BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6391
         (617 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF444798_1800410 Perilla frutescens var. crispa cultivar No. ...   132   4e-30   
gb:AY693650_1623448 Ocimum basilicum terpinolene synthase (TES) ...   129   4e-29   
gb:AF051901_1764287 Salvia officinalis (+)-sabinene synthase mRN...   124   2e-27   
gb:AY693649_1623447 Ocimum basilicum beta-myrcene synthase (MYS)...   124   2e-27   
gb:AY083653_1569255 Mentha citrata linalool synthase mRNA, compl...   122   5e-27   
gb:AY693648_1623446 Ocimum basilicum fenchol synthase (FES) mRNA...   121   1e-26   
gb:AF282875_1783032 Schizonepeta tenuifolia (+)-4R-limonene synt...   117   1e-25   
gb:AY691947_1622588 Arabidopsis thaliana 1,8-cineole synthase mR...   115   6e-25   
gb:AY055214_1563377 Agastache rugosa d-limonene synthase mRNA, c...   114   1e-24   
gb:AF178535_1774714 Arabidopsis thaliana myrcene/ocimene synthas...   112   5e-24   
pir|H84633|H84633 probable limonene cyclase [imported] - Arabido...   112   5e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AF051900_1764286 Salvia officinalis (+)-bornyl diphosphate sy...   112   6e-24   
gb:AY572987_1615755 Vitis vinifera clone VitiC4568 terpenoid syn...   111   1e-23   
gb:AY572986_1615754 Vitis vinifera clone VitiC1891 terpenoid syn...   110   1e-23   
gb:AY151086_1585101 Arabidopsis thaliana E-beta-ocimene synthase...   110   1e-23   
gb:AB110636_1526999 Citrus unshiu CitMTSE1 mRNA for d-limonene s...   109   3e-23   
gb:QIL304839_1703197 Quercus ilex mRNA for putative chloroplast ...   108   9e-23   
gb:AB110637_1527000 Citrus unshiu CitMTSE2 mRNA for d-limonene s...   107   2e-22   
gb:AF241791_1780127 Perilla frutescens strain 32 limonene syntha...   106   4e-22   
gb:AB028607_1517902 Arabidopsis thaliana genomic DNA, chromosome...   106   4e-22   
gb:AB005744_1509697 Perilla frutescens DNA for 1-limonene syntha...   106   4e-22   
pir|A48863|A48863 limonene cyclase - spearmint>gb:MHC4SLSP_16861...   106   4e-22   Mentha spicata
gb:AF317695_1785568 Perilla frutescens var. frutescens limonene ...   105   6e-22   
gb:AF241792_1780128 Perilla frutescens strain 5598 limonene synt...   105   6e-22   
gb:AF241790_1780126 Perilla citriodora limonene synthase gene, c...   105   6e-22   
gb:AF233894_1779525 Perilla citriodora limonene synthase mRNA, c...   105   6e-22   
gb:AF051899_1764285 Salvia officinalis 1,8-cineole synthase mRNA...   105   6e-22   
gb:AF527416_1808381 Salvia stenophylla 3-carene synthase mRNA, c...   105   8e-22   
gb:AF497484_1805879 Arabidopsis thaliana monoterpene synthase mR...   105   8e-22   
gb:AF175323_1774500 Mentha longifolia limonene synthase mRNA, co...   105   8e-22   
gb:AF241793_1780129 Perilla frutescens strain 1 limonene synthas...   103   2e-21   
gb:AF514289_1807412 Citrus limon (+)-limonene synthase 2 mRNA, c...   103   3e-21   
sp|Q8L5K3|RLC1_CITLI|RLC1_CITLI (R)-limonene synthase 1 (EC 4.2.3.20) ((+)-...   103   3e-21   
gb:AY316691_1598425 Pueraria montana var. lobata isoprene syntha...   102   4e-21   
gb:AY341431_1600759 Populus tremuloides isoprene synthase (IspS)...   101   9e-21   
gb:CTE457070_1674203 Cinnamomum tenuipilum mRNA for geraniol syn...   101   1e-20   
gb:AY766248_1627648 Medicago truncatula wound-inducible putative...   101   1e-20   
gb:AF271259_1782138 Perilla frutescens mercene synthase mRNA, co...   100   1e-20   
gb:AF154124_1772922 Artemisia annua (3R)-linalool synthase (QH5)...   100   2e-20   
gb:PAL294819_1698712 Populus alba x Populus tremula mRNA for iso...    98   1e-19   
gb:AB110641_1527003 Citrus unshiu CitMTSL62 mRNA for beta-pinene...    98   1e-19   
gb:AF154125_1772923 Artemisia annua (3R)-linalool synthase (QH1)...    97   2e-19   
gb:AF514288_1807411 Citrus limon (-)-beta-pinene synthase mRNA, ...    96   5e-19   
gb:AB110640_1527002 Citrus unshiu CitMTSL61 mRNA for gamma-terpi...    96   5e-19   
gb:AF276072_1782622 Artemisia annua (-)-beta-pinene synthase (QH...    95   1e-18   
gb:AY693646_1623444 Ocimum basilicum alpha-zingiberene synthase ...    95   1e-18   
gb:AY575970_1615894 Lotus corniculatus var. japonicus E-beta-oci...    95   1e-18   
gb:AY279379_1594619 Melaleuca alternifolia putative monoterpene ...    94   1e-18   
gb:AF542544_1810170 Nicotiana attenuata 5-epi-aristolochene synt...    93   4e-18   
gb:CQ813506_1453487 Sequence 2 from Patent WO2004031376.               92   5e-18   
sp|Q40577|5EAS_TOBAC|5EAS_TOBAC Aristolchene synthase (EC 4.2.3.9) (5-epi-a...    92   5e-18   Nicotiana tabacum [American tobacco]
gb:AF484125_1804056 Nicotiana attenuata 5-epi-aristolochene synt...    91   1e-17   
gb:AF484123_1804054 Nicotiana attenuata 5-epi-aristolochene synt...    89   4e-17   
gb:AY438099_1606225 Populus balsamifera subsp. trichocarpa x Pop...    89   4e-17   
gb:AY640155_1618969 Cucumis sativus beta-caryophyllene synthase ...    89   6e-17   
pir|T03714|T03714 5-epi-aristolochene synthase - common tobacco>...    89   6e-17   Nicotiana tabacum [American tobacco]
gb:AK118969_1816915 Arabidopsis thaliana At4g16740 mRNA for puta...    88   1e-16   
gb:AF514286_1807409 Citrus limon gamma-terpinene synthase mRNA, ...    88   1e-16   
gb:AF484124_1804055 Nicotiana attenuata 5-epi-aristolochene synt...    87   3e-16   
gb:AF174294_1774470 Gossypium arboreum (+)-delta-cadinene sythas...    86   4e-16   
gb:AF270425_1782068 Gossypium hirsutum (+)-delta-cadinene syntha...    86   5e-16   
gb:GAR18484_1679606 Gossypium arboreum cad1-A gene.                    86   5e-16   
gb:AB110639_1527001 Citrus unshiu CitMTSL3 mRNA for gamma-terpin...    86   5e-16   
sp|Q43714|DCS3_GOSAR|DCS3_GOSAR (+)-delta-cadinene synthase isozyme A (EC 4...    86   5e-16   Gossypium arboreum [tree cotton]
gb:AY087142_1572177 Arabidopsis thaliana clone 32194 mRNA, compl...    86   6e-16   
gb:AY085646_1570714 Arabidopsis thaliana clone 16525 mRNA, compl...    86   6e-16   
sp|O49853|DCS4_GOSAR|DCS4_GOSAR (+)-delta-cadinene synthase isozyme C2 (EC ...    86   6e-16   Gossypium arboreum [tree cotton]
sp|Q39760|DCS2_GOSAR|DCS2_GOSAR (+)-delta-cadinene synthase isozyme XC14 (E...    86   6e-16   Gossypium arboreum [tree cotton]
gb:AGU87910_1811078 Abies grandis (-)-camphene synthase (AG6.5) ...    84   1e-15   
gb:AY561842_1614989 Vitis vinifera clone VitiM1610 terpene synth...    84   2e-15   
sp|P59287|CASS_RICCO|CASS_RICCO Casbene synthase, chloroplast precursor (EC...    84   2e-15   Ricinus communis
gb:GACADB_1679588 Gossypium arboreum cad1-b gene for (+)-delta-c...    84   2e-15   
sp|Q39761|DCS1_GOSAR|DCS1_GOSAR (+)-delta-cadinene synthase isozyme XC1 (EC...    84   2e-15   Gossypium arboreum [tree cotton]
gb:AF279454_1782827 Lycopersicon esculentum sesquiterpene syntha...    82   5e-15   
gb:AY473627_1608214 Picea abies E,E-alpha-farnesene synthase (TP...    82   5e-15   
gb:CQ813505_1453486 Sequence 1 from Patent WO2004031376.               82   5e-15   
pir|T06265|T06265 germacrene C synthase, epidermal - tomato>gb:A...    82   5e-15   Solanum lycopersicum
pir|T06266|T06266 germacrene C synthase - tomato>gb:AF035631_176...    82   5e-15   Solanum lycopersicum
gb:AF411120_1797174 Citrus x paradisi putative terpene synthase ...    82   7e-15   
gb:AY766250_1627650 Medicago truncatula wound-inducible putative...    82   9e-15   
gb:AB022720_1515264 Solanum tuberosum PVS3 mRNA for vetispiradie...    82   9e-15   
gb:CQ813508_1453489 Sequence 4 from Patent WO2004031376.               82   9e-15   
gb:XXU20187_2154080 Synthetic construct vetispiradiene synthase ...    81   1e-14   
gb:AF441124_1800098 Citrus sinensis valencene synthase (tps1) mR...    81   1e-14   
sp|P93665|DCS1_GOSHI|DCS1_GOSHI (+)-delta-cadinene synthase (EC 4.2.3.13) (...    81   1e-14   Gossypium hirsutum [American cotton]
gb:CAN5588_1645077 Capsicum annuum gene encoding 5-epi-aristoloc...    81   2e-14   
gb:AF279455_1782828 Lycopersicon hirsutum sesquiterpene synthase...    80   2e-14   
gb:AF171216_1774390 Lycopersicon esculentum vetispiradiene synth...    80   2e-14   
gb:AY563622_1615074 Malus x domestica (E,E)-alpha-farnesene synt...    80   2e-14   
gb:AY313939_1598391 Nicotiana tabacum epi-arisotolchene synthase...    80   2e-14   
gb:AY182241_1587878 Malus x domestica (E,E)-alpha-farnesene synt...    80   2e-14   
gb:AB022719_1515263 Solanum tuberosum PVS2 mRNA for vetispiradie...    80   2e-14   
gb:AF374462_1792783 Citrus junos (E)-beta-farnesene synthase mRN...    80   3e-14   
pir|T08174|T08174 sesquiterpene cyclase (EC 2.5.1.-) - pepper>gb...    80   3e-14   Capsicum annuum
gb:AF042382_1763637 Solanum tuberosum vetispiradiene synthase (V...    80   4e-14   
gb:AF543528_1810267 Pinus taeda alpha-farnesene synthase mRNA, c...    79   6e-14   
gb:AF288465_1783465 Citrus junos terpene synthase mRNA, complete...    79   6e-14   
gb:AB023816_1515643 Solanum tuberosum PVS4 mRNA for vetispiradie...    79   6e-14   
gb:CQ813507_1453488 Sequence 3 from Patent WO2004031376.               79   6e-14   
gb:AX529019_1469926 Sequence 41 from Patent WO02064764.                79   8e-14   
gb:MVU291755_1687768 Marrubium vulgare partial tps1 gene for put...    78   1e-13   
gb:AY561843_1614990 Vitis vinifera clone M4670 terpenoid synthet...    78   1e-13   
gb:AY473626_1608213 Picea abies myrcene synthase (TPS-Myr) mRNA,...    78   1e-13   
gb:AAN271792_1508201 Artemisia annua mRNA for putative sesquiter...    78   1e-13   
pir|F71434|F71434 probable limonene cyclase - Arabidopsis thalia...    78   1e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AF043299_1763695 Solanum tuberosum putative vetispiradiene sy...    77   2e-13   
gb:AY693644_1623442 Ocimum basilicum germacrene D synthase (GDS)...    77   2e-13   
gb:AY693643_1623441 Ocimum basilicum selinene synthase (SES) mRN...    77   2e-13   
gb:AY523409_1611392 Malus x domestica alpha-farnesene synthase m...    77   2e-13   
gb:AX529025_1469928 Sequence 47 from Patent WO02064764.                77   2e-13   
gb:AX529022_1469927 Sequence 44 from Patent WO02064764.                77   2e-13   
gb:AY473624_1608211 Picea abies (-)-limonene synthase (TPS-Lim) ...    77   3e-13   
gb:AF304444_1784388 Artemisia annua sesquiterpene cyclase mRNA, ...    76   5e-13   
gb:AF212433_1777443 Capsicum annuum UV-induced sesquiterpene cyc...    76   5e-13   
sp|O24475|TSD1_ABIGR|TSD1_ABIGR Pinene synthase, chloroplast precursor (EC ...    76   5e-13   Abies grandis [grand fir]
gb:AF326517_1786660 Abies grandis pinene synthase gene, partial ...    75   7e-13   
gb:AF080245_1766439 Elaeis oleifera sesquiterpene synthase mRNA,...    75   9e-13   
gb:AF043298_1763694 Solanum tuberosum putative vetispiradiene sy...    75   9e-13   
gb:HMU20188_1681908 Hyoscyamus muticus clone cVS1 vetispiradiene...    75   1e-12   
gb:AY491399_1608694 Pyrus pyrifolia alpha-farnesene synthase (PF...    75   1e-12   
pir|A56118|A56118 vetispiradiene synthase 1 - Hyoscyamus muticus...    75   1e-12   Hyoscyamus muticus
gb:AB120957_1528006 Chamaecyparis obtusa co1 mRNA for limonene/b...    74   2e-12   
gb:AF497999_1805903 Cichorium intybus germacrene A synthase long...    73   4e-12   
gb:AF369918_1791998 Picea abies beta-phellandrene synthase-like ...    73   4e-12   
gb:AF279456_1782829 Lycopersicon hirsutum sesquiterpene synthase...    73   4e-12   
gb:AF498000_1805904 Cichorium intybus germacrene A synthase shor...    72   6e-12   
gb:AF326117_1786620 Capsicum annuum sesquiterpene cyclase (PSC2)...    72   7e-12   
gb:AF139205_1771400 Abies grandis beta-phellandrene synthase (ag...    72   7e-12   
pir|G71434|G71434 probable limonene cyclase - Arabidopsis thalia...    72   7e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AF369919_1791999 Picea abies myrcene synthase-like protein mR...    72   1e-11   
gb:AB022598_1515240 Solanum tuberosum PVS1 mRNA for vetispiradie...    72   1e-11   
sp|O24474|TSD2_ABIGR|TSD2_ABIGR Myrcene synthase, chloroplast precursor (EC...    72   1e-11   Abies grandis [grand fir]
gb:AY082672_1569201 Ixeris dentata var. albiflora guaiadiene syn...    71   2e-11   
gb:AF543531_1810270 Pinus taeda monoterpene synthase-like protei...    70   2e-11   
gb:AY763425_1627091 Medicago truncatula wound-inducible putative...    70   2e-11   
gb:AY473623_1608210 Picea abies (-)-linalool synthase (TPS-Lin) ...    70   2e-11   
gb:AF489964_1804672 Lactuca sativa germacrene A synthase LTC1 mR...    70   3e-11   
gb:AF461460_1801829 Picea abies (+)-3-carene synthase (JF67) mRN...    70   3e-11   
gb:AY237645_1592190 Picea sitchensis pinene synthase mRNA, compl...    70   3e-11   
gb:AY049090_1561819 Nicotiana tabacum cyclase gene, complete cds.      70   3e-11   
gb:AF139206_1771401 Abies grandis terpinolene synthase (agc9) mR...    70   4e-11   
gb:AX529002_1469920 Sequence 24 from Patent WO02064764.                69   8e-11   
gb:AF401234_1796131 Nicotiana tabacum cyclase mRNA, complete cds.      68   1e-10   
gb:AY495694_1608981 Nicotiana tabacum cultivar T.I.1068 cyclase ...    68   1e-10   
gb:AY473622_1608209 Picea abies (-)-alpha/beta-pinene synthase (...    68   1e-10   
gb:AF489965_1804673 Lactuca sativa germacrene A synthase LTC2 mR...    67   2e-10   
gb:AF326518_1786661 Abies grandis (-)-4S-limonene synthase gene,...    67   2e-10   
gb:AY640154_1618968 Cucumis sativus E,E-alpha-farnesene synthase...    67   2e-10   
gb:AX529067_1469942 Sequence 89 from Patent WO02064764.                66   4e-10   
gb:AJ786641_1814110 Mentha x piperita mRNA for cis-muuroladiene ...    66   5e-10   
gb:AJ786642_1814111 Mentha x piperita mRNA for (E)-beta-farnesen...    65   7e-10   
gb:AF024615_1762129 Mentha x piperita (E)-B-farnesene synthase (...    65   7e-10   
gb:AY362553_1602613 Ocimum basilicum geraniol synthase (GES) mRN...    65   7e-10   
sp|O22340|TSD3_ABIGR|TSD3_ABIGR (4S)-limonene synthase, chloroplast precurs...    65   7e-10   Abies grandis [grand fir]
gb:AATERPENE_1508235 Artemisia annua mRNA for epi-cedrol synthas...    65   9e-10   
gb:AAN249561_1508199 Artemisia annua mRNA for putative sesquiter...    65   9e-10   
gb:AX529000_1469919 Sequence 22 from Patent WO02064764.                65   1e-09   
gb:AX528996_1469917 Sequence 18 from Patent WO02064764.>gb:AX528...    65   1e-09   
gb:AF543530_1810269 Pinus taeda (+)-alpha-pinene synthase mRNA, ...    64   2e-09   
gb:AX529065_1469941 Sequence 87 from Patent WO02064764.                64   2e-09   
gb:AF139207_1771402 Abies grandis (-)-limonene/(-)-alpha-pinene ...    64   2e-09   
gb:ATH544238_1552875 Arabidopsis thaliana mRNA for putative delt...    64   2e-09   
gb:AB009056_1510747 Arabidopsis thaliana genomic DNA, chromosome...    64   2e-09   
gb:AP005160_1848453 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AX529063_1469940 Sequence 85 from Patent WO02064764.                64   3e-09   
gb:CQ813536_1453490 Sequence 32 from Patent WO2004031376.              64   3e-09   
gb:AY693647_1623445 Ocimum basilicum R-linalool synthase (LIS) m...    63   4e-09   
gb:AF543527_1810266 Pinus taeda (-)-alpha-pinene synthase mRNA, ...    62   6e-09   
gb:AF472361_1803078 Artemisia annua beta-caryophyllene synthase ...    62   6e-09   
gb:AF327526_1786810 Artemisia annua amorpha-4,11-diene synthase ...    62   6e-09   
gb:OSJN00073_1694333 Oryza sativa genomic DNA, chromosome 4, BAC...    62   6e-09   
gb:AAN271793_1508202 Artemisia annua mRNA for putative sesquiter...    62   8e-09   
pir|G96588|G96588 hypothetical protein T22H22.10 [imported] - Ar...    62   8e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY693645_1623443 Ocimum basilicum gamma-cadinene synthase (CD...    62   1e-08   
gb:AY006482_1557857 Artemisia annua amorpha-4,11-diene synthase ...    62   1e-08   
gb:AF138959_1771392 Artemisia annua amorpha-4,11-diene synthase ...    61   1e-08   
gb:AAN251751_1508200 Artemisia annua mRNA for amorpha-4,11-diene...    61   1e-08   
gb:OSJN00039_1693729 Oryza sativa genomic DNA, chromosome 4, BAC...    61   2e-08   
gb:AF543529_1810268 Pinus taeda alpha-terpineol synthase mRNA, c...    60   2e-08   
gb:AF497491_1805886 Arabidopsis thaliana beta-caryophyllene/alph...    60   2e-08   
gb:AY766249_1627649 Medicago truncatula wound-inducible putative...    60   3e-08   
gb:AF497486_1805881 Arabidopsis thaliana terpene synthase mRNA, ...    60   4e-08   
gb:AF326515_1786658 Abies grandis E-alpha-bisabolene synthase ge...    60   4e-08   
gb:AF006195_1760857 Abies grandis E-alpha-bisabolene synthase mR...    60   4e-08   
gb:AF006194_1760856 Abies grandis E-alpha-bisabolene synthase mR...    60   4e-08   
gb:AY518316_1610802 Zea mays B73 terpene synthase 7 (TPS7) mRNA,...    60   4e-08   
gb:AF497490_1805885 Arabidopsis thaliana terpene synthase mRNA, ...    59   8e-08   
gb:AF453326_1800902 Gossypium hirsutum (+)-delta-cadinene syntha...    59   8e-08   
gb:AY673673_1621343 Solidago canadensis cascarilladiene synthase...    59   8e-08   
gb:AB023038_1515397 Arabidopsis thaliana genomic DNA, chromosome...    59   8e-08   
gb:OSJN00107_1695043 Oryza sativa genomic DNA, chromosome 4, BAC...    58   1e-07   
pir|D85035|D85035 ent-kaurene synthetase A-like protein [importe...    58   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00039_1693724 Oryza sativa genomic DNA, chromosome 4, BAC...    57   2e-07   
gb:AF497487_1805882 Arabidopsis thaliana terpene synthase mRNA, ...    57   2e-07   
gb:AF272244_1782234 Nicotiana tabacum 5-epi-aristolochene syntha...    57   2e-07   
gb:AB023038_1515395 Arabidopsis thaliana genomic DNA, chromosome...    57   2e-07   
gb:AGU92266_1811079 Abies grandis d-selinene synthase mRNA, comp...    56   4e-07   
gb:AY473619_1608206 Picea abies E-alpha-bisabolene synthase (TPS...    56   4e-07   
gb:OSJN00131_1695413 Oryza sativa genomic DNA, chromosome 4, BAC...    56   5e-07   
gb:AY133718_1581538 Arabidopsis thaliana clone C103298 putative ...    56   5e-07   
pir|T05331|T05331 hypothetical protein F1C12.150 - Arabidopsis t...    56   5e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AJ583448_1811342 Solidago canadensis mRNA for germacrene D sy...    55   7e-07   
gb:AJ583447_1811341 Solidago canadensis mRNA for germacrene D sy...    55   7e-07   
gb:AF326519_1786662 Taxus brevifolia taxadiene synthase gene, pa...    55   7e-07   
gb:AY397645_1605108 Solidago canadensis (-)-germacrene D synthas...    55   7e-07   
gb:AY397644_1605107 Solidago canadensis (+)-germacrene D synthas...    55   7e-07   
sp|Q41594|TASY_TAXBR|TASY_TAXBR Taxadiene synthase (EC 4.2.3.17) (Taxa-4(5)...    55   7e-07   Taxus brevifolia [Pacific yew]
gb:AF497489_1805884 Arabidopsis thaliana terpene synthase mRNA, ...    55   9e-07   
gb:SCA304452_1706418 Solidago canadensis mRNA for germacrene A s...    55   9e-07   
gb:AB018121_1513912 Arabidopsis thaliana genomic DNA, chromosome...    55   1e-06   
gb:AF326513_1786656 Abies grandis delta-selinene synthase gene, ...    54   2e-06   
gb:OSJN00107_1695045 Oryza sativa genomic DNA, chromosome 4, BAC...    54   2e-06   
gb:OSJN00039_1693722 Oryza sativa genomic DNA, chromosome 4, BAC...    54   2e-06   
gb:AC133398_1741442 Oryza sativa chromosome 3 BAC OSJNBa0083F15 ...    54   3e-06   
gb:OSJN00027_1693532 Oryza sativa genomic DNA, chromosome 4, BAC...    54   3e-06   
gb:AF171218_1774391 Lycopersicon esculentum vetispiradiene synth...    53   4e-06   
gb:AY195609_1588872 Antirrhinum majus myrcene synthase 1e20 mRNA...    53   4e-06   
gb:AY195608_1588871 Antirrhinum majus myrcene synthase Oc15 mRNA...    53   4e-06   
gb:AB031204_1518599 Lactuca sativa LsCPS1 mRNA for copalyldiphos...    53   4e-06   
pir|H86460|H86460 hypothetical protein F14M2.13 - Arabidopsis th...    53   4e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T05328|T05328 hypothetical protein F1C12.120 - Arabidopsis t...    53   4e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AY195607_1588870 Antirrhinum majus (E)-b-ocimene synthase (0e...    53   5e-06   
gb:AF497485_1805880 Arabidopsis thaliana linalool synthase mRNA,...    52   8e-06   
gb:OSJN00131_1695415 Oryza sativa genomic DNA, chromosome 4, BAC...    52   8e-06   
gb:OSJN00027_1693545 Oryza sativa genomic DNA, chromosome 4, BAC...    52   8e-06   
gb:ATTERSYNT_1556657 A.thaliana mRNA for putative terpene synthase.    52   8e-06   
pir|C71424|C71424 hypothetical protein - Arabidopsis thaliana>gb...    52   8e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T06287|T06287 hypothetical protein T9E8.40 - Arabidopsis tha...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY473620_1608207 Picea abies isopimaradiene synthase (TPS-Iso...    50   2e-05   
gb:AGU50768_1811067 Abies grandis abietadiene synthase (ac22) mR...    50   3e-05   
gb:AF326516_1786659 Abies grandis abietadiene synthase gene, par...    50   3e-05   
gb:AP004560_1841588 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AGU92267_1811080 Abies grandis gamma-humulene synthase mRNA, ...    50   4e-05   
gb:AC073555_1541082 Arabidopsis thaliana chromosome 1 BAC F11I4 ...    50   4e-05   
gb:AY473621_1608208 Picea abies levopimaradiene/abietadiene synt...    49   5e-05   
gb:AP005114_1848101 Oryza sativa (japonica cultivar-group) genom...    49   9e-05   
gb:AF034545_1762775 Stevia rebaudiana copalyl pyrophosphate synt...    49   9e-05   
gb:AY602991_1617444 Oryza sativa (indica cultivar-group) ent-cop...    49   9e-05   
gb:AB066271_1522559 Oryza sativa (japonica cultivar-group) OsCyc...    49   9e-05   
gb:AP004560_1841591 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AP003793_1833442 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AY518314_1610800 Zea mays Delprim terpene synthase 5 (TPS5) m...    48   1e-04   
gb:AY518310_1610796 Zea mays B73 terpene synthase 4 (TPS4) mRNA,...    48   1e-04   
gb:AAN276415_1508206 Artemisia annua partial gASC24 gene for put...    48   1e-04   
pir|E96723|E96723 hypothetical protein F20P5.19 [imported] - Ara...    48   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP003876_1834698 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AY518311_1610797 Zea mays B73 terpene synthase 5 (TPS5) mRNA,...    47   2e-04   
gb:AT23KB_1542658 A.thaliana RH1, TC1, G14587-5, G14587-6, and P...    47   2e-04   
pir|T06285|T06285 hypothetical protein T9E8.20 - Arabidopsis tha...    47   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY518313_1610799 Zea mays Delprim terpene synthase 5 (TPS5) m...    47   3e-04   
pir|T02959|T02959 kaurene synthase A - maize>gb:MZEAN1A_1687833 ...    47   3e-04   Zea mays [maize]
gb:AP001309_1821136 Arabidopsis thaliana genomic DNA, chromosome...    47   3e-04   
gb:AF369920_1792000 Picea abies gamma-humulene synthase-like pro...    47   3e-04   
gb:AF323431_1786284 Perilla frutescens strain 5343 limonene synt...    47   3e-04   
gb:AY473625_1608212 Picea abies longifolene synthase (TPS-Lon) m...    47   3e-04   
gb:AP004560_1841594 Oryza sativa (japonica cultivar-group) genom...    46   4e-04   
gb:AF326118_1786621 Capsicum annuum sesquiterpene cyclase (PSC1)...    46   4e-04   
gb:AF049906_1764115 Cucurbita maxima copalyl diphosphate synthas...    46   4e-04   
gb:AC092211_1735232 Oryza sativa chromosome 10 P0031G09 genomic ...    46   4e-04   
gb:AY562490_1615000 Zea mays copalyl diphosphate synthase like-p...    46   4e-04   
gb:AY518312_1610798 Zea mays Delprim terpene synthase 4 (TPS4) m...    46   4e-04   
pir|T05329|T05329 hypothetical protein F1C12.130 - Arabidopsis t...    46   4e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AF497488_1805883 Arabidopsis thaliana terpene synthase mRNA, ...    46   6e-04   
gb:AB046689_1520536 Scoparia dulcis cps mRNA for copalyl diphosp...    45   7e-04   
gb:AY518315_1610801 Zea mays B73 terpene synthase 6 (TPS6) mRNA,...    45   0.001   
gb:AP004872_1846366 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:AB126932_1528276 Oryza sativa (japonica cultivar-group) OsCPS...    45   0.001   
pir|C96642|C96642 hypothetical protein T13M11.3 [imported] - Ara...    45   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:AB024024_1515697 Arabidopsis thaliana genomic DNA, chromosome...    44   0.002   
gb:AB015675_1512721 Lycopersicon esculentum CPS mRNA for copalyl...    44   0.002   
pir|F96684|F96684 probable terpene synthase F15E12.3 [imported] ...    44   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AY518317_1610803 Zea mays B73 terpene synthase 9 (TPS9) mRNA,...    44   0.003   
gb:AC079041_1541807 Arabidopsis thaliana chromosome 1 BAC F5M6 g...    44   0.003   
gb:AB028617_1518023 Arabidopsis thaliana genomic DNA, chromosome...    44   0.003   
pir|G86443|G86443 probable terpene synthase type protein [import...    44   0.003   Arabidopsis thaliana [mouse-ear cress]
gb:AB075045_1523301 Cucumis sativus CsCPS1 mRNA for copalyl diph...    43   0.004   
gb:AC146481_1744575 Oryza sativa chromosome 10 B1288B10 genomic ...    43   0.005   
gb:AE016959_1023195 Oryza sativa (japonica cultivar-group) chrom...    43   0.005   
gb:AB026657_1517336 Arabidopsis thaliana genomic DNA, chromosome...    42   0.006   
gb:AAN276413_1508204 Artemisia annua partial gASC22 gene for put...    42   0.008   
gb:AP004078_1837357 Oryza sativa (japonica cultivar-group) genom...    42   0.011   
gb:OSJN00131_1695414 Oryza sativa genomic DNA, chromosome 4, BAC...    42   0.011   
gb:AB045310_1520398 Cucumis sativus CsKS1 mRNA for ent-kaurene s...    40   0.024   
gb:AY574248_1615873 Ginkgo biloba levopimaradiene synthase (LPS)...    40   0.040   
gb:AY551436_1613344 Hordeum vulgare subsp. vulgare ent-kaurene s...    39   0.053   
gb:AF258249_1781371 Brassica napus cultivar Drakkar cyclase ent-...    39   0.069   
gb:OSJN00137_1695507 Oryza sativa genomic DNA, chromosome 4, BAC...    39   0.069   
gb:OSJN00107_1695051 Oryza sativa genomic DNA, chromosome 4, BAC...    39   0.069   
gb:AY616862_1618167 Oryza sativa (indica cultivar-group) syn-pim...    39   0.069   
gb:AY347880_1601407 Oryza sativa (japonica cultivar-group) map B...    39   0.069   
gb:AB126934_1528277 Oryza sativa (japonica cultivar-group) OsKS4...    39   0.069   
gb:AP002068_1821889 Arabidopsis thaliana genomic DNA, chromosome...    39   0.090   
gb:OSJN00131_1695410 Oryza sativa genomic DNA, chromosome 4, BAC...    39   0.090   
gb:AF529266_1809036 Zea mays terpene synthase (tps1) mRNA, compl...    38   0.12    
gb:AY347878_1601405 Oryza sativa (japonica cultivar-group) ent-k...    38   0.15    
gb:AY347877_1601404 Oryza sativa (japonica cultivar-group) clone...    38   0.15    
gb:AY347876_1601403 Oryza sativa (japonica cultivar-group) map B...    38   0.15    
gb:AB042424_1519885 Croton sublyratus cps mRNA for copalyl dipho...    38   0.15    
gb:AF258251_1781373 Brassica rapa cyclase ent-kaurene synthetase...    37   0.20    
gb:OSJN00255_1697483 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.20    
gb:AY347879_1601406 Oryza sativa (japonica cultivar-group) map B...    37   0.20    
gb:AY528645_1611743 Nicotiana tabacum terpenoid cyclase mRNA, co...    37   0.26    
pir|T09672|T09672 ent-kaurene synthase B (EC 2.5.1.-) - winter s...    37   0.26    
gb:AC073555_1541081 Arabidopsis thaliana chromosome 1 BAC F11I4 ...    37   0.34    
gb:AF258250_1781372 Brassica napus cultivar Drakkar cyclase ent-...    36   0.45    
gb:AF097311_1767869 Stevia rebaudiana kaurene synthase (KS22-1) ...    36   0.45    
gb:AB031205_1518600 Lactuca sativa LsKS1 mRNA for ent-kaurene sy...    36   0.45    
gb:AY461450_1607453 Taxus x media taxadiene synthase (txs) mRNA,...    35   0.99    
gb:AY424738_1605498 Taxus baccata taxadiene synthase (TXS) mRNA,...    35   0.99    
gb:AAN276412_1508203 Artemisia annua partial gASC21 gene for put...    35   0.99    
gb:AF097310_1767868 Stevia rebaudiana kaurene synthase (KS1-1) m...    34   1.7     
gb:AAN276414_1508205 Artemisia annua partial gASC23 gene for put...    34   1.7     
gb:AY364470_2145085 Synthetic construct taxa-4(5),11(12)-diene s...    34   2.2     
gb:AC135916_1742807 Genomic sequence for Oryza sativa, Nipponbar...    34   2.2     
gb:AY530101_1611874 Oryza sativa (indica cultivar-group) syn-cop...    34   2.2     
gb:AY365032_1602849 Taxus chinensis var. mairei taxadiene syntha...    34   2.2     
gb:AY364469_1602837 Taxus canadensis clone Tc3003 taxa-4(5),11(1...    34   2.2     
gb:AB066270_1522558 Oryza sativa (japonica cultivar-group) OsCyc...    34   2.2     
gb:OSJN00145_1190849 Oryza sativa (japonica cultivar-group) chro...    34   2.2     
sp|Q9FT37|TASY_TAXCH|TASY_TAXCH Taxadiene synthase (EC 4.2.3.17) (Taxa-4(5)...    34   2.2     
sp|Q93YA3|TASY_TAXBA|TASY_TAXBA Taxadiene synthase (EC 4.2.3.17) (Taxa-4(5)...    34   2.2     
gb:PFMAL4P3_1394818 Plasmodium falciparum MAL4P3.                      33   2.9     
gb:AP005835_1858751 Oryza sativa (japonica cultivar-group) genom...    33   4.9     
gb:AB089272_1524876 Oryza sativa OsDTC1 mRNA for putative diterp...    33   4.9     
gb:AF067601_1765611 Clarkia breweri linalool synthase 1 (LIS1) g...    32   6.4     
gb:CBU58314_1645705 Clarkia breweri S-linalool synthase (Lis) mR...    32   6.4     


