
           chromosome 3L, section 69 of 83 of the complete
           sequence.>gb:AE003516_1213708 Drosophila melanogaster
           chromosome 3L, section 69 of 83 of the complete
           sequence.>gb:BT011062_1357669 Drosophila melanogaster
           LD12174 full insert cDNA.>gb:DRODGC1A_1381885 Drosophila
           melanogaster receptor guanylyl cyclase (DGC1) mRNA,
           complete cds.
          Length = 1525

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 9/124 (7%)
 Frame = +2

Query: 368 VKRLRTVRHPNILSFLHS----TEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ 535
           ++ LR +RH NI SF+ +    T +  V     K ++Y + E      E +K        
Sbjct: 599 MRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIEN-----EDIK-------L 646

Query: 536 RDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT-----QTLDWKLHALDVLSEFD 700
            D + A  +H + K + +++N   + HGN+  ++ VVT     Q  D+ LH L   +E +
Sbjct: 647 DDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENE 706

Query: 701 GNNE 712
              E
Sbjct: 707 SIGE 710



>pir|A56699|A56699 guanylate cyclase (EC 4.6.1.2), receptor-type
           drgc - fruit fly (Drosophila
           melanogaster)>gb:DMU23485_1380532 Drosophila
           melanogaster receptor-type guanylate cyclase mRNA,
           complete cds.
          Length = 1525

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 9/124 (7%)
 Frame = +2

Query: 368 VKRLRTVRHPNILSFLHS----TEVETVDGSTTKVTIYIVTEPVMPLCEKLKELGLVGTQ 535
           ++ LR +RH NI SF+ +    T +  V     K ++Y + E      E +K        
Sbjct: 599 MRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIEN-----EDIK-------L 646

Query: 536 RDEYYAWGLHRITKAVSFLNNDCKLVHGNVCVASVVVT-----QTLDWKLHALDVLSEFD 700
            D + A  +H + K + +++N   + HGN+  ++ VVT     Q  D+ LH L   +E +
Sbjct: 647 DDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENE 706

Query: 701 GNNE 712
              E
Sbjct: 707 SIGE 710



>sp|O32866|MTRB_METKA Tetrahydromethanopterin S-methyltransferase
           subunit B (EC 2.1.1.86)
           (N5-methyltetrahydromethanopterin--coenzyme M
           methyltransferase subunit B).>gb:MKY14428_144295
           Methanopyrus kandleri mtrE, mtrD, mtrC, mtrB, mtrA,
           mtrF, mtrG, mtrH genes.>gb:AE010359_262291 Methanopyrus
           kandleri AV19 section 58 of 157 of the complete
           genome.>gb:AE009439_903072 Methanopyrus kandleri AV19,
           complete genome.
          Length = 112

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 10/97 (10%)
 Frame = +2

Query: 428 VETVDGSTTKVTIYIVTEPVMPLCEKLKEL-----GLVGTQRDEYYAWGL----HRITKA 580
           ++ V G+  + +  +VT  VMPL EK++EL      ++         WG       + + 
Sbjct: 14  MDAVTGAVAEWSEDVVTLDVMPLYEKVEELEQYVNDMMRAMDPSTTTWGTLPGREGVHET 73

Query: 581 VSFLNNDCK-LVHGNVCVASVVVTQTLDWKLHALDVL 688
             FL N     V G + VA V  T    +KLHAL +L
Sbjct: 74  AGFLTNFAHGFVIGTMIVALVAFTLAAVYKLHALRLL 110



>gb:AY014441_1287958 Drosophila americana strain G96.36 fused1
           protein (fu1) gene, partial cds.
          Length = 699

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 27/134 (20%), Positives = 64/134 (47%)
 Frame = +2

Query: 269 YRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGS 448
           Y+   +DD   V+I  +S    ++  L   R        ++HP+++  + S E       
Sbjct: 19  YKAQRRDDDKVVAIKVISKRGRSNRELKNLRRECDIQARLKHPHVIEMVESFE------- 71