>gb:AF444798_1800410 Perilla frutescens var. crispa cultivar No. 79
           linalool synthase mRNA, complete cds.
          Length = 607

 Score =  132 bits (333), Expect = 4e-30
 Identities = 75/157 (47%), Positives = 90/157 (57%), Gaps = 1/157 (0%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI 326
           T RRSGNY+P  WD++Y+QSLNTT Y     + R  EL E+VK ML             +
Sbjct: 61  TARRSGNYQPSLWDFNYLQSLNTTQYKEVRHLKREAELIEQVK-MLLEEEMEAVQQLELV 119

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXX-XXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           D+L+ LG SY FE++I   L  IY                  DLY TAL FR+LRQ+GF 
Sbjct: 120 DDLKNLGLSYFFEDQIKQILTFIYNEHKCFHSNSIIEAEEIRDLYFTALGFRLLRQHGFQ 179

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +SQEVFDCF +   S F   LG D KGLL LYEASFL
Sbjct: 180 VSQEVFDCFKNEEGSDFKARLGDDTKGLLQLYEASFL 216



>gb:AY693650_1623448 Ocimum basilicum terpinolene synthase (TES)
           mRNA, complete cds.
          Length = 601

 Score =  129 bits (324), Expect = 4e-29
 Identities = 70/166 (42%), Positives = 96/166 (57%)
 Frame = +3

Query: 117 SFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXX 296
           S S+      TTRRSGNYEP  WD++Y+QSLN  H+  E ++ R+ +L E+VK +L    
Sbjct: 42  SCSLQLQPPPTTRRSGNYEPSAWDFNYLQSLNNYHHKEERYLRRQADLIEKVKMILKEEK 101

Query: 297 XXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEF 476
                    ID+L+ LG SY F+++I   L  IY                 +LY TAL F
Sbjct: 102 MEALQQLELIDDLRNLGLSYCFDDQINHILTTIYNQHSCFHYHEAATSEEANLYFTALGF 161

Query: 477 RVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           R+LR++GF +SQEVFD F + + + F  +L  D +GLL LYEASFL
Sbjct: 162 RLLREHGFKVSQEVFDRFKNEKGTDFRPDLVDDTQGLLQLYEASFL 207



>gb:AF051901_1764287 Salvia officinalis (+)-sabinene synthase mRNA,
           complete cds.
          Length = 590

 Score =  124 bits (310), Expect = 2e-27
 Identities = 78/182 (42%), Positives = 98/182 (53%)
 Frame = +3

Query: 69  YKLSCLPSIHRSHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMR 248
           +  SC     R  A SS           RRSG+Y+P  WD++YIQSLNT  Y  +    R
Sbjct: 26  WSTSCTAPAARLRASSSLQQ--EKPHQIRRSGDYQPSLWDFNYIQSLNTP-YKEQRHFNR 82

Query: 249 RDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXX 428
           + EL  +V+ ML             ID+LQ LG SY F++EI   L  I+          
Sbjct: 83  QAELIMQVR-MLLKVKMEAIQQLELIDDLQYLGLSYFFQDEIKQILSSIH--------NE 133

Query: 429 XXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
                  DLY TAL FR+LRQ+GFN+S++VFDCF   + S FN NL QD KG+L LYEAS
Sbjct: 134 PRYFHNNDLYFTALGFRILRQHGFNVSEDVFDCFKIEKCSDFNANLAQDTKGMLQLYEAS 193

Query: 609 FL 614
           FL
Sbjct: 194 FL 195



>gb:AY693649_1623447 Ocimum basilicum beta-myrcene synthase (MYS)
           mRNA, complete cds.
          Length = 599

 Score =  124 bits (310), Expect = 2e-27
 Identities = 75/186 (40%), Positives = 97/186 (52%), Gaps = 12/186 (6%)
 Frame = +3

Query: 93  IHRSHAESSFSMCYHTT-----------TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGF 239
           +H S+ ++S   C  +T              RRSGNY+P  WD++YIQSLN  H   E  
Sbjct: 21  LHNSNNKASNPRCVSSTRRRPSCPLQLDVEPRRSGNYQPSAWDFNYIQSLNNNHSKEERH 80

Query: 240 VMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXX 419
           + R+ +L E VK ML             I++L+ LG SY F++EI   L  IY       
Sbjct: 81  LERKAKLIEEVK-MLLEQEMAAVQQLELIEDLKNLGLSYLFQDEIKIILNSIYNHHKCFH 139

Query: 420 XXXXX-XXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNL 596
                      DLY  AL FR+ RQ+GF +SQEVFDCF +   S F+ NL  D KGLL L
Sbjct: 140 NNHEQCIHVNSDLYFVALGFRLFRQHGFKVSQEVFDCFKNEEGSDFSANLADDTKGLLQL 199

Query: 597 YEASFL 614
           YEAS+L
Sbjct: 200 YEASYL 205



>gb:AY083653_1569255 Mentha citrata linalool synthase mRNA, complete
           cds.
          Length = 606

 Score =  122 bits (306), Expect = 5e-27
 Identities = 72/156 (46%), Positives = 88/156 (56%), Gaps = 1/156 (0%)
 Frame = +3

Query: 150 TRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXID 329
           TRRSGNY P  WD+ +IQSL+T HY  E  + R +EL   VK +L             ID
Sbjct: 68  TRRSGNYHPSVWDFDFIQSLDTDHYKEEKQLEREEELIMEVKKLL-GAKMEATKQLELID 126

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
           +LQ LG SY F +EI   L  IY                 DL+ T+L FR+LRQ+GFN+S
Sbjct: 127 DLQNLGLSYFFRDEIKNILNSIY-----KIFQNNNSTKVGDLHFTSLGFRLLRQHGFNVS 181

Query: 510 QEVFDCFMDGRRSRFNVNL-GQDIKGLLNLYEASFL 614
           Q VFDCF +   S F   L G+D KG+L LYEASFL
Sbjct: 182 QGVFDCFKNEHGSDFEKTLIGEDTKGVLQLYEASFL 217



>gb:AY693648_1623446 Ocimum basilicum fenchol synthase (FES) mRNA,
           complete cds.
          Length = 598

 Score =  121 bits (303), Expect = 1e-26
 Identities = 74/186 (39%), Positives = 96/186 (51%), Gaps = 12/186 (6%)
 Frame = +3

Query: 93  IHRSHAESSFSMCYHTT-----------TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGF 239
           +H S+ ++S   C  +T              RRSGNY+P  WD++YIQSLN  H   E  
Sbjct: 21  LHNSNNKASNPRCVSSTRRRPSCPLQLDVEPRRSGNYQPSAWDFNYIQSLNNNHSKEERH 80

Query: 240 VMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXX-XX 416
           +  + +L E VK ML             I++L+ LG SY F++EI   L  IY       
Sbjct: 81  LQGKAKLIEEVK-MLLEQEMAAVQQLEFIEDLKNLGLSYLFQDEIKIILNSIYNHHKCFH 139

Query: 417 XXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNL 596
                      DLY  AL FR+ RQ+GF +SQEVFDCF +   S F  NL +D KGLL L
Sbjct: 140 NNHQQRTDENADLYFVALGFRLFRQHGFKVSQEVFDCFKNEEGSDFIPNLAEDTKGLLQL 199

Query: 597 YEASFL 614
           YEAS+L
Sbjct: 200 YEASYL 205



>gb:AF282875_1783032 Schizonepeta tenuifolia (+)-4R-limonene
           synthase mRNA, complete cds.
          Length = 620

 Score =  117 bits (294), Expect = 1e-25
 Identities = 76/200 (38%), Positives = 102/200 (51%), Gaps = 4/200 (2%)
 Frame = +3

Query: 27  KKEMAILNVLSTFTYKLSCLPSIHRSHA--ESSFSMCYHTTTTTRRSGNYEPPTWDYSYI 200
           K+ + +L  +ST +   +     HR      +S S      T  RRSGNY+P  WD  ++
Sbjct: 29  KQSLKLLRNVSTISTSAAAATPRHRLPVCCSASSSSSSQLPTIERRSGNYKPSRWDVDFM 88

Query: 201 QSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXX-XXXXXXIDELQRLGCSYHFEEEIM 377
           QSLN+  Y  E    +  EL  +VK++L              ID+LQRLG S HFE E  
Sbjct: 89  QSLNSD-YQEERHRTKASELITQVKNLLEKETSDDPIRQLELIDDLQRLGLSDHFEHEFK 147

Query: 378 AALMDIYMXXXXXXXXXXXXXXXX-DLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRF 554
             L  IY+                 DLY+TAL FR+LR++GF ++QEVFDCF +     F
Sbjct: 148 EVLNSIYLDNKYYNINIMKETTSSRDLYSTALAFRLLREHGFQVAQEVFDCFKN-EEGEF 206

Query: 555 NVNLGQDIKGLLNLYEASFL 614
             +L  D +GLL LYEASFL
Sbjct: 207 KASLSDDPRGLLQLYEASFL 226



>gb:AY691947_1622588 Arabidopsis thaliana 1,8-cineole synthase mRNA,
           complete cds.>gb:AP000599_1820364 Arabidopsis thaliana
           genomic DNA, chromosome 3, TAC clone: K9I22.
          Length = 600

 Score =  115 bits (288), Expect = 6e-25
 Identities = 77/201 (38%), Positives = 109/201 (54%), Gaps = 7/201 (3%)
 Frame = +3

Query: 36  MAILNVLSTFTYK--LSCLPSIHRSHAESSFSMCYHTTTTT-----RRSGNYEPPTWDYS 194
           MA L + S   Y+  L+    + R H     SM   T  TT     RRSGNY+P  W++ 
Sbjct: 1   MATLRISSALIYQNTLTHHFRLRRPHRFVCKSMTKTTPDTTLVELSRRSGNYQPSPWNHC 60

Query: 195 YIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEI 374
           Y+ S+    Y +E  V+ RD LK++VK ML             ID+LQ+LG SYHFE EI
Sbjct: 61  YLLSIENK-YASETEVITRDVLKKKVKSMLDDEKKSRLEQLELIDDLQKLGVSYHFEIEI 119

Query: 375 MAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRF 554
              L D+++                DL+AT+LEFR+LRQ+GF++S+ +FD  +D   S  
Sbjct: 120 NDTLTDLHL---KMGRNCWKCDKEEDLHATSLEFRLLRQHGFDVSENIFDVIIDQIES-- 174

Query: 555 NVNLGQDIKGLLNLYEASFLS 617
           N     +I G+++LYEAS+LS
Sbjct: 175 NTFKTNNINGIISLYEASYLS 195



>gb:AY055214_1563377 Agastache rugosa d-limonene synthase mRNA,
           complete cds.
          Length = 613

 Score =  114 bits (286), Expect = 1e-24
 Identities = 70/167 (41%), Positives = 88/167 (52%)
 Frame = +3

Query: 114 SSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXX 293
           SS S      T  RRSGNY P  WD  +IQSLN+  Y  E    R  EL  +VK ++   
Sbjct: 57  SSSSSSSQLPTIERRSGNYSPSRWDVDFIQSLNSD-YQEERHTRRASELITQVKMLMEKE 115

Query: 294 XXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALE 473
                     ID+LQRLG S HF+ E    L  IY+                DLY+TAL 
Sbjct: 116 TTDPIRQLELIDDLQRLGLSDHFQNEFKEILNTIYLDNKYYNINIMREESR-DLYSTALA 174

Query: 474 FRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           FR+LR++GF ++QEVF+CF +     F  +L  D +GLL LYEASFL
Sbjct: 175 FRLLREHGFQVAQEVFECFKN-EEGDFKASLIDDTRGLLQLYEASFL 220



>gb:AF178535_1774714 Arabidopsis thaliana myrcene/ocimene synthase
           (TPS10) mRNA, partial cds.
          Length = 555

 Score =  112 bits (280), Expect = 5e-24
 Identities = 68/165 (41%), Positives = 91/165 (55%), Gaps = 2/165 (1%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           C  + T  RRS NY+P  WD+ ++ S+    +  +  V  RD LKE+V+ ML        
Sbjct: 2   CNKSPTVQRRSANYQPSRWDHHHLLSVENK-FAKDKRVRERDLLKEKVRKMLNDEQKTYL 60

Query: 309 XXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID+LQ+LG SYHFE EI   L   Y                 DL+ATALEFR+ R
Sbjct: 61  DQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQES-------DLHATALEFRLFR 113

Query: 489 QNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFLS 617
           Q+GFN+S++VFD FM+  G+  R       DI GL++LYEAS+LS
Sbjct: 114 QHGFNVSEDVFDVFMENCGKFDR------DDIYGLISLYEASYLS 152



>pir|H84633|H84633 probable limonene cyclase [imported] -
           Arabidopsis thaliana>gb:AC005967_1533275 Arabidopsis
           thaliana chromosome 2 clone F27D4 map CIC06C07, complete
           sequence.
          Length = 591

 Score =  112 bits (280), Expect = 5e-24
 Identities = 68/165 (41%), Positives = 91/165 (55%), Gaps = 2/165 (1%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           C  + T  RRS NY+P  WD+ ++ S+    +  +  V  RD LKE+V+ ML        
Sbjct: 38  CNKSPTVQRRSANYQPSRWDHHHLLSVENK-FAKDKRVRERDLLKEKVRKMLNDEQKTYL 96

Query: 309 XXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID+LQ+LG SYHFE EI   L   Y                 DL+ATALEFR+ R
Sbjct: 97  DQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQES-------DLHATALEFRLFR 149

Query: 489 QNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFLS 617
           Q+GFN+S++VFD FM+  G+  R       DI GL++LYEAS+LS
Sbjct: 150 QHGFNVSEDVFDVFMENCGKFDR------DDIYGLISLYEASYLS 188



>gb:AF051900_1764286 Salvia officinalis (+)-bornyl diphosphate
           synthase mRNA, complete cds.
          Length = 598

 Score =  112 bits (279), Expect = 6e-24
 Identities = 79/208 (37%), Positives = 110/208 (52%), Gaps = 15/208 (7%)
 Frame = +3

Query: 36  MAILNV-LSTFTYKLSCLPSIHRSHAESSFSMCYHTTTTTR--------------RSGNY 170
           M+I+++ +S  +  L+CL ++ R  +++    C   T   R              RSGNY
Sbjct: 1   MSIISMNVSILSKPLNCLHNLERRPSKALLVPCTAPTARLRASCSSKLQEAHQIRRSGNY 60

Query: 171 EPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGC 350
           +P  WD +YIQSLNT  YT E  + R+ EL  +V+ +L             I +L+ LG 
Sbjct: 61  QPALWDSNYIQSLNTP-YTEERHLDRKAELIVQVR-ILLKEKMEPVQQLELIHDLKYLGL 118

Query: 351 SYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCF 530
           S  F++EI   L  IY                 DLY TAL FR+LRQ+GFNISQ+VF+CF
Sbjct: 119 SDFFQDEIKEILGVIY---NEHKCFHNNEVEKMDLYFTALGFRLLRQHGFNISQDVFNCF 175

Query: 531 MDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            + +   F  +L QD KG+L LYEASFL
Sbjct: 176 KNEKGIDFKASLAQDTKGMLQLYEASFL 203



>gb:AY572987_1615755 Vitis vinifera clone VitiC4568 terpenoid
           synthase mRNA, complete cds.
          Length = 590

 Score =  111 bits (277), Expect = 1e-23
 Identities = 69/154 (44%), Positives = 86/154 (55%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RR+ NY P  WDY Y+QSL +  Y  E +  R D+LK  VK ML             ID 
Sbjct: 49  RRTANYHPTIWDYDYVQSLRSD-YVGETYTRRLDKLKRDVKPMLGKVKKPLDQLEL-IDV 106

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           LQRLG  YHF++EI   L  IY                 DLYATALEFR+LRQ+G+++ Q
Sbjct: 107 LQRLGIYYHFKDEIKRILNSIY-----NQYNRHEEWQKDDLYATALEFRLLRQHGYDVPQ 161

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF  F D   S F   L +D+KG+L LYEAS+L
Sbjct: 162 DVFSRFKDDTGS-FKACLCEDMKGMLCLYEASYL 194



>gb:AY572986_1615754 Vitis vinifera clone VitiC1891 terpenoid
           synthase mRNA, complete cds.
          Length = 590

 Score =  110 bits (276), Expect = 1e-23
 Identities = 69/154 (44%), Positives = 86/154 (55%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RR+ NY P  WDY Y+QSL +  Y  E +  R D+LK  VK ML             ID 
Sbjct: 49  RRTANYHPTIWDYDYVQSLRSD-YVGETYTRRLDKLKRDVKPMLGKVKKPLDQLEL-IDV 106

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           LQRLG  YHF++EI   L  IY                 DLYATALEFR+LRQ+G+++ Q
Sbjct: 107 LQRLGIYYHFKDEIKRILNGIY-----NQYNRHEEWQKDDLYATALEFRLLRQHGYDVPQ 161

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF  F D   S F   L +D+KG+L LYEAS+L
Sbjct: 162 DVFSRFKDDTGS-FKACLCEDMKGMLCLYEASYL 194



>gb:AY151086_1585101 Arabidopsis thaliana E-beta-ocimene synthase
           mRNA, partial cds.
          Length = 540

 Score =  110 bits (276), Expect = 1e-23
 Identities = 69/156 (44%), Positives = 88/156 (56%), Gaps = 1/156 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RRS NY+P  W + Y+ SL  T Y  E  V R   LK+ V  ML             ID 
Sbjct: 1   RRSANYQPSLWQHEYLLSLGNT-YVKEDNVERVTLLKQEVSKMLNETEGLLEQLEL-IDT 58

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           LQRLG SYHFE+EI   L ++++                DLYATALEFR+LRQ+GF+I+Q
Sbjct: 59  LQRLGVSYHFEQEIKKTLTNVHVKNVRAHKNRIDRNRWGDLYATALEFRLLRQHGFSIAQ 118

Query: 513 EVFDCFMDGRRSRFNVNL-GQDIKGLLNLYEASFLS 617
           +VFD           V+L  +DIKG+L+LYEAS+LS
Sbjct: 119 DVFD-------GNIGVDLDDKDIKGILSLYEASYLS 147



>gb:AB110636_1526999 Citrus unshiu CitMTSE1 mRNA for d-limonene
           synthase, complete cds.
          Length = 606

 Score =  109 bits (273), Expect = 3e-23
 Identities = 67/162 (41%), Positives = 91/162 (56%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXX 311
           Y   T  RRS NY+P  WD+ ++QSLN+ +YT E +  R +ELK +V   +         
Sbjct: 46  YDNLTVDRRSANYQPSIWDHDFLQSLNS-NYTDETYKRREEELKGKVMTTIKDVTEPLNQ 104

Query: 312 XXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID LQRLG +YHFE EI   L DIY                 +LYAT+LEFR+LRQ
Sbjct: 105 LEL-IDSLQRLGLAYHFETEIRNILHDIY------NSNNDYVWRKENLYATSLEFRLLRQ 157

Query: 492 NGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +G+ +SQEVF+ F D +       +  D KG+L+L+EAS+ S
Sbjct: 158 HGYPVSQEVFNGFKDDQGG----FICDDFKGVLSLHEASYFS 195



>gb:QIL304839_1703197 Quercus ilex mRNA for putative chloroplast
           terpene synthase (16 gene).
          Length = 597

 Score =  108 bits (269), Expect = 9e-23
 Identities = 68/153 (44%), Positives = 89/153 (58%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RRS NY+P  W++ YI+SL    Y  E    + + LKE+V+ ML             I+ 
Sbjct: 57  RRSANYQPSIWNHDYIESLRI-EYVGETCTRQINVLKEQVRMMLHKVVNPLEQLEL-IEI 114

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           LQRLG SYHFEEEI   L  +Y                 +LYATAL+FR+LRQ+G+++SQ
Sbjct: 115 LQRLGLSYHFEEEIKRILDGVY-----NNDHGGDTWKAENLYATALKFRLLRQHGYSVSQ 169

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASF 611
           EVF+ F D R S F   L +D KG+L+LYEASF
Sbjct: 170 EVFNSFKDERGS-FKACLCEDTKGMLSLYEASF 201



>gb:AB110637_1527000 Citrus unshiu CitMTSE2 mRNA for d-limonene
           synthase, complete cds.
          Length = 608

 Score =  107 bits (267), Expect = 2e-22
 Identities = 66/162 (40%), Positives = 91/162 (56%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXX 311
           Y   T  RRS NY+P  WD+ ++QSLN+ +YT E +  R +ELK +VK  +         
Sbjct: 46  YDNLTVDRRSANYQPSIWDHDFLQSLNS-NYTDETYKRRAEELKGKVKTAIKDVTEPLDQ 104

Query: 312 XXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID LQRLG +YHFE EI   L +I+                 +LYAT+LEFR+LRQ
Sbjct: 105 LEL-IDNLQRLGLAYHFEPEIRNILRNIH------NHNKDYNWRKENLYATSLEFRLLRQ 157

Query: 492 NGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +G+ +SQEVF  F D +       +  D KG+L+L+EAS+ S
Sbjct: 158 HGYPVSQEVFSGFKDDKVG----FICDDFKGILSLHEASYYS 195



>gb:AF241791_1780127 Perilla frutescens strain 32 limonene synthase
           gene, complete cds.
          Length = 336

 Score =  106 bits (264), Expect = 4e-22
 Identities = 68/162 (41%), Positives = 84/162 (51%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           C    +  RRSGNY P  W+  YI SLN+ HY  +  + R  EL  +VK M+        
Sbjct: 53  CSLQASDQRRSGNYSPSFWNADYILSLNS-HYKDKSHMKRAGELIVQVK-MVMGKETDPV 110

Query: 309 XXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID+LQ+L  S+H E+EI   L  I                  DLY+TAL FR+LR
Sbjct: 111 VQLELIDDLQKLALSHHVEKEIKEILFKI-------STYDHKIMVERDLYSTALAFRLLR 163

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           Q GF + QEVFDCF +     F  +L  D KGLL LYEASFL
Sbjct: 164 QYGFKVPQEVFDCFKND-NGEFKRSLSSDTKGLLQLYEASFL 204



>gb:AB028607_1517902 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K13N2.
          Length = 598

 Score =  106 bits (264), Expect = 4e-22
 Identities = 64/156 (41%), Positives = 90/156 (57%), Gaps = 1/156 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX-ID 329
           RRSGNY+P +WD+SY+ S+    Y  E  V+ R  LK++VK ML              ID
Sbjct: 47  RRSGNYQPSSWDHSYLLSIENK-YVNEKEVITRHVLKKKVKKMLEEVETKSRLEKLELID 105

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
           +LQ+LG SYHFE+EI   L + ++                DL+ATALEFR+LRQ+GF +S
Sbjct: 106 DLQKLGVSYHFEQEINNILTNFHLENGKNIWKCDKEE---DLHATALEFRLLRQHGFGVS 162

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +++FD  +D   S  N     +I  ++ LYEAS+LS
Sbjct: 163 EDIFDVIIDKIES--NTFKSDNITSIITLYEASYLS 196



>gb:AB005744_1509697 Perilla frutescens DNA for 1-limonene synthase,
           complete cds.>gb:D49368_1674614 Perilla frutescens mRNA
           for limonene cyclase, complete cds.
          Length = 603

 Score =  106 bits (264), Expect = 4e-22
 Identities = 68/162 (41%), Positives = 84/162 (51%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           C    +  RRSGNY P  W+  YI SLN+ HY  +  + R  EL  +VK M+        
Sbjct: 53  CSLQASDQRRSGNYSPSFWNADYILSLNS-HYKDKSHMKRAGELIVQVK-MVMGKETDPV 110

Query: 309 XXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID+LQ+L  S+H E+EI   L  I                  DLY+TAL FR+LR
Sbjct: 111 VQLELIDDLQKLALSHHVEKEIKEILFKI-------STYDHKIMVERDLYSTALAFRLLR 163

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           Q GF + QEVFDCF +     F  +L  D KGLL LYEASFL
Sbjct: 164 QYGFKVPQEVFDCFKND-NGEFKRSLSSDTKGLLQLYEASFL 204



>pir|A48863|A48863 limonene cyclase - spearmint>gb:MHC4SLSP_1686145
           Mentha spicata 4S-limonene synthase mRNA, complete cds.
          Length = 599

 Score =  106 bits (264), Expect = 4e-22
 Identities = 66/157 (42%), Positives = 85/157 (54%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX 323
           TT RRSGNY P  WD ++IQSL  + Y  +  V+R  EL   VK M              
Sbjct: 55  TTERRSGNYNPSRWDVNFIQSL-LSDYKEDKHVIRASELVTLVK-MELEKETDQIRQLEL 112

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID+LQR+G S HF+ E    L  IY+                DLY+T+L FR+LR++GF 
Sbjct: 113 IDDLQRMGLSDHFQNEFKEILSSIYLDHHYYKNPFPKEER--DLYSTSLAFRLLREHGFQ 170

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           ++QEVFD F +     F  +L  D +GLL LYEASFL
Sbjct: 171 VAQEVFDSFKN-EEGEFKESLSDDTRGLLQLYEASFL 206



>gb:AF317695_1785568 Perilla frutescens var. frutescens limonene
           synthase gene, complete cds.
          Length = 604

 Score =  105 bits (262), Expect = 6e-22
 Identities = 70/163 (42%), Positives = 86/163 (52%), Gaps = 1/163 (0%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR-DELKERVKDMLXXXXXXX 305
           C    +  RRSGNY P  W+  YI SLN  HY  E   M+R  EL  +VK M+       
Sbjct: 53  CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKRAGELIVQVK-MVMGKETDP 110

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID+L +L  S+HFE+EI   L +I +                DLY+TAL FR+L
Sbjct: 111 VVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMVER-------DLYSTALAFRLL 163

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           RQ GF + QEVFDCF +     F  +L  D KGLL LYEASFL
Sbjct: 164 RQYGFKVPQEVFDCFKND-NGEFKRSLSSDTKGLLQLYEASFL 205



>gb:AF241792_1780128 Perilla frutescens strain 5598 limonene
           synthase gene, complete cds.
          Length = 604

 Score =  105 bits (262), Expect = 6e-22
 Identities = 69/163 (42%), Positives = 87/163 (53%), Gaps = 1/163 (0%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR-DELKERVKDMLXXXXXXX 305
           C    +  RRSGNY P  W+  YI SLN  HY  E   M+R  EL  +VK M+       
Sbjct: 53  CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKRAGELIVQVK-MVMGKETDP 110

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID+L +L  S+HFE+EI   L +I +                DLY+TAL FR+L
Sbjct: 111 VVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMVER-------DLYSTALAFRLL 163

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           RQ+G+ + QEVFDCF +     F  +L  D KGLL LYEASFL
Sbjct: 164 RQHGYQVHQEVFDCFKND-NGEFKRSLSSDTKGLLQLYEASFL 205



>gb:AF241790_1780126 Perilla citriodora limonene synthase gene,
           complete cds.
          Length = 604

 Score =  105 bits (262), Expect = 6e-22
 Identities = 70/163 (42%), Positives = 86/163 (52%), Gaps = 1/163 (0%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR-DELKERVKDMLXXXXXXX 305
           C    +  RRSGNY P  W+  YI SLN  HY  E   M+R  EL  +VK M+       
Sbjct: 53  CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKRAGELIVQVK-MVMGKETDP 110

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID+L +L  S+HFE+EI   L +I +                DLY+TAL FR+L
Sbjct: 111 VVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMVER-------DLYSTALAFRLL 163

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           RQ GF + QEVFDCF +     F  +L  D KGLL LYEASFL
Sbjct: 164 RQYGFKVPQEVFDCFKND-NGEFKRSLSSDTKGLLQLYEASFL 205



>gb:AF233894_1779525 Perilla citriodora limonene synthase mRNA,
           complete cds.
          Length = 604

 Score =  105 bits (262), Expect = 6e-22
 Identities = 70/163 (42%), Positives = 86/163 (52%), Gaps = 1/163 (0%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR-DELKERVKDMLXXXXXXX 305
           C    +  RRSGNY P  W+  YI SLN  HY  E   M+R  EL  +VK M+       
Sbjct: 53  CSLQASDQRRSGNYSPSFWNADYILSLNN-HYKEESRHMKRAGELIVQVK-MVMGKETDP 110

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID+L +L  S+HFE+EI   L +I +                DLY+TAL FR+L
Sbjct: 111 VVQLELIDDLHKLALSHHFEKEIKEILFNISIYDHKIMVER-------DLYSTALAFRLL 163

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           RQ GF + QEVFDCF +     F  +L  D KGLL LYEASFL
Sbjct: 164 RQYGFKVPQEVFDCFKND-NGEFKRSLSSDTKGLLQLYEASFL 205



>gb:AF051899_1764285 Salvia officinalis 1,8-cineole synthase mRNA,
           complete cds.
          Length = 591

 Score =  105 bits (262), Expect = 6e-22
 Identities = 65/157 (41%), Positives = 87/157 (55%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI 326
           T RR+G Y+P  WD+S IQ L  + Y  E  +MR   +  +V +ML             I
Sbjct: 55  TGRRTGGYQPTLWDFSTIQ-LFDSEYKEEKHLMRAAGMIAQV-NMLLQEEVDSIQRLELI 112

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
           D+L+RLG S HF+ EI+  L   Y                 DLY+TAL F++LRQ  F++
Sbjct: 113 DDLRRLGISCHFDREIVEILNSKYYTNNEIDES--------DLYSTALRFKLLRQYDFSV 164

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           SQEVFDCF + + + F  +L  D +GLL LYEASFLS
Sbjct: 165 SQEVFDCFKNDKGTDFKPSLVDDTRGLLQLYEASFLS 201



>gb:AF527416_1808381 Salvia stenophylla 3-carene synthase mRNA,
           complete cds.
          Length = 597

 Score =  105 bits (261), Expect = 8e-22
 Identities = 64/154 (41%), Positives = 82/154 (53%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RRSGNY P  WD  YIQSL++  Y  E    R  EL   VK +L             ID+
Sbjct: 51  RRSGNYSPSKWDVDYIQSLHSD-YKEERHTRRASELIMEVKKLLEKEPNPTRQLEL-IDD 108

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           LQ+LG S HF  E    L  +Y+                DLY+TAL FR+LRQ+GF ++Q
Sbjct: 109 LQKLGLSDHFNNEFKEILNSVYLDNKYYRNGAMKEVER-DLYSTALAFRLLRQHGFQVAQ 167

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +V +CF +  +  F  +L  D +GLL LYEASFL
Sbjct: 168 DVLECFKN-TKGEFEPSLSDDTRGLLQLYEASFL 200



>gb:AF497484_1805879 Arabidopsis thaliana monoterpene synthase mRNA,
           complete cds.
          Length = 598

 Score =  105 bits (261), Expect = 8e-22
 Identities = 64/156 (41%), Positives = 89/156 (57%), Gaps = 1/156 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX-ID 329
           RRSGNY+P +WD+SY+ S     Y  E  V+ R  LK++VK ML              ID
Sbjct: 47  RRSGNYQPSSWDHSYLLSTENK-YVNEKEVITRHVLKKKVKKMLEEVETKSRLEKLELID 105

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
           +LQ+LG SYHFE+EI   L + ++                DL+ATALEFR+LRQ+GF +S
Sbjct: 106 DLQKLGVSYHFEQEINNILTNFHLENGKNIWKCDKEE---DLHATALEFRLLRQHGFGVS 162

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +++FD  +D   S  N     +I  ++ LYEAS+LS
Sbjct: 163 EDIFDVIIDKIES--NTFKSDNITSIITLYEASYLS 196



>gb:AF175323_1774500 Mentha longifolia limonene synthase mRNA,
           complete cds.
          Length = 599

 Score =  105 bits (261), Expect = 8e-22
 Identities = 65/157 (41%), Positives = 84/157 (53%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX 323
           TT RRSGNY P  WD  +IQSL++  Y  +   +R  EL   VK M              
Sbjct: 55  TTERRSGNYNPSRWDVEFIQSLHSD-YEEDKHAIRASELVTLVK-MELEKETDHIRQLEL 112

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID+LQR+G S HF+ E    L  IY+                DLY+T+L FR+LR++GF 
Sbjct: 113 IDDLQRMGLSDHFQNEFKEILSSIYLDHHYYKNPFPKEER--DLYSTSLAFRLLREHGFQ 170

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           ++QEVFD F +     F  +L  D +GLL LYEASFL
Sbjct: 171 VAQEVFDSFKN-EEGEFKESLSDDTRGLLQLYEASFL 206



>gb:AF241793_1780129 Perilla frutescens strain 1 limonene synthase
           gene, complete cds.
          Length = 603

 Score =  103 bits (258), Expect = 2e-21
 Identities = 67/162 (41%), Positives = 83/162 (51%)
 Frame = +3

Query: 129 CYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           C    +  RRSGNY P  W+  YI  LN+ HY  +  + R  EL  +VK M+        
Sbjct: 53  CSLQASDQRRSGNYSPSFWNADYILLLNS-HYKDKSHMKRAGELIVQVK-MVMGKETDPV 110

Query: 309 XXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID+LQ+L  S+H E+EI   L  I                  DLY+TAL FR+LR
Sbjct: 111 VQLELIDDLQKLALSHHVEKEIKEILFKI-------STYDHKIMVERDLYSTALAFRLLR 163

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           Q GF + QEVFDCF +     F  +L  D KGLL LYEASFL
Sbjct: 164 QYGFKVPQEVFDCFKND-NGEFKRSLSSDTKGLLQLYEASFL 204



>gb:AF514289_1807412 Citrus limon (+)-limonene synthase 2 mRNA,
           complete cds.
          Length = 606

 Score =  103 bits (256), Expect = 3e-21
 Identities = 65/162 (40%), Positives = 90/162 (55%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXX 311
           Y      RRS NY+P  WD+ ++QSLN+ +YT E +  R +ELK +VK +          
Sbjct: 46  YDNLIVDRRSANYQPSIWDHDFLQSLNS-NYTDETYRRRAEELKGKVK-IAIKDVTEPLD 103

Query: 312 XXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID LQRLG +Y FE EI   L +IY                 +LYAT+LEFR+LRQ
Sbjct: 104 QLELIDNLQRLGLAYRFETEIRNILHNIY------NNNKDYVWRKENLYATSLEFRLLRQ 157

Query: 492 NGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +G+ +SQEVF+ F D +       +  D KG+L+L+EAS+ S
Sbjct: 158 HGYPVSQEVFNGFKDDQGG----FIFDDFKGILSLHEASYYS 195



>sp|Q8L5K3|RLC1_CITLI (R)-limonene synthase 1 (EC 4.2.3.20)
           ((+)-limonene synthase 1).>gb:AF514287_1807410 Citrus
           limon (+)-limonene synthase 1 mRNA, complete cds.
          Length = 606

 Score =  103 bits (256), Expect = 3e-21
 Identities = 64/162 (39%), Positives = 91/162 (56%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXX 311
           Y   T  RRS NY+P  WD+ ++QSLN+ +YT E +  R +EL+ +VK +          
Sbjct: 46  YDNLTVDRRSANYQPSIWDHDFLQSLNS-NYTDEAYKRRAEELRGKVK-IAIKDVIEPLD 103

Query: 312 XXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID LQRLG ++ FE EI   L +IY                 +LYAT+LEFR+LRQ
Sbjct: 104 QLELIDNLQRLGLAHRFETEIRNILNNIY------NNNKDYNWRKENLYATSLEFRLLRQ 157

Query: 492 NGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +G+ +SQEVF+ F D +       +  D KG+L+L+EAS+ S
Sbjct: 158 HGYPVSQEVFNGFKDDQGG----FICDDFKGILSLHEASYYS 195



>gb:AY316691_1598425 Pueraria montana var. lobata isoprene synthase
           (IspS) gene, complete cds.
          Length = 608

 Score =  102 bits (255), Expect = 4e-21
 Identities = 60/159 (37%), Positives = 91/159 (57%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T   +RRS NY+P  W++ ++QSL       E    +  +L+E V+ M+           
Sbjct: 56  TEHNSRRSANYQPNLWNFEFLQSLEND-LKVEKLEEKATKLEEEVRCMINRVDTQPLSLL 114

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             ID++QRLG +Y FE++I+ AL +I +                DL+ATAL FR+LRQ+G
Sbjct: 115 ELIDDVQRLGLTYKFEKDIIKALENIVLLDENKKNKS-------DLHATALSFRLLRQHG 167

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           F +SQ+VF+ F D +   F+  L  D++GLL+LYEAS+L
Sbjct: 168 FEVSQDVFERFKD-KEGGFSGELKGDVQGLLSLYEASYL 205



>gb:AY341431_1600759 Populus tremuloides isoprene synthase (IspS)
           gene, complete cds.
          Length = 595

 Score =  101 bits (252), Expect = 9e-21
 Identities = 70/184 (38%), Positives = 90/184 (48%)
 Frame = +3

Query: 66  TYKLSCLPSIHRSHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVM 245
           T KL C  S        SFS    T T TRRS NYEP +WDY Y+ S +T   + E    
Sbjct: 33  TLKLRCSVSTENV----SFS---ETETETRRSANYEPNSWDYDYLLSSDTDE-SIEVHKD 84

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           +  +L+  V+  +             ID +QRLG  Y FE +I  AL             
Sbjct: 85  KAKKLEAEVRREINNEKAEFLTLLELIDNVQRLGLGYRFESDIRRAL------DRFVSSG 138

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                    L+ TAL FR+LRQ+GF +SQE F  F D +   F  NL +DIK +L+LYEA
Sbjct: 139 GFDGVTKTSLHGTALSFRLLRQHGFEVSQEAFSGFKD-QNGNFLENLKEDIKAILSLYEA 197

Query: 606 SFLS 617
           SFL+
Sbjct: 198 SFLA 201



>gb:CTE457070_1674203 Cinnamomum tenuipilum mRNA for geraniol
           synthase (GerS gene).
          Length = 603

 Score =  101 bits (251), Expect = 1e-20
 Identities = 64/171 (37%), Positives = 90/171 (52%)
 Frame = +3

Query: 105 HAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDML 284
           H   S +   ++TT  RRSGNY+P  WDY ++QSL  + Y  E    R  +LKE VK +L
Sbjct: 35  HISCSTTTPTYSTTVPRRSGNYKPSIWDYDFVQSLG-SGYKVEAHGTRVKKLKEVVKHLL 93

Query: 285 XXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYAT 464
                        ID+L+RLG  + F+ EI   L  I                  DL+A 
Sbjct: 94  -KETDSSLAQIELIDKLRRLGLRWLFKNEIKQVLYTI-------SSDNTSIEMRKDLHAV 145

Query: 465 ALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +  FR+LRQ+G+ +S +VF+ F D  +  F  +L  DIKG+L+LYEAS L+
Sbjct: 146 STRFRLLRQHGYKVSTDVFNDFKD-EKGCFKPSLSMDIKGMLSLYEASHLA 195



>gb:AY766248_1627648 Medicago truncatula wound-inducible putative
           chloroplast terpene synthase 4 mRNA, complete cds;
           nuclear gene for chloroplast product.
          Length = 580

 Score =  101 bits (251), Expect = 1e-20
 Identities = 68/173 (39%), Positives = 93/173 (53%), Gaps = 2/173 (1%)
 Frame = +3

Query: 105 HAESSFSMCYHTTTTT--RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKD 278
           H   S  +CY T T    R+S NY+P  W+Y  +QSL   +  A  +V R   L+E VK 
Sbjct: 27  HRNGSPLLCYATNTNVSQRKSANYQPNIWNYDILQSLKHDYEDAR-YVDRSRRLQEEVKR 85

Query: 279 MLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLY 458
           M+             ID +++LG SYHFEEEI  AL D ++                 L+
Sbjct: 86  MIKDENVNILEL---IDTVKQLGLSYHFEEEIGEAL-DRFLSLEKCSGRNNFGRS---LH 138

Query: 459 ATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
            TAL FR+LR+ G++IS ++F+ F D     F   L QDIKG+L+LY+ASFLS
Sbjct: 139 ETALRFRLLREYGYDISPDIFEKFKD-HNGNFKACLVQDIKGMLSLYDASFLS 190



>gb:AF271259_1782138 Perilla frutescens mercene synthase mRNA,
           complete cds.
          Length = 608

 Score =  100 bits (250), Expect = 1e-20
 Identities = 68/194 (35%), Positives = 92/194 (47%), Gaps = 20/194 (10%)
 Frame = +3

Query: 93  IHRSHAESSFSMCYHTTTTTR--------------------RSGNYEPPTWDYSYIQSLN 212
           +H S + +S  +C  ++T+TR                    RSGNY P  W+  YI SLN
Sbjct: 18  LHNSGSSNSSKLCGVSSTSTRAATARLRLRLRCSMQLSDQRRSGNYSPSFWNTDYILSLN 77

Query: 213 TTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMD 392
             +           EL E+VK ML             ID LQ+L  S+HFE+E    L +
Sbjct: 78  CDYEDERRMRGAAGELVEQVK-MLMEKETDPIVQLELIDVLQKLALSHHFEKEFEGILFN 136

Query: 393 IYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQ 572
           I                  DLY+T L FR+LRQ+G+ + QE+F+CF +  +  F  +L  
Sbjct: 137 I-------STIYDDKNRERDLYSTTLAFRLLRQHGYQVPQELFECFKND-KGEFKESLSN 188

Query: 573 DIKGLLNLYEASFL 614
           D KGLL LYEASFL
Sbjct: 189 DTKGLLQLYEASFL 202



>gb:AF154124_1772922 Artemisia annua (3R)-linalool synthase (QH5)
           mRNA, complete cds.
          Length = 583

 Score =  100 bits (249), Expect = 2e-20
 Identities = 69/178 (38%), Positives = 93/178 (52%), Gaps = 10/178 (5%)
 Frame = +3

Query: 114 SSFSMCYHTTTT----------TRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELK 263
           ++++  Y T TT           RRS NYEP +W + +IQSL ++ YT +  V R + LK
Sbjct: 22  TAYNRIYSTKTTGITVDVAESHVRRSANYEPSSWSFDHIQSL-SSKYTGDDCVARANTLK 80

Query: 264 ERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXX 443
           E VK M+             +DELQRLG SY FE EI   L  IY               
Sbjct: 81  ESVKTMI-RKEGNLLRTLELVDELQRLGISYLFEGEISNLLETIY----YNHYKFPEKWN 135

Query: 444 XXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
             DL   AL FR+LRQ+G+++ QE+F  F D +    N  L +D+ G+LNLYEAS+ S
Sbjct: 136 KFDLNLKALGFRLLRQHGYHVPQEIFLNFKD-KNQNLNSYLLEDVVGMLNLYEASYHS 192



>gb:PAL294819_1698712 Populus alba x Populus tremula mRNA for
           isoprene synthase (ispS gene).
          Length = 595

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 60/160 (37%), Positives = 82/160 (51%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T T  RRS NYEP +WDY ++ S +T   + E +  +  +L+  V+  +           
Sbjct: 50  TETEARRSANYEPNSWDYDFLLSSDTDE-SIEVYKDKAKKLEAEVRREINNEKAEFLTLL 108

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             ID +QRLG  Y FE +I  AL                      L+ATAL FR+LRQ+G
Sbjct: 109 ELIDNVQRLGLGYRFESDIRRAL------DRFVSSGGFDGVTKTSLHATALSFRLLRQHG 162

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           F +SQE F  F D +   F  NL +D K +L+LYEASFL+
Sbjct: 163 FEVSQEAFSGFKD-QNGNFLENLKEDTKAILSLYEASFLA 201



>gb:AB110641_1527003 Citrus unshiu CitMTSL62 mRNA for beta-pinene
           synthase, complete cds.
          Length = 602

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 64/162 (39%), Positives = 86/162 (53%), Gaps = 5/162 (3%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXX--- 314
           T  RRS +Y P  W + YIQSL++  Y  E +  + ++LKE+V  ML             
Sbjct: 53  TIIRRSADYGPTIWSFDYIQSLDSK-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLH 111

Query: 315 -XXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID L RLG SYHFE+EI   L  I+                 +LYATAL+FR+LRQ
Sbjct: 112 QLELIDNLHRLGVSYHFEDEIKRTLDRIH-----------NKNTNENLYATALKFRILRQ 160

Query: 492 NGFNIS-QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            G+N   +E F  FMD + S  + + G D KG+L LYEA++L
Sbjct: 161 YGYNTPVKETFSRFMDEKGSFKSSSHGDDCKGMLALYEAAYL 202



>gb:AF154125_1772923 Artemisia annua (3R)-linalool synthase (QH1)
           mRNA, partial cds.
          Length = 567

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 63/158 (39%), Positives = 86/158 (54%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX 323
           T  RRS NY+P +W + +IQSL++  YT + +V R + LK+ VK M+             
Sbjct: 26  THVRRSANYKPSSWSFDHIQSLSSK-YTGDDYVARANTLKDAVKTMIRKSGNSLRTLEL- 83

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +DELQRLG SY FEEEI   L  IY                 +L   AL FR+LRQ+G++
Sbjct: 84  VDELQRLGISYLFEEEISNLLETIY----YNYYKFPENWNKINLNLKALGFRLLRQHGYH 139

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           + QE+F  F D +    N  L  D+  +LNLYEAS+ S
Sbjct: 140 VPQEIFLNFKD-KNQNLNSYLLNDVVEMLNLYEASYHS 176



>gb:AF514288_1807411 Citrus limon (-)-beta-pinene synthase mRNA,
           complete cds.
          Length = 602

 Score = 95.9 bits (237), Expect = 5e-19
 Identities = 63/162 (38%), Positives = 84/162 (51%), Gaps = 5/162 (3%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX 323
           T  RRS +Y P  W + YIQSL++  Y  E +  + ++LKE+V  ML             
Sbjct: 53  TIIRRSADYGPTIWSFDYIQSLDSK-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDTLH 111

Query: 324 ----IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID L RLG SYHFE+EI   L  I+                  LYATAL+FR+LRQ
Sbjct: 112 QLELIDNLHRLGVSYHFEDEIKRTLDRIH-----------NKNTNKSLYATALKFRILRQ 160

Query: 492 NGFNIS-QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            G+N   +E F  FMD + S  + +   D KG+L LYEA++L
Sbjct: 161 YGYNTPVKETFSRFMDEKGSFKSSSHSDDCKGMLALYEAAYL 202



>gb:AB110640_1527002 Citrus unshiu CitMTSL61 mRNA for
           gamma-terpinene synthase, complete cds.
          Length = 600

 Score = 95.9 bits (237), Expect = 5e-19
 Identities = 63/162 (38%), Positives = 85/162 (52%), Gaps = 5/162 (3%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXX--- 314
           T  RRS +Y P  W + YIQSL++  Y  E +  + ++LKE+V  ML             
Sbjct: 53  TIIRRSADYGPTIWSFDYIQSLDSK-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLH 111

Query: 315 -XXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID L RLG SYHFE+EI   L  I+                 +LYATAL+FR+LRQ
Sbjct: 112 QLELIDNLHRLGVSYHFEDEIKRTLDRIH-----------NKNTNENLYATALKFRILRQ 160

Query: 492 NGFNIS-QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            G+N   +E F  FMD + S  + +   D KG+L LYEA++L
Sbjct: 161 YGYNTPVKETFSHFMDEKGSFKSSSHSDDCKGMLALYEAAYL 202



>gb:AF276072_1782622 Artemisia annua (-)-beta-pinene synthase (QH6)
           mRNA, complete cds.
          Length = 582

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 61/160 (38%), Positives = 83/160 (51%), Gaps = 2/160 (1%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXX--XXXX 317
           TT RRS NY P  W Y ++QSL ++ Y  + ++ R   LK  V+ M+             
Sbjct: 45  TTNRRSANYAPSLWSYDFVQSL-SSKYKGDNYMARSRALKGVVRTMILEANGIENPLSLL 103

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             +D+LQRLG SYHF +EI   L  IY+                DL   +L FR+LRQ+G
Sbjct: 104 NLVDDLQRLGISYHFLDEISNVLEKIYL----NFYKSPEKWTNMDLNLRSLGFRLLRQHG 159

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           ++I QE+F  F+D      N N   DI  +LNLYEAS+ S
Sbjct: 160 YHIPQEIFKDFID-----VNGNFKGDIISMLNLYEASYHS 194



>gb:AY693646_1623444 Ocimum basilicum alpha-zingiberene synthase
           (ZIS) mRNA, complete cds.
          Length = 541

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 58/156 (37%), Positives = 85/156 (54%)
 Frame = +3

Query: 150 TRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXID 329
           +RRS NY+   WD ++IQSL  + Y  E +  + ++LK  VK M+             ID
Sbjct: 3   SRRSANYQASIWDDNFIQSL-ASPYAGEKYAEKAEKLKTEVKTMIDQTRDELKQLEL-ID 60

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            LQRLG  +HF++     L  IY                  L+ TAL FR+LRQ+G+++ 
Sbjct: 61  NLQRLGICHHFQDLTKKILQKIY---GEERNGDHQHYKEKGLHFTALRFRILRQDGYHVP 117

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           Q+VF  FM+ +   F  +L +D KGL++LYEAS+LS
Sbjct: 118 QDVFSSFMN-KAGDFEESLSKDTKGLVSLYEASYLS 152



>gb:AY575970_1615894 Lotus corniculatus var. japonicus
           E-beta-ocimene synthase (EBOS) mRNA, complete cds.
          Length = 595

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 60/177 (33%), Positives = 94/177 (53%), Gaps = 4/177 (2%)
 Frame = +3

Query: 99  RSHAESSFSMCYHTTTTT----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKE 266
           + H  +S   CY +T++T    R+S NY+P  W+Y Y+QSL   +  A    M + +L+E
Sbjct: 34  QGHRINSPIPCYASTSSTSVSQRKSANYQPNIWNYDYLQSLKLGYADAHYEDMAK-KLQE 92

Query: 267 RVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXX 446
            V+ ++             ID+++RLG  YHFE+EI   L                    
Sbjct: 93  EVRRIIKDDKAEIWTTLELIDDVKRLGLGYHFEKEIREVL---------NKFLSLNTCVH 143

Query: 447 XDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
             L  TAL FR+LR+ G ++S ++F+ F+D +   F  +L  ++KG+L+LYEASFLS
Sbjct: 144 RSLDKTALCFRLLREYGSDVSADIFERFLD-QNGNFKTSLVNNVKGMLSLYEASFLS 199



>gb:AY279379_1594619 Melaleuca alternifolia putative monoterpene
           synthase mRNA, complete cds.
          Length = 583

 Score = 94.4 bits (233), Expect = 1e-18
 Identities = 60/160 (37%), Positives = 81/160 (50%), Gaps = 5/160 (3%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSL-----NTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           RRS NY+P  W Y+Y+QSL       +    E    +   L+E V+  L           
Sbjct: 38  RRSANYQPSVWTYNYLQSLVADDIRRSRREVEQEREKAQILEEDVRGALNDGNAEPMAIF 97

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             +D++QRLG   +FEE+I  AL                      L+ TAL FRVLRQ+G
Sbjct: 98  ALVDDIQRLGLGRYFEEDISKALRRCL------SQYAVTGSLQKSLHGTALSFRVLRQHG 151

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           F +SQ+VF  FMD   S F   LG D++G+L+LYEAS L+
Sbjct: 152 FEVSQDVFKIFMDESGS-FMKTLGGDVQGMLSLYEASHLA 190



>gb:AF542544_1810170 Nicotiana attenuata 5-epi-aristolochene
           synthase mRNA, complete cds.
          Length = 548

 Score = 92.8 bits (229), Expect = 4e-18
 Identities = 55/152 (36%), Positives = 78/152 (51%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   ++ P  W   ++ S +  ++ A+ +    + LKE+ + ML             ID 
Sbjct: 15  RPVADFSPSLWGDHFL-SFSIDNHVAQKYAQEIEPLKEQTRSMLVATGRKLVDTLNLIDT 73

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           ++RLG SYHFE+EI   L  IY                 DL+ +AL FR+LRQ+GFNIS 
Sbjct: 74  IERLGISYHFEKEIDEILDQIY----------NQNSNSSDLFTSALLFRLLRQHGFNISP 123

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           E+F  F D    +F  +L  D+ GLLNLYEAS
Sbjct: 124 EIFSKFQD-ENGKFKESLASDVVGLLNLYEAS 154



>gb:CQ813506_1453487 Sequence 2 from Patent WO2004031376.
          Length = 562

 Score = 92.4 bits (228), Expect = 5e-18
 Identities = 57/156 (36%), Positives = 81/156 (51%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI 326
           +TRRS NY P  W   ++Q    T  T +G  ++  ELK+ ++ ML             I
Sbjct: 20  STRRSANYHPSIWGDHFLQYTCDTQETDDGSNVKHLELKKEIRRMLKADNKPSRTLQL-I 78

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
           D +QRLG SYHFE EI   L  ++                 +LY  +L FR+LRQNG+ I
Sbjct: 79  DAIQRLGVSYHFESEIDEILGKMHKASQDSDLCDNEND---ELYYISLHFRLLRQNGYKI 135

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           S +VF  F D     F  +L +D++G+L+LYEA+ L
Sbjct: 136 SADVFKKFKD-TDGNFKTSLAKDVRGMLSLYEATHL 170



>sp|Q40577|5EAS_TOBAC Aristolchene synthase (EC 4.2.3.9)
           (5-epi-aristolochene synthase) (EAS).
          Length = 548

 Score = 92.4 bits (228), Expect = 5e-18
 Identities = 57/165 (34%), Positives = 83/165 (50%)
 Frame = +3

Query: 114 SSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXX 293
           +S ++  +     R   ++ P  W   ++ S +  +  AE +    + LKE+ ++ML   
Sbjct: 2   ASAAVANYEEEIVRPVADFSPSLWGDQFL-SFSIDNQVAEKYAKEIEALKEQTRNMLLAT 60

Query: 294 XXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALE 473
                     ID ++RLG SYHFE+EI   L  IY                 DL  +AL+
Sbjct: 61  GMKLADTLNLIDTIERLGISYHFEKEIDDILDQIY----------NQNSNCNDLCTSALQ 110

Query: 474 FRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           FR+LRQ+GFNIS E+F  F D    +F  +L  D+ GLLNLYEAS
Sbjct: 111 FRLLRQHGFNISPEIFSKFQD-ENGKFKESLASDVLGLLNLYEAS 154



>gb:AF484125_1804056 Nicotiana attenuata 5-epi-aristolochene
           synthase 37 mRNA, complete cds.
          Length = 548

 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 55/165 (33%), Positives = 82/165 (49%)
 Frame = +3

Query: 114 SSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXX 293
           +S ++  +     R   ++ P  W   ++ S +  +  AE +    + LKE+ + ML   
Sbjct: 2   ASAAVANYEEEIVRPVADFSPSLWGDQFL-SFSIDNQIAEKYAQEIEALKEQTRSMLLAT 60

Query: 294 XXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALE 473
                     ID ++RLG +YHFE+EI   L  IY                 DL  +AL+
Sbjct: 61  ARKLADTLNLIDTIERLGIAYHFEKEIDEILDQIY----------NQNSTFDDLCTSALQ 110

Query: 474 FRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           FR+LRQ+GFNIS ++F  F D    +F  +L  D+ GLLNLYEAS
Sbjct: 111 FRLLRQHGFNISPQIFSKFQD-ENGKFKESLASDVLGLLNLYEAS 154



>gb:AF484123_1804054 Nicotiana attenuata 5-epi-aristolochene
           synthase 12 mRNA, complete cds.
          Length = 548

 Score = 89.4 bits (220), Expect = 4e-17
 Identities = 56/152 (36%), Positives = 76/152 (50%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   ++ P  W   ++ S +  +  AE +    + LKE+ + ML             ID 
Sbjct: 15  RPVADFSPSLWGDQFL-SFSIENQVAEKYAQEIEALKEQTRSMLLENGRKLADTLYLIDI 73

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           ++RLG SYHFE+EI   L  IY                 DL  +AL+FR+LRQ+GFNIS 
Sbjct: 74  IERLGISYHFEKEIDDILDQIY----------NQNSNCNDLCTSALQFRLLRQHGFNISP 123

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           E+F  F D    +F  +L  D  GLLNLYEAS
Sbjct: 124 EIFSKFQD-ENGKFKESLASDFLGLLNLYEAS 154



>gb:AY438099_1606225 Populus balsamifera subsp. trichocarpa x
           Populus deltoides (-)-germacrene D synthase (Tps1) mRNA,
           complete cds.
          Length = 561

 Score = 89.4 bits (220), Expect = 4e-17
 Identities = 57/165 (34%), Positives = 79/165 (47%)
 Frame = +3

Query: 120 FSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXX 299
           FS        +RRS  Y P  W   ++     +  T++       +LKE VK  L     
Sbjct: 9   FSTATVEPNVSRRSAGYSPSIWGDHFLSYATDSMETSDK--AEHKKLKEEVKRELMANIN 66

Query: 300 XXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFR 479
                   ID +QRLG SYHFE EI   L ++Y                 DLYA +L+FR
Sbjct: 67  KPSQTLDFIDAIQRLGISYHFEIEIDEILREMYKSHCDFDNGDDDDHHHNDLYAISLKFR 126

Query: 480 VLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +LRQ G+ IS +VF  F +  +  FN +L  D +G+L+LYEA+ L
Sbjct: 127 LLRQQGYKISCDVFGKFKNS-QGTFNDSLANDTRGILSLYEATHL 170



>gb:AY640155_1618969 Cucumis sativus beta-caryophyllene synthase
           mRNA, complete cds.
          Length = 567

 Score = 89.0 bits (219), Expect = 6e-17
 Identities = 54/172 (31%), Positives = 84/172 (48%), Gaps = 1/172 (0%)
 Frame = +3

Query: 102 SHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR-DELKERVKD 278
           SH  +S         T R   N+ P  W   ++          +G +  R ++LKE ++ 
Sbjct: 3   SHFPASIMKTNDIYDTKRSLANFHPTIWKEHFLSFTFDDALKVDGGMKERIEKLKEEIRM 62

Query: 279 MLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLY 458
           M+             +D +QRLG SYHFE+EI   L  +Y+                DL+
Sbjct: 63  MVIASVQNPLVKLNLVDSIQRLGVSYHFEDEIDQFLEHMYVSYNNSLLFSSNDSQDDDLH 122

Query: 459 ATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +AL FR+LRQ+G+ IS ++F  FMD    +F  +L +D +G+L+LYEAS +
Sbjct: 123 ISALLFRLLRQHGYRISCDIFLKFMD-NNGKFKESLVEDERGILSLYEASHM 173



>pir|T03714|T03714 5-epi-aristolochene synthase - common
           tobacco>gb:TOBSQPC_1725547 Nicotiana tabacum
           5-epi-aristolochene gene, complete cds.
          Length = 550

 Score = 89.0 bits (219), Expect = 6e-17
 Identities = 57/167 (34%), Positives = 84/167 (50%), Gaps = 2/167 (1%)
 Frame = +3

Query: 114 SSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRD--ELKERVKDMLX 287
           +S ++  +     R   ++ P  W   ++ S +  +  AE ++  ++   LKE+ + ML 
Sbjct: 2   ASAAVANYEEEIVRPVADFSPSLWGDQFL-SFSIDNQVAEKYIYAQEIEALKEQTRSMLL 60

Query: 288 XXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATA 467
                       ID ++RLG SYHFE+EI   L  IY                 DL  +A
Sbjct: 61  ATGRKLADTLNLIDIIERLGISYHFEKEIDEILDQIY----------NQNSNCNDLCTSA 110

Query: 468 LEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           L+FR+LRQ+GFNIS E+F  F D    +F  +L  D+ GLLNLYEAS
Sbjct: 111 LQFRLLRQHGFNISPEIFSKFQD-ENGKFKESLASDVLGLLNLYEAS 156



>gb:AK118969_1816915 Arabidopsis thaliana At4g16740 mRNA for
           putative limonene cyclase, complete cds, clone:
           RAFL21-30-G19.
          Length = 144

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 52/121 (42%), Positives = 66/121 (54%)
 Frame = +3

Query: 150 TRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXID 329
           +RRS NY+P  W + Y+ SL  T Y  E  V R   LK+ V  ML             ID
Sbjct: 25  SRRSANYQPSLWQHEYLLSLGNT-YVKEDNVERVTLLKQEVSKMLDETEGLLEQLEL-ID 82

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            LQRLG SYHFE+EI   L ++++                DLYATALEFR+LRQ+GF+I+
Sbjct: 83  TLQRLGVSYHFEQEIKKTLTNVHVKNVRAHKNRIDRNRWGDLYATALEFRLLRQHGFSIA 142

Query: 510 Q 512
           Q
Sbjct: 143 Q 143



>gb:AF514286_1807409 Citrus limon gamma-terpinene synthase mRNA,
           complete cds.
          Length = 600

 Score = 87.8 bits (216), Expect = 1e-16
 Identities = 60/162 (37%), Positives = 81/162 (50%), Gaps = 5/162 (3%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXX--- 314
           T  RRS +Y P  W + YIQSL++  Y  E +  + ++LKE+V  ML             
Sbjct: 53  TIIRRSADYGPTIWSFDYIQSLDSK-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLH 111

Query: 315 -XXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               ID L RLG SYHFE+EI   L  I+                  LYA AL+FR+LRQ
Sbjct: 112 QLELIDNLHRLGVSYHFEDEIKRTLDRIH-----------NKNTNKSLYARALKFRILRQ 160

Query: 492 NGFNIS-QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            G+    +E F  FMD + S    +   + KG+L LYEA++L
Sbjct: 161 YGYKTPVKETFSRFMDEKGSFKLSSHSDECKGMLALYEAAYL 202



>gb:AF484124_1804055 Nicotiana attenuata 5-epi-aristolochene
           synthase 34 mRNA, complete cds.
          Length = 548

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 53/152 (34%), Positives = 76/152 (50%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   ++ P  W   ++ S +  +  AE +    + LKE+ + ML             ID 
Sbjct: 15  RPVADFSPSLWGDHFL-SFSIDNQVAEKYAQEIEPLKEQTRSMLLATGRKLADTLNLIDT 73

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           ++RLG SY+FE+EI   L  IY                 D   +AL+FR+LRQ+GFNIS 
Sbjct: 74  IERLGISYYFEKEIDEILDHIY----------NQNSNCNDFCTSALQFRLLRQHGFNISP 123

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++F  F D    +F  +L  D+ GLLNLYEAS
Sbjct: 124 QIFSKFQD-ENGKFRESLASDVLGLLNLYEAS 154



>gb:AF174294_1774470 Gossypium arboreum (+)-delta-cadinene sythase
           (CAD1-C1) gene, complete cds.
          Length = 508

 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 52/154 (33%), Positives = 78/154 (50%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   +++P  W   ++   +       G   R  +LKE V+ M+             ID 
Sbjct: 22  RPKADFQPSIWGDFFLNCPDKN--IDAGTEKRHQQLKEEVRKMIVAPMANSTQKLAFIDS 79

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           LQRLG SYHF +EI   L +IY                 DLY T+L FR+LR++G+N+S 
Sbjct: 80  LQRLGVSYHFTKEIEDELENIY---------HNNNDAENDLYTTSLRFRLLREHGYNVSC 130

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF+ F D  +  F  ++  D++GLL LY+AS+L
Sbjct: 131 DVFNKFKD-EQGNFKSSVTLDVRGLLELYQASYL 163



>gb:AF270425_1782068 Gossypium hirsutum (+)-delta-cadinene synthase
           (cdn2) mRNA, partial cds.
          Length = 551

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 53/155 (34%), Positives = 79/155 (50%), Gaps = 1/155 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR-DELKERVKDMLXXXXXXXXXXXXXID 329
           R   +++P  W   +   LN      +    +R  +LKE V+ M+             ID
Sbjct: 19  RPKADFQPSIWGDFF---LNCPDKNIDAETQKRHQQLKEEVRKMIVAPMANSTQKLAFID 75

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            +QRLG SYHF +EI   L +IY                 DLY T+L FR+LR++GFN+S
Sbjct: 76  SVQRLGVSYHFTKEIEDELENIY---------HNNNDAENDLYTTSLRFRLLREHGFNVS 126

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +VF+ F D  +  F  ++  D++GLL LY+AS+L
Sbjct: 127 CDVFNKFKD-EQGNFKSSVTSDVRGLLELYQASYL 160



>gb:GAR18484_1679606 Gossypium arboreum cad1-A gene.
          Length = 555

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 55/158 (34%), Positives = 81/158 (51%)
 Frame = +3

Query: 141 TTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX 320
           ++  R   ++ P  W   +I   +T    A    ++ +ELK +V+ M+            
Sbjct: 17  SSENRPKADFHPGIWGDMFIICPDTDIDAATE--LQYEELKAQVRKMIMEPVDDSNQKLP 74

Query: 321 XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGF 500
            ID +QRLG SYHFE+EI   L +IY                 DLY TAL FR+LR++GF
Sbjct: 75  FIDAVQRLGVSYHFEKEIEDELENIY-------RDTNNNDADTDLYTTALRFRLLREHGF 127

Query: 501 NISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +IS + F+ F D     F  +L  D++GLL LYEAS++
Sbjct: 128 DISCDAFNKFKD-EAGNFKASLTSDVQGLLELYEASYM 164



>gb:AB110639_1527001 Citrus unshiu CitMTSL3 mRNA for gamma-terpinene
           synthase, complete cds.
          Length = 600

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 62/170 (36%), Positives = 82/170 (48%), Gaps = 13/170 (7%)
 Frame = +3

Query: 144 TTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXX--- 314
           T  RRS +Y P  W + YIQSL++  Y  E +  + ++LKE+V  ML             
Sbjct: 53  TIIRRSADYGPTIWSFDYIQSLDSK-YKGESYARQLEKLKEQVSAMLQQDNKVVDLDPLH 111

Query: 315 -XXXIDELQRLGCSYHFEEEIMAA--------LMDIYMXXXXXXXXXXXXXXXXDLYATA 467
               ID L RLG SYHFE+EI           LM IYM                     A
Sbjct: 112 QLELIDNLHRLGVSYHFEDEIKRTLDRIHNKNLMKIYM-------------------PQA 152

Query: 468 LEFRVLRQNGFNIS-QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           L+FR+LRQ G+N   +E F  FMD + S  + +   D KG+L LYEA++L
Sbjct: 153 LKFRILRQYGYNTPVKETFSHFMDEKGSFKSSSHSDDCKGMLALYEAAYL 202



>sp|Q43714|DCS3_GOSAR (+)-delta-cadinene synthase isozyme A (EC
           4.2.3.13) (D-cadinene synthase).>gb:GACADSYNH_1679589
           Gossypium arboreum mRNA for cadinene synthase (cad1-A
           gene).>gb:GAU27535_1679629 Gossypium arboreum
           (+)-delta-cadinene synthase isozyme A mRNA, complete
           cds.
          Length = 555

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 55/158 (34%), Positives = 81/158 (51%)
 Frame = +3

Query: 141 TTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX 320
           ++  R   ++ P  W   +I   +T    A    ++ +ELK +V+ M+            
Sbjct: 17  SSENRPKADFHPGIWGDMFIICPDTDIDAATE--LQYEELKAQVRKMIMEPVDDSNQKLP 74