Query: 449 TTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVC 628
            +K  +++VTE    L +  + L   G  R+E+    +  +  A+ +L+++ +++H ++ 
Sbjct: 72  -SKFDLFVVTE--FALMDLHRYLSFNGAMREEHAQRVVCHLVSALYYLHSN-RILHRDLK 127

Query: 629 VASVVVTQTLDWKL 670
             +V++ + +  KL
Sbjct: 128 PQNVLLDKNMHAKL 141



>gb:AY014435_1287952 Drosophila americana strain G96.21 fused1
           protein (fu1) gene, partial cds.>gb:AY014437_1287954
           Drosophila americana strain G96.24 fused1 protein (fu1)
           gene, partial cds.
          Length = 699

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 27/134 (20%), Positives = 64/134 (47%)
 Frame = +2

Query: 269 YRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGS 448
           Y+   +DD   V+I  +S    ++  L   R        ++HP+++  + S E       
Sbjct: 19  YKAQRRDDDKVVAIKVISKRGRSNRELKNLRRECDIQARLKHPHVIEMVESFE------- 71

Query: 449 TTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVC 628
            +K  +++VTE    L +  + L   G  R+E+    +  +  A+ +L+++ +++H ++ 
Sbjct: 72  -SKFDLFVVTE--FALMDLHRYLSFNGAMREEHAQRVVCHLVSALYYLHSN-RILHRDLK 127

Query: 629 VASVVVTQTLDWKL 670
             +V++ + +  KL
Sbjct: 128 PQNVLLDKNMHAKL 141



>gb:AE014186_938205 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014839_1228939 Plasmodium falciparum 3D7
            chromosome 11 section 4 of 8 of the complete sequence.
          Length = 2265

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 31/128 (24%), Positives = 63/128 (49%), Gaps = 1/128 (0%)
 Frame = +2

Query: 269  YRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGS 448
            YRG +K   +  +I  +   + +       R+ +  LR +RHPN+   ++  E+      
Sbjct: 1836 YRGINKQTNSEFAIKVIDKRSVSIYEKELLRSEISILRLLRHPNV---IYLKEI-----I 1887

Query: 449  TTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWG-LHRITKAVSFLNNDCKLVHGNV 625
             TK T+YI  E V     +L +  L  T+  E +A   + ++ K V++L+  C ++H ++
Sbjct: 1888 NTKETLYISMELVKG--GELYDFLLAETRLSEIHANKIITQLIKTVAYLHR-CGIIHRDI 1944

Query: 626  CVASVVVT 649
               ++++T
Sbjct: 1945 KPENILLT 1952



>gb:AJ720053_2502240 Gallus gallus mRNA for hypothetical protein,
           clone 9p8.
          Length = 372

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 26/134 (19%), Positives = 58/134 (43%), Gaps = 6/134 (4%)
 Frame = +2

Query: 269 YRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGS 448
           ++   +  G  V++  +   N  +G        +K L+ ++H N+++ +     +    +
Sbjct: 34  FKAKHRQTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYN 93

Query: 449 TTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDC------KL 610
             K +IY+V +     CE      L G   + +  + L  I K +  L N        K+
Sbjct: 94  RCKGSIYLVFD----FCEH----DLAGLLSNTHVKFTLSEIKKVMQMLLNGLYYIHRNKI 145

Query: 611 VHGNVCVASVVVTQ 652
           +H ++  A+V++T+
Sbjct: 146 LHRDMKAANVLITR 159



>gb:AF231723_2218879 Dengue virus type 4 isolate P75-514 envelope
           protein (E) gene, partial cds.>gb:AF231724_2218880
           Dengue virus type 4 isolate P73-1120 envelope protein
           (E) gene, partial cds.>gb:AF231725_2218881 Dengue virus
           type 4 isolate P75-215 envelope protein (E) gene,
           partial cds.
          Length = 495