Query: 321 XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGF 500
            ID +QRLG SYHFE+EI   L +IY                 DLY TAL FR+LR++GF
Sbjct: 75  FIDAVQRLGVSYHFEKEIEDELENIY-------RDTNNNDADTDLYTTALRFRLLREHGF 127

Query: 501 NISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +IS + F+ F D     F  +L  D++GLL LYEAS++
Sbjct: 128 DISCDAFNKFKD-EAGNFKASLTSDVQGLLELYEASYM 164



>gb:AY087142_1572177 Arabidopsis thaliana clone 32194 mRNA, complete
           sequence.
          Length = 164

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 50/121 (41%), Positives = 70/121 (57%), Gaps = 1/121 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDML-XXXXXXXXXXXXXID 329
           RRSGNY+P +WD+SY+ S+    Y  E  V+ R  LK++VK ML              ID
Sbjct: 47  RRSGNYQPSSWDHSYLLSIE-NKYVNEKEVITRHVLKKKVKKMLEEVETKSRLEKLELID 105

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
           +LQ+LG SYHFE+EI   L + ++                DL+ATAL+FR+LRQ+GF +S
Sbjct: 106 DLQKLGVSYHFEQEINTILTNFHL---ENGKNIWKCDKEEDLHATALQFRLLRQHGFGVS 162

Query: 510 Q 512
           +
Sbjct: 163 E 163



>gb:AY085646_1570714 Arabidopsis thaliana clone 16525 mRNA, complete
           sequence.
          Length = 144

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 51/121 (42%), Positives = 65/121 (53%)
 Frame = +3

Query: 150 TRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXID 329
           +R S NY+P  W + Y+ SL  T Y  E  V R   LK+ V  ML             ID
Sbjct: 25  SRLSANYQPSLWQHEYLLSLGNT-YVKEDNVERVTLLKQEVSKMLNETEGLLEQLEL-ID 82

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            LQRLG SYHFE+EI   L ++++                DLYATALEFR+LRQ+GF+I+
Sbjct: 83  TLQRLGVSYHFEQEIKKTLTNVHVKNVRAHKNRIDRNRWGDLYATALEFRLLRQHGFSIA 142

Query: 510 Q 512
           Q
Sbjct: 143 Q 143



>sp|O49853|DCS4_GOSAR (+)-delta-cadinene synthase isozyme C2 (EC
           4.2.3.13) (D-cadinene synthase).>gb:GACAD1C2_1679587
           Gossypium arboreum mRNA for (+)-delta-cadinene synthase.
          Length = 554

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 51/154 (33%), Positives = 78/154 (50%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   +++P  W   ++   +       G   R  +LKE V+ M+             ID 
Sbjct: 22  RPKADFQPSIWGDFFLNCPDKN--IDAGTEKRHQQLKEEVRKMIVAPMANSTQKLAFIDS 79

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +QRLG SYHF +EI   L +IY                 DLY T+L FR+LR++G+N+S 
Sbjct: 80  VQRLGVSYHFTKEIEDELENIY---------HNNNDAENDLYTTSLRFRLLREHGYNVSC 130

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF+ F D  +  F  ++  D++GLL LY+AS+L
Sbjct: 131 DVFNKFKD-EQGNFKSSVTSDVQGLLELYQASYL 163



>sp|Q39760|DCS2_GOSAR (+)-delta-cadinene synthase isozyme XC14 (EC
           4.2.3.13) (D-cadinene synthase).>pir|S68366|S68366
           (+)-delta-cadinene synthase isozyme XC14 - Gossypium
           arboreum>gb:GAU23205_1679624 Gossypium arboreum
           (+)-delta-cadinene synthase isozyme XC14 mRNA, complete
           cds.
          Length = 554

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 48/123 (39%), Positives = 68/123 (55%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           R  +LKE V+ M+             ID +QRLG SYHF +EI   L +IY         
Sbjct: 51  RHQQLKEEVRKMIVAPMANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIY--------- 101

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                   DLY T+L FR+LR++GFN+S +VF+ F D  +  F  ++  D++GLL LY+A
Sbjct: 102 HNNNDAENDLYTTSLRFRLLREHGFNVSCDVFNKFKD-EQGNFKSSVTSDVRGLLELYQA 160

Query: 606 SFL 614
           S+L
Sbjct: 161 SYL 163



>gb:AGU87910_1811078 Abies grandis (-)-camphene synthase (AG6.5)
           mRNA, complete cds.
          Length = 618

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 60/192 (31%), Positives = 89/192 (46%), Gaps = 13/192 (6%)
 Frame = +3

Query: 81  CLPSIHRSHAESSFSMCYHTTTTT----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMR 248
           C P    +H   S +MC  +  +T    RR GNY    WD  +IQSL +T Y A  +  R
Sbjct: 34  CRPGKSVAH---SINMCLTSVASTDSVQRRVGNYHSNLWDDDFIQSLISTPYGAPDYRER 90

Query: 249 RDELKERVKDM------LXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXX 410
            D L   VKD+      L             +D+++RLG   HF++EI  AL  +     
Sbjct: 91  ADRLIGEVKDIMFNFKSLEDGGNDLLQRLLLVDDVERLGIDRHFKKEIKTALDYVNSYWN 150

Query: 411 XXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGR---RSRFNVNLGQDIK 581
                        DL +TAL  R LR +G+ +S +V + F D      S  N+ +  +I+
Sbjct: 151 EKGIGCGRESVVTDLNSTALGLRTLRLHGYTVSSDVLNVFKDKNGQFSSTANIQIEGEIR 210

Query: 582 GLLNLYEASFLS 617
           G+LNL+ AS ++
Sbjct: 211 GVLNLFRASLVA 222



>gb:AY561842_1614989 Vitis vinifera clone VitiM1610 terpene synthase
           mRNA, complete cds.
          Length = 557

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 47/152 (30%), Positives = 73/152 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RR  N+ P  W   ++   +    T +       +LKE V+ ML             ID 
Sbjct: 22  RRCANFHPSIWGDHFLSYASEFTNTDDHLKQHVQQLKEEVRKMLMAADDDSAQKLLLIDA 81

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +QRLG +YHFE EI   L  ++                 D+Y  +L FR+LRQ G+++S 
Sbjct: 82  IQRLGVAYHFESEIDEVLKHMF--------DGSVVSAEEDVYTASLRFRLLRQQGYHVSC 133

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++F+ F D     F  +L  D++G+L+LYEA+
Sbjct: 134 DLFNNFKD-NEGNFKESLSSDVRGMLSLYEAT 164



>sp|P59287|CASS_RICCO Casbene synthase, chloroplast precursor (EC
           4.2.3.8).
          Length = 601

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 62/174 (35%), Positives = 81/174 (46%), Gaps = 1/174 (0%)
 Frame = +3

Query: 99  RSHAESSFSMCYHTTTTTR-RSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVK 275
           +SH +     C  +TT    R   Y PPT   +   SL       E +  R   LK++VK
Sbjct: 44  KSHFKKPTQACLSSTTHQEVRPLAYFPPTVWGNRFASLTFNPSEFESYDERVIVLKKKVK 103

Query: 276 DMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDL 455
           D+L             ID L RLG SYHFE +I   L  I+                 DL
Sbjct: 104 DILISSTSDSVETVILIDLLCRLGVSYHFENDIEELLSKIF-----NSQPDLVDEKECDL 158

Query: 456 YATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           Y  A+ FRV RQ+GF +S +VF  F D    +F  +L  D KG+L+L+EAS LS
Sbjct: 159 YTAAIVFRVFRQHGFKMSSDVFSKFKDS-DGKFKESLRGDAKGMLSLFEASHLS 211



>gb:GACADB_1679588 Gossypium arboreum cad1-b gene for
           (+)-delta-cadinene synthase.
          Length = 555

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 56/171 (32%), Positives = 81/171 (47%)
 Frame = +3

Query: 102 SHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM 281
           S   SS S         R   +Y P  W   +  +    +  AE    R  +LKE V+ M
Sbjct: 6   SQMPSSSSPLSSNKDEMRPKADYPPSIWG-DFFHNCPDKNIDAET-EKRHQQLKEEVRKM 63

Query: 282 LXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYA 461
           +             ID +QRLG SYHF +EI   L +IY                 DLY 
Sbjct: 64  IVAPMANSTQKLTFIDSVQRLGVSYHFTKEIEDELENIY--------HNNNIDAENDLYT 115

Query: 462 TALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           T+L FR+LR++GFN+S + F+ F +  +  F  ++  +++GLL LYEAS+L
Sbjct: 116 TSLRFRLLREHGFNVSCDAFNKFKE-EQGNFKSSVTNNVRGLLELYEASYL 165



>sp|Q39761|DCS1_GOSAR (+)-delta-cadinene synthase isozyme XC1 (EC
           4.2.3.13) (D-cadinene synthase).>pir|S68365|S68365
           (+)-delta-cadinene synthase isozyme XC1 - Gossypium
           arboreum>gb:GAU23206_1679625 Gossypium arboreum
           (+)-delta-cadinene synthase isozyme XC1 mRNA, complete
           cds.
          Length = 554

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 46/123 (37%), Positives = 68/123 (55%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           R  +LKE V+ M+             ID +QRLG SYHF +EI   L +IY         
Sbjct: 51  RHQQLKEEVRKMIVAPMANSTQKLAFIDSVQRLGVSYHFTKEIEDELENIY--------- 101

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                   DLY T++ FR+LR++G+N+S +VF+ F D  +  F  ++  D++GLL LY+A
Sbjct: 102 HNNNDAENDLYTTSIRFRLLREHGYNVSCDVFNKFKD-EQGNFKSSVTSDVRGLLELYQA 160

Query: 606 SFL 614
           S+L
Sbjct: 161 SYL 163



>gb:AF279454_1782827 Lycopersicon esculentum sesquiterpene synthase
           2 (SSTLE2) mRNA, partial cds.
          Length = 552

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 50/154 (32%), Positives = 75/154 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   N+ P  W Y +   L+ TH       +  DE KE ++ ML             ID 
Sbjct: 14  RPLANFHPSVWGYHF---LSYTHEITNQEKVEVDEYKETIRKMLVETCDNSTQKLVLIDA 70

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +QRLG +YHF+ EI  ++ +I+                 +LY  +L FR++RQ G  +S 
Sbjct: 71  MQRLGVAYHFDNEIETSIQNIF------DASSKQNDNDNNLYVVSLRFRLVRQQGHYMSS 124

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF  F + +  +F   L  D++GLL+LYEAS L
Sbjct: 125 DVFKQFTN-QDGKFKETLTNDVQGLLSLYEASHL 157



>gb:AY473627_1608214 Picea abies E,E-alpha-farnesene synthase
           (TPS-Far) mRNA, complete cds.
          Length = 580

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 56/165 (33%), Positives = 78/165 (47%), Gaps = 10/165 (6%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX--- 323
           RR G+Y    WD  +IQSL+T  Y A  +  R + L   VK+M                 
Sbjct: 18  RRVGDYHSNLWDDDFIQSLSTP-YGASSYRERAERLVGEVKEMFTSISIEDGELTSDLLQ 76

Query: 324 ----IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQ 491
               +D ++RLG S HFE EI AA+  +Y                 DL + AL FR LR 
Sbjct: 77  RLWMVDNVERLGISRHFENEIKAAIDYVYSYWSDKGIVRGRDSAVPDLNSIALGFRTLRL 136

Query: 492 NGFNISQEVFDCFMDGRRSRF---NVNLGQDIKGLLNLYEASFLS 617
           +G+ +S +VF  F D R+  F    +    DIKG+LNL  AS+++
Sbjct: 137 HGYTVSSDVFKVFQD-RKGEFACSAIPTEGDIKGVLNLLRASYIA 180



>gb:CQ813505_1453486 Sequence 1 from Patent WO2004031376.
          Length = 556

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 53/167 (31%), Positives = 81/167 (48%), Gaps = 3/167 (1%)
 Frame = +3

Query: 123 SMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDE---LKERVKDMLXXX 293
           S   + T   R + +Y P  W   ++   +     A    + +DE   LK+++K+ML   
Sbjct: 10  SSILNATAGNRPTASYHPTLWGGKFLDYSSVDDSEAMDATIDQDEFEALKQKIKNMLISP 69

Query: 294 XXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALE 473
                     ID +QRLG +YHFE EI   L  +                  D+++ AL 
Sbjct: 70  TDKSFQKLNLIDAVQRLGVAYHFEREIEDELEKL----------SPDEYDGNDVHSVALR 119

Query: 474 FRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           FR+LRQ G+ IS ++F  F D  R +F V+L  D+ G+L+LYEA+ L
Sbjct: 120 FRLLRQQGYRISCDIFGGFKDD-RGKFKVSLINDVTGMLSLYEAAHL 165



>pir|T06265|T06265 germacrene C synthase, epidermal -
           tomato>gb:AF035630_1762888 Lycopersicon esculentum cv.
           VFNT epidermal germacrene C synthase mRNA, complete
           cds.>gb:AF279453_1782826 Lycopersicon esculentum
           sesquiterpene synthase 1 (SSTLE1) mRNA, complete cds.
          Length = 548

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 50/154 (32%), Positives = 75/154 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   N+ P  W Y +   L+ TH       +  DE KE ++ ML             ID 
Sbjct: 10  RPLANFHPSVWGYHF---LSYTHEITNQEKVEVDEYKETIRKMLVETCDNSTQKLVLIDA 66

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +QRLG +YHF+ EI  ++ +I+                 +LY  +L FR++RQ G  +S 
Sbjct: 67  MQRLGVAYHFDNEIETSIQNIF------DASSKQNDNDNNLYVVSLRFRLVRQQGHYMSS 120

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF  F + +  +F   L  D++GLL+LYEAS L
Sbjct: 121 DVFKQFTN-QDGKFKETLTNDVQGLLSLYEASHL 153



>pir|T06266|T06266 germacrene C synthase -
           tomato>gb:AF035631_1762889 Lycopersicon esculentum cv.
           VFNT germacrene C synthase mRNA, complete cds.
          Length = 548

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 50/154 (32%), Positives = 75/154 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   N+ P  W Y +   L+ TH       +  DE KE ++ ML             ID 
Sbjct: 10  RPLANFHPSVWGYHF---LSYTHEITNQEKVEVDEYKETIRKMLVETCDNSTQKLVLIDA 66

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +QRLG +YHF+ EI  ++ +I+                 +LY  +L FR++RQ G  +S 
Sbjct: 67  MQRLGVAYHFDNEIETSIQNIF------DASSKQNDNDNNLYVVSLRFRLVRQQGHYMSS 120

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF  F + +  +F   L  D++GLL+LYEAS L
Sbjct: 121 DVFKQFTN-QDGKFKETLTNDVQGLLSLYEASHL 153



>gb:AF411120_1797174 Citrus x paradisi putative terpene synthase
           mRNA, complete cds.
          Length = 548

 Score = 82.0 bits (201), Expect = 7e-15
 Identities = 52/160 (32%), Positives = 83/160 (51%), Gaps = 3/160 (1%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLN---TTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T R + ++ P  W   +++  +   T  +TA     R + LKE V+ M+           
Sbjct: 6   TFRPTADFHPSLWRNHFLKGASDFKTVDHTATQ--ERHEALKEEVRRMITDAEDKPVQKL 63

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             IDE+QRLG +YHFE+EI  A++ +                  DL+  +L FR+LRQ G
Sbjct: 64  RLIDEVQRLGVAYHFEKEIEDAILKL--------CPIYIDSNRADLHTVSLHFRLLRQQG 115

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
             IS +VF+ F D    RF  +L  D++G+L+LYEA++++
Sbjct: 116 IKISCDVFEKFKDD-EGRFKSSLINDVQGMLSLYEAAYMA 154



>gb:AY766250_1627650 Medicago truncatula wound-inducible putative
           cytosolic terpene synthase 2 mRNA, complete cds; nuclear
           gene for chloroplast product.
          Length = 553

 Score = 81.6 bits (200), Expect = 9e-15
 Identities = 52/154 (33%), Positives = 74/154 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   +Y P  W   +IQ  + +    +  V   D LK  V++ML             +D 
Sbjct: 14  RNLADYHPNIWGEYFIQYASESMDLDQNIVAEIDTLKSEVRNMLVAKTDEPFAKVKLVDS 73

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           + RLG SYHFE+EI   L  ++                 +L A A+ FRVLRQ GF +S 
Sbjct: 74  ICRLGVSYHFEKEIDDVLQQVH----KSCVENGEVILEDNLCALAVLFRVLRQQGFYVSP 129

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            VF  F D ++  FN  L  D++G+L+LYEAS +
Sbjct: 130 NVFTKFKD-KQGNFNETLITDVEGMLSLYEASHM 162



>gb:AB022720_1515264 Solanum tuberosum PVS3 mRNA for vetispiradiene
           synthase, complete cds.>gb:AF043300_1763696 Solanum
           tuberosum putative vetispiradiene synthase 5 mRNA,
           complete cds.
          Length = 551

 Score = 81.6 bits (200), Expect = 9e-15
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 2/154 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXX--XXXXXXXXXI 326
           R   N+ P  W   +  S +  +  AE +    + LKE+ + +L               I
Sbjct: 15  RPVANFSPSLWGDRF-HSFSLDNQVAEKYAQEIETLKEQTRSLLSAAACGITLAEKLNLI 73

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
           D ++RLG +YHFE++I   L  IY                 DL   +L+FR+LRQ+G+NI
Sbjct: 74  DIVERLGLAYHFEKQIDDMLDQIYKADPNFDAH--------DLNTLSLQFRILRQHGYNI 125

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           SQ+ F  F D    +F   L  DI+GLLNLYEAS
Sbjct: 126 SQKFFSRFQDA-NGKFKECLSNDIRGLLNLYEAS 158



>gb:CQ813508_1453489 Sequence 4 from Patent WO2004031376.
          Length = 548

 Score = 81.6 bits (200), Expect = 9e-15
 Identities = 55/163 (33%), Positives = 84/163 (51%), Gaps = 6/163 (3%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLN---TTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T R + ++ P  W   +++  +   T  +TA     R + LKE V+ M+           
Sbjct: 6   TFRPTADFHPSLWRNHFLKGASDFKTVDHTATQ--ERHEALKEEVRRMITDAEDKPVQKL 63

Query: 318 XXIDELQRLGCSYHFEEEIMAA---LMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
             IDE+QRLG +YHFE+EI  A   L  IY+                DL+  +L FR+LR
Sbjct: 64  RLIDEVQRLGVAYHFEKEIEDAIQKLCPIYI-----------DSNRADLHTVSLHFRLLR 112

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           Q G  IS +VF+ F D    RF  +L  D++G+L+LYEA++++
Sbjct: 113 QQGIKISCDVFEKFKDD-EGRFKSSLINDVQGMLSLYEAAYMA 154



>gb:XXU20187_2154080 Synthetic construct vetispiradiene synthase
           gene, complete cds.
          Length = 555

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 51/160 (31%), Positives = 76/160 (47%), Gaps = 1/160 (0%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXX-XXXXX 308
           Y      R   ++ P  W   +  S +  +  AE +    + LKE+   ML         
Sbjct: 10  YEEEEIVRPVADFSPSLWG-DHFHSFSVDNQVAEKYAQEIETLKEQTSTMLSAACGTTLT 68

Query: 309 XXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID ++RLG +YHFE++I   L  IY                 DL  ++++FR+LR
Sbjct: 69  EKLNLIDIIERLGIAYHFEKQIEDMLDHIYRADPYFEAHEYN-----DLNTSSVQFRLLR 123

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           Q+G+N+S  +F  F D    +F  +L  DI+GLLNLYEAS
Sbjct: 124 QHGYNVSPNIFSRFQDA-NGKFKESLRSDIRGLLNLYEAS 162



>gb:AF441124_1800098 Citrus sinensis valencene synthase (tps1) mRNA,
           complete cds.
          Length = 548

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 54/163 (33%), Positives = 84/163 (51%), Gaps = 6/163 (3%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLN---TTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T R + ++ P  W   +++  +   T  +TA     R + LKE V+ M+           
Sbjct: 6   TFRPTADFHPSLWRNHFLKGASDFKTVDHTATQ--ERHEALKEEVRRMITDAEDKPVQKL 63

Query: 318 XXIDELQRLGCSYHFEEEI---MAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
             IDE+QRLG +YHFE+EI   +  L  IY+                DL+  +L FR+LR
Sbjct: 64  RLIDEVQRLGVAYHFEKEIGDAIQKLCPIYI-----------DSNRADLHTVSLHFRLLR 112

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           Q G  IS +VF+ F D    RF  +L  D++G+L+LYEA++++
Sbjct: 113 QQGIKISCDVFEKFKDD-EGRFKSSLINDVQGMLSLYEAAYMA 154



>sp|P93665|DCS1_GOSHI (+)-delta-cadinene synthase (EC 4.2.3.13)
           (D-cadinene synthase).>gb:GHU88318_1680185 Gossypium
           hirsutum (+)-delta-cadinene synthase (cdn1) mRNA,
           complete cds.
          Length = 554

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 51/155 (32%), Positives = 78/155 (50%), Gaps = 1/155 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR-DELKERVKDMLXXXXXXXXXXXXXID 329
           R   +++P  W   +   LN      +    +R  +LKE V+ M+             ID
Sbjct: 22  RPKADFQPSIWGDFF---LNCPDKNIDAETQKRHQQLKEEVRKMIVAPMANSTLKLAFID 78

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            +Q LG SYHF +EI   L +IY                 DLY T+L FR+LR++GF++S
Sbjct: 79  SVQGLGVSYHFTKEIEDELENIY---------HNNNDAENDLYTTSLRFRLLREHGFHVS 129

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +VF+ F D  +  F  ++  D++GLL LY+AS+L
Sbjct: 130 CDVFNKFKD-EQGNFKSSVTSDVRGLLELYQASYL 163



>gb:CAN5588_1645077 Capsicum annuum gene encoding
           5-epi-aristolochene synthase, exons 1 to 7.
          Length = 559

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 51/152 (33%), Positives = 74/152 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   +Y P  W   ++ S +  +   + +    +  KE+ + ML             ID 
Sbjct: 20  RPVADYSPSIWGDRFL-SFSIDNQVEQKYAQEIEPPKEQTRSMLLASPRKLSDTLNLIDV 78

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           ++RL  +YHFE+EI   L  IY                 DL   AL+FR+LRQ+G+NIS 
Sbjct: 79  IERLAIAYHFEKEIDEILDRIY----NENSNFEGDVYNEDLCTCALQFRLLRQHGYNISL 134

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           E+F  F+DG   R   +L  D+ GLL+LYEAS
Sbjct: 135 EIFSKFLDG-NGRLKESLASDVLGLLSLYEAS 165



>gb:AF279455_1782828 Lycopersicon hirsutum sesquiterpene synthase 1
           (SSTLH1) mRNA, complete cds.
          Length = 544

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 50/163 (30%), Positives = 78/163 (47%)
 Frame = +3

Query: 126 MCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXX 305
           M   +   +R   N+ P  W Y +   L+ TH       +  DE KE ++ ML       
Sbjct: 1   MAASSANKSRPLANFHPTVWGYHF---LSYTHEITNQEKVEVDEYKETIRKMLVEAPEGS 57

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID +QRLG +YHF  EI  ++ +I+                 +L+  +L FR++
Sbjct: 58  EQKLVLIDAMQRLGVAYHFHNEIETSIQNIF----------DAPKQNNNLHIVSLRFRLV 107

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           RQ G  +S +VF  F + +  +F   L  D++GLL+LYEAS+L
Sbjct: 108 RQQGHYMSSDVFKQFTN-QDGKFKETLTNDVQGLLSLYEASYL 149



>gb:AF171216_1774390 Lycopersicon esculentum vetispiradiene synthase
           (LEVS2) gene, complete cds.
          Length = 556

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 52/160 (32%), Positives = 79/160 (49%), Gaps = 1/160 (0%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXX 311
           Y      R   ++ P  W   +  S +  +  A  +    + LKE+ + +L         
Sbjct: 11  YREEEIVRPVADFSPSLWGDRF-HSFSLDNKIAGKYAQEIETLKEQSRVILSASSGTTLA 69

Query: 312 XXXX-IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID ++RLG +YHFE++I   L  IY                 DL  ++++FR+LR
Sbjct: 70  QKLDLIDIVERLGLAYHFEKQIDDVLDQIYKADPNSEAQEYN-----DLQTSSIQFRLLR 124

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           Q+G+NIS ++F  F D  + +FN +L  DIKGLLNLYEAS
Sbjct: 125 QHGYNISPKLFSRFQDA-KGKFNESLSNDIKGLLNLYEAS 163



>gb:AY563622_1615074 Malus x domestica (E,E)-alpha-farnesene
           synthase (AFS) mRNA, complete cds.
          Length = 576

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 49/154 (31%), Positives = 76/154 (49%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RRS NY+P  W   ++     + Y  + +    ++L E VK  +             ID 
Sbjct: 33  RRSANYKPNIWKNDFLDQSLISKYDGDEYRKLSEKLIEEVKIYISAETMDLVAKLELIDS 92

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +++LG +  FE+EI  AL  I                  DLY TAL F++LRQ+G+ +SQ
Sbjct: 93  VRKLGLANLFEKEIKEALDSI------AAIESDNLGTRDDLYGTALHFKILRQHGYKVSQ 146

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           ++F  FMD + +  N +    +KG+L L+EAS L
Sbjct: 147 DIFGRFMDEKGTLENHHFAH-LKGMLELFEASNL 179



>gb:AY313939_1598391 Nicotiana tabacum epi-arisotolchene synthase
           110 gene, complete cds.
          Length = 548

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 50/127 (39%), Positives = 66/127 (51%)
 Frame = +3

Query: 228 AEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXX 407
           AE +    + LKE+ ++ML             ID ++RLG SYHFE+EI   L  IY   
Sbjct: 39  AEKYTKEIEGLKEQTRNMLLATGMKLADTLNLIDIIERLGISYHFEKEIDEILDQIY--- 95

Query: 408 XXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGL 587
                         DL  +AL+FR+LRQ+GFNIS  +F  F D    +   +L  D+ GL
Sbjct: 96  -------NQNSNCDDLCTSALQFRLLRQHGFNISPGIFSKFQD-ENGKSKESLASDVLGL 147

Query: 588 LNLYEAS 608
           LNLYEAS
Sbjct: 148 LNLYEAS 154



>gb:AY182241_1587878 Malus x domestica (E,E)-alpha-farnesene
           synthase (AFS1) mRNA, complete cds.
          Length = 576

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 49/154 (31%), Positives = 76/154 (49%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RRS NY+P  W   ++     + Y  + +    ++L E VK  +             ID 
Sbjct: 33  RRSANYKPNIWKNDFLDQSLISKYDGDEYRKLSEKLIEEVKIYISAETMDLVAKLELIDS 92

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +++LG +  FE+EI  AL  I                  DLY TAL F++LRQ+G+ +SQ
Sbjct: 93  VRKLGLANLFEKEIKEALDSI------AAIESDNLGTRDDLYGTALHFKILRQHGYKVSQ 146

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           ++F  FMD + +  N +    +KG+L L+EAS L
Sbjct: 147 DIFGRFMDEKGTLENHHFAH-LKGMLELFEASNL 179



>gb:AB022719_1515263 Solanum tuberosum PVS2 mRNA for vetispiradiene
           synthase, complete cds.
          Length = 549

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 55/161 (34%), Positives = 80/161 (49%), Gaps = 2/161 (1%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTW-DYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           Y      R   ++ P  W D  +  SL+  +  A+ +    + LKE+ + ML        
Sbjct: 4   YGEEEIVRPVADFSPSLWGDRFHYFSLD--NQVAKEYAQEIETLKEQTRSMLLTASGMTL 61

Query: 309 XXXXX-IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID ++RLG +YHFE++I   L  IY                 DL   +L+FR+L
Sbjct: 62  AEKLNLIDIVERLGLAYHFEKQIEDMLDQIYKAHPNFDSHEYS-----DLTTLSLQFRLL 116

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           RQ+G+NIS ++F  + D  + +FN  L  DIKGLLNLYEAS
Sbjct: 117 RQHGYNISPKIFSRYQDA-KGKFNEPLSNDIKGLLNLYEAS 156



>gb:AF374462_1792783 Citrus junos (E)-beta-farnesene synthase mRNA,
           complete cds.
          Length = 560

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 50/160 (31%), Positives = 74/160 (46%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T  T R   ++ P  W   +++S             +   LK+ V+ M+           
Sbjct: 16  TEETVRPIADFHPTLWGNHFLKSAADVETIDAATQEQHAALKQEVRRMITTTANKLAQKL 75

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             ID +QRLG +YHFE+EI   L  +                  DLY  +L FR+ RQ G
Sbjct: 76  HMIDAVQRLGVAYHFEKEIEDELGKV-----------SHDLDSDDLYVVSLRFRLFRQQG 124

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
             IS +VFD F D    +F  +L  DI+G+L+LYEA++L+
Sbjct: 125 VKISCDVFDKFKDD-EGKFKESLINDIRGMLSLYEAAYLA 163



>pir|T08174|T08174 sesquiterpene cyclase (EC 2.5.1.-) -
           pepper>gb:AF061285_1765208 Capsicum annuum sesquiterpene
           cyclase mRNA, complete cds.
          Length = 559

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 50/152 (32%), Positives = 74/152 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   ++ P  W   ++ S +  +     +    + LKE+ + ML             ID 
Sbjct: 20  RPVADFSPSLWGDRFL-SFSIDNQVETKYAQEIEPLKEQTRSMLLASGRKLSETLNLIDV 78

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           ++RLG +YHFE+EI   L  IY                 DL    L+FR+LRQ+G+NIS 
Sbjct: 79  IERLGIAYHFEKEIDEILDRIY----NENSNFEGDVYNEDLCTCRLQFRLLRQHGYNISL 134

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++F  F+DG   R   +L  D+ GLL+LYEAS
Sbjct: 135 KIFSKFLDG-NGRLKESLASDVLGLLSLYEAS 165



>gb:AF042382_1763637 Solanum tuberosum vetispiradiene synthase (VS1)
           mRNA, complete cds.
          Length = 550

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 2/154 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXX--XXXXXXXXXI 326
           R   N+ P  W   +  S +  +  AE +    + LKE+ + +L               I
Sbjct: 15  RPVANFSPSLWGDRF-HSFSLDNQVAEKYAQEIETLKEQTRSLLSAAACGITLAEKLNLI 73

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
           D ++RLG +YHFE++I   L  IY                 DL   +L+FR+LRQ+G+NI
Sbjct: 74  DIVERLGLAYHFEKQIDDMLDQIYKADPNFDGH--------DLNTLSLQFRILRQHGYNI 125

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           SQ+ F  F D   + F   L  DI+GLLNLYEAS
Sbjct: 126 SQKFFSRFQDA--NGFKECLSNDIRGLLNLYEAS 157



>gb:AF543528_1810267 Pinus taeda alpha-farnesene synthase mRNA,
           complete cds.
          Length = 574

 Score = 79.0 bits (193), Expect = 6e-14
 Identities = 56/167 (33%), Positives = 81/167 (48%), Gaps = 12/167 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX---- 320
           RR G+Y P  WD + IQSL+T  Y A  +    ++L   +K+M                 
Sbjct: 11  RRVGDYHPNLWDDALIQSLSTP-YGASPYRDVAEKLIGEIKEMFASISIEDGDDEICYFL 69

Query: 321 ----XIDELQRLGCSYHFEEEIMAALMDIYMXX-XXXXXXXXXXXXXXDLYATALEFRVL 485
                ID ++RLG S HFE EI AA+ D+Y                  DL +TAL FR L
Sbjct: 70  QRLWMIDNVERLGISRHFENEIKAAMEDVYSRHWSDKGIACGRHSVVADLNSTALAFRTL 129

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           R +G+++  +VF  F D ++  F  +  Q   +IKG+LNL  AS ++
Sbjct: 130 RLHGYSVCSDVFKIFQD-QKGEFACSADQTEGEIKGILNLLRASLIA 175



>gb:AF288465_1783465 Citrus junos terpene synthase mRNA, complete
           cds.
          Length = 555

 Score = 79.0 bits (193), Expect = 6e-14
 Identities = 54/166 (32%), Positives = 78/166 (46%), Gaps = 6/166 (3%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTW-DY-----SYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXX 299
           T  T R    + P  W DY     S  ++ +TTH          + LK+ V+ M+     
Sbjct: 13  TEKTVRPIAGFHPNLWGDYFLTLASDCKTDDTTHQE------EYEALKQEVRSMITATAD 66

Query: 300 XXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFR 479
                   +D +QRLG +YHFE+EI  A+  IY                 DLY  +L FR
Sbjct: 67  TPAQKLQLVDAVQRLGVAYHFEQEIEDAMEKIY-------HDDFDNNDDVDLYTVSLRFR 119

Query: 480 VLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +LRQ GF +  +VF  F D    +F  +L +D+ G+L+LYEA  L+
Sbjct: 120 LLRQQGFKVPCDVFAKFKDD-EGKFKASLVRDVHGILSLYEAGHLA 164



>gb:AB023816_1515643 Solanum tuberosum PVS4 mRNA for vetispiradiene
           synthase, complete cds.
          Length = 549

 Score = 79.0 bits (193), Expect = 6e-14
 Identities = 53/160 (33%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXX 311
           Y      R   ++ P  W   +  S +  +  A  +    D LKE+ + +L         
Sbjct: 4   YQEEDIVRPVADFSPSLWGDRF-HSFSLDNQIAGKYAQEIDTLKEQSRLILFASYIRTLA 62

Query: 312 XXXX-IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID ++RLG +YHFE++I   L  IY                 DL   +++FR+LR
Sbjct: 63  EKLDLIDIVERLGIAYHFEKQIDDMLDQIYKADPNFEAHEYN-----DLQTLSVQFRLLR 117

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           Q+G+NIS ++F  F D  + +FN +L  DIKGLLNLYEAS
Sbjct: 118 QHGYNISPKLFSRFQDA-KGKFNESLSNDIKGLLNLYEAS 156



>gb:CQ813507_1453488 Sequence 3 from Patent WO2004031376.
          Length = 555

 Score = 79.0 bits (193), Expect = 6e-14
 Identities = 54/166 (32%), Positives = 78/166 (46%), Gaps = 6/166 (3%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTW-DY-----SYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXX 299
           T  T R    + P  W DY     S  ++ +TTH          + LK+ V+ M+     
Sbjct: 13  TEKTVRPIAGFHPNLWGDYFLTLASDCKTDDTTHQE------EYEALKQEVRSMITATAD 66

Query: 300 XXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFR 479
                   +D +QRLG +YHFE+EI  A+  IY                 DLY  +L FR
Sbjct: 67  TPAQKLQLVDAVQRLGVAYHFEQEIEDAMEKIY-------HDDFDNNDDVDLYTVSLRFR 119

Query: 480 VLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +LRQ GF +  +VF  F D    +F  +L +D+ G+L+LYEA  L+
Sbjct: 120 LLRQQGFKVPCDVFAKFKDD-EGKFKASLVRDVHGILSLYEAGHLA 164



>gb:AX529019_1469926 Sequence 41 from Patent WO02064764.
          Length = 254

 Score = 78.6 bits (192), Expect = 8e-14
 Identities = 52/157 (33%), Positives = 79/157 (50%), Gaps = 3/157 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWD---YSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX 323
           RR+ N++P  W     +Y + + T     E    + +ELK+  K++              
Sbjct: 21  RRTANFKPSVWGDRFANYAEDIITQTQMQE----QVEELKQVRKEVFTNAADDSSHQLKP 76

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           IDE+QRLG +YHFE EI  AL  I+                 DLY  AL FR+LR++G+N
Sbjct: 77  IDEIQRLGVAYHFESEIDQALERIH-------ETYQDIHDGGDLYNVALRFRLLRRHGYN 129

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S +VF+ F D     +  +L  D+ G+L+ YEA+ L
Sbjct: 130 VSCDVFNKFKD-TNGDYKKSLVTDLSGMLSFYEAAHL 165



>gb:MVU291755_1687768 Marrubium vulgare partial tps1 gene for
           putative terpenesynthase-1, exons 1-7.
          Length = 545

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 50/156 (32%), Positives = 74/156 (47%), Gaps = 1/156 (0%)
 Frame = +3

Query: 150 TRRSGNYEP-PTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI 326
           TR   N+ P P+         N+     E +  + + LK  VK M+             I
Sbjct: 7   TRPFANFSPSPSLWGDQFTKYNSDPQVKEKYSKQIEVLKNEVKSMVTAQGGKMVDTINFI 66

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
           D ++RLG +YHF++EI   +   +                 DLY  AL FR+ RQ+G  I
Sbjct: 67  DTMERLGIAYHFKDEIEETIQQFF------NLNTNYEDEAYDLYTVALHFRLFRQHGHPI 120

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           S ++F  ++DG   +F  +L  D KGLL+LYEAS+L
Sbjct: 121 SCDIFGKWIDG-NGKFQESLKSDAKGLLSLYEASYL 155



>gb:AY561843_1614990 Vitis vinifera clone M4670 terpenoid synthetase
           mRNA, complete cds.
          Length = 556

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 60/174 (34%), Positives = 79/174 (45%), Gaps = 7/174 (4%)
 Frame = +3

Query: 114 SSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR------DELKERVK 275
           S+ S+        R   N+ P  W   +I       YT E  V R       ++LK+ VK
Sbjct: 6   SASSLAQIPQPKNRPVANFHPNIWGDQFIT------YTPEDKVTRACKEEQIEDLKKEVK 59

Query: 276 DMLXXXXXXX-XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXD 452
             L              ID +QRLG +YHFE+EI  AL  I                  D
Sbjct: 60  RKLTAAAVANPSQLLNFIDAVQRLGVAYHFEQEIEEALQHIC------NSFHDCNDMDGD 113

Query: 453 LYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           LY  AL FR+LRQ G+ IS ++F+ F D  R RF   L  D++G+L LYEA+ L
Sbjct: 114 LYNIALGFRLLRQQGYTISCDIFNKFTD-ERGRFKEALISDVRGMLGLYEAAHL 166



>gb:AY473626_1608213 Picea abies myrcene synthase (TPS-Myr) mRNA,
           complete cds.
          Length = 633

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 59/191 (30%), Positives = 85/191 (44%), Gaps = 18/191 (9%)
 Frame = +3

Query: 99  RSHAESSFSMCYHTTTTT-----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELK 263
           R     S SM  +T  +      RR G+Y    W+  +IQSL TT Y A  ++ R D L 
Sbjct: 42  RMSVTPSMSMSLNTVVSDNDAVQRRIGDYHSNLWNDDFIQSL-TTPYGAPSYIERADRLI 100

Query: 264 ERVKDM----------LXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXX 413
             VK+M          L             +D ++RLG   HF+ EI A+L  +Y     
Sbjct: 101 SEVKEMFNRMCMEDGELMSPLNDLIQRLWTVDSVERLGIDRHFKNEIKASLDYVYSYWNE 160

Query: 414 XXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQ---DIKG 584
                       DL +TAL  R+LRQ+G+ +S EV   F +    +F  +  Q   +I+ 
Sbjct: 161 KGIGCGRQSVVTDLNSTALGLRILRQHGYTVSSEVLKVF-EEENGQFACSPSQTEGEIRS 219

Query: 585 LLNLYEASFLS 617
            LNLY AS ++
Sbjct: 220 FLNLYRASLIA 230



>gb:AAN271792_1508201 Artemisia annua mRNA for putative
           sesquiterpene cyclase (cASC125 gene).
          Length = 577

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 62/193 (32%), Positives = 91/193 (47%), Gaps = 13/193 (6%)
 Frame = +3

Query: 75  LSCLPSIHRSHAESSFSMCYHTTTTT-----RRSGNYEPPTWDYSYIQSLNTTHYTAEGF 239
           +S LP    S + S+  +      +T     R + N+    W   ++     T+   E  
Sbjct: 1   MSTLPISSVSFSSSTSPLVVDDKVSTKPDVIRHTMNFNASIWGDQFL-----TYDEPEDL 55

Query: 240 VMRR---DELKERVKDMLXXXXXXXX-----XXXXXIDELQRLGCSYHFEEEIMAALMDI 395
           VM++   +ELKE VK  L                  ID +QRLG +YHFEEEI  AL  I
Sbjct: 56  VMKKQLVEELKEEVKKELITIKGSNEPMQHVKLIELIDAVQRLGIAYHFEEEIEEALQHI 115

Query: 396 YMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQD 575
           ++                +L + +L FR+LRQ GFN+S  VF  FMD  + +F  +L  D
Sbjct: 116 HV------TYGEQWVDKENLQSISLWFRLLRQQGFNVSSGVFKDFMD-EKGKFKESLCND 168

Query: 576 IKGLLNLYEASFL 614
            +G+L LYEA+F+
Sbjct: 169 AQGILALYEAAFM 181



>pir|F71434|F71434 probable limonene cyclase - Arabidopsis
           thaliana>gb:ATCHRIV44_1545475 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 44.>gb:ATFCA6_1551723
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 6.
          Length = 600

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 45/98 (45%), Positives = 58/98 (59%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID LQRLG SYH++ EI   L  I+                 DL+AT+LEF +LRQ+GF+
Sbjct: 113 IDSLQRLGISYHYKHEIHDILRKIH------DQHGEIERETQDLHATSLEFILLRQHGFD 166

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +SQ+ FD F+      F   L  DIKGLL+LYEAS+ S
Sbjct: 167 VSQDAFDVFI-SETGEFRKTLHSDIKGLLSLYEASYFS 203



>gb:AF043299_1763695 Solanum tuberosum putative vetispiradiene
           synthase 4 mRNA, complete cds.
          Length = 556

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 53/161 (32%), Positives = 79/161 (49%), Gaps = 2/161 (1%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTW-DYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           Y      R   ++ P  W D  +  SL+  +   + +    + LKE+ + ML        
Sbjct: 11  YGEEEIVRPVADFSPSLWGDRFHYFSLD--NQVEKEYAQEIETLKEQTRSMLLAASGMTL 68

Query: 309 XXXXX-IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID ++RLG +YHFE++I   L  IY                 DL   +++FR+L
Sbjct: 69  AEKLNLIDIVERLGLAYHFEKQIEDMLDQIYKAHPNFESHEYS-----DLTTLSVQFRLL 123

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           RQ+G+NIS ++F  + D  + +FN  L  DIKGLLNLYEAS
Sbjct: 124 RQHGYNISPKIFSRYQDA-KGKFNEPLSNDIKGLLNLYEAS 163



>gb:AY693644_1623442 Ocimum basilicum germacrene D synthase (GDS)
           mRNA, complete cds.
          Length = 546

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 50/157 (31%), Positives = 76/157 (48%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T    RRS  Y P  W   +   L+      E  + +  + KER+K +L           
Sbjct: 17  TVEDMRRSVTYHPSVWKDHF---LDYASGITEVEMEQLQKQKERIKTLLAQTLDDFVLKI 73

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             ID +QRLG  YHFE+EI  +L  IY                 D+   AL FR+LRQ+G
Sbjct: 74  ELIDAIQRLGVGYHFEKEINHSLRQIY-------DTFQISSKDNDIRVVALRFRLLRQHG 126

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           + +  +VF  F+D  + R + ++  +++G+L+LYEAS
Sbjct: 127 YPVPSDVFKKFID-NQGRLDESVMNNVEGMLSLYEAS 162



>gb:AY693643_1623441 Ocimum basilicum selinene synthase (SES) mRNA,
           complete cds.
          Length = 550

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 47/153 (30%), Positives = 72/153 (47%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R+S  Y    W   ++   +           + ++LKE+VK++L             ID 
Sbjct: 22  RKSATYHSSVWGNHFLSYTSDVTEITAAEKEQLEKLKEKVKNLLAQTPDESTGKMELIDA 81

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +QRLG  YHF  EI  +L  I+                 D+   AL FR+LRQ G+    
Sbjct: 82  IQRLGVGYHFTTEIQESLRQIH--------EGQIRNDDDDVRVVALRFRLLRQGGYRAPC 133

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASF 611
           +VF+ FMD     F  +L +D++G+L+LYEAS+
Sbjct: 134 DVFEKFMDD-GGNFKESLKKDVEGMLSLYEASY 165



>gb:AY523409_1611392 Malus x domestica alpha-farnesene synthase
           mRNA, complete cds.
          Length = 576

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 47/154 (30%), Positives = 75/154 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RRS NY+P  W   ++     + Y  + +    ++L E VK  +             ID 
Sbjct: 33  RRSANYKPNIWKNDFLDQSLISKYDGDEYRKLSEKLIEEVKIYISAETMDLVAKLELIDS 92

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +++LG +  FE++I  AL  I                  DLY  AL F++LRQ+G+ +SQ
Sbjct: 93  VRKLGLANLFEKKIKEALDSI------AAIESDNLGTRDDLYGAALHFKILRQHGYKVSQ 146

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           ++F  FMD + +  N +    +KG+L L+EAS L
Sbjct: 147 DIFGRFMDEKGTLENHHFAH-LKGMLELFEASNL 179



>gb:AX529025_1469928 Sequence 47 from Patent WO02064764.
          Length = 556

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 53/158 (33%), Positives = 80/158 (50%), Gaps = 4/158 (2%)
 Frame = +3

Query: 153 RRSGNYEPPTWD---YSYIQSLNTTHYTAEGFVMRRDELKERV-KDMLXXXXXXXXXXXX 320
           RR+ N++P  W     +Y + + T     E    + +ELK+ V K++             
Sbjct: 21  RRTANFKPSVWGDRFANYAEDIITQTQMQE----QVEELKQVVRKEVFTNAADDSSHQLK 76

Query: 321 XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGF 500
            IDE+QRLG +YHFE EI  AL  I+                 DLY  AL FR+LR++G+
Sbjct: 77  LIDEIQRLGVAYHFESEIDQALERIH-------ETYQDIHDGGDLYNVALRFRLLRRHGY 129

Query: 501 NISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           N+S +VF+ F D     +  +L  D+ G+L+ YEA+ L
Sbjct: 130 NVSCDVFNKFKD-TNGDYKKSLVTDLSGMLSFYEAAHL 166



>gb:AX529022_1469927 Sequence 44 from Patent WO02064764.
          Length = 255

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 53/158 (33%), Positives = 80/158 (50%), Gaps = 4/158 (2%)
 Frame = +3

Query: 153 RRSGNYEPPTWD---YSYIQSLNTTHYTAEGFVMRRDELKERV-KDMLXXXXXXXXXXXX 320
           RR+ N++P  W     +Y + + T     E    + +ELK+ V K++             
Sbjct: 21  RRTANFKPSVWGDRFANYAEDIITQTQMQE----QVEELKQVVRKEVFTNAADDSSHQLK 76

Query: 321 XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGF 500
            IDE+QRLG +YHFE EI  AL  I+                 DLY  AL FR+LR++G+
Sbjct: 77  LIDEIQRLGVAYHFESEIDQALERIH-------ETYQDIHDGGDLYNVALRFRLLRRHGY 129

Query: 501 NISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           N+S +VF+ F D     +  +L  D+ G+L+ YEA+ L
Sbjct: 130 NVSCDVFNKFKD-TNGDYKKSLVTDLSGMLSFYEAAHL 166



>gb:AY473624_1608211 Picea abies (-)-limonene synthase (TPS-Lim)
           mRNA, complete cds.
          Length = 634

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 54/167 (32%), Positives = 74/167 (44%), Gaps = 12/167 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX---- 320
           RR GNY    WD  +IQSL+T  Y    +  R + LK  +K M                 
Sbjct: 66  RRRGNYHSNLWDDDFIQSLSTP-YGEPSYRERAERLKGEIKKMFRSMSKDDGELITPLND 124

Query: 321 ------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
                  +D +QRLG   HF+ EI +AL  +Y                 DL +TAL FR 
Sbjct: 125 LIQRLWMVDSVQRLGIDRHFKNEIKSALDYVYSYWNEKGIGCGRDSVVADLNSTALGFRT 184

Query: 483 LRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFLS 617
           LR +G+N+S EV   F D  G+ +        +I+  LNLY AS ++
Sbjct: 185 LRLHGYNVSSEVLKVFEDQNGQFACSPSKTEGEIRSALNLYRASLIA 231



>gb:AF304444_1784388 Artemisia annua sesquiterpene cyclase mRNA,
           complete cds.
          Length = 573

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 46/161 (28%), Positives = 79/161 (49%), Gaps = 6/161 (3%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR------DELKERVKDMLXXXXXXXXXX 314
           R +  + P  W   ++    T H   +   + +      +E+++++ +            
Sbjct: 33  RNTVKFPPSIWGDQFL----TYHEPKKSLTIEKQHVEEVEEIRKKLLNTAFSEPKQHTKL 88

Query: 315 XXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQN 494
              ID +QRLG SYHFE+EI  AL  +Y                 +L +T+  FR+LRQ 
Sbjct: 89  IHLIDSVQRLGVSYHFEQEIEEALQHVY------ATHGDQWIGKDNLKSTSQWFRILRQQ 142

Query: 495 GFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           GFN+S  +F+  MD  + +F  +L  D++G+L LYEA+++S
Sbjct: 143 GFNVSSGIFENHMDD-KGKFKEHLSDDVQGMLGLYEAAYMS 182



>gb:AF212433_1777443 Capsicum annuum UV-induced sesquiterpene
           cyclase (SC2) mRNA, complete cds.
          Length = 560

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 47/152 (30%), Positives = 73/152 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R   N+ P  W  S++ S +  ++    +V   + LKE+ + ML             ID 
Sbjct: 22  RPVANFAPSLWGNSFL-SFSINNHVETKYVQEIEVLKEQTRSMLLDTGRKLVETLNLIDV 80

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           ++RLG +YH+E+EI     D  +                DL   AL+FR+LRQ+G+ IS 
Sbjct: 81  IERLGIAYHYEKEI-----DDILKKNFLDNSNFDEDDFNDLCTCALQFRLLRQHGYKISL 135

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++F    D    +   +L  D+ GLL+LYEAS
Sbjct: 136 KIFSKLQD-ENGKLKESLASDVLGLLSLYEAS 166



>sp|O24475|TSD1_ABIGR Pinene synthase, chloroplast precursor (EC
           4.2.3.14) (Beta-geraniolene synthase)
           ((-)-(1S,5S)-pinene synthase).>gb:AGU87909_1811077 Abies
           grandis pinene synthase (AG3.18) mRNA, complete cds.
          Length = 628

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 56/185 (30%), Positives = 85/185 (45%), Gaps = 18/185 (9%)
 Frame = +3

Query: 117 SFSMCYHTTTTT----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDML 284
           S SM   T  T     RR G++    WD   IQSL T  Y  + ++ R ++L   VK+M 
Sbjct: 48  SISMSSTTVVTDDGVRRRMGDFHSNLWDDDVIQSLPTA-YEEKSYLERAEKLIGEVKNMF 106

Query: 285 XXXXXXXXXXXX----------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXX 434
                                  +D L+RLG   HF++EI +AL  +Y            
Sbjct: 107 NSMSLEDGELMSPLNDLIQRLWIVDSLERLGIHRHFKDEIKSALDYVYSYWGENGIGCGR 166

Query: 435 XXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRF----NVNLGQDIKGLLNLYE 602
                DL +TAL  R LR +G+ +S +VF  F  G+  +F    N+   ++I+G+LNL+ 
Sbjct: 167 ESVVTDLNSTALGLRTLRLHGYPVSSDVFKAF-KGQNGQFSCSENIQTDEEIRGVLNLFR 225

Query: 603 ASFLS 617
           AS ++
Sbjct: 226 ASLIA 230



>gb:AF326517_1786660 Abies grandis pinene synthase gene, partial
           cds.
          Length = 623

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 56/185 (30%), Positives = 85/185 (45%), Gaps = 18/185 (9%)
 Frame = +3

Query: 117 SFSMCYHTTTTT----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDML 284
           S SM   T  T     RR G++    WD   IQSL T  Y  + ++ R ++L   V++M 
Sbjct: 43  SISMSSTTVVTDDGVRRRMGDFHSNLWDDDVIQSLPTA-YEEKSYLERAEKLIGEVENMF 101

Query: 285 XXXXXXXXXXXX----------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXX 434
                                  +D L RLG   HF++EI +AL  +Y            
Sbjct: 102 NSMSLEDGELMSPLNDLIQRLWIVDSLGRLGIHRHFKDEIKSALDYVYSYWGENGIGCGR 161

Query: 435 XXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRF----NVNLGQDIKGLLNLYE 602
                DL +TAL FR LR +G+ +S +VF  F  G+  +F    N+   ++I+G+LNL+ 
Sbjct: 162 ESAVTDLNSTALGFRTLRLHGYPVSSDVFKAF-KGQNGQFSCSENIQTDEEIRGVLNLFR 220

Query: 603 ASFLS 617
           AS ++
Sbjct: 221 ASLIA 225



>gb:AF080245_1766439 Elaeis oleifera sesquiterpene synthase mRNA,
           complete cds.
          Length = 561

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 55/159 (34%), Positives = 81/159 (50%), Gaps = 3/159 (1%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQS--LNTTHYTAEGFV-MRRDELKERVKDMLXXXXXXXXXXX 317
           T R   N+ P  W   +I++  L +    +E  +  RR+ELK  V ++L           
Sbjct: 24  TIRFLANFHPTIWGDYFIENYPLPSNLQKSEACIEKRREELKVEVMNLLKNANDYLQEME 83

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             ID LQRLG +YHFE++I   L  I+                 +L+A AL FR+LRQ+G
Sbjct: 84  L-IDILQRLGVAYHFEKKIDEILSQIFKEHMEDD----------NLHAVALRFRLLRQHG 132

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +N+   +F  F +   S F   L  D+KGLL+LYEA++L
Sbjct: 133 YNMPTNIFIKFKEVDGS-FKATLRNDVKGLLSLYEAAYL 170



>gb:AF043298_1763694 Solanum tuberosum putative vetispiradiene
           synthase 3 mRNA, complete cds.
          Length = 557

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 53/161 (32%), Positives = 76/161 (47%), Gaps = 2/161 (1%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTW-DYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX 308
           Y      R   ++ P  W D  +  SL+  +  A+ +    + LKE+ + ML        
Sbjct: 11  YGEEEIVRPVADFSPSLWGDRFHYFSLD--NQVAKEYAQEIETLKEQTRSMLLAASGMTL 68

Query: 309 XXXXX-IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVL 485
                 ID ++RLG +YHF+++I   L  IY                 DL   +L+FR+L
Sbjct: 69  AEKLNLIDIVERLGLAYHFDKQIEDMLDQIYKAHPNFESHEYS-----DLTTLSLQFRLL 123

Query: 486 RQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           RQ+G+NIS   F       + +FN  L  DIKGLLNLYEAS
Sbjct: 124 RQHGYNISPNRFFSRYQDAKGKFNEPLSNDIKGLLNLYEAS 164



>gb:HMU20188_1681908 Hyoscyamus muticus clone cVS1 vetispiradiene
           synthase mRNA, partial cds.
          Length = 520

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 46/128 (35%), Positives = 66/128 (51%), Gaps = 1/128 (0%)
 Frame = +3

Query: 228 AEGFVMRRDELKERVKDMLXXX-XXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMX 404
           AE +    + LKE+   ML              ID ++RLG +YHFE++I   L  IY  
Sbjct: 6   AEKYAQEIETLKEQTSTMLSAACGTTLTEKLNLIDIIERLGIAYHFEKQIEDMLDHIYRA 65

Query: 405 XXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKG 584
                          DL  ++++FR+LRQ+G+N+S  +F  F D    +F  +L  DI+G
Sbjct: 66  DPYFEAHEYN-----DLNTSSVQFRLLRQHGYNVSPNIFSRFQDA-NGKFKESLRSDIRG 119

Query: 585 LLNLYEAS 608
           LLNLYEAS
Sbjct: 120 LLNLYEAS 127



>gb:AY491399_1608694 Pyrus pyrifolia alpha-farnesene synthase (PFS)
           gene, partial cds.
          Length = 163

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 41/128 (32%), Positives = 62/128 (48%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RRS NY+P  W   ++     + Y  + +    ++L E VK  +             ID 
Sbjct: 33  RRSANYKPNIWKNDFLDQSLISKYDGDEYRKLSEKLIEEVKIYISAETKDLVAKLELIDS 92

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +++LG + HFE+EI  AL  I                  DLY TAL F++LRQ+G+ +SQ
Sbjct: 93  VRKLGLANHFEKEIKEALDSI------AAIESDNLGTRDDLYGTALHFKILRQHGYKVSQ 146

Query: 513 EVFDCFMD 536
           ++F  FMD
Sbjct: 147 DIFGRFMD 154



>pir|A56118|A56118 vetispiradiene synthase 1 - Hyoscyamus muticus
           (fragment)
          Length = 520

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 46/128 (35%), Positives = 66/128 (51%), Gaps = 1/128 (0%)
 Frame = +3

Query: 228 AEGFVMRRDELKERVKDMLXXX-XXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMX 404
           AE +    + LKE+   ML              ID ++RLG +YHFE++I   L  IY  
Sbjct: 6   AEKYAQEIETLKEQTSTMLSAACGTTLTEKLNLIDIIERLGIAYHFEKQIEDMLDHIYRA 65

Query: 405 XXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKG 584
                          DL  ++++FR+LRQ+G+N+S  +F  F D    +F  +L  DI+G
Sbjct: 66  DPYFEAHEYN-----DLNTSSVQFRLLRQHGYNVSPNIFSRFQDA-NGKFKESLRSDIRG 119

Query: 585 LLNLYEAS 608
           LLNLYEAS
Sbjct: 120 LLNLYEAS 127



>gb:AB120957_1528006 Chamaecyparis obtusa co1 mRNA for
           limonene/borneol synthase, complete cds.
          Length = 605

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 63/216 (29%), Positives = 95/216 (43%), Gaps = 22/216 (10%)
 Frame = +3

Query: 36  MAILNVLST-FTYKLSCLPSIHRSHAESSF----------SMCYHTTTT---TRRSGNYE 173
           MA++++ S+ FT+ L   P+     +  SF          +M   TT+    TRR+GN+ 
Sbjct: 1   MALISLSSSAFTFCLKSKPTHLSKPSPKSFPTLARKCMRNTMAMATTSVESVTRRTGNHH 60

Query: 174 PPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXX------XXXIDEL 335
              WD  +IQSL    Y A  +  R D L   VK+M                    +D++
Sbjct: 61  GNLWDDDFIQSLPKLPYDAPEYRERADRLVGEVKNMFNAVRAADSSSQNILRLLEMVDKV 120

Query: 336 QRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQE 515
           +RLG   HFE EI  AL  +Y                 DL   AL  R+LR + + +S +
Sbjct: 121 ERLGIGRHFETEIAEALDYVY--------RFWNDISSKDLNTAALGLRILRLHRYPVSSD 172

Query: 516 VFDCF--MDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           V + F   DG        L ++IK +LNL+ AS ++
Sbjct: 173 VLEQFKEKDGHFLCCTTQLEEEIKSILNLFRASLIA 208



>gb:AF497999_1805903 Cichorium intybus germacrene A synthase long
           form mRNA, complete cds; alternatively spliced.
          Length = 583

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 46/159 (28%), Positives = 73/159 (45%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T    R   N+ P  W   +I S +  +   E +    +E KE VK ++           
Sbjct: 38  TPEPVRPLANFPPSIWADRFI-SFSLDNSQLEAYANALEEPKEAVKSLITDTTIDANTKL 96

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             I  + RLG SY + +EI A L  ++                 DLY  A++F+V R +G
Sbjct: 97  KLIYSVHRLGLSYLYPDEIDAELNKLF------EKIDLQYYEQVDLYTIAVQFQVFRHHG 150

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + IS +VF  F D     F  ++ +D+KG+L+LYE++ L
Sbjct: 151 YKISSDVFKKFKDSTTGTFTDDVTKDVKGMLSLYESAHL 189



>gb:AF369918_1791998 Picea abies beta-phellandrene synthase-like
           protein mRNA, complete cds.
          Length = 634

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 53/167 (31%), Positives = 74/167 (44%), Gaps = 12/167 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM----------LXXXXXX 302
           RR GNY    WD  +IQSL+T  Y    +  R + LK  +K M          L      
Sbjct: 66  RRRGNYHSNLWDDDFIQSLSTP-YGEPSYRERAETLKGEIKKMFRSISKDDGELITPLND 124

Query: 303 XXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
                  +D ++RLG   HF+ EI +AL  +Y                 DL +TAL FR 
Sbjct: 125 LIQRLWMVDSVERLGIDRHFKNEIKSALDYVYSYWNEKGIGCGRDSVVADLNSTALGFRT 184

Query: 483 LRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFLS 617
           LR +G+ +S EV   F D  G+ +        +I+  LNLY AS ++
Sbjct: 185 LRLHGYTVSSEVLKVFEDQNGQFACSPSKTEGEIRSALNLYRASLIA 231



>gb:AF279456_1782829 Lycopersicon hirsutum sesquiterpene synthase 2
           (SSTLH2) mRNA, complete cds.
          Length = 546

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 3/157 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR---DELKERVKDMLXXXXXXXXXXXXX 323
           R   N+ P  W Y ++      +Y  E     +   DE KE ++ ML             
Sbjct: 10  RPLANFHPTVWGYHFL------YYNPEITNQEKIEVDEYKETIRKMLVEAPEGSEQKLVL 63

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +YHF  EI  ++ +I+                 +L+  +L FR++RQ G  
Sbjct: 64  IDAMQRLGVAYHFHNEIETSIQNIF--------DAPKQNNDDNLHIVSLRFRLVRQQGHY 115

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S +VF  F + +  +F   L  D++GLL+LYEAS L
Sbjct: 116 MSSDVFKQFTN-QDGKFKETLTNDVQGLLSLYEASHL 151



>gb:AF498000_1805904 Cichorium intybus germacrene A synthase short
           form mRNA, complete cds; alternatively spliced.
          Length = 558

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 49/170 (28%), Positives = 76/170 (44%), Gaps = 1/170 (0%)
 Frame = +3

Query: 108 AESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQ-SLNTTHYTAEGFVMRRDELKERVKDML 284
           A  +F     TT   R   N+ P  W   ++  SL+TT    EG+    +E KE V+ ++
Sbjct: 6   ANGTFQANTKTTEPVRPLANFPPSVWGDRFLSFSLDTTEL--EGYAKAMEEPKEEVRKLI 63

Query: 285 XXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYAT 464
                        I  + RLG +Y F +EI A L  ++                 DLY T
Sbjct: 64  VDPTMDSNKKLSLIYSVHRLGLTYLFLQEIEAQLDKLFKEFNLQDYDEF------DLYTT 117

Query: 465 ALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           ++ F+V R  G  +  +VF+ F D     F  ++  D+KG+L LYE++ L
Sbjct: 118 SINFQVFRHLGHKLPCDVFNKFKDSSSGTFKESITNDVKGMLGLYESAQL 167



>gb:AF326117_1786620 Capsicum annuum sesquiterpene cyclase (PSC2)
           mRNA, complete cds.
          Length = 553

 Score = 72.0 bits (175), Expect = 7e-12
 Identities = 48/153 (31%), Positives = 74/153 (48%), Gaps = 1/153 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXX-XXXXXXXXXXID 329
           R   N+ P  W   +  S +  +   E +    + LKE+ + ML              ID
Sbjct: 15  RPVANFSPSLWGDRF-HSFSLDNQVVEKYGQEIETLKEQTRSMLSAACGKTLVEKLNLID 73

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            ++RLG +YHFE++I   L  IY                 DL   ++ FR+LRQ+G+NIS
Sbjct: 74  IVERLGLAYHFEKQIENMLDPIYKADPKFEAHDYN-----DLNTMSIPFRLLRQHGYNIS 128

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
            ++F  F    + +F  ++  D++GLLNLYEAS
Sbjct: 129 PKIFSRF-PKCKGKFKESISNDMRGLLNLYEAS 160



>gb:AF139205_1771400 Abies grandis beta-phellandrene synthase (agc8)
           mRNA, complete cds.
          Length = 630

 Score = 72.0 bits (175), Expect = 7e-12
 Identities = 56/198 (28%), Positives = 88/198 (44%), Gaps = 20/198 (10%)
 Frame = +3

Query: 84  LPSIHRSHAESSFSMCYHTTTTT--------RRSGNYEPPTWDYSYIQSLNTTHYTAEGF 239
           +P++       SF+     + TT        RR G+Y    WD  +IQSL+T  Y    +
Sbjct: 31  IPTLGMCRRGKSFTPSVSMSLTTAVSDDGLQRRIGDYHSNLWDDDFIQSLSTP-YGEPSY 89

Query: 240 VMRRDELKERVKDMLXXXXXXXXXXXX----------XIDELQRLGCSYHFEEEIMAALM 389
             R ++L   VK+M                        +D ++RLG   HF++EI +AL 
Sbjct: 90  RERAEKLIGEVKEMFNSMPSEDGESMSPLNDLIERLWMVDSVERLGIDRHFKKEIKSALD 149

Query: 390 DIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMD--GRRSRFNVN 563
            +Y                 D+ +TA  FR LR +G+++S EV   F D  G+ +     
Sbjct: 150 YVYSYWNEKGIGCGRDSVFPDVNSTASGFRTLRLHGYSVSSEVLKVFQDQNGQFAFSPST 209

Query: 564 LGQDIKGLLNLYEASFLS 617
             +DI+ +LNLY ASF++
Sbjct: 210 KERDIRTVLNLYRASFIA 227



>pir|G71434|G71434 probable limonene cyclase - Arabidopsis
           thaliana>gb:ATCHRIV44_1545476 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 44.>gb:ATFCA6_1551724
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 6.
          Length = 1024

 Score = 72.0 bits (175), Expect = 7e-12
 Identities = 53/130 (40%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 EGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXX 410
           E  V R   LK+ V  ML             ID LQRLG SYHFE+EI   L ++++   
Sbjct: 4   EDNVERVTLLKQEVSKMLNETEGLLEQLEL-IDTLQRLGVSYHFEQEIKKTLTNVHVKNV 62

Query: 411 XXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNL-GQDIKGL 587
                        DLYATALEFR+LRQ+      +VFD           V+L  +DIKG+
Sbjct: 63  RAHKNRIDRNRWGDLYATALEFRLLRQH------DVFD-------GNIGVDLDDKDIKGI 109

Query: 588 LNLYEASFLS 617
           L+LYEAS+LS
Sbjct: 110 LSLYEASYLS 119



>gb:AF369919_1791999 Picea abies myrcene synthase-like protein mRNA,
           complete cds.
          Length = 633

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 57/191 (29%), Positives = 83/191 (43%), Gaps = 18/191 (9%)
 Frame = +3

Query: 99  RSHAESSFSMCYHTTTTT-----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELK 263
           R     S SM  +T  +      RR G+Y    W+  +IQSL TT Y A  ++ R D L 
Sbjct: 42  RMSVTPSMSMSLNTVVSDNDAVQRRIGDYHSNLWNDDFIQSL-TTPYGAPSYIERADGLI 100

Query: 264 ERVKDM----------LXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXX 413
             VK+M          L             +D ++RLG   HF+ EI A+L  +Y     
Sbjct: 101 SEVKEMFNRMCMEDGELMSPLNDLIQRLWTVDSVERLGIDRHFKNEIKASLDYVYSYWNE 160

Query: 414 XXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQ---DIKG 584
                       DL +TAL   +LR +G+ +S EV   F +    +F  +  Q   +I+ 
Sbjct: 161 KGIGCGRTSVVTDLNSTALGAXILRLHGYTVSSEVLKVF-EEENGQFACSPSQTEGEIRS 219

Query: 585 LLNLYEASFLS 617
            LNLY AS ++
Sbjct: 220 FLNLYRASLIA 230



>gb:AB022598_1515240 Solanum tuberosum PVS1 mRNA for vetispiradiene
           synthase, complete cds.
          Length = 556

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 50/160 (31%), Positives = 76/160 (47%), Gaps = 1/160 (0%)
 Frame = +3