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = -3

Query: 298 STIVFGGSTVVNPRAPSRGIRLADVVWQILDARPRSGDD 182
           ST   G +T + PR+PS  ++L D     LD  PRSG D
Sbjct: 154 STSNHGVTTTITPRSPSVEVKLPDYGELTLDCEPRSGID 192



>gb:AB011967_1511593 Oryza sativa OsPK4 gene, complete
           cds.>gb:AC132485_1741136 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0022D06, complete
           sequence.
          Length = 508

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 26/74 (35%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = +2

Query: 269 YRGTSKDDGAPVSIFALSGSNA-NDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDG 445
           Y+  S D G PV+I  L    A   G +   +  +  LR VRHPNI        V   + 
Sbjct: 52  YQARSADSGEPVAIKVLDKEKAMRHGLVPHIKREIAILRRVRHPNI--------VRLFEV 103

Query: 446 STTKVTIYIVTEPV 487
             TK  IY V E V
Sbjct: 104 MATKSKIYFVMELV 117



>gb:AF239866_1253941 Drosophila lummei fused protein (fu) gene,
           partial cds.
          Length = 699

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 27/134 (20%), Positives = 64/134 (47%)
 Frame = +2

Query: 269 YRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHSTEVETVDGS 448
           Y+   +DD   V+I  +S    ++  L   R        ++HP+++  + S E       
Sbjct: 19  YKAQRRDDDKVVAIKVISKRGRSNRELKNLRRECDIQARLKHPHVIEMVESFE------- 71

Query: 449 TTKVTIYIVTEPVMPLCEKLKELGLVGTQRDEYYAWGLHRITKAVSFLNNDCKLVHGNVC 628
            +K  +++VTE    L +  + L   GT  +E+    +  +  A+ +L+++ +++H ++ 
Sbjct: 72  -SKFDLFVVTE--FALMDLHRYLSFNGTMPEEHAQRVVCHLVSALYYLHSN-RILHRDLK 127

Query: 629 VASVVVTQTLDWKL 670
             +V++ + +  KL
Sbjct: 128 PQNVLLDKNMHAKL 141



>gb:CP000004_861918 Gluconobacter oxydans 621H plasmid pGOX1,
           complete sequence.
          Length = 769

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 14/27 (51%), Positives = 15/27 (55%)
 Frame = +2

Query: 659 DWKLHALDVLSEFDGNNETSTGPMLQY 739
           DW    LD L    G  ET+TG MLQY
Sbjct: 50  DWSARVLDSLFPMSGGTETATGTMLQY 76



>gb:CR382124_1656964 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 427

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 25/79 (31%), Positives = 38/79 (48%)
 Frame = +2

Query: 242 SSAWGSWVHYRGTSKDDGAPVSIFALSGSNANDGHLAAGRNGVKRLRTVRHPNILSFLHS 421
           SS  G+     GTS  D +  +    S S+A DG  ++G +          P++   ++S
Sbjct: 181 SSNSGTTTTLAGTSSADSSTQASITSSPSSATDGSNSSGDD---------EPSV---VYS 228

Query: 422 TEVETVDGSTTKVTIYIVT 478
           T ++TV GS   VT  IVT
Sbjct: 229 TSIKTVSGSVQYVTTNIVT 247



>pir|T03130|T03130 probable tyrosine kinase - alcelaphine
           herpesvirus 1>gb:AF005370_2176798 Alcelaphine
           herpesvirus 1 L-DNA, complete sequence.
          Length = 454

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +2

Query: 569 ITKAVSFLNNDCKLVHGNVCVASVVV 646
           +T AV FLN  C L HG++C ++++V
Sbjct: 175 LTDAVFFLNQKCGLFHGDICPSNILV 200


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,864,326
Number of Sequences: 1806583
Number of extensions: 17045587
Number of successful extensions: 54055
Number of sequences better than 10.0: 69
Number of HSP's better than 10.0 without gapping: 51490
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53965
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 46141821864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)