Query: 132 YHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXX 311
           Y      R   ++ P  W   +  S +  +  A  +    + LKE+ + +L         
Sbjct: 11  YGEEEIVRPIADFSPSLWGDRF-HSFSLDNQIAGKYAQEIETLKEQSRIILSASSRRTLA 69

Query: 312 XXXX-IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLR 488
                ID ++RLG +YHFE++I   L   Y                 DL   +++FR+LR
Sbjct: 70  EKLDLIDIVERLGIAYHFEKQIDDMLDQFYKADPNFEAHEYN-----DLQTLSVQFRLLR 124

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           Q+G+NIS ++F  F D  + +F  +L  DIKGLLNLYEAS
Sbjct: 125 QHGYNISPKLFIRFQDA-KGKFKESLCNDIKGLLNLYEAS 163



>sp|O24474|TSD2_ABIGR Myrcene synthase, chloroplast precursor (EC
           4.2.3.15).>gb:AGU87908_1811076 Abies grandis myrcene
           synthase (AG2.2) mRNA, complete cds.
          Length = 627

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 52/168 (30%), Positives = 78/168 (46%), Gaps = 13/168 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM----------LXXXXXX 302
           RR G+Y    WD  +IQSL+T  Y    +  R + L   VK +          L      
Sbjct: 64  RRIGDYHSNIWDDDFIQSLSTP-YGEPSYQERAERLIVEVKKIFNSMYLDDGRLMSSFND 122

Query: 303 XXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
                  +D ++RLG + HF+ EI +AL  ++                 DL +TAL FR 
Sbjct: 123 LMQRLWIVDSVERLGIARHFKNEITSALDYVFRYWEENGIGCGRDSIVTDLNSTALGFRT 182

Query: 483 LRQNGFNISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           LR +G+ +S EV   F D +  +F  + GQ   +I+ +LNLY AS ++
Sbjct: 183 LRLHGYTVSPEVLKAFQD-QNGQFVCSPGQTEGEIRSVLNLYRASLIA 229



>gb:AY082672_1569201 Ixeris dentata var. albiflora guaiadiene
           synthase (ISC1) mRNA, complete cds.
          Length = 584

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 43/159 (27%), Positives = 72/159 (45%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T    R   N+ P  W   +I S +  +   E +    +E KE V+ ++           
Sbjct: 38  TPEPVRPLANFPPSIWANRFI-SFSLDNSELEAYANAHEEPKESVRSLITDTTIDASAKL 96

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             I  + RLG SY + EEI A L  ++                 DLY  +++F+V R +G
Sbjct: 97  KLIYSVHRLGLSYLYPEEIDAELDQLFKKIDLHHYEQV------DLYTISVQFQVFRHHG 150

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + +S ++F  F D     F   + +D+KG+L+LYE++ L
Sbjct: 151 YKLSSDIFKKFKDTTTGTFTDEVTKDVKGMLSLYESAHL 189



>gb:AF543531_1810270 Pinus taeda monoterpene synthase-like protein
           mRNA, complete cds.
          Length = 615

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 49/167 (29%), Positives = 75/167 (44%), Gaps = 12/167 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX---- 320
           RR G+Y    WD   I SL T+ Y A  ++ R D L E  KD                  
Sbjct: 64  RRVGDYRYNHWDEDLIDSLATS-YEAPSYLKRADTLVEATKDRFNSMGVDDGQRMSPLTD 122

Query: 321 ------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
                  +D ++RLG   HF+ EI +AL  ++                 DL +TAL  R 
Sbjct: 123 LYQRLWMVDSVERLGIDRHFQNEIKSALDYVFSYWKEKGIGRGRQSAVTDLNSTALGLRT 182

Query: 483 LRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFLS 617
           LR +G+ +S +V + F D  G+ +   +    +I+G+LNL+ AS ++
Sbjct: 183 LRLHGYPVSSDVLENFKDHNGQFTCSGIQTEGEIRGVLNLFRASLIA 229



>gb:AY763425_1627091 Medicago truncatula wound-inducible putative
           cytosolic terpene synthase 1 mRNA, complete cds.
          Length = 562

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 56/164 (34%), Positives = 77/164 (46%), Gaps = 9/164 (5%)
 Frame = +3

Query: 150 TRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDE-------LKERVKDMLXXXXXXX- 305
           +RRS NY P  W   +IQ      Y  E   M  DE       LKE+V+ ML        
Sbjct: 21  SRRSANYHPNIWGDLFIQ------YVLEP--MEFDEIMKQIIMLKEKVRQMLVPNVNVTN 72

Query: 306 -XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
                  ID +QRLG  +HFE+EI   L  I                  DL++ AL FR+
Sbjct: 73  PSREANLIDSIQRLGLYHHFEQEIGELLRHI----DNNHVENGTITLNEDLHSIALVFRL 128

Query: 483 LRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           LRQ G++I  +VF  F +  +  F   L  D++G+L+LYEA+ +
Sbjct: 129 LRQQGYHILPDVFKKFKN-EQGNFKETLVGDVEGMLSLYEATHM 171



>gb:AY473623_1608210 Picea abies (-)-linalool synthase (TPS-Lin)
           mRNA, complete cds.
          Length = 623

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 54/183 (29%), Positives = 83/183 (45%), Gaps = 16/183 (8%)
 Frame = +3

Query: 117 SFSMCYHTTTTT----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDML 284
           S SMC  TT +     RR  ++ P  WD ++IQSL+T  Y A  +  R  +L   VK ++
Sbjct: 47  SISMCLTTTVSDDGVQRRIADHHPNLWDDNFIQSLSTP-YGATAYHERAQKLIGEVKVII 105

Query: 285 XXXXXXXXXXXX----------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXX 434
                                  +D ++RLG   HF+ EI +AL  +Y            
Sbjct: 106 NSILVEDGELITPPNDLLQRLSIVDSIERLGIDRHFKNEIKSALDYVYSYWSEKGIGCGR 165

Query: 435 XXXXXDLYATALEFRVLRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEAS 608
                DL  TAL  R LR +G+ +S +V + F D  G+ +   +    +IK +LNL+ AS
Sbjct: 166 DSVVNDLNTTALGLRTLRLHGYPVSSDVLEQFKDQNGQFACSAIQTEGEIKTVLNLFRAS 225

Query: 609 FLS 617
            ++
Sbjct: 226 LIA 228



>gb:AF489964_1804672 Lactuca sativa germacrene A synthase LTC1 mRNA,
           complete cds.
          Length = 559

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 47/160 (29%), Positives = 72/160 (45%), Gaps = 1/160 (0%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQ-SLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXX 314
           TT   R   N+ P  W   ++  SL+ T    EG+    +E KE V+ ++          
Sbjct: 17  TTEPVRPLANFPPSVWGDRFLSFSLDNTEL--EGYAKAMEEPKEEVRRLIVDPTMDSNKK 74

Query: 315 XXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQN 494
              I  + RLG +Y F +EI A L +I+                 DLY T++ F+V R  
Sbjct: 75  LSLIYSVHRLGLTYLFLQEIEAQLDNIFKAFKLQDYDEV------DLYTTSINFQVFRHL 128

Query: 495 GFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           G  +  +VF+ F D     F  ++  D+KG+L LYE + L
Sbjct: 129 GHKLPCDVFNKFKDSSSGTFKESITNDVKGMLGLYECAQL 168



>gb:AF461460_1801829 Picea abies (+)-3-carene synthase (JF67) mRNA,
           complete cds.
          Length = 627

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 48/167 (28%), Positives = 78/167 (46%), Gaps = 12/167 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RR G++    WD ++IQSL++  Y A  +  R + L   VK++              +D+
Sbjct: 64  RRIGDHHSNLWDDNFIQSLSSP-YGASSYGERAERLIGEVKEIFNSLSRTDGELVSHVDD 122

Query: 333 L----------QRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
           L          +RLG   HF+ EI  +L  +Y                 DL  TAL FR+
Sbjct: 123 LLQHLSMVDNVERLGIDRHFQTEIKVSLDYVYSYWSEKGIGSGRDIVCTDLNTTALGFRI 182

Query: 483 LRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFLS 617
           LR +G+ +  +VF+ F D  GR +  + +  + I  +LNL+ AS ++
Sbjct: 183 LRLHGYTVFPDVFEHFKDQMGRIACSDNHTERQISSILNLFRASLIA 229



>gb:AY237645_1592190 Picea sitchensis pinene synthase mRNA, complete
           cds.
          Length = 627

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 54/186 (29%), Positives = 83/186 (44%), Gaps = 16/186 (8%)
 Frame = +3

Query: 108 AESSFSMCYHTTTTT----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVK 275
           A  S SM   TT +     RR G++    W+  +IQSL+T+ Y    +  R + L   VK
Sbjct: 45  ATPSMSMSLTTTVSDDGVQRRMGDFHSNLWNDDFIQSLSTS-YGEPSYRERAERLIGEVK 103

Query: 276 DMLXXXXXXXXXXXX----------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
            M                        +D ++RLG   HF+ EI +AL  +Y         
Sbjct: 104 KMFNSMSSEDGELISPHNDLIQRVWMVDSVERLGIERHFKNEIKSALDYVYSYWSEKGIG 163

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLY 599
                   DL +TAL FR LR +G+ +S +V + F D  G+ +       ++I+ +LNLY
Sbjct: 164 CGRESVVADLNSTALGFRTLRLHGYAVSADVLNLFKDQNGQFACSPSQTEEEIRSVLNLY 223

Query: 600 EASFLS 617
            AS ++
Sbjct: 224 RASLIA 229



>gb:AY049090_1561819 Nicotiana tabacum cyclase gene, complete cds.
          Length = 597

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 53/196 (27%), Positives = 88/196 (44%), Gaps = 7/196 (3%)
 Frame = +3

Query: 48  NVLSTFTYKLSCLPSIH------RSHAESSFSMCYHTTTTTRRSGNYEPPTW-DYSYIQS 206
           N+    T++L  + S +      R   E       + ++++R   ++    W D+    +
Sbjct: 18  NIWRCSTFELRVIHSSYASIGGRRKERERRMKRAMNPSSSSRHLADFHSTIWGDHFLSYN 77

Query: 207 LNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAAL 386
              T  T +      + LKE V+ ML             ID +QRLG +YHF +EI  ++
Sbjct: 78  SEITEITTQE-KNEHEMLKEIVRKMLVETPDNSTQKLVLIDTIQRLGLAYHFNDEIENSI 136

Query: 387 MDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNL 566
            +I+                 +LY  AL FR+ RQ G+ +S +VF  F +    +F  N 
Sbjct: 137 QNIF-----NLSQNSENDNEHNLYVAALRFRLARQQGYYMSSDVFKQFTN-HDGKFKENH 190

Query: 567 GQDIKGLLNLYEASFL 614
             DI+GLL+LYEA+ +
Sbjct: 191 INDIQGLLSLYEATHM 206



>gb:AF139206_1771401 Abies grandis terpinolene synthase (agc9) mRNA,
           complete cds.
          Length = 630

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 49/169 (28%), Positives = 78/169 (46%), Gaps = 14/169 (8%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX---- 320
           RR   +    WD  +IQSL+T  Y A  +  R D L   VK +                 
Sbjct: 65  RRIVEFHSNLWDDDFIQSLSTP-YGAPSYRERADRLIVEVKGIFTSISAEDGELITPLND 123

Query: 321 ------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
                  +D ++RLG   HF+ EI AAL  +Y                 DL +TAL FR+
Sbjct: 124 LIQRLLMVDNVERLGIDRHFKNEIKAALDYVYSYWNEKGIGSGSDSGVADLNSTALGFRI 183

Query: 483 LRQNGFNISQEVFDCFMDGR-RSRF---NVNLGQDIKGLLNLYEASFLS 617
           LR +G+++S +V + F + + + +F    +   ++IK +LNL+ AS ++
Sbjct: 184 LRLHGYSVSSDVLEHFKEEKEKGQFVCSAIQTEEEIKSVLNLFRASLIA 232



>gb:AX529002_1469920 Sequence 24 from Patent WO02064764.
          Length = 580

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 41/97 (42%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG  YHF+ EI   L                     DLY  AL FR+LRQ+G+ 
Sbjct: 105 IDAVQRLGIDYHFQREIDEIL----------HKQMGIVSACDDLYEVALRFRLLRQHGYF 154

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + ++VF+ F D  +  F   LG+DIKGL++LYEAS L
Sbjct: 155 VPEDVFNNFKDS-KGTFKQVLGEDIKGLMSLYEASQL 190



>gb:AF401234_1796131 Nicotiana tabacum cyclase mRNA, complete cds.
          Length = 598

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 41/119 (34%), Positives = 61/119 (51%)
 Frame = +3

Query: 258 LKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXX 437
           LKE V+ ML             ID +QRLG +YHF +EI  ++ +I+             
Sbjct: 95  LKEIVRKMLVETPDNSTQKLVLIDTIQRLGLAYHFNDEIENSIQNIF-----NLSQNSED 149

Query: 438 XXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
               +LY  AL FR+ RQ G+ +S +VF  F +    +F  N   D++GLL+LYEA+ +
Sbjct: 150 DDEHNLYVAALRFRLARQQGYYMSSDVFKQFTN-HDGKFKENHTNDVQGLLSLYEAAHM 207



>gb:AY495694_1608981 Nicotiana tabacum cultivar T.I.1068 cyclase
           gene, complete cds.
          Length = 598

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 41/119 (34%), Positives = 61/119 (51%)
 Frame = +3

Query: 258 LKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXX 437
           LKE V+ ML             ID +QRLG +YHF +EI  ++ +I+             
Sbjct: 95  LKEIVRKMLVETPDNSTQKLVLIDTIQRLGLAYHFNDEIENSIQNIF-----NLSQNSED 149

Query: 438 XXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
               +LY  AL FR+ RQ G+ +S +VF  F +    +F  N   D++GLL+LYEA+ +
Sbjct: 150 DDEHNLYVAALRFRLARQQGYYMSSDVFKQFTN-HDGKFKENHTNDVQGLLSLYEAAHM 207



>gb:AY473622_1608209 Picea abies (-)-alpha/beta-pinene synthase
           (TPS-Pin) mRNA, partial cds.
          Length = 621

 Score = 67.8 bits (164), Expect = 1e-10
 Identities = 53/186 (28%), Positives = 82/186 (44%), Gaps = 16/186 (8%)
 Frame = +3

Query: 108 AESSFSMCYHTTTTT----RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVK 275
           A  S SM   TT +     RR G++    W+  +IQSL+T+ Y    +  R + L   VK
Sbjct: 39  ATPSMSMSLTTTVSDDGVQRRMGDFHSNLWNDDFIQSLSTS-YGEPSYRERAERLIGEVK 97

Query: 276 DMLXXXXXXXXXXXX----------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
            M                        +D ++RLG   HF+ EI +AL  +Y         
Sbjct: 98  KMFNSMSSEDGELISPHNDLIQRVWMVDSVERLGIERHFKNEIKSALDYVYSYWSEKGIG 157

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLY 599
                   DL +TAL  R LR +G+ +S +V + F D  G+ +       ++I+ +LNLY
Sbjct: 158 CGRESVVADLNSTALGLRTLRLHGYAVSADVLNLFKDQNGQFACSPSQTEEEIRSVLNLY 217

Query: 600 EASFLS 617
            AS ++
Sbjct: 218 RASLIA 223



>gb:AF489965_1804673 Lactuca sativa germacrene A synthase LTC2 mRNA,
           complete cds.
          Length = 557

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 43/159 (27%), Positives = 69/159 (43%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXX 317
           T    R   N+ P  W   ++ S    +   EG+    +  KE ++ ++           
Sbjct: 15  TAEPVRPLANFPPSVWGDRFL-SFTLDNSELEGYAKAMEAPKEELRRLIVDQTMDSNKKL 73

Query: 318 XXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNG 497
             I  + RLG +Y F +EI A L  I+                 DLY T++ F+V R  G
Sbjct: 74  SLIYSVHRLGLTYLFLQEIEAQLDKIFKEFNLQNYDEV------DLYTTSINFQVFRHLG 127

Query: 498 FNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + +  +VF+ F D     F  ++  D+KG+L LYE+S L
Sbjct: 128 YKLPCDVFNKFKDNTSGAFKEDISTDVKGMLGLYESSQL 166



>gb:AF326518_1786661 Abies grandis (-)-4S-limonene synthase gene,
           complete cds.
          Length = 637

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 50/169 (29%), Positives = 77/169 (45%), Gaps = 14/169 (8%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM---------LXXXXXXX 305
           RR  ++ P  W+  +IQSL++  Y    +  R + L E VK+M         L       
Sbjct: 70  RRIADHHPNLWEDDFIQSLSSP-YGGSSYSERAETLVEEVKEMFNSIPNNRELFGSQNDL 128

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXX-DLYATALEFRV 482
                 +D ++RLG   HF+ EI  AL  +Y                  DL +TAL  R 
Sbjct: 129 LTRLWMVDSIERLGIDRHFQNEIRVALDYVYSYWKEKEGIGCGRDSTFPDLNSTALALRT 188

Query: 483 LRQNGFNISQEVFDCFMDGRRSRFN----VNLGQDIKGLLNLYEASFLS 617
           LR +G+N+S +V + F D ++  F     +  GQ  + +LNLY AS ++
Sbjct: 189 LRLHGYNVSSDVLEYFKD-QKGHFACPAILTEGQITRSVLNLYRASLVA 236



>gb:AY640154_1618968 Cucumis sativus E,E-alpha-farnesene synthase
           mRNA, complete cds.
          Length = 561

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 50/156 (32%), Positives = 71/156 (45%), Gaps = 2/156 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRR--DELKERVKDMLXXXXXXXXXXXXXI 326
           RRS  ++   W   Y  S ++        VM +  +ELKE +K  L             I
Sbjct: 16  RRSAQFQASVWG-DYFLSYHSLPPEKGNKVMEKQTEELKEEIKMELVSTTKDEPEKLRLI 74

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
           D +QRLG  YHFE EI   L  ++                 + Y   L FR+LRQ G+N+
Sbjct: 75  DLIQRLGVCYHFENEINNILQQLH-----HITITSEKNGDDNPYNMTLCFRLLRQQGYNV 129

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           S E FD F    R ++  +   +++ LL+LYEAS L
Sbjct: 130 SSEPFDRF----RGKWESSYDNNVEELLSLYEASQL 161



>gb:AX529067_1469942 Sequence 89 from Patent WO02064764.
          Length = 578

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 39/97 (40%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG  +HF+ EI   L                     DL+  AL FR+LRQ+G+ 
Sbjct: 103 IDAVQRLGIDFHFQREIDEIL----------HKQMSNVSASDDLHEVALRFRLLRQHGYF 152

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + ++VF+ F D  +  F   LG+DIKGL++LYEAS L
Sbjct: 153 VPEDVFNNFKDS-KGTFKQVLGEDIKGLMSLYEASQL 188



>gb:AJ786641_1814110 Mentha x piperita mRNA for cis-muuroladiene
           synthase (ORF1).
          Length = 551

 Score = 65.9 bits (159), Expect = 5e-10
 Identities = 41/119 (34%), Positives = 64/119 (53%)
 Frame = +3

Query: 252 DELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXX 431
           + LK+  + ML             ID L+RLG ++HFE E+   +  I            
Sbjct: 48  EALKQEARGMLMAATTPLQQMTL-IDTLERLGLAFHFETEVEYKIEQI---------NAA 97

Query: 432 XXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
                 DL+ATAL FR+LRQ+  ++S +VFD F+D +  +F  +L  +++GLL+LYEA+
Sbjct: 98  AEDDGFDLFATALRFRLLRQHQRHVSCDVFDKFVD-KDGKFEESLSNNVEGLLSLYEAA 155



>gb:AJ786642_1814111 Mentha x piperita mRNA for (E)-beta-farnesene
           synthase (tspa11 gene).
          Length = 550

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 43/119 (36%), Positives = 64/119 (53%)
 Frame = +3

Query: 252 DELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXX 431
           + LK+  + ML             ID L+RLG S+HFE EI   +  I            
Sbjct: 48  EALKQEARGMLMAATTPLQQMTL-IDTLERLGLSFHFETEIEYKIELI----------NA 96

Query: 432 XXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
                 DL+ATAL FR+LRQ+  ++S +VFD F+D +  +F  +L  +++GLL+LYEA+
Sbjct: 97  AEDDGFDLFATALRFRLLRQHQRHVSCDVFDKFID-KDGKFEESLSNNVEGLLSLYEAA 154



>gb:AF024615_1762129 Mentha x piperita (E)-B-farnesene synthase
           (Tspa11) mRNA, complete cds.
          Length = 550

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 43/119 (36%), Positives = 64/119 (53%)
 Frame = +3

Query: 252 DELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXX 431
           + LK+  + ML             ID L+RLG S+HFE EI   +  I            
Sbjct: 48  EALKQEARGMLMAATTPLQQMTL-IDTLERLGLSFHFETEIEYKIELI----------NA 96

Query: 432 XXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
                 DL+ATAL FR+LRQ+  ++S +VFD F+D +  +F  +L  +++GLL+LYEA+
Sbjct: 97  AEDDGFDLFATALRFRLLRQHQRHVSCDVFDKFID-KDGKFEESLSNNVEGLLSLYEAA 154



>gb:AY362553_1602613 Ocimum basilicum geraniol synthase (GES) mRNA,
           complete cds.
          Length = 567

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 48/138 (34%), Positives = 62/138 (44%)
 Frame = +3

Query: 201 QSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMA 380
           Q  NT  +  E    RR+ L E     L             ID +Q+LG  Y+FE+ I A
Sbjct: 58  QRKNTRQHMEESSSKRREYLLEETTRKLQRNDTESVEKLKLIDNIQQLGIGYYFEDAINA 117

Query: 381 ALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNV 560
            L   +                 DL+  AL FR+LR NG  IS E+F  F D  R +F+ 
Sbjct: 118 VLRSPF------------STGEEDLFTAALRFRLLRHNGIEISPEIFLKFKD-ERGKFDE 164

Query: 561 NLGQDIKGLLNLYEASFL 614
           +   D  GLL+LYEAS L
Sbjct: 165 S---DTLGLLSLYEASNL 179



>sp|O22340|TSD3_ABIGR (4S)-limonene synthase, chloroplast precursor
           (EC 4.2.3.16) ((-)-(4S)- limonene
           synthase).>gb:AF006193_1760855 Abies grandis
           (-)-4S-limonene synthase mRNA, complete cds.
          Length = 637

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 49/169 (28%), Positives = 76/169 (44%), Gaps = 14/169 (8%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM---------LXXXXXXX 305
           RR  ++ P  W+  +IQSL++  Y    +  R + + E VK+M         L       
Sbjct: 70  RRIADHHPNLWEDDFIQSLSSP-YGGSSYSERAETVVEEVKEMFNSIPNNRELFGSQNDL 128

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXX-DLYATALEFRV 482
                 +D ++RLG   HF+ EI  AL  +Y                  DL +TAL  R 
Sbjct: 129 LTRLWMVDSIERLGIDRHFQNEIRVALDYVYSYWKEKEGIGCGRDSTFPDLNSTALALRT 188

Query: 483 LRQNGFNISQEVFDCFMDGRRSRFN----VNLGQDIKGLLNLYEASFLS 617
           LR +G+N+S +V + F D  +  F     +  GQ  + +LNLY AS ++
Sbjct: 189 LRLHGYNVSSDVLEYFKD-EKGHFACPAILTEGQITRSVLNLYRASLVA 236



>gb:AATERPENE_1508235 Artemisia annua mRNA for epi-cedrol
           synthase.>gb:AF157059_1773065 Artemisia annua
           8-epicedrol synthase (Ecs1) mRNA, complete cds.
          Length = 547

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 3/131 (2%)
 Frame = +3

Query: 231 EGFVMRRDELKERVKDMLXXXXXXXXXXXXX---IDELQRLGCSYHFEEEIMAALMDIYM 401
           EG      +LKE VK  L                ID ++RLG +Y+FEEEI      +Y 
Sbjct: 33  EGVEQVIKDLKEEVKSELLTALNSPTQHTELLKFIDAIERLGIAYYFEEEINQVFQHMYT 92

Query: 402 XXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIK 581
                               T+L FR++RQ+GF +S ++F  + D +  RF  +L +D+ 
Sbjct: 93  AYGDKWTGGN----------TSLWFRLMRQHGFFVSSDIFSTYKD-KEGRFKESLEKDVH 141

Query: 582 GLLNLYEASFL 614
           GLL LYEA+++
Sbjct: 142 GLLELYEAAYM 152



>gb:AAN249561_1508199 Artemisia annua mRNA for putative
           sesquiterpene cyclase.
          Length = 547

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 3/131 (2%)
 Frame = +3

Query: 231 EGFVMRRDELKERVKDMLXXXXXXXXXXXXX---IDELQRLGCSYHFEEEIMAALMDIYM 401
           EG      +LKE VK  L                ID ++RLG +Y+FEEEI      +Y 
Sbjct: 33  EGVEQVIKDLKEEVKSELLTALNSPTQHTELLKFIDAIERLGIAYYFEEEINQVFQHMYT 92

Query: 402 XXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIK 581
                               T+L FR++RQ+GF +S ++F  + D +  RF  +L +D+ 
Sbjct: 93  AYGDKWTGGN----------TSLWFRLMRQHGFFVSSDIFSTYKD-KEGRFKESLEKDVH 141

Query: 582 GLLNLYEASFL 614
           GLL LYEA+++
Sbjct: 142 GLLELYEAAYM 152



>gb:AX529000_1469919 Sequence 22 from Patent WO02064764.
          Length = 552

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 39/97 (40%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG  Y+F+ EI   L                     DL+  AL FR+LRQ+G+ 
Sbjct: 77  IDAVQRLGIDYNFQREIDEIL----------HKQMSIVSARDDLHEVALRFRLLRQHGYF 126

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + ++VF+ F D  +  F   LG+DIKGL++LYEAS L
Sbjct: 127 VPEDVFNNFKDS-KGTFKQVLGEDIKGLMSLYEASQL 162



>gb:AX528996_1469917 Sequence 18 from Patent
           WO02064764.>gb:AX528998_1469918 Sequence 20 from Patent
           WO02064764.
          Length = 519

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 39/97 (40%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG  Y+F+ EI   L                     DL+  AL FR+LRQ+G+ 
Sbjct: 44  IDAVQRLGIDYNFQREIDEIL----------HKQMSIVSARDDLHEVALRFRLLRQHGYF 93

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + ++VF+ F D  +  F   LG+DIKGL++LYEAS L
Sbjct: 94  VPEDVFNNFKDS-KGTFKQVLGEDIKGLMSLYEASQL 129



>gb:AF543530_1810269 Pinus taeda (+)-alpha-pinene synthase mRNA,
           complete cds.
          Length = 628

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 12/188 (6%)
 Frame = +3

Query: 90  SIHRSHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKER 269
           SI  S + SS +   +     RR   +    WD   I SL+T+ Y A  +  R D+L   
Sbjct: 44  SIAPSMSMSSTTSVSNEDGVPRRIAGHHSNLWDDDSIASLSTS-YEAPSYRKRADKLIGE 102

Query: 270 VKDMLXXXXXXXXXXXX----------XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXX 419
           VK++                        +D ++RLG   HF++EI +AL  +Y       
Sbjct: 103 VKNIFDLMSVEDGVFTSPLSDLHHRLWMVDSVERLGIDRHFKDEINSALDHVYSYWTEKG 162

Query: 420 XXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLN 593
                     DL +TAL  R LR +G+ +S  V D F +  G+ +   +    +I+ +LN
Sbjct: 163 IGRGRESGVTDLNSTALGLRTLRLHGYTVSSHVLDHFKNEKGQFTCSAIQTEGEIRDVLN 222

Query: 594 LYEASFLS 617
           L+ AS ++
Sbjct: 223 LFRASLIA 230



>gb:AX529065_1469941 Sequence 87 from Patent WO02064764.
          Length = 554

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 39/97 (40%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG  Y+F+ EI   L                     DL+  AL FR+LRQ+G+ 
Sbjct: 79  IDAVQRLGIDYNFQREIDEIL----------HKQMSIVSACDDLHEVALRFRLLRQHGYF 128

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + ++VF+ F D  +  F   LG+DIKGL++LYEAS L
Sbjct: 129 VPEDVFNNFKDS-KGMFKQVLGEDIKGLMSLYEASQL 164



>gb:AF139207_1771402 Abies grandis (-)-limonene/(-)-alpha-pinene
           synthase (agc11) mRNA, complete cds.
          Length = 637

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 49/169 (28%), Positives = 76/169 (44%), Gaps = 14/169 (8%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM---------LXXXXXXX 305
           RR  ++ P  W+  +IQSL++  Y    +  R   + E VK+M         L       
Sbjct: 70  RRIADHHPNLWEDDFIQSLSSP-YGGSSYSERAVTVVEEVKEMFNSIPNNRELFGSQNDL 128

Query: 306 XXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXX-DLYATALEFRV 482
                 +D ++RLG   HF+ EI  AL  +Y                  DL +TAL  R 
Sbjct: 129 LTRLWMVDSIERLGIDRHFQNEIRVALDYVYSYWKEKEGIGCGRDSTFPDLNSTALALRT 188

Query: 483 LRQNGFNISQEVFDCFMDGRRSRFN----VNLGQDIKGLLNLYEASFLS 617
           LR +G+N+S +V + F D ++  F     +  GQ  + +LNLY AS ++
Sbjct: 189 LRLHGYNVSSDVLEYFKD-QKGHFACPAILTEGQITRSVLNLYRASLVA 236



>gb:ATH544238_1552875 Arabidopsis thaliana mRNA for putative
           delta-cadinene synthase, PUP8 (At5g23960 gene).
          Length = 545

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 44/137 (32%), Positives = 63/137 (45%)
 Frame = +3

Query: 198 IQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIM 377
           + S + +    E F  +   LKE VK+               ID L RLG SYHFE++I+
Sbjct: 21  LTSFSKSDLGTETFKEKHSTLKEAVKEAFMSSKANPIENIKFIDALCRLGVSYHFEKDIV 80

Query: 378 AALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFN 557
             L   +                 DLY   + F+V RQ GF +S +VF+ F D    +F 
Sbjct: 81  EQLDKSF---DCLDFPQMVRQEGCDLYTVGIIFQVFRQFGFKLSADVFEKFKD-ENGKFK 136

Query: 558 VNLGQDIKGLLNLYEAS 608
            +L  D  G+L+LYEA+
Sbjct: 137 GHLVTDAYGMLSLYEAA 153



>gb:AB009056_1510747 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MZF18.
          Length = 522

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 44/137 (32%), Positives = 63/137 (45%)
 Frame = +3

Query: 198 IQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIM 377
           + S + +    E F  +   LKE VK+               ID L RLG SYHFE++I+
Sbjct: 21  LTSFSKSDLGTETFKEKHSTLKEAVKEAFMSSKANPIENIKFIDALCRLGVSYHFEKDIV 80

Query: 378 AALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFN 557
             L   +                 DLY   + F+V RQ GF +S +VF+ F D    +F 
Sbjct: 81  EQLDKSF---DCLDFPQMVRQEGCDLYTVGIIFQVFRQFGFKLSADVFEKFKD-ENGKFK 136

Query: 558 VNLGQDIKGLLNLYEAS 608
            +L  D  G+L+LYEA+
Sbjct: 137 GHLVTDAYGMLSLYEAA 153



>gb:AP005160_1848453 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0031C24.
          Length = 532

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 43/123 (34%), Positives = 60/123 (48%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           R D+L E V  ML             +D LQRLG  +HFEE+I   L +I+         
Sbjct: 32  RVDQLVEEVGRMLEVCKDDVVKQMNLVDVLQRLGIDHHFEEQIDTILKNIHRAEFNSS-- 89

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                   DLY  AL FR+LR+ G+ +S + F+ F     S  + ++  D KGLL+LY A
Sbjct: 90  --------DLYEVALRFRLLRKQGYWVSPDEFNKFKAEDGSFSSDDITNDPKGLLSLYNA 141

Query: 606 SFL 614
           + L
Sbjct: 142 AHL 144



>gb:AX529063_1469940 Sequence 85 from Patent WO02064764.
          Length = 554

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 38/97 (39%), Positives = 53/97 (54%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG  +HF+ EI   L                     DL+  AL FR+LRQ+G+ 
Sbjct: 79  IDAVQRLGIDFHFQREIDEIL----------HKQMSNVSASDDLHEVALRFRLLRQHGYF 128

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           + ++VF+ F D  +  F   LG+DIKGL++LY AS L
Sbjct: 129 VPEDVFNNFKDS-KGTFKQVLGEDIKGLMSLYGASQL 164



>gb:CQ813536_1453490 Sequence 32 from Patent WO2004031376.
          Length = 260

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 38/98 (38%), Positives = 53/98 (54%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID  QRLG +YHFE+EI   L  +                  DLY  +L FR+ RQ G  
Sbjct: 6   IDAAQRLGVAYHFEKEIEDELGKV-----------SHDLDSDDLYVVSLRFRLFRQQGVK 54

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           IS +VF+ F D    +F  +L  DI+G+ +LYEA++L+
Sbjct: 55  ISCDVFEKFKDD-EGKFKESLINDIRGMSSLYEAAYLA 91



>gb:AY693647_1623445 Ocimum basilicum R-linalool synthase (LIS)
           mRNA, complete cds.
          Length = 574

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 46/135 (34%), Positives = 60/135 (44%)
 Frame = +3

Query: 210 NTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALM 389
           NT  +  E    RR+ L E     L             ID +QRLG  Y+FE+ I A L 
Sbjct: 61  NTHQHVEERSSKRREYLLEETARKLQRNDTESVEKLKLIDNIQRLGIGYYFEDAIDAVLR 120

Query: 390 DIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLG 569
             +                 DL+  AL FR+LR NG  ++ E+F  F D  R  F+ +  
Sbjct: 121 SPF-----------SAEEEEDLFTAALRFRLLRHNGIQVTPEIFLKFKD-ERGEFDES-- 166

Query: 570 QDIKGLLNLYEASFL 614
            D  GLL+LYEAS L
Sbjct: 167 -DTLGLLSLYEASNL 180



>gb:AF543527_1810266 Pinus taeda (-)-alpha-pinene synthase mRNA,
           complete cds.
          Length = 629

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 48/168 (28%), Positives = 76/168 (45%), Gaps = 13/168 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           RR G++    WD   IQSL++  Y    +  R + L   VK+               +D+
Sbjct: 66  RRRGDFHSNLWDDDLIQSLSSP-YGEPSYRERAERLIGEVKNSFNSMSNEDGESITPLDD 124

Query: 333 L----------QRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRV 482
           L          +RLG   HF++EI +AL  +Y                 DL +TAL  R 
Sbjct: 125 LIQRLWMVDSVERLGIDRHFKKEIKSALDHVYRYWSEKGIGCGRESVVTDLNSTALGLRT 184

Query: 483 LRQNGFNISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           LR +G+++S +V + F + +  +F   L Q    I+ +LNLY AS ++
Sbjct: 185 LRLHGYDVSADVLNHFKN-QSGQFACTLKQTEDQIRTVLNLYRASLIA 231



>gb:AF472361_1803078 Artemisia annua beta-caryophyllene synthase
           QHS1 (QHS1) mRNA, complete cds.
          Length = 548

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 39/97 (40%), Positives = 53/97 (54%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +YHFEEEI  AL  IY                    + +L FR+LRQ GF 
Sbjct: 69  IDAIQRLGIAYHFEEEIEQALQHIYDTYGDDWKGR----------SPSLWFRILRQQGFY 118

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S ++F  +     S F  +L  D++GLL LYEA++L
Sbjct: 119 VSCDIFKNYKKEDGS-FKESLTNDVEGLLELYEATYL 154



>gb:AF327526_1786810 Artemisia annua amorpha-4,11-diene synthase
           (AMS1) mRNA, complete cds.>gb:AF327527_1786811 Artemisia
           annua amorpha-4,11-diene synthase (AMS1) gene, complete
           cds.
          Length = 546

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 46/155 (29%), Positives = 72/155 (46%), Gaps = 3/155 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXX---XXXXXXX 323
           R   N+ P  W   ++          E  V   ++LK+ V+ +L                
Sbjct: 10  RPIANFPPSIWGDQFLIYEKQVEQGVEQIV---NDLKKEVRQLLKEALDIPMKHANLLKL 66

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           IDE+QRLG  YHFE+EI  AL  IY                 D   ++L FR++R+ G+ 
Sbjct: 67  IDEIQRLGIPYHFEQEIDHALQCIY----------ETYGDNWDGDRSSLWFRLMRKQGYY 116

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++ +VF+ + D +   F  +L  D++GLL LYEA+
Sbjct: 117 VTCDVFNNYKD-KDGAFKQSLANDVEGLLELYEAT 150



>gb:OSJN00073_1694333 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0027H06, complete sequence.
          Length = 497

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 47/143 (32%), Positives = 64/143 (44%), Gaps = 6/143 (4%)
 Frame = +3

Query: 204 SLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX---IDELQRLGCSYHFEEEI 374
           +LN T    E    RRD+L  +V  M+                +D ++RLG  YHF EEI
Sbjct: 45  TLNVT--LEESIKERRDKLVTKVHCMIQGYTSSKIHLSHGMKIVDAIERLGVGYHFHEEI 102

Query: 375 ---MAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRR 545
              M  L D                   D+   AL FR+LRQ+ +N   +VF CF+D + 
Sbjct: 103 GMFMRVLND-------------TPARENDMAEAALRFRLLRQHHYNAPSDVFGCFLD-KN 148

Query: 546 SRFNVNLGQDIKGLLNLYEASFL 614
             F   L  D+  LL+LYEA+ L
Sbjct: 149 GDFKETLRHDVDALLSLYEAAHL 171



>gb:AAN271793_1508202 Artemisia annua mRNA for putative
           sesquiterpene cyclase (cASC34 gene).
          Length = 549

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 38/97 (39%), Positives = 51/97 (52%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +YHFEEEI  AL  IY                    + +L FR+LRQ GF 
Sbjct: 69  IDAIQRLGIAYHFEEEIEQALQHIYDTYGDDWKGR----------SPSLWFRILRQQGFY 118

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S ++F  +     S     L  D++GLL LYEA++L
Sbjct: 119 VSCDIFKNYKKEDGSILRNPLTNDVEGLLELYEATYL 155



>pir|G96588|G96588 hypothetical protein T22H22.10 [imported] -
           Arabidopsis thaliana>gb:AE005173_893363 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:T22H22_1723775 Sequence of BAC T22H22 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 530

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 40/120 (33%), Positives = 58/120 (48%)
 Frame = +3

Query: 258 LKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXX 437
           LKE V+ +L             ID L RLG SYHFE       +DI+             
Sbjct: 52  LKETVRGLLMASKEEPIENIKFIDALCRLGVSYHFE-------VDIFTQLETMFGVMMIR 104

Query: 438 XXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
               DLY  +L F++ RQ G+ +  +VF+ F + +  +F  +L +D +GLL LYEA+  S
Sbjct: 105 GNEFDLYTVSLVFQIFRQFGYKLGVDVFNNFKN-KDGKFKEHLAEDARGLLCLYEAAHWS 163



>gb:AY693645_1623443 Ocimum basilicum gamma-cadinene synthase (CDS)
           mRNA, complete cds.
          Length = 540

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 48/148 (32%), Positives = 71/148 (47%)
 Frame = +3

Query: 165 NYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRL 344
           +Y P  W  ++  +++      + +    + LK+ V+ ML             ID L+RL
Sbjct: 15  SYAPNIWADTF-SNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIF-IDTLERL 72

Query: 345 GCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFD 524
           G +YHFE EI   L  IY                 DL+ TAL FR+LRQ+  ++S +VFD
Sbjct: 73  GLAYHFETEIEHKLQKIY--------DDNVCGDDCDLFTTALRFRLLRQHRHHVSCDVFD 124

Query: 525 CFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
            F+     +F      D +GLL+LYEAS
Sbjct: 125 KFL-YEEGKFK----GDAEGLLSLYEAS 147



>gb:AY006482_1557857 Artemisia annua amorpha-4,11-diene synthase
           mRNA, complete cds.
          Length = 546

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 3/155 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXX---XXXXXXX 323
           R   N+ P  W   ++          E  V   ++LK+ V+ +L                
Sbjct: 10  RPIANFPPSIWGDQFLIYQKQVEQGVEQIV---NDLKKEVRQLLKEALDIPMKHANLLKL 66

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           IDE+QRLG  YHFE EI  AL  IY                     ++L FR++R+ G+ 
Sbjct: 67  IDEIQRLGIPYHFEREIDHALQCIYETYGDNWNGD----------RSSLWFRLMRKQGYY 116

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++ +VF+ + D +   F  +L  D++GLL LYEA+
Sbjct: 117 VTCDVFNNYKD-KNGAFKQSLANDVEGLLELYEAT 150



>gb:AF138959_1771392 Artemisia annua amorpha-4,11-diene synthase
           mRNA, complete cds.
          Length = 546

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 3/155 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXX---XXXXXXX 323
           R   N+ P  W   ++          E  V   ++LK+ V+ +L                
Sbjct: 10  RPIANFPPSIWGDQFLIYEKQVEQGVEQIV---NDLKKEVRQLLKEALDIPMKHANLLKL 66

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           IDE+QRLG  YHFE EI  AL  IY                     ++L FR++R+ G+ 
Sbjct: 67  IDEIQRLGIPYHFEREIDHALQCIYETYGDNWNGD----------RSSLWFRLMRKQGYY 116

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++ +VF+ + D +   F  +L  D++GLL LYEA+
Sbjct: 117 VTCDVFNNYKD-KNGAFKQSLANDVEGLLELYEAT 150



>gb:AAN251751_1508200 Artemisia annua mRNA for amorpha-4,11-diene
           yynthase (kcs12 gene).
          Length = 546

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 3/155 (1%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXX---XXXXXXX 323
           R   N+ P  W   ++          E  V   ++LK+ V+ +L                
Sbjct: 10  RPIANFPPSIWGDQFLIYEKQVEQGVEQIV---NDLKKEVRQLLKEALDIPMKHANLLKL 66

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           IDE+QRLG  YHFE EI  AL  IY                     ++L FR++R+ G+ 
Sbjct: 67  IDEIQRLGIPYHFEREIDHALQCIYETYGDNWNGD----------RSSLWFRLMRKQGYY 116

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++ +VF+ + D +   F  +L  D++GLL LYEA+
Sbjct: 117 VTCDVFNNYKD-KNGAFKQSLANDVEGLLELYEAT 150



>gb:OSJN00039_1693729 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0032I19, complete sequence.
          Length = 523

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 42/125 (33%), Positives = 63/125 (50%), Gaps = 2/125 (1%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           R ++LKE V  +              +D +Q LG  + F+EEI +AL DI+         
Sbjct: 15  RANKLKEDVCGLFIMASNGILERMNLVDTIQHLGIDHLFQEEIDSALKDIH--------- 65

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFN--VNLGQDIKGLLNLY 599
                    L+  AL FR+LR++GF +S +VF+ F  G    FN  ++L  D +GLL+LY
Sbjct: 66  -ENDLASSKLHEVALRFRLLREHGFWVSPDVFNKF-KGDHGTFNNELSLADDPRGLLSLY 123

Query: 600 EASFL 614
            A+ L
Sbjct: 124 NAAHL 128



>gb:AF543529_1810268 Pinus taeda alpha-terpineol synthase mRNA,
           complete cds.
          Length = 627

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 46/163 (28%), Positives = 73/163 (44%), Gaps = 8/163 (4%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI-- 326
           RR+G Y    W+   IQ L+T  Y    +  R + L + V+D+              I  
Sbjct: 64  RRTGGYLSNLWNDDVIQFLSTP-YGELAYRERAERLIDEVRDIFSSMSLEDGEFSDLIQR 122

Query: 327 ----DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQN 494
               D ++RLG   HF+ EI +AL  +Y                 +L +TAL FR LR +
Sbjct: 123 LWMVDNVERLGIDRHFKNEIKSALDYVYSYWSEKGIGCGTKSIITNLNSTALGFRTLRLH 182

Query: 495 GFNISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFLS 617
           G+ +S +V   F +  G+         +DI+ ++NLY AS ++
Sbjct: 183 GYPVSADVLKHFRNQIGQFVSCPSETEEDIRIMVNLYRASLIA 225



>gb:AF497491_1805886 Arabidopsis thaliana
           beta-caryophyllene/alpha-humulene synthase mRNA,
           complete cds.
          Length = 547

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 43/137 (31%), Positives = 62/137 (45%)
 Frame = +3

Query: 198 IQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIM 377
           + S + +    E F  +   LKE VK+               ID L RLG S HFE++I+
Sbjct: 21  LTSFSKSDLGTETFKEKHSTLKEAVKEAFMSSKANPIENIKFIDALCRLGVSCHFEKDIV 80

Query: 378 AALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFN 557
             L   +                 DLY   + F+V RQ GF +S +VF+ F D    +F 
Sbjct: 81  EQLDKSF---DCLDFPQMVRQEGCDLYTVGIIFQVFRQFGFKLSADVFEKFKD-ENGKFK 136

Query: 558 VNLGQDIKGLLNLYEAS 608
            +L  D  G+L+LYEA+
Sbjct: 137 GHLVTDAYGMLSLYEAA 153



>gb:AY766249_1627649 Medicago truncatula wound-inducible putative
           chloroplast terpene synthase 3 mRNA, complete cds;
           nuclear gene for chloroplast product.
          Length = 573

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 36/98 (36%), Positives = 51/98 (52%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D +QRLG  Y+FEEEI A L   +                  L   A +FR+LRQ G+ 
Sbjct: 81  VDSIQRLGMEYNFEEEIEATLERKH---TMLRFQNFQRNEYQGLSQAAFQFRMLRQEGYY 137

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           IS ++FD F D  + +      +DI G++ L+EAS LS
Sbjct: 138 ISPDIFDKFCD-NKGKLKYTFSEDINGMIALFEASQLS 174



>gb:AF497486_1805881 Arabidopsis thaliana terpene synthase mRNA,
           complete cds.
          Length = 611

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 59/198 (29%), Positives = 86/198 (43%), Gaps = 10/198 (5%)
 Frame = +3

Query: 45  LNVLSTFTYKLSCLPSIHRSHAESSFSMCYHTTTT-------TRRSGNYEPPT-WDYSYI 200
           LN+ S++ Y L    S+  S  +S   +C    TT       T RS    PP+ W + ++
Sbjct: 23  LNLSSSYHYPL-LKSSLSFSRFQSPKKLCLVRATTNPTDDNSTTRSFTPHPPSLWGHHFL 81

Query: 201 Q-SLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX-XIDELQRLGCSYHFEEEI 374
             S+N T    +    + + LK  V  ML              I  L  LG SYHFEE I
Sbjct: 82  SASVNQTEM--DDLWRQIEALKPIVNAMLLPCNGADAKKITCFIHTLVSLGVSYHFEERI 139

Query: 375 MAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRF 554
           +  L D++                 DLY  ++ FRV R  G  I+ ++F+ F  G    F
Sbjct: 140 VEFLKDVF----ENIEDIIIDCKEDDLYTVSVIFRVFRLYGHYITPDIFNRF-KGDDGNF 194

Query: 555 NVNLGQDIKGLLNLYEAS 608
              L  D++G+L+ YEAS
Sbjct: 195 KKCLNDDVRGMLSFYEAS 212



>gb:AF326515_1786658 Abies grandis E-alpha-bisabolene synthase gene,
           partial cds.
          Length = 816

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 38/101 (37%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D + RLG   HFE+EI  AL  +Y                 DL  TAL FR+LR + +N
Sbjct: 304 VDNIVRLGIYRHFEKEIKEALDYVYRHWNERGIGWGRLNPIADLETTALGFRLLRLHRYN 363

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           +S  +FD F D    +F  + GQ   D+  +LNLY AS L+
Sbjct: 364 VSPAIFDNFKDA-NGKFICSTGQFNKDVASMLNLYRASQLA 403



>gb:AF006195_1760857 Abies grandis E-alpha-bisabolene synthase mRNA,
           complete cds.
          Length = 817

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 38/101 (37%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D + RLG   HFE+EI  AL  +Y                 DL  TAL FR+LR + +N
Sbjct: 305 VDNIVRLGIYRHFEKEIKEALDYVYRHWNERGIGWGRLNPIADLETTALGFRLLRLHRYN 364

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           +S  +FD F D    +F  + GQ   D+  +LNLY AS L+
Sbjct: 365 VSPAIFDNFKDA-NGKFICSTGQFNKDVASMLNLYRASQLA 404



>gb:AF006194_1760856 Abies grandis E-alpha-bisabolene synthase mRNA,
           partial cds.
          Length = 782

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 38/101 (37%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D + RLG   HFE+EI  AL  +Y                 DL  TAL FR+LR + +N
Sbjct: 270 VDNIVRLGIYRHFEKEIKEALDYVYRHWNERGIGWGRLNPIADLETTALGFRLLRLHRYN 329

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           +S  +FD F D    +F  + GQ   D+  +LNLY AS L+
Sbjct: 330 VSPAIFDNFKDA-NGKFICSTGQFNKDVASMLNLYRASQLA 369



>gb:AY518316_1610802 Zea mays B73 terpene synthase 7 (TPS7) mRNA,
           complete cds.
          Length = 548

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 46/160 (28%), Positives = 67/160 (41%), Gaps = 1/160 (0%)
 Frame = +3

Query: 138 TTTTTRRSGNYEPPTWDYSYIQSL-NTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXX 314
           T TT+  +  + P  W   +I+ +      + E    R   L+E V  M           
Sbjct: 4   TGTTSMPAPVFHPTVWGDYFIKFVPEPLQVSDETMAERIRHLREEVSGMFQACKNVVDKT 63

Query: 315 XXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQN 494
              +D +QRLG  +HFEE+I  AL  I+                  L+  AL FR+LRQ 
Sbjct: 64  NL-VDVVQRLGIDHHFEEQIATALASIH---------SAGLFNSSSLHEAALRFRLLRQQ 113

Query: 495 GFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           GF +  +    F+      F   +  D KGLL+LY A+ L
Sbjct: 114 GFWVPADELVKFIKNEDGSFIDGITNDPKGLLSLYNAAHL 153



>gb:AF497490_1805885 Arabidopsis thaliana terpene synthase mRNA,
           complete cds.
          Length = 602

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 44/156 (28%), Positives = 66/156 (42%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI 326
           T+R S  + P  W   ++ S++  H          + +K  VKDML             I
Sbjct: 58  TSRPSTYFSPSLWGDHFL-SVSLDHAEFVELEREIETMKPLVKDMLMSSQSSDKEKIRLI 116

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
             L  LG SYHF++EI   L   +                 DL   ++ F V R  G  +
Sbjct: 117 HLLVSLGSSYHFDKEIQDILKHSF------TKLDDIIVEEDDLETISIMFEVFRLYGHKM 170

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           S + FD F  G   RF  +L +D++G+L L+E + L
Sbjct: 171 SCDAFDRFRGG-DGRFKESLAKDVRGMLQLFEVAHL 205



>gb:AF453326_1800902 Gossypium hirsutum (+)-delta-cadinene synthase
           mRNA, partial cds.
          Length = 220

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 27/55 (49%), Positives = 41/55 (74%)
 Frame = +3

Query: 450 DLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           DLY T+L FR+LR++GFN+S +VF+ F D  +  F  ++  D++GLL LY+AS+L
Sbjct: 20  DLYTTSLRFRLLREHGFNVSCDVFNKFKD-EQGNFKSSVTSDVRGLLELYQASYL 73



>gb:AY673673_1621343 Solidago canadensis cascarilladiene synthase
           mRNA, complete cds.
          Length = 559

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 39/158 (24%), Positives = 70/158 (44%)
 Frame = +3

Query: 141 TTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX 320
           TT  R    + P  W   ++ S +  +   +  V    E  + ++ ++            
Sbjct: 18  TTIVRPIAKFPPSLWGDRFL-SFDLDNLELDDCVAAMKEPSDEIQRLIVDPDMDSNEKLR 76

Query: 321 XIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGF 500
            I+ + RLG SY F ++I   L  ++                 DLY T++ F V RQ+G+
Sbjct: 77  LINCVCRLGLSYLFIKDIECQLEKLFKELNMEEYNEF------DLYTTSVNFLVFRQHGY 130

Query: 501 NISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +S +VF+ F D    +F  ++  D+KG+L+ YE + L
Sbjct: 131 KLSCDVFNKFKDVSTGKFKEHITSDVKGMLSFYECTHL 168



>gb:AB023038_1515397 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIE1.
          Length = 602

 Score = 58.5 bits (140), Expect = 8e-08
 Identities = 44/156 (28%), Positives = 66/156 (42%)
 Frame = +3

Query: 147 TTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI 326
           T+R S  + P  W   ++ S++  H          + +K  VKDML             I
Sbjct: 58  TSRPSTYFSPSLWGDHFL-SVSLDHAEFVELEREIETMKPLVKDMLMSSQSSDKEKIRLI 116

Query: 327 DELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNI 506
             L  LG SYHF++EI   L   +                 DL   ++ F V R  G  +
Sbjct: 117 HLLVSLGSSYHFDKEIQDILKHSF------TKLDGIIVEEDDLETISIMFEVFRLYGHKM 170

Query: 507 SQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           S + FD F  G   RF  +L +D++G+L L+E + L
Sbjct: 171 SCDAFDRFRGG-DGRFKESLAKDVRGMLQLFEVAHL 205



>gb:OSJN00107_1695043 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0062B06, complete sequence.
          Length = 507

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 41/125 (32%), Positives = 62/125 (49%)
 Frame = +3

Query: 240 VMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXX 419
           V R ++LK+ V+ M              +D +Q LG  + F+EEI  +L +I        
Sbjct: 2   VERAEKLKDDVRTMFETCDSTEGRLQL-VDAIQHLGIDHLFKEEIEYSLSEI-------- 52

Query: 420 XXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLY 599
                      L+  AL FR+LRQ+GF++S +VF+ F  G   RF   +  D +GLL+LY
Sbjct: 53  --NASEFISSSLHDVALRFRLLRQHGFHVSPDVFNKF-KGDDGRFVSGITNDPRGLLSLY 109

Query: 600 EASFL 614
            A+ L
Sbjct: 110 NAAHL 114



>pir|D85035|D85035 ent-kaurene synthetase A-like protein [imported]
           - Arabidopsis thaliana>gb:AC004044_1531339 Arabidopsis
           thaliana BAC T5J8 from chromosome IV, top arm, complete
           sequence.>gb:ATCHRIV7_1546787 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 7.>gb:ATU11034_1556744
           Arabidopsis thaliana ent-kaurene synthetase A (GA1)
           mRNA, complete cds.
          Length = 802

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 1/99 (1%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D LQRLG S +FEEEI   L  ++                 D+  TA+ FR+LRQ+G+ 
Sbjct: 335 VDRLQRLGISRYFEEEIKECLDYVHRYWTDNGICWARCSHVQDIDDTAMAFRLLRQHGYQ 394

Query: 504 ISQEVFDCF-MDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +S +VF  F  +G    F     Q + G+ NLY AS L+
Sbjct: 395 VSADVFKNFEKEGEFFCFVGQSNQAVTGMFNLYRASQLA 433



>gb:OSJN00039_1693724 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0032I19, complete sequence.
          Length = 142

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 46/137 (33%), Positives = 64/137 (46%), Gaps = 7/137 (5%)
 Frame = +3

Query: 225 TAEGFVMRRDELKERV-------KDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAA 383
           +AE    R ++LKE V       KDML             +DE+  LG  + FE+EI  A
Sbjct: 4   SAEWMRERTNKLKEEVCTLFTPSKDMLRRMYL--------VDEIVHLGIDHLFEKEIETA 55

Query: 384 LMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVN 563
           L DI+                 +L+  AL FR+LR+ GF +S +VF  F  G    F   
Sbjct: 56  LKDIH----------ESEFASSNLHEVALRFRLLRERGFWVSPDVFQKF-KGDDGNFLNE 104

Query: 564 LGQDIKGLLNLYEASFL 614
           L  D +GL++LY A+ L
Sbjct: 105 LADDPRGLISLYNAAHL 121



>gb:AF497487_1805882 Arabidopsis thaliana terpene synthase mRNA,
           complete cds.
          Length = 605

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 52/189 (27%), Positives = 78/189 (41%), Gaps = 4/189 (2%)
 Frame = +3

Query: 63  FTYKLSCLPS--IHRSHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEG 236
           + + L+  P   I R   ++S ++ +     TR+        W + Y  S+       + 
Sbjct: 30  YGFPLTSFPGKPIKRIRLKASNTLTFDDKERTRKFKKLPLSEWTH-YFHSIPLDISEMDA 88

Query: 237 FVMRRDELKERVKD--MLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXX 410
                DELK +VK+  M              I     LG +YHFEEEI   L + +    
Sbjct: 89  LKEEIDELKPKVKNTFMSSQGSDSTKTKILMIYLFVSLGLAYHFEEEIYETLKEGF---- 144

Query: 411 XXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLL 590
                        DLY  ++ F V R+ G  IS +VF  F  G    F  +L  D KG+L
Sbjct: 145 --ENIEKIMAGEEDLYTVSIIFWVFRRYGHYISSDVFQRFK-GSNGSFKESLIGDAKGML 201

Query: 591 NLYEASFLS 617
           +LYEA+ L+
Sbjct: 202 SLYEAAHLA 210



>gb:AF272244_1782234 Nicotiana tabacum 5-epi-aristolochene synthase
           mRNA, partial cds.
          Length = 441

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 28/49 (57%), Positives = 36/49 (73%)
 Frame = +3

Query: 462 TALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           +AL+FR+LRQ+GFNIS E+F  F D    +F  +L  D+ GLLNLYEAS
Sbjct: 1   SALQFRLLRQHGFNISPEIFSKFQD-ENGKFKESLASDVLGLLNLYEAS 48



>gb:AB023038_1515395 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIE1.
          Length = 605

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 49/199 (24%), Positives = 82/199 (41%), Gaps = 6/199 (3%)
 Frame = +3

Query: 36  MAILNVLSTFTYKLSCLPSIHRSHAESSFSMCYHTTTTT------RRSGNYEPPTWDYSY 197
           + + + LS F  +L    ++    A+    +C  +T ++      R S  + P  W   +
Sbjct: 18  LCLTSNLSLFPQRLLQKHTLPLKPAKKHHLVCVRSTKSSDDLEGSRPSTYFSPSLWGDHF 77

Query: 198 IQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIM 377
           + S++      +      + +K  VKDML             I  L  LG SYHF++EI 
Sbjct: 78  L-SVSLDRGEFDELEREIETMKPLVKDMLMSSQSSDKEKIRLIHLLVSLGSSYHFDKEIQ 136

Query: 378 AALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFN 557
             L   +                 DL   ++ F V R  G  +S + FD F  G   RF 
Sbjct: 137 DILKHSF------TKLDDIIVGEDDLETISIMFEVFRLYGHKMSCDAFDRFR-GEDGRFK 189

Query: 558 VNLGQDIKGLLNLYEASFL 614
            +L +D++G+L L+E + L
Sbjct: 190 ESLAKDVRGMLQLFEVAHL 208



>gb:AGU92266_1811079 Abies grandis d-selinene synthase mRNA,
           complete cds.
          Length = 581

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 49/169 (28%), Positives = 69/169 (40%), Gaps = 14/169 (8%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXI-- 326
           RR+GN+    WD   I SLN+  Y A  +     +L + +K +L             I  
Sbjct: 11  RRTGNHHGNVWDDDLIHSLNSP-YGAPAYYELLQKLIQEIKHLLLTEMEMDDGDHDLIKR 69

Query: 327 ----DELQRLGCSYHFEEEIMAALMDIYMX--XXXXXXXXXXXXXXXDLYATALEFRVLR 488
               D L+ LG   HFE EI  A +D                     DL ATAL FR LR
Sbjct: 70  LQIVDTLECLGIDRHFEHEIQTAALDYVYRWWNEKGIGEGSRDSFSKDLNATALGFRALR 129

Query: 489 QNGFNISQEVFDCFMDGRRSRFNVNLGQD------IKGLLNLYEASFLS 617
            + +N+S  V   F D     F    G++      ++ +L+L  AS +S
Sbjct: 130 LHRYNVSSGVLKNFKDENGKFFCNFTGEEGRGDKQVRSMLSLLRASEIS 178



>gb:AY473619_1608206 Picea abies E-alpha-bisabolene synthase
           (TPS-Bis) mRNA, complete cds.
          Length = 807

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 37/101 (36%), Positives = 51/101 (50%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D ++RLG   HFE+EI  AL  +Y                 DL  TAL FR+LR + +N
Sbjct: 295 VDNVERLGIDRHFEKEIKEALDYVYRHWNDRGIGWGRLSPIADLETTALGFRLLRLHRYN 354

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           +S  V D F D     F  + GQ   D+  +L+LY AS L+
Sbjct: 355 VSPVVLDNFKDA-DGEFFCSTGQFNKDVASMLSLYRASQLA 394



>gb:OSJN00131_1695413 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0085H11, complete sequence.
          Length = 481

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 34/97 (35%), Positives = 50/97 (51%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D +Q LG  + F+E+I  ALM I+                  LY  AL FR+LR++GF 
Sbjct: 29  VDSIQHLGIVHLFQEQIEDALMSIH----------ESEFTSSSLYEVALRFRLLREHGFW 78

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +  + F+ F  G   RF   +  D +GLL+LY A+ L
Sbjct: 79  VPPDAFNKF-KGDDGRFRNEIANDPRGLLSLYNAAHL 114



>gb:AY133718_1581538 Arabidopsis thaliana clone C103298 putative
           terpene cyclase (At4g20230) mRNA, complete cds.
          Length = 609

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 51/189 (26%), Positives = 78/189 (41%), Gaps = 4/189 (2%)
 Frame = +3

Query: 63  FTYKLSCLPS--IHRSHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEG 236
           + + L+  P   I R   +++ ++ +     TR+        W + Y  S+       + 
Sbjct: 32  YGFPLTSFPGKPIKRIRLKATNTLTFDDKERTRKFKKLPLSEWTH-YFHSIPLDISEMDA 90

Query: 237 FVMRRDELKERVKD--MLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXX 410
                DELK +VK+  M              I     LG +YHFEEEI   L + +    
Sbjct: 91  LKEEIDELKPKVKNTFMSSQGSDSTKTKILMIYLFVSLGLAYHFEEEIYETLKEGF---- 146

Query: 411 XXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLL 590
                        DLY  ++ F V R+ G  IS +VF  F  G    F  +L  D KG+L
Sbjct: 147 --ENIEKIMAGEEDLYTVSIIFWVFRRYGHYISSDVFQRFK-GSNGSFKESLIGDAKGML 203

Query: 591 NLYEASFLS 617
           +LYEA+ L+
Sbjct: 204 SLYEAAHLA 212



>pir|T05331|T05331 hypothetical protein F1C12.150 - Arabidopsis
           thaliana>gb:ATCHRIV52_1545861 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 52.>gb:ATF1C12_1549343
           Arabidopsis thaliana DNA chromosome 4, BAC clone F1C12
           (ESSA project).
          Length = 612

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 51/189 (26%), Positives = 78/189 (41%), Gaps = 4/189 (2%)
 Frame = +3

Query: 63  FTYKLSCLPS--IHRSHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEG 236
           + + L+  P   I R   +++ ++ +     TR+        W + Y  S+       + 
Sbjct: 30  YGFPLTSFPGKPIKRIRLKATNTLTFDDKERTRKFKKLPLSEWTH-YFHSIPLDISEMDA 88

Query: 237 FVMRRDELKERVKD--MLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXX 410
                DELK +VK+  M              I     LG +YHFEEEI   L + +    
Sbjct: 89  LKEEIDELKPKVKNTFMSSQGSDSTKTKILMIYLFVSLGLAYHFEEEIYETLKEGF---- 144

Query: 411 XXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLL 590
                        DLY  ++ F V R+ G  IS +VF  F  G    F  +L  D KG+L
Sbjct: 145 --ENIEKIMAGEEDLYTVSIIFWVFRRYGHYISSDVFQRFK-GSNGSFKESLIGDAKGML 201

Query: 591 NLYEASFLS 617
           +LYEA+ L+
Sbjct: 202 SLYEAAHLA 210



>gb:AJ583448_1811342 Solidago canadensis mRNA for germacrene D
           synthase (19 gene).
          Length = 551

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 36/97 (37%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +Y+FE EI  AL  IY                    +T+L FR+LRQ GF 
Sbjct: 71  IDVIQRLGIAYYFEHEITQALDHIYNVYGDEWNGG----------STSLWFRLLRQQGFY 120

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S ++F+ +     S F  +L +DI+ +L LYEA+++
Sbjct: 121 VSCDIFNIYKLDNGS-FKDSLTKDIECMLELYEAAYM 156



>gb:AJ583447_1811341 Solidago canadensis mRNA for germacrene D
           synthase (11 gene).
          Length = 551

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 36/97 (37%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +Y+FE EI  AL  IY                    +T+L FR+LRQ GF 
Sbjct: 71  IDVIQRLGIAYYFEHEITQALDHIYNVYGDEWNGG----------STSLWFRLLRQQGFY 120

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S ++F+ +     S F  +L +DI+ +L LYEA+++
Sbjct: 121 VSCDIFNIYKLDNGS-FKDSLTKDIECMLELYEAAYM 156



>gb:AF326519_1786662 Taxus brevifolia taxadiene synthase gene,
           partial cds.
          Length = 862

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D ++ LG   HF++EI  AL  +Y                 DL  TAL  R LR +G+N
Sbjct: 359 VDNIEHLGIGRHFKQEIKGALDYVYRHWSERGIGWGRDSLVPDLNTTALGLRTLRMHGYN 418

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           +S +V + F D    RF  + GQ   +++ ++NL+ AS L+
Sbjct: 419 VSSDVLNNFKD-ENGRFFSSAGQTHVELRSVVNLFRASDLA 458



 Score = 33.9 bits (76), Expect = 2.2
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM 281
           R S NY    W ++ IQ+L T    +  +  R DEL  ++KDM
Sbjct: 84  RLSANYHGDLWHHNVIQTLETPFRESSTYQERADELVVKIKDM 126



>gb:AY397645_1605108 Solidago canadensis (-)-germacrene D synthase
           mRNA, complete cds.
          Length = 551

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 36/97 (37%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +Y+FE EI  AL  IY                    +T+L FR+LRQ GF 
Sbjct: 71  IDVIQRLGIAYYFEHEITQALGHIYNVYGDEWNGG----------STSLWFRLLRQQGFY 120

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S ++F+ +     S F  +L +DI+ +L LYEA+++
Sbjct: 121 VSCDIFNIYKLDNGS-FKDSLTKDIECMLELYEAAYM 156



>gb:AY397644_1605107 Solidago canadensis (+)-germacrene D synthase
           mRNA, complete cds.
          Length = 551

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 36/97 (37%), Positives = 54/97 (55%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +Y+FE EI  AL  IY                    +T+L FR+LRQ GF 
Sbjct: 71  IDVIQRLGIAYYFEHEITQALDHIYNVYGDEWNGG----------STSLWFRLLRQQGFY 120

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S ++F+ +     S F  +L +DI+ +L LYEA+++
Sbjct: 121 VSCDIFNIYKLDNGS-FKDSLTKDIECMLELYEAAYM 156



>sp|Q41594|TASY_TAXBR Taxadiene synthase (EC 4.2.3.17)
           (Taxa-4(5),11(12)-diene synthase).>gb:TBU48796_1724838
           Taxus brevifolia taxadiene synthase (TDC1) mRNA,
           complete cds.
          Length = 862

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D ++ LG   HF++EI  AL  +Y                 DL  TAL  R LR +G+N
Sbjct: 359 VDNIEHLGIGRHFKQEIKGALDYVYRHWSERGIGWGRDSLVPDLNTTALGLRTLRMHGYN 418

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQ---DIKGLLNLYEASFLS 617
           +S +V + F D    RF  + GQ   +++ ++NL+ AS L+
Sbjct: 419 VSSDVLNNFKD-ENGRFFSSAGQTHVELRSVVNLFRASDLA 458



 Score = 33.9 bits (76), Expect = 2.2
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDM 281
           R S NY    W ++ IQ+L T    +  +  R DEL  ++KDM
Sbjct: 84  RLSANYHGDLWHHNVIQTLETPFRESSTYQERADELVVKIKDM 126



>gb:AF497489_1805884 Arabidopsis thaliana terpene synthase mRNA,
           complete cds.
          Length = 605

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 42/155 (27%), Positives = 65/155 (41%)
 Frame = +3

Query: 150 TRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXID 329
           +R S  + P  W   ++ S++      +      + +K  VKDML             I 
Sbjct: 62  SRPSTYFSPSLWGDHFL-SVSLDRGEFDELEREIETMKPLVKDMLMSSQSSDKEKIRLIH 120

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            L  LG SYHF++EI   L   +                 DL   ++ F V R  G  +S
Sbjct: 121 LLVSLGSSYHFDKEIQDILKHSF------TKLDDIIVGEDDLETISIMFEVFRLYGHKMS 174

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            + FD F  G   RF  +L +D++G+L L+E + L
Sbjct: 175 CDAFDRFR-GEDGRFKESLAKDVRGMLQLFEVAHL 208



>gb:SCA304452_1706418 Solidago canadensis mRNA for germacrene A
           synthase (1 gene).
          Length = 549

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 36/97 (37%), Positives = 53/97 (54%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID +QRLG +Y+FE EI  AL  IY                     T+L FR+LRQ GF 
Sbjct: 69  IDVIQRLGIAYYFEHEITQALDHIYSVYGDEWNGG----------RTSLWFRLLRQQGFY 118

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S ++F+ +     S F  +L +DI+ +L LYEA+++
Sbjct: 119 VSCDIFNIYKLDNGS-FKDSLTKDIECMLELYEAAYM 154



>gb:AB018121_1513912 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MXE2.
          Length = 595

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 44/149 (29%), Positives = 66/149 (44%), Gaps = 2/149 (1%)
 Frame = +3

Query: 174 PPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX--IDELQRLG 347
           PP+   +Y  S+       +      + LK  V++ML               I  L  LG
Sbjct: 61  PPSKWTNYFHSVLVDVSEMDVLEREIEALKPNVREMLMSSKGYDSVKKRSLMIYLLVSLG 120

Query: 348 CSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDC 527
            +YHFEEEI  +L D +                 DLY  +  F V R  G+N+S +VF  
Sbjct: 121 LAYHFEEEIEKSLKDGF------EKIDEIIAGEDDLYTISTIFWVFRTYGYNMSSDVFRR 174

Query: 528 FMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           F +    +F  +L +D +G+L+LYEA+ L
Sbjct: 175 FKE-ENGKFKESLIEDARGMLSLYEAAHL 202



>gb:AF326513_1786656 Abies grandis delta-selinene synthase gene,
           complete cds.
          Length = 579

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 47/167 (28%), Positives = 68/167 (40%), Gaps = 12/167 (7%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXX--- 323
           RR+GN+    WD   I SLN+  Y A  +     +L + +K +L                
Sbjct: 11  RRTGNHHGNVWDDDLIHSLNSP-YGAPAYYEILQKLIQEIKHLLSIEMEDSDHDLIKRLQ 69

Query: 324 -IDELQRLGCSYHFEEEIMAALMDIYMX--XXXXXXXXXXXXXXXDLYATALEFRVLRQN 494
            +D L+ LG   HFE EI    +D                     DL ATAL FR LR +
Sbjct: 70  IVDSLECLGIDRHFEHEIETTALDYVYRWWNEKDIGEGSRDSFSKDLNATALGFRALRLH 129

Query: 495 GFNISQEVFDCFMDGRRSRFNVNLGQD------IKGLLNLYEASFLS 617
            +N+S  V   F D     F    G++      ++ +L+L  AS +S
Sbjct: 130 RYNVSSGVLKNFKDENGKFFCNFSGEEGRGDKRVRSMLSLLRASEIS 176



>gb:OSJN00107_1695045 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0062B06, complete sequence.
          Length = 500

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 42/125 (33%), Positives = 60/125 (48%), Gaps = 2/125 (1%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           R DELKE+V+  L             +D +Q LG  + F++EI   L DI          
Sbjct: 4   RADELKEKVRTQLGTCEDIVGTMNL-VDAIQHLGIEHLFKQEIDNTLRDI---------- 52

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCF-MDGRRSRF-NVNLGQDIKGLLNLY 599
                    L+  AL FR+LR++G  +S +VF  F  DG  +R  +V    D +GLL+LY
Sbjct: 53  RTSEFTSSSLHEVALWFRLLREHGLWVSPDVFGKFKFDGDDARLSSVIADHDTRGLLSLY 112

Query: 600 EASFL 614
            A+ L
Sbjct: 113 NAAHL 117



>gb:OSJN00039_1693722 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0032I19, complete sequence.
          Length = 510

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 40/123 (32%), Positives = 58/123 (47%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           R D+LKE V   L             +DE+  LG  + FE+EI  AL DI+         
Sbjct: 4   RADKLKEDVCT-LFTPTKDILRRMYLVDEIVHLGIDHLFEKEIETALKDIH--------- 53

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                   +L+  AL FR+LR+ GF +S ++F+ F  G    F     +D + LL+LY A
Sbjct: 54  -ETEFTSSNLHEVALRFRLLRERGFWVSPDIFNKF-KGDDGNFLNEFAEDPRSLLSLYNA 111

Query: 606 SFL 614
           + L
Sbjct: 112 AHL 114



>gb:AC133398_1741442 Oryza sativa chromosome 3 BAC OSJNBa0083F15
           genomic sequence, complete sequence.
          Length = 505

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 36/97 (37%), Positives = 50/97 (51%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           ID LQRLG SYHF+EEI  +L  +                  D +A +L+FR+LRQ    
Sbjct: 29  IDALQRLGVSYHFKEEIDNSLESL----------VSVKFANDDFHAISLQFRLLRQQRRY 78

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +  + F  F+D ++   N  L  D + LL LYEA+ L
Sbjct: 79  MPCDAFKEFID-KQGNLNGTLCSDTRALLALYEAAHL 114



>gb:OSJN00027_1693532 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0067G20, complete sequence.
          Length = 505

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 37/123 (30%), Positives = 60/123 (48%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           + D+LK+ V+ +L             +D +QRLG  + F++EI  A+ DI          
Sbjct: 3   KADKLKQDVR-ILFETHNDTAKKMHLVDAVQRLGIDHLFQDEINNAISDI---------- 51

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                    L+  AL FR+LR++G  +S +VF+ F  G   RF   +  + + LL+LY A
Sbjct: 52  KESEFTSSSLHEVALHFRLLREHGIWVSPDVFEKF-KGEDGRFINTIADEPRALLSLYNA 110

Query: 606 SFL 614
           + L
Sbjct: 111 AHL 113



>gb:AF171218_1774391 Lycopersicon esculentum vetispiradiene synthase
           (LEVS4) gene, partial cds.
          Length = 453

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = +3

Query: 450 DLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEAS 608
           DL   +L+FR+LRQ+G+ IS ++F  F D    +F  +L  DI+G+LNLYEAS
Sbjct: 9   DLCTLSLQFRILRQHGYYISPKIFSRFQDA-NGKFKESLCDDIRGILNLYEAS 60



>gb:AY195609_1588872 Antirrhinum majus myrcene synthase 1e20 mRNA,
           complete cds.
          Length = 584

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 34/98 (34%), Positives = 51/98 (52%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D   RLG ++HF++EI   L   Y                  L+  +L FR++RQ+G  
Sbjct: 106 VDATLRLGVNHHFQKEIEEILRKSYATMKSPIICEYHT-----LHEVSLFFRLMRQHGRY 160

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +S +VF+ F  G   RF   L +D +GL+ LYEA+ LS
Sbjct: 161 VSADVFNNFK-GESGRFKEELKRDTRGLVELYEAAQLS 197



>gb:AY195608_1588871 Antirrhinum majus myrcene synthase Oc15 mRNA,
           complete cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 34/98 (34%), Positives = 51/98 (52%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D   RLG ++HF++EI   L   Y                  L+  +L FR++RQ+G  
Sbjct: 103 VDATLRLGVNHHFQKEIEEILRKSYATMKSPIICEYHT-----LHEVSLFFRLMRQHGRY 157

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +S +VF+ F  G   RF   L +D +GL+ LYEA+ LS
Sbjct: 158 VSADVFNNFK-GESGRFKEELKRDTRGLVELYEAAQLS 194



>gb:AB031204_1518599 Lactuca sativa LsCPS1 mRNA for
           copalyldiphosphate synthase No1, complete cds.
          Length = 799

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D LQRLG S +F+ EI   +  IY                 D+  TA+ FRVLR +G+ 
Sbjct: 334 VDRLQRLGISRYFDSEIKDCVDYIYRYWTKDGICWAKNSNVQDIDDTAMGFRVLRMHGYK 393

Query: 504 ISQEVFDCF-MDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++ +VF  F  DG+   F     Q + G+ NL+ AS
Sbjct: 394 VTTDVFRQFEKDGKFVCFPGQTTQAVTGMFNLFRAS 429



>pir|H86460|H86460 hypothetical protein F14M2.13 - Arabidopsis
           thaliana>gb:AE005172_892180 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC010164_1536949 Arabidopsis thaliana
           chromosome I BAC F14M2 genomic sequence, complete
           sequence.
          Length = 598

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 43/148 (29%), Positives = 66/148 (44%)
 Frame = +3

Query: 174 PPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCS 353
           P  W   +I S+ T +   +      + +K +V++ML             I  L  LG  
Sbjct: 68  PDLWG-DHILSVPTENSEFDTLETEIESIKPKVRNMLMSSHKTDKERICLIHLLICLGTF 126

Query: 354 YHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFM 533
           ++FE+EI   L   +                 DL  TA+ F V R  G  IS +VFD F 
Sbjct: 127 HYFEKEIEEILEQAFRKLDMLFTDED------DLETTAIMFEVFRLYGHKISCDVFDRFK 180

Query: 534 DGRRSRFNVNLGQDIKGLLNLYEASFLS 617
            G  ++F  +L  D++G+L LYEA+ L+
Sbjct: 181 -GVDAKFKEHLVSDVRGMLQLYEAAHLA 207



>pir|T05328|T05328 hypothetical protein F1C12.120 - Arabidopsis
           thaliana>gb:ATCHRIV52_1545858 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 52.>gb:ATF1C12_1549340
           Arabidopsis thaliana DNA chromosome 4, BAC clone F1C12
           (ESSA project).
          Length = 573

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 35/94 (37%), Positives = 48/94 (51%)
 Frame = +3

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           L  LG +YHFEEEI   L   +                 DLY  ++ F V R++G++IS 
Sbjct: 123 LVSLGLAYHFEEEIYETLKMSF------ENIDKMMDGEDDLYTVSIIFWVFRRHGYHISY 176

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            VF  F  G    F  +L +D KG+L+LYEA+ L
Sbjct: 177 GVFQRFK-GSNGNFKESLTRDAKGMLSLYEAANL 209



>gb:AY195607_1588870 Antirrhinum majus (E)-b-ocimene synthase (0e23)
           mRNA, complete cds.
          Length = 579

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 34/98 (34%), Positives = 51/98 (52%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D  QRLG ++HF++EI   L   Y                  L+  +L F ++RQ+G  
Sbjct: 101 VDATQRLGVNHHFQKEIEEILRKSYATMKSPSICKYHT-----LHDVSLFFCLMRQHGRY 155

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFLS 617
           +S +VF+ F  G   RF   L +D +GL+ LYEA+ LS
Sbjct: 156 VSADVFNNFK-GESGRFKEELKRDTRGLVELYEAAQLS 192



>gb:AF497485_1805880 Arabidopsis thaliana linalool synthase mRNA,
           complete cds.
          Length = 569

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 35/117 (29%), Positives = 53/117 (45%)
 Frame = +3

Query: 264 ERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXX 443
           +++K++L             ID +Q LG   HF + I   L  IY               
Sbjct: 77  KKIKNILSANVDVPSENLEMIDVIQSLGTDLHFRQGIEQTLHMIYKEGLQFNG------- 129

Query: 444 XXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
             DL+  AL FR+LRQ G  + + +F   +D ++  F   +  D+KGL  L+EAS L
Sbjct: 130 --DLHEIALRFRLLRQEGHYVQESIFKNILD-KKGGFKDVVKNDVKGLTELFEASEL 183



>gb:OSJN00131_1695415 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0085H11, complete sequence.
          Length = 504

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 32/97 (32%), Positives = 50/97 (51%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D +QRLG  + F++EI   L DI+                  L+  AL FR+LR++G  
Sbjct: 29  VDAVQRLGIGHLFKDEIRRTLNDIHQ----------SEFTSSSLHEVALRFRLLREHGLW 78

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +S   F+ F  G   RF   +  + +GLL+LY A++L
Sbjct: 79  VSPVTFNKF-KGDDGRFMNGIADEPRGLLSLYNAAYL 114



>gb:OSJN00027_1693545 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0067G20, complete
           sequence.>gb:OSJN00107_1695040 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0062B06, complete
           sequence.
          Length = 505

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 36/123 (29%), Positives = 59/123 (47%)
 Frame = +3

Query: 246 RRDELKERVKDMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           + D+LK+ V+ +L             +D +QRLG  + F++EI   + DI          
Sbjct: 3   KADKLKQDVR-ILFETHNDTAKKMHLVDAVQRLGIDHLFQDEINNVISDI---------- 51

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                    L+  AL FR+LR++G  +S +VF+ F  G   RF   +  + + LL+LY A
Sbjct: 52  KESEFTSSSLHEVALHFRLLREHGIWVSPDVFEKF-KGEDGRFINTIADEPRALLSLYNA 110

Query: 606 SFL 614
           + L
Sbjct: 111 AHL 113



>gb:ATTERSYNT_1556657 A.thaliana mRNA for putative terpene synthase.
          Length = 598

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 31/94 (32%), Positives = 50/94 (53%)
 Frame = +3

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           L  LG ++HFE+EI  +L + +                 DLY  ++ F V R  G+N+S 
Sbjct: 129 LVSLGVAFHFEDEIEQSLEEGF------EKIQEMIAGEDDLYTISIMFWVFRTYGYNMST 182

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF  F  G   +F  ++  D+KG+++LYEA+ L
Sbjct: 183 DVFKRFK-GENEKFMESITSDVKGMVSLYEAAHL 215



>pir|C71424|C71424 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV42_1545389 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 42.>gb:ATFCA4_1551637
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 4.
          Length = 582

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 31/94 (32%), Positives = 50/94 (53%)
 Frame = +3

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           L  LG ++HFE+EI  +L + +                 DLY  ++ F V R  G+N+S 
Sbjct: 129 LVSLGVAFHFEDEIEQSLEEGF------EKIQEMIAGEDDLYTISIMFWVFRTYGYNMST 182

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +VF  F  G   +F  ++  D+KG+++LYEA+ L
Sbjct: 183 DVFKRFK-GENEKFMESITSDVKGMVSLYEAAHL 215



>pir|T06287|T06287 hypothetical protein T9E8.40 - Arabidopsis
           thaliana>gb:ATCHRIV36_1545094 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 36.>gb:ATT9E8_1556614
           Arabidopsis thaliana DNA chromosome 4, BAC clone T9E8,
           partial sequence (ESSA project).
          Length = 471

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 34/97 (35%), Positives = 46/97 (47%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           I  L  LG ++HFE EI   L D +                 DL   ++ FRV R  G N
Sbjct: 70  IQSLLSLGLAFHFENEIKDILEDAFRRIDDITGDEN------DLSTISIMFRVFRTYGHN 123

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +   VF  F  G   +F  +L +D KG+L+LYEA+ L
Sbjct: 124 LPSSVFKRFT-GDDGKFERSLTEDAKGILSLYEAAHL 159



>gb:AY473620_1608207 Picea abies isopimaradiene synthase (TPS-Iso)
           mRNA, complete cds.
          Length = 867

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 29/91 (31%), Positives = 46/91 (50%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D ++RLG  +HF+EEI  AL  +Y                 D+  TA+  R+LR +G+N
Sbjct: 358 VDTVERLGIDHHFKEEIKDALDYVYSHWDERGIGWARENPIPDIDDTAMGLRILRLHGYN 417

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNL 596
           +S +V   F D     F   LGQ  +G+ ++
Sbjct: 418 VSSDVLKTFRD-ENGEFFCFLGQTQRGVTDM 447



>gb:AGU50768_1811067 Abies grandis abietadiene synthase (ac22) mRNA,
           complete cds.
          Length = 868

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D ++RLG   HF+EEI  AL  +Y                 D+  TA+  R+LR +G+N
Sbjct: 360 VDTVERLGIDRHFKEEIKEALDYVYSHWDERGIGWARENPVPDIDDTAMGLRILRLHGYN 419

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKG---LLNLYEASFLS 617
           +S +V   F D     F   LGQ  +G   +LN+   S +S
Sbjct: 420 VSSDVLKTFRD-ENGEFFCFLGQTQRGVTDMLNVNRCSHVS 459



>gb:AF326516_1786659 Abies grandis abietadiene synthase gene,
           partial cds.
          Length = 853

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 33/101 (32%), Positives = 49/101 (48%), Gaps = 3/101 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D ++RLG   HF+EEI  AL  +Y                 D+  TA+  R+LR +G+N
Sbjct: 345 VDTVERLGIDRHFKEEIKEALDYVYSHWDERGIGWARENPVPDIDDTAMGLRILRLHGYN 404

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKG---LLNLYEASFLS 617
           +S +V   F D     F   LGQ  +G   +LN+   S +S
Sbjct: 405 VSSDVLKTFRD-ENGEFFCFLGQTQRGVTDMLNVNRCSHVS 444



>gb:AP004560_1841588 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0462E11.
          Length = 605

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 31/94 (32%), Positives = 48/94 (51%)
 Frame = +3

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           LQRLG   ++E EI   L  +Y                 DL+  +L F +LR+NG+++S 
Sbjct: 100 LQRLGLDSYYETEINDLLCIVY----------NTDYNDKDLHLVSLRFYLLRKNGYDVSS 149

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           ++F  F D   S     +  D++ LL+LY A+FL
Sbjct: 150 DMFQHFKDKEGS----FVADDVRSLLSLYNAAFL 179



>gb:AGU92267_1811080 Abies grandis gamma-humulene synthase mRNA,
           complete cds.
          Length = 593

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 45/160 (28%), Positives = 66/160 (41%), Gaps = 9/160 (5%)
 Frame = +3

Query: 84  LPSIHRSHAESSFSMCYHTTTTTRRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELK 263
           +  I  S + S+      ++ T+ R GN     W+   IQSLN+  Y A  +  R ++L 
Sbjct: 1   MAQISESVSPSTDLKSTESSITSNRHGNM----WEDDRIQSLNSP-YGAPAYQERSEKLI 55

Query: 264 ERVK--------DMLXXXXXXXXXXXXXIDELQRLGCSYHFEEEIMAALMDIYMX-XXXX 416
           E +K        D               +D ++ LG   HF+ EI  AL  +Y       
Sbjct: 56  EEIKLLFLSDMDDSCNDSDRDLIKRLEIVDTVECLGIDRHFQPEIKLALDYVYRCWNERG 115

Query: 417 XXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMD 536
                      DL ATAL FR LR + +N+S  V + F D
Sbjct: 116 IGEGSRDSLKKDLNATALGFRALRLHRYNVSSGVLENFRD 155



>gb:AC073555_1541082 Arabidopsis thaliana chromosome 1 BAC F11I4
           genomic sequence, complete sequence.
          Length = 603

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 37/123 (30%), Positives = 55/123 (44%), Gaps = 2/123 (1%)
 Frame = +3

Query: 252 DELKERVKDMLXXXXXXXXXXXXX--IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXX 425
           + LK +V+DM                I  L  LG ++HFE+EI  ++             
Sbjct: 95  EALKPKVRDMFMSFKGMKSNKKNLFLIYLLVSLGLAHHFEDEIEESVKGC------SQEM 148

Query: 426 XXXXXXXXDLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEA 605
                   DLY  ++ F V R  G NIS ++F+ F  G   +F   L  D KG+L+LYEA
Sbjct: 149 VEMMDGENDLYTVSIIFWVFRTYGHNISSDIFNRF-KGHNGKFKECLATDAKGILSLYEA 207

Query: 606 SFL 614
           + +
Sbjct: 208 AHM 210



>gb:AY473621_1608208 Picea abies levopimaradiene/abietadiene
           synthase (TPS-LAS) mRNA, complete cds.
          Length = 859

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 29/91 (31%), Positives = 45/91 (49%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D ++RLG   HF+EEI  AL  +Y                 D+  TA+  R+LR +G+N
Sbjct: 350 VDTIERLGIDRHFKEEIKDALDYVYSHWDERGIGWARENPVPDIDDTAMGLRILRLHGYN 409

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNL 596
           +S +V   F D     F   LGQ  +G+ ++
Sbjct: 410 VSSDVLKTFRD-ENGEFFCFLGQTQRGVTDM 439



>gb:AP005114_1848101 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0689H05.
          Length = 800

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 32/96 (33%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D L+RLG S +F  EI   L   Y                 D+  TA+ FR+LR +G+N
Sbjct: 332 VDRLRRLGISRYFTSEIEEYLEYAYRHLSPDGMSYGGLCPVKDIDDTAMAFRLLRLHGYN 391

Query: 504 ISQEVFDCF-MDGRRSRFNVNLGQDIKGLLNLYEAS 608
           +S  VF+ F  DG    F     Q +  + N Y AS
Sbjct: 392 VSSSVFNHFEKDGEYFCFAGQSSQSLTAMYNSYRAS 427



>gb:AF034545_1762775 Stevia rebaudiana copalyl pyrophosphate
           synthase (Cpps1) mRNA, complete cds.
          Length = 787

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D LQRLG + +F+ EI   +  I                  D+  TA+ FRVLR +G++
Sbjct: 331 VDRLQRLGIARYFKSEIKDCVEYINKYWTKNGICWARNTHVQDIDDTAMGFRVLRAHGYD 390

Query: 504 ISQEVFDCF-MDGRRSRFNVNLGQDIKGLLNLYEAS 608
           ++ +VF  F  DG+   F     Q + G+ N+Y AS
Sbjct: 391 VTPDVFRQFEKDGKFVCFAGQSTQAVTGMFNVYRAS 426



>gb:AY602991_1617444 Oryza sativa (indica cultivar-group)
           ent-copalyl diphosphate synthase (CPSent2) mRNA,
           complete cds.
          Length = 800

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 32/96 (33%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D L+RLG S +F  EI   L   Y                 D+  TA+ FR+LR +G+N
Sbjct: 332 VDRLRRLGISRYFTSEIEEYLEYAYRHLSPDGMSYGGLCPVKDIDDTAMAFRLLRLHGYN 391

Query: 504 ISQEVFDCF-MDGRRSRFNVNLGQDIKGLLNLYEAS 608
           +S  VF+ F  DG    F     Q +  + N Y AS
Sbjct: 392 VSSSVFNHFEKDGEYFCFAGQSSQSLTAMYNSYRAS 427



>gb:AB066271_1522559 Oryza sativa (japonica cultivar-group) OsCyc2
           mRNA for ent-CDP synthase, complete cds.
          Length = 800

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 32/96 (33%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D L+RLG S +F  EI   L   Y                 D+  TA+ FR+LR +G+N
Sbjct: 332 VDRLRRLGISRYFTSEIEEYLEYAYRHLSPDGMSYGGLCPVKDIDDTAMAFRLLRLHGYN 391

Query: 504 ISQEVFDCF-MDGRRSRFNVNLGQDIKGLLNLYEAS 608
           +S  VF+ F  DG    F     Q +  + N Y AS
Sbjct: 392 VSSSVFNHFEKDGEYFCFAGQSSQSLTAMYNSYRAS 427



>gb:AP004560_1841591 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0462E11.
          Length = 462

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 38/149 (25%), Positives = 63/149 (42%)
 Frame = +3

Query: 168 YEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDELQRLG 347
           + P  W   +I     T         R + LKE V+ ++             I  LQRLG
Sbjct: 22  FHPSLWGDFFISYQPPTAPKHAYMKERAEVLKEEVRKVVKGSNEVPEILDLVIT-LQRLG 80

Query: 348 CSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEVFDC 527
              +++ EI   L  +Y                 DL+  +L F +LR+NG+++S ++F  
Sbjct: 81  LDSYYKAEIDELLCTVY----------NTDYNDKDLHLVSLRFYLLRKNGYDVSSDIFQH 130

Query: 528 FMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           F D   S     +  D + LL+LY A+++
Sbjct: 131 FKDKEGS----FVADDTRSLLSLYNAAYM 155



>gb:AP003793_1833442 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0487E11.
          Length = 547

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 42/154 (27%), Positives = 64/154 (41%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXXXIDE 332
           R+S N+ P  W   ++     T         R + L+E V+ +L             +  
Sbjct: 25  RKSTNFHPSLWGDFFLNYEPPTAPQQACMKGRAEVLREEVRTLLKGLKEVQKILDITM-A 83

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           +QRLG   ++  EI   L  +Y                 DL   +L F +LR+NG+N+S 
Sbjct: 84  IQRLGLDMYYVNEINELLHFVY----------SSDYNDKDLNLVSLRFYLLRKNGYNMSS 133

Query: 513 EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +F  F D     F V+   D + LLNLY A+ L
Sbjct: 134 GIFLSFKD-NEGNFIVD---DTRSLLNLYNAANL 163



>gb:AY518314_1610800 Zea mays Delprim terpene synthase 5 (TPS5)
           mRNA, TPS5-2 allele, complete cds.
          Length = 554

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 40/155 (25%), Positives = 61/155 (39%), Gaps = 1/155 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX-XXXXXID 329
           + S  + P  W   ++     T         R + L+ERV+ +L              I 
Sbjct: 19  KASSTFHPSLWGSFFLTYQPPTAPQRANMKERAEVLRERVRKVLKGSTTDQLPETVNLIL 78

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            LQRLG  Y++E EI   L  IY                 DL   +  F +LR+NG+++ 
Sbjct: 79  TLQRLGLGYYYENEIDKLLHQIY---------SNSDYNVKDLNLVSQRFYLLRKNGYDVP 129

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +VF  F              D + LL+LY A++L
Sbjct: 130 SDVFLSFKTEEGG--FACAAADTRSLLSLYNAAYL 162



>gb:AY518310_1610796 Zea mays B73 terpene synthase 4 (TPS4) mRNA,
           complete cds.
          Length = 554

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 40/155 (25%), Positives = 61/155 (39%), Gaps = 1/155 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX-XXXXXID 329
           + S  + P  W   ++     T         R + L+ERV+ +L              I 
Sbjct: 19  KASSTFHPSLWGSFFLTYQPPTAPQRANMKERAEVLRERVRKVLKGSTTDQLPETVNLIL 78

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            LQRLG  Y++E EI   L  IY                 DL   +  F +LR+NG+++ 
Sbjct: 79  TLQRLGLGYYYENEIDKLLHQIY---------SNSDYNVKDLNLVSQRFYLLRKNGYDVP 129

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +VF  F              D + LL+LY A++L
Sbjct: 130 SDVFLSFKTEEGG--FACAAADTRSLLSLYNAAYL 162



>gb:AAN276415_1508206 Artemisia annua partial gASC24 gene for
           putative sesquiterpene cyclase, exons 1-3.
          Length = 184

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 24/55 (43%), Positives = 38/55 (69%)
 Frame = +3

Query: 450 DLYATALEFRVLRQNGFNISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           DL +T+L FR+LRQ GF+IS E+F+ + +     F  +L  D++G+L LYEA+ +
Sbjct: 18  DLQSTSLWFRLLRQQGFDISSEIFNKYKN-TNGDFMESLRDDVRGMLYLYEAAHM 71



>pir|E96723|E96723 hypothetical protein F20P5.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_894591 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F20P5_1677773 Sequence of BAC F20P5 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 632

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 60/218 (27%), Positives = 85/218 (38%), Gaps = 30/218 (13%)
 Frame = +3

Query: 45  LNVLSTFTYKLSCLPSIHRSHAESSFSMCYHTTTT-------TRRSGNYEPPT-WDYSYI 200
           LN+ S++ Y L    S+  S  +S   +C    TT       T RS    PP+ W + ++
Sbjct: 23  LNLSSSYHYPL-LKSSLSFSRFQSPKKLCLVRATTNPTDDNSTTRSFTPHPPSLWGHHFL 81

Query: 201 Q-SLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXXXXXX-XIDELQRLGCSYHFEEEI 374
             S+N T    +    + + LK  V  ML              I  L  LG SYHFEE+I
Sbjct: 82  SASVNQTEM--DDLWRQIEALKPIVNAMLLPCNGADAKKITCFIHTLVSLGVSYHFEEKI 139

Query: 375 MAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQEV------------ 518
           +  L D +                 DLY  ++ FRV R  G  I+ E+            
Sbjct: 140 VEFLKDAF----ENIEDMIIDCKEDDLYTVSIIFRVFRLYGHYITPELHITISYYFFFLI 195

Query: 519 ------FDCF--MDGRRSRFNVNLGQDIKGLLNLYEAS 608
                  D F    G    F   L  D++G+L+ YEAS
Sbjct: 196 FHTCMCVDIFNRFKGDDGNFKKCLNDDVRGMLSFYEAS 233



>gb:AP003876_1834698 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1119_D01.>gb:AP003911_1835068 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1368_G08.
          Length = 576

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 2/99 (2%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           +D L+RL   YH+E+EI   L  ++                 DL+ TAL F +LR++G+ 
Sbjct: 92  VDTLERLCIDYHYEKEIENVLRRVH-------EEEDDTDNHYDLHTTALRFYLLRKHGYY 144

Query: 504 ISQEVFDCFMD--GRRSRFNVNLGQDIKGLLNLYEASFL 614
            S +VF  F D  G  +R + N G   + +L+LY A+ L
Sbjct: 145 ASPDVFQRFRDEEGNFTRDDNNNG--TRSMLSLYNAAHL 181



>gb:AY518311_1610797 Zea mays B73 terpene synthase 5 (TPS5) mRNA,
           complete cds.
          Length = 554

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 40/153 (26%), Positives = 60/153 (39%), Gaps = 1/153 (0%)
 Frame = +3

Query: 159 SGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX-XXXXXIDEL 335
           S  + P  W   ++     T         R + L+ERV+ +L              I  L
Sbjct: 21  SSTFHPSLWGSFFLTYQPPTAPQRANMKERAEVLRERVRKVLKGSTTDQLPETVNLILTL 80

Query: 336 QRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQE 515
           QRLG  Y++E EI   L  IY                 DL   +  F +LR+NG+++  +
Sbjct: 81  QRLGLGYYYENEIDKLLHQIY---------SNSDYNVKDLNLVSQRFYLLRKNGYDVPSD 131

Query: 516 VFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           VF  F              D + LL+LY A++L
Sbjct: 132 VFLSFKTEEGG--FACAAADTRSLLSLYNAAYL 162



>gb:AT23KB_1542658 A.thaliana RH1, TC1, G14587-5, G14587-6, and PRL1
           genes.
          Length = 599

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = +3

Query: 333 LQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNISQ 512
           L  LG ++HFE+EI  +L + +                 DLY  ++ F V R  G+N+S 
Sbjct: 129 LVSLGVAFHFEDEIEQSLEEGF------EKIQEMIAGEDDLYTISIMFWVFRTYGYNMST 182

Query: 513 -EVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +VF  F  G   +F  ++  D+KG+++LYEA+ L
Sbjct: 183 GDVFKRFK-GENEKFMESITSDVKGMVSLYEAAHL 216



>pir|T06285|T06285 hypothetical protein T9E8.20 - Arabidopsis
           thaliana>gb:ATCHRIV36_1545092 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 36.>gb:ATT9E8_1556612
           Arabidopsis thaliana DNA chromosome 4, BAC clone T9E8,
           partial sequence (ESSA project).
          Length = 535

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 33/97 (34%), Positives = 45/97 (46%)
 Frame = +3

Query: 324 IDELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFN 503
           I  L  LG ++HFE EI   L   +                 DL   ++ FRV R  G N
Sbjct: 70  IQLLLSLGLAFHFENEIKNILEHAFRKIDDITGDEK------DLSTISIMFRVFRTYGHN 123

Query: 504 ISQEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
           +   VF  F  G   +F  +L +D KG+L+LYEA+ L
Sbjct: 124 LPSSVFKRFT-GDDGKFQQSLTEDAKGILSLYEAAHL 159



>gb:AY518313_1610799 Zea mays Delprim terpene synthase 5 (TPS5)
           mRNA, TPS5-1 allele, complete cds.
          Length = 554

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 40/155 (25%), Positives = 61/155 (39%), Gaps = 1/155 (0%)
 Frame = +3

Query: 153 RRSGNYEPPTWDYSYIQSLNTTHYTAEGFVMRRDELKERVKDMLXXXXXXXX-XXXXXID 329
           + S  + P  W   ++     T         R + L+ERV+ +L              I 
Sbjct: 19  KASSTFHPSLWGSFFLTYQPPTAPQRANMKERAEVLRERVRKVLKGSTTDQLPETVNLIL 78

Query: 330 ELQRLGCSYHFEEEIMAALMDIYMXXXXXXXXXXXXXXXXDLYATALEFRVLRQNGFNIS 509
            LQRLG  Y++E EI   L  IY                 DL   +  F +LR+NG+++ 
Sbjct: 79  TLQRLGLGYYYENEIDKLLHQIY---------SNSDYNEKDLNLVSQRFYLLRKNGYDVP 129

Query: 510 QEVFDCFMDGRRSRFNVNLGQDIKGLLNLYEASFL 614
            +VF  F              D + LL+LY A++L
Sbjct: 130 SDVFLNFKTEEGG--FACAAADTRSLLSLYNAAYL 162


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 522,417,269
Number of Sequences: 1806583
Number of extensions: 8826745
Number of successful extensions: 19932
Number of sequences better than 10.0: 326
Number of HSP's better than 10.0 without gapping: 19002
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19459
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 31556375428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